Sequence alignment for CL0498

PF15891

T1IEI4_RHOPR/4-94--THDVFLGGSC..........--.------------------------------------------NPT-TWRQDVAIP
X2J5A2_DROME/193-284--PVEVFLGGSC..........--.------------------------------------------NPT-TWRADV...
R0I588_SETT2/52-156--KYSVFTAGSI........EM--G------------------------------------------AAV-QWQKQMAAQ
H9JE69_BOMMO/75-165--PCEVFLGGSC..........--.------------------------------------------NPT-TWRSDI...
G3JGW9_CORMM/20-125--LHSVFFAGTT........SK--V------------------------------------------DAV-DWRETLASL
Q93174_CAEEL/75-166--TYDVFLGGSC..........--.------------------------------------------GTT-VWRRQS...
H1UV03_COLHI/23-124--GRSVFFAGTT..........--.------------------------------------------SKG-DWRKHLADS
G8XAS8_FLACA/18-121--KPSIFLAGSI........EM--N------------------------------------------KAI-DWQSNCEEK
R0KPG9_SETT2/22-127--RPSVILYGAM.........S--G------------------------------------------QNK-NWQGDLINS
M2SPH0_COCSN/22-128--RPSVILYGAI........QS--D------------------------------------------PAK-DWQGYLTAS
B3RNW2_TRIAD/383-473--ERDIFLGGSC..........--.------------------------------------------GRS-TWREDV...
X1WIH3_ACYPI/191-281--SYDVFLGGSC..........--.------------------------------------------NPT-TWRQDL...
G4UZT0_NEUT9/26-130--KKSVFLAGTT.......SKM--G------------------------------------------DEP-DWRDTLSRQ
A9FNG6_SORC5/15-119--GPKLFLAGSI........DN--G------------------------------------------QAE-LWQARVAE.
F2TZC5_SALR5/498-589--PHQVFLGGAC..........--.------------------------------------------NPT-TWRRDV...
G2PI08_STRVO/16-123--GPSVFLAGPTP......DKS--A------------------------------------------PVP-SWRPDAVRA
G2QGY7_THIHA/19-130--KVAVFLAGTTTGT..TAAAA--A------------------------------------------AGA-DWRETVTLA
A0A0D2XJJ8_FUSO4/20-126--NTSIFLAGIT........TS--T------------------------------------------GEP-DWRETLTKA
H3GTN6_PHYRM/285-389--GGAVYLGGNL..........--.------------------------------------------TAT-SWRQKV...
E4ZGB9_LEPMJ/74-178--KFSVFTAGSI........EM--G------------------------------------------KAV-QWQSQMATM
G0RX56_HYPJQ/19-123--RKAIFLAGTT........SP--T------------------------------------------GEP-DWRQTLTRA
S3CPA1_OPHP1/16-127--PTRLFLAGTTP......VPG--S------------------------------------------SAP-DWRALVWNA
B2VZJ4_PYRTR/54-158--KFSVFTAGSI........EM--G------------------------------------------NAV-MWQEQMAQM
E6XC92_CELAD/16-114--QRYIFLAGSM........AP--N------------------------------------------QSV-NWRTQVVKS
A0A0C4ECV9_MAGP6/43-148--LLSVFLAGTT........SR--V------------------------------------------DTT-DWRETLSSL
Q12WB5_METBU/4-107--TKNIYLAAPL........FS--E------------------------------------------AEQ-DYNRKLETA
Q0UL03_PHANO/21-123--RISVVLYGGI..........--Q------------------------------------------PEP-AWQTSIAAS
B7P1W0_IXOSC/23-113--SYDVFLGGSC..........--.------------------------------------------NPT-TWRKDV...
A3CYE1_METMJ/140-241--RYRVYLAAPL........FS--E------------------------------------------AEV-TYNLALQEL
R1ERD8_BOTPV/31-135--GRSIFLAGSI........EM--G------------------------------------------AAE-DWQTVMTNR
D7E641_METEZ/4-106--SKKVYIAGPL........FS--E------------------------------------------GEL-DFNKKLRDA
D5E7K8_METMS/3-106--YKKIYLAGPL........FS--E------------------------------------------AEK-NFNEQLTQR
V4II58_9ACTN/15-116--SPSVFLAGGI..........--T------------------------------------------NCP-DWQQTAAAA
E0VD46_PEDHC/3-94--KYEVFLGGSC..........--.------------------------------------------NPT-TWRIDL...
Q24ZT6_DESHY/231-331--NLQVYLAGPF........FS--D------------------------------------------QEL-FWVNQVCDI
E3RE45_PYRTT/24-128--IVSVILYGGM........ST--D------------------------------------------TKK-NWRADLSAS
T1FMG7_HELRO/145-235--GFQVFLGGSC..........--.------------------------------------------NPT-TWRTDI...
C3ZHY4_BRAFL/353-443--RRDVFLGGSC..........--.------------------------------------------ANT-TWREQI...
W4YFJ1_STRPU/135-225--NFNVFLGGSC..........--.------------------------------------------NPT-TWRRDV...
D3PWT7_STANL/21-126--WPAVFLGGGI..........--T------------------------------------------GVD-DWQASAVGM
F4W7J2_ACREC/24-115--AYEVFLGGSC..........--.------------------------------------------NPT-TWRSDI...
K1R891_CRAGI/425-516--TFDIYLGGSC..........--.------------------------------------------GDS-EWRDNI...
Q0UX75_PHANO/110-214--KFALFTAGSI........EM--G------------------------------------------AAI-QWQTLLVKH
R5LK94_9MOLU/14-117--KKSIFLAGPT.......PRD--E------------------------------------------KTK-SWRTTACER
E1REK1_METP4/142-243--RYKIYLAGPL........FT--E------------------------------------------AET-DFNLKLHDF
D1A6W5_THECD/19-124--DAAIFLAGPS.......PRD--E------------------------------------------AVP-SWRPRAVEV
D6WAD7_TRICA/459-558--KYDVFLGGTH..........--N------------------------------------------SLS-NWREDV...
R6SVN4_9CLOT/14-118--TRAISLCGPT.......PRN--N------------------------------------------KVT-SWRKEALNI
A2SPZ5_METLZ/139-240--KYRIYLASPL........FS--E------------------------------------------AER-RYNAYLVEV
L0HB91_METFS/144-245--RYRVYLAAPL........FS--A------------------------------------------AER-TYNAYLAGL
N4V4C4_COLOR/57-165--GKSVFLAGSI........EM--G------------------------------------------SAP-DWQAALTET
C3ZHY4_BRAFL/64-161--RFEVFLGGSC..........--.------------------------------------------VPS-TWRQDI...
G9P4H0_HYPAI/21-126--VKSLFLAGTT........TA--V------------------------------------------DNV-DWRETLSAS
G2QVT9_THITE/23-127--RTSVFLAGTT........SS--S------------------------------------------SGP-DWRQTLTEA
R0ILK1_SETT2/51-155--KFSVFTASSI........EM--G------------------------------------------NAV-QWQKHMTNL
G4NHQ6_MAGO7/32-137--QRIVYLAGST........TG--S------------------------------------------GTA-DWREALVGS
T1KY10_TETUR/147-237--QSTVFLGGSC..........--.------------------------------------------NPT-TWRKDI...
V6JDP9_STRNV/16-123--GPSVFLAGPTP......RLG--G------------------------------------------DVE-SWRPAAVEA
T1FMG7_HELRO/415-504--RRDIFLGGSC..........--.------------------------------------------GAS-AWRESI...
C7ZCF7_NECH7/13-117--NTSIFLAGTT........SA--T------------------------------------------GEP-DWRETLTQA
M7UKY8_BOTF1/34-167--HPLIFLSGTT.......NYN--K------------------------------------------DES-RWQEILTDR
G7YEE9_CLOSI/49-140--KYHVFLGGAC..........--.------------------------------------------NPT-TWRVDT...
T1IR01_STRMM/382-473--QHDVYLGGSC..........--.------------------------------------------DTT-SWREDI...
A9AZW5_HERA2/17-121--MPTIFLAGSI........DM--G------------------------------------------SAI-DWQAEIERQ
A7IB55_METB6/144-245--RYRIYLAGPL........FS--E------------------------------------------AER-TYNAAIAED
D0MXH6_PHYIT/72-162--EIAVFLGGSC..........--.------------------------------------------NPT-TWRHDV...
Q2FP85_METHJ/144-245--CWKVYLAAPL........FS--E------------------------------------------AEC-DFNRKVADI
E3S628_PYRTT/77-181--KFSVFTAGSI........EM--G------------------------------------------KAV-HWQKQMVTM
I0GUV7_SELRL/54-159--GKKVYLAGPL........FN--Q------------------------------------------AEK-DFNLKITKV
I4AQY7_FLELS/16-121--QKTIFLAGSI........DM--G------------------------------------------NAI-DWQQEIIDS
R8BX59_TOGMI/36-142--RTSVFLAGST.......SPV--P------------------------------------------GEP-DWRDTLTSA
E0VD46_PEDHC/263-353--YYDVYLGGTI..........--.------------------------------------------ENT-QWRESI...
G4V7S9_SCHMA/78-169--RYDFFLGGAC..........--.------------------------------------------NPT-TWRKEV...
Q2GRH7_CHAGB/23-123--ELSVFLAGTT........TK--S------------------------------------------SYP-DWRQALIEA
S3CVC4_GLAL2/28-132--TPTIFLSGYI.........S--H------------------------------------------PDA-CWRNHLTTA
C9SYP4_VERA1/23-124--NKSIFLAGTT.........H--K------------------------------------------DAG-DWRATLCNA
H1Z0K3_9EURY/139-240--DYRIYLAAPL........FS--Q------------------------------------------AEQ-EFNLKVAEI
C7QF56_CATAD/15-121--GPSVFLAGPT.......PRS--K------------------------------------------TVA-SWRPQAIQA
Q4WMH8_ASPFU/20-125--VKSVFLAGTT........SK--V------------------------------------------DPG-DWRETLSTS
L0KW01_METHD/4-107--QKNIYLAGPL........FS--H------------------------------------------AER-DFNVYLRDK
K1R891_CRAGI/151-241--KRKVFLGGSC..........--.------------------------------------------NPT-TWRQEA...
A6L9R1_PARD8/43-145--YQKIFLAGTI........DM--G------------------------------------------KSV-DWQKATCDW
K4MDC8_9EURY/4-107--KKQIYLAGPL........FS--K------------------------------------------AER-DFNIYLRDR
Q8TK51_METAC/4-106--KKMIYLAGPL........FS--R------------------------------------------AEL-EYNLKLKDM
T1IR01_STRMM/86-176--KYEVFLGGSC..........--.------------------------------------------NPT-TWRQNI...
E4ZNI1_LEPMJ/22-126--RPSVILYGAI........LS--D------------------------------------------PDK-DWHTNLAAS
F7XKZ0_METZD/2-105--KINVYLAGPL........FS--E------------------------------------------AER-NFNKQLKNI
G9MES0_HYPVG/13-117--RPSIFLAGNA........SP--T------------------------------------------GEA-DWRQTLTEA
K3WUG2_PYTUL/124-214--DIDIFLGGSC..........--.------------------------------------------NPT-TWRRDV...
U7Q6W0_SPOS1/18-131--ITRLFLAGTTPVKSLGHGNP--N------------------------------------------PVV-DWRRLVCSA
B2AQB5_PODAN/21-125--KKTVFLAGTT........TR--T------------------------------------------NGP-EWRGTLFQS
A8NV21_BRUMA/75-166--IYDVFLGGSC..........--.------------------------------------------GNT-VWRRDL...
D6WAD7_TRICA/186-276--NCEVFLGGSC..........--.------------------------------------------NPT-TWRADT...
E9EQF8_METRA/36-140--EPLIFLAGTT........TP--T------------------------------------------ADG-DWRQRLVNR
F2KPY9_ARCVS/3-103--GLKVFLAAPF........FC--E------------------------------------------AER-EFNIKVAEF
I1FY95_AMPQE/147-238--CVLVFLGGSC..........--.------------------------------------------NPT-VWRREL...
H6L323_SAPGL/16-120--EKLLFLAGSI........DM--G------------------------------------------KAQ-DWQSWVGYQ
R6SWJ3_9BACE/43-144--YKSVFLAGTI........DM--G------------------------------------------SGV-DWQKDVADF
F2TZC5_SALR5/813-902--ASDVYLGGTC..........--.------------------------------------------GDS-QWRTDV...
D2V4M3_NAEGR/31-141--VKNLFLAGGI..........--S------------------------------------------GCG-NWHLDMIES
J1AN41_9EURY/138-239--RYRVYLAAPL........FS--R------------------------------------------AER-AFNREVRDL

PF05014

Q74CV5_GEOSL/3-131-----IYLASPL-------GFS..P..----------------------------------------ETK-SYLEKVKDK
DNPH1_TETNG/3-110-----VYFCGSI-------RGG..R..----------------------------------------DDA-ELYHRMVAK
DNPH1_MOUSE/12-119-----VYFCGSI-------RGG..R..----------------------------------------EDQ-ALYSRIVSR
Q3XZF0_ENTFC/3-117-----IYFAAPM-------.FA..K..----------------------------------------SDL-LYNQQLVKE
Q831Y8_ENTFA/4-118-----IYFAGPL-------.FS..Q..----------------------------------------ADL-RYNAYLVEQ
Q037S4_LACC3/3-117-----IYFANAL-------.FS..H..----------------------------------------ADF-NYNAQLAAQ
Q38VK0_LACSS/3-117-----IYFANAL-------.FS..Q..----------------------------------------ADF-DYNTRVVAA
Q5FMM8_LACAC/8-127-----LYFGAGW-------.FN..E..----------------------------------------KQN-KAYKAAMEA
Q38YB9_LACSS/5-123-----IYLAGGW-------.FT..P..----------------------------------------KQA-DMVARAHKA
Q5FIN0_LACAC/10-130-----IYLGTPF-------.YN..D..----------------------------------------DQR-ARVKKARAL
Q4K9G5_PSEF5/5-138-----IYLAGFD-------VFR..A..----------------------------------------DAP-AHGEYLKQL
C1DJ67_AZOVD/4-137-----IYLAGPD-------VFR..P..----------------------------------------DAI-ERGARLKWL
Q2KTK9_BORA1/4-141-----IYLAGFD-------VFR..A..----------------------------------------DSI-SHGERLKAL
Q0KDU3_CUPNH/46-184-----IYLAGFD-------VFR..K..----------------------------------------DAR-AWGEHLKSL
Q1LQW3_RALME/4-142-----VYLAGFD-------VFR..E..----------------------------------------DAR-DWGEQLKAL
Q47ET2_DECAR/3-138-----IYFAGPD-------VFR..Q..----------------------------------------DAL-AWADEVRRL
Q2RU71_RHORT/7-150-----IYLAGPE-------VFL..A..----------------------------------------ESQ-AVAETMKER
A5FTP2_ACICJ/9-159-----VYLAGPD-------VFR..A..----------------------------------------DSD-THGAHLIQL
Q2W5R7_MAGSA/7-146-----AYLAGPA-------VFH..P..----------------------------------------AAK-ALLDYLAEM
A1U4X5_MARHV/25-160-----IYLAGPE-------VFF..PHE----------------------------------------EHN-AIVAEKKRL
A9CG29_AGRFC/36-179-----IYLAGPE-------VFL..P..----------------------------------------NAR-EMLDLKASL
A4YQ35_BRASO/3-141-----IYLAGPD-------VFL..P..----------------------------------------DAV-EIGRRKAAI
Q89RW2_BRADU/3-141-----IYLAGPD-------VFL..P..----------------------------------------DAV-EIGRRKAEI
Q21A75_RHOPB/3-141-----IYLAGPD-------VFL..P..----------------------------------------DAA-EIGRRKQAI
A5G297_ACICJ/7-142-----AYLAGPD-------LFL..P..----------------------------------------DAH-AHAARKVAI
Q0BQQ5_GRABC/21-153-----AYLAGPD-------VFM..P..----------------------------------------DAP-ERAARKIAI
A7IM74_XANP2/3-145-----LYLAGPE-------VFL..D..----------------------------------------DAR-EIGRRKVEL
B0T4X8_CAUSK/7-152-----IWLAGPE-------PWL..P..----------------------------------------DAA-PQAARQRAL
Q9A6H7_CAUCR/7-151-----LWLAGPE-------AWL..P..----------------------------------------DLD-LQTSRQRAL
Q57VC7_TRYB2/4-128-----IYIAGPA-------VFN..P.D----------------------------------------MGA-SYYNKVREL
Q4QAY0_LEIMA/7-130-----IYIAGPA-------VFH..P.D----------------------------------------NGE-AYYNHVRAL
Q4DGS2_TRYCC/4-128-----VYIAGPA-------VFN..E.D----------------------------------------MGG-TYYDRVRTA
YQ65_SCHPO/20-174-----VYLAGDL-------VFR..P..----------------------------------------NAI-ELFDELKEI
Q5FND5_GLUOX/8-164-----VYLAGDL-------VFR..P..----------------------------------------EAL-ALFAKLKSI
Q5NX98_AROAE/5-139-----VYFAGPD-------LFF..G..----------------------------------------CYQ-GKKDAIRRM
Q7VB88_PROMA/6-120-----IYLASPY-------GFS..K.Q----------------------------------------CKK-NLLPEFIAA
A5GSS0_SYNR3/13-127-----LYLASPY-------GFA..P.Q----------------------------------------WKE-QLLPQFCQA
B5E901_GEOBB/16-144-----VYLASPL-------GFS..P..----------------------------------------END-HYRGKVKER
Q7NFW9_GLOVI/18-124-----FYVAGPL-------.FN..A..----------------------------------------YEQ-AYQAELAAR
Q6AQB0_DESPS/15-129-----LYLAAPL-------.FN..E..----------------------------------------AEK-ESNRNIRDS
Y063_UREPA/7-134-----IYLAGPL-------.FTLAEIN----------------------------------------DRK-QQASLIRKT
A5VK58_LACRD/9-128-----VYFCAGW-------.FT..D..----------------------------------------KQN-KAYEDAMNA
B2U7I3_RALPJ/5-137-----LYLAGPD-------VFR..P..----------------------------------------EPI-AHGEALKAL
Q04FG4_OENOB/4-122-----VYFACSW-------.FS..D..----------------------------------------SQT-NYMNQGIEL
Q1G8M7_LACDA/7-128-----IYLGSSF-------.HR..D..----------------------------------------HHQ-ARAKQVREY
Q2K9H8_RHIEC/4-146-----IYLAGPE-------VFL..P..----------------------------------------DAL-PIMAEKRRL
Q46LL2_PROMT/6-120-----LYLASPY-------GFS..E.H----------------------------------------WRL-KLLPDFVSK
Q9I6Y7_PSEAE/4-145-----IYLAGPD-------VFR..P..----------------------------------------DAE-AHGETLKAL
Q9I6Y8_PSEAE/42-183-----LYLAGPD-------VFR..A..----------------------------------------DAV-AHGEALKAL
V6F0F5_9PROT/7-146-----LYLAGPA-------VFH..P..----------------------------------------AAK-ALFQYLKEI

PF14359

Q2NSU1_SODGM/3-92-----TYIAGPM------------S------------------------------------------GIP.NYNRLAFYQ
B2JD24_BURP8/3-94-----LYLSGPM------------T------------------------------------------GLP.DLNKPAFHA
A5I2H3_CLOBH/3-91-----IYIAGKI------------N------------------------------------------GLK.DY.KKNFDK
D9SWF2_CLOC7/7-95-----VYIAGKI------------T------------------------------------------GLP.DY.KENFAE
C5CJN4_VARPS/4-95-----IYIAGPM------------S------------------------------------------GVP.GLNYPEFNS
C8WLV1_EGGLE/6-97-----LYVSGPV------------T------------------------------------------GMP.DDNREAFEA
C4Z5Z6_EUBE2/3-89-----VYIAGAM------------T------------------------------------------GVF.KY.KEKFIE
C8WA55_ATOPD/35-125-----VYLSGPI------------T------------------------------------------G...EKNYKGLFS
Q12J43_SHEDO/10-99-----VYIAGPM------------S------------------------------------------GMV.GENRREFHL
D4IIW9_9BACT/4-96-----IYISGRI------------S------------------------------------------GLPIEEVAAKFDE
Q8NPR6_CORGL/6-107-----MYLAGPM------------T------------------------------------------GIP.EYNYPTFHA
Q2NSN9_SODGM/3-92-----IYIAGPM------------T------------------------------------------GKP.DFNRTAFSL
D4L1U8_9FIRM/28-119-----IYISGPI------------T------------------------------------------GTS.DY.MERFEK
Q8ECZ5_SHEON/4-92-----TYIAGPI------------S------------------------------------------GNV.EANKLAFFK

PF11071

D3FX91_BACPE/6-145------YLAGEI--------------------------------------------------------HS-SWRQDLKEA
U5LEP3_9BACI/6-145------YLAGEI--------------------------------------------------------HT-DWRGELKEK
B8BWK8_THAPS/26-165------YLSGEI--------------------------------------------------------HS-NWREVIAEG
Q5WEA2_BACSK/6-145------YLAGEI--------------------------------------------------------HS-DWREEIKRL
Q1GL75_RUEST/6-143------YLSGEI--------------------------------------------------------HT-DWREQIIEG
K0J0D1_AMPXN/6-145------YLAGQI--------------------------------------------------------HD-DWREQLKAQ
A8FGC3_BACP2/6-145------YLAGEI--------------------------------------------------------HS-QWRDEIKEK
I0JPU7_HALH3/6-145------YLAGQI--------------------------------------------------------HD-DWRNDVKAQ
F2F8P8_SOLSS/6-145------YLAGQI--------------------------------------------------------HD-NWREEIAQK
J9Z0F9_9PROT/5-144------YLAGEI--------------------------------------------------------HT-NWREELIDL
V4J0N1_9DELT/6-144------YLSGEI--------------------------------------------------------HT-GWRDEITSG
G8PSA2_PSEUV/7-146------YLSGEI--------------------------------------------------------HT-DWRERIEHG
Q8EP80_OCEIH/6-145------YLAGQI--------------------------------------------------------HD-NWRDEVEKI
H2FX43_OCESG/9-148------YLSGEI--------------------------------------------------------HT-DWREQIIHG
K7AD99_9ALTE/7-145------YLSGEI--------------------------------------------------------HT-DWRELIIQG
A1U6Z6_MARHV/6-144------YLSGEI--------------------------------------------------------HT-DWREQIAAG
B1VFR0_CORU7/6-144------YLSGEI--------------------------------------------------------HT-DWREEIQRG
U4K8X0_9VIBR/6-144------YLSGEI--------------------------------------------------------HT-DWRDQIIEQ
E6U185_BACCJ/6-145------YLAGQI--------------------------------------------------------HD-NWREEFKEK
D3FC17_CONWI/9-148------YLSGEI--------------------------------------------------------HS-DWRARIANA
D5BQ04_PUNMI/6-143------YLSGEI--------------------------------------------------------HT-DWREQIIQG
D5DE71_BACMD/6-145------YLAGQI--------------------------------------------------------HD-NWRDEIKNQ
Q4FSH8_PSYA2/6-144------YLSGEI--------------------------------------------------------HT-DWRQKIMQG
M5DS25_9GAMM/6-145------YLSGEI--------------------------------------------------------HT-DWRDEIARG
G4T0P2_META2/6-145------YLSGET--------------------------------------------------------HT-DWRDQIIQG
Q0VTM0_ALCBS/7-146------YLSGEI--------------------------------------------------------HT-DWRERIVKG
E0TC70_PARBH/7-146------YLSGEI--------------------------------------------------------HT-DWRDDIAAG
Q31G06_THICR/6-144------YLSGEI--------------------------------------------------------HT-DWRQKIIEG
L0F1C2_DESDL/6-146------YLAGEI--------------------------------------------------------HT-QWREELKEK
Q47W56_COLP3/6-144------YLSGEI--------------------------------------------------------HT-DWREKIIQG
F2I1N1_PELSM/5-144------YLAGEI--------------------------------------------------------HS-NWREEIIQL
Q9K7V4_BACHD/6-145------YLAGEI--------------------------------------------------------HS-NWRQQIKEA
D6XSI6_BACIE/6-145------YLAGQI--------------------------------------------------------HD-DWRTEIKQE

PF09152

A8GFA5_SERP5/2-112---RKIFLACPYS........HADENV----------------------------------------VQE-RFLACNKVA
A7ILK0_XANP2/11-118---GITYVSVPYTAHLYG.........----------------------------------------LSA-AAYDADRHA
Q4KJD5_PSEF5/2-112---RKIFLACPYS........HSEPAV----------------------------------------INE-RFLQCNQVA
Q3IVN8_RHOS4/48-169---RPVYLATPYSLRAVDREGRWSADM----------------------------------------SAA-AMGDAGREI
Q3IW66_RHOS4/60-180---RPVYLATPYTLRAIGPDGRWSRDQ----------------------------------------SEA-TMAEAAREV
Q9I3M0_PSEAE/2-112---RKIFLACPYS........HADAEV----------------------------------------VEQ-RFRACNEVA

PF02267

F6QEE7_MACMU/57-297TSRFPETVLARC--------VKYTE.V..........HP.EMR...................HV...DCQSVWDAFKGAF
H2PCY6_PONAB/41-280.AQLRDIFLGRC--------AEYGALL..........SP.EQR...................NK...NCTAIWEAFKVA.
G3NMH1_GASAC/2-226T..FKETFVARC--------EDFNGT.........................................DCEKIWGLFEEAY
F6WMZ1_ORNAN/53-298TENLQEIILGRC--------FNFIRTV..........NPDQQR...................DI...DCVRIWKTFKNGF
CD38_RABIT/53-294TDHVSAIVLGRC--------LTYTRNM..........HP.ELR...................NQ...DCKKILNTFTSAF
I3JGM5_ORENI/40-267.SEFESTFLSRC--------EKFDHKHYLFFRY..................................DCKKVWDAFQQAY
M4A1C9_XIPMA/3-246TPNIKHIVIGRC--------FTYTTLV..........QP.GLCIEK................KY...DCEEIWRQFEKAV
A0A0D2X2X5_CAPO3/27-255TAHLAEIFVGRC--------FDKSTVA........................................DCNAWWAAFNQVV
T1FV69_HELRO/36-278...FPNIFIARC--------QEFQEVI..........KP.ELFENNPK...................NCSTLWYKFASSF
H2UBF5_TAKRU/48-277.QTFKETFIARC--------HLAIKGQ..........YK.......................GS...DCETIWSTFEQAY
F6ZFL7_MONDO/56-295THNLKEIILGRC--------FTYIRMV..........NP.GLR....................K...DCLKIWETFENAF
W5KGC3_ASTMX/46-287TPHLKHIVIGRC--------YDYITLV..........NP.SFRY.......................NCEDIWREFEEAV
G7YGU8_CLOSI/32-273...LQRLVIGRC--------SEWAFAH..........AEYNI.........................DCQEVWTDFQKII
W5MUD4_LEPOC/54-285...LKYVFITRC--------KEYLETH..........DE.......................VRVGIDCNEVWDAFQSSF
H2S9L5_TAKRU/26-267TPNIKHIVMGRC--------YEYSTLV..........NP.GVRY.......................DCESIWRHFEEAV
F1PKL7_CANFA/63-304TAHFYEILLGRC--------YTYTQVV..........RP.ELR...................HT...DCQKIGKAFTSAF
E1C8Y0_CHICK/57-298TRNLREIVLGRC--------YSYLAEG..........HA.ELR...................DK...DCLKIWESLKAAF
G3U406_LOXAF/31-277.PHLRTIFLGRC--------SDYSSLL..........SP.QQR...................PR...WLTRFWGA..TLS
G1L422_AILME/37-297TRHLESIIRGRC--------AEYVARL..........NP.DQRQIKRAENNREMAILHNTSWDK...NCTALWEAFRMVL
G7YGU9_CLOSI/32-273...LQMLVTGRC--------SEWAFTH..........GKYGI.........................DCQNVWTEFEKIL
F6XI43_XENTR/38-277TPNLQSIVLGRC--------YDYTETV.............ALD...................KK...NCSEIWEAFEKAF
G1PDG1_MYOLU/63-304TPHFSEIVLGRC--------YTYTQVL..........WP.ELR...................HK...DCGQIGKAFTNAF
H0WV24_OTOGA/63-304TKHFPEIVLGRC--------LIYTQLV..........RP.AMR...................DV...DCHKIWEAFKNAF
B3RIX9_TRIAD/24-272THNIKEIFIGRC--------YGYIALQ..........NF.TLRPGV.....................TCPSLWQEFSRVF
W5KGB4_ASTMX/49-278.EELKSTVVGRC--------ETYLKEH..........SD.......................ISSVNNCERIWDTFHQAY
I3NBZ0_SPETR/34-275.QRLQSIFLGRC--------AEYCSLV..........SP.ELR...................DK...NCTAIWEAFKVV.
B3RIY0_TRIAD/24-258TARIQEIFIGRC--------SEYQAVN.............KLQRQV.....................DCIHVWNQFSRVF
H0ZHK5_TAEGU/57-298TKNLQEVILGRC--------YNYITAQ..........HP.ELG...................DK...DCLKIWESLKDAF
CD38_MOUSE/59-300TKHFSDIFLGRC--------LIYTQIL..........RP.EMR...................DQ...NCQEILSTFKGAF
G3VL69_SARHA/73-312.RHLESLFLGRC--------YEYIFLV..........NP.DLR...................DK...NCSAIWEAFKSV.
G3NMG7_GASAC/25-263TPNIKHIVVGRC--------YNYITLV..........NP.SLRI.......................DCEEIWRRFEESV
F6ZFG5_MONDO/39-279TPHLESIFRGRC--------NEFISLE..........NP.ELG...................DK...NCSEIWEAFKTV.
W4ZBI8_STRPU/28-287TSNITDILTGRC--------EEYRKCLLGEPCLPFYRNV............................KCRAAVESFFKGI
F6WHT8_XENTR/55-295TKNLKDIVLGRC--------YNYIT.M..........NP.NIW...................LR...NCDAIWERLTDAV
I3M660_SPETR/62-303TSHFSEIVLGRC--------FTYTQLI..........RP.ELR...................DQ...DCRKILDAFKSAF
BST1_MOUSE/35-273TPHLQSIFLGRC--------AEYTTLL..........S...LG...................NK...NCTAIWEAFKGV.
U3IER2_ANAPL/39-280TQNLERIFIGRC--------YDYIRIV..........NP.AVG...................EK...NCLELWEAFRNAF

PF15891

T1IEI4_RHOPR/4-94LLES..................LG--I-----TYY-NP.Q---------------------VSE.WSA--------DL..
X2J5A2_DROME/193-284...AIPA............LKELG--I-----SFY-NP.Q---------------------VSD.WTP--------DL..
R0I588_SETT2/52-156L.SH..................LP--I-----TIC-NP.R---------------------RGH.WNP--------NI.T
H9JE69_BOMMO/75-165...AIPM............LKKMG--I-----TYF-NP.Q---------------------VED.WST--------EL..
G3JGW9_CORMM/20-125L.SG..................TP--V-----TIY-NP.F---------------------RAD.WDS--------TW.R
Q93174_CAEEL/75-166...VIPF............LKKRG--I-----TYY-DP.Q---------------------RSF.WSE--------NM..
H1UV03_COLHI/23-124I.SH..................LP--V-----TVF-NP.F---------------------RPD.WDS--------TW.R
G8XAS8_FLACA/18-121L..S..................DQ--Y-----TIF-NP.R---------------------RKS.WDS--------SW.E
R0KPG9_SETT2/22-127L.SD..................LS--V-----AIL-DP.R---------------------RDE.WDN--------TW.V
M2SPH0_COCSN/22-128L.SD..................LP--V-----AIL-NP.R---------------------CDA.WDS--------SW.V
B3RNW2_TRIAD/383-473...AIPL............LKKQA--I-----SYF-NP.Q---------------------LPD.WSM--------KF..
X1WIH3_ACYPI/191-281...AIPY............LQDAG--V-----SFY-NP.Q---------------------VDH.WSQ--------DL..
G4UZT0_NEUT9/26-130L.SR..................LP--I-----TVI-NP.T---------------------PPN.W.T--------DW.P
A9FNG6_SORC5/15-119...ELA...............DLE--V-----VIL-NP.R---------------------RER.WEP--------GW.A
F2TZC5_SALR5/498-589...AIPF............LEQHD--V-----TYY-NP.Q---------------------VDE.WYP--------EL..
G2PI08_STRVO/16-123LAARWD..............GDRP--L-----SVL-SP.E---------------------SRN....--------....
G2QGY7_THIHA/19-130V.SH..................LP--V-----TVL-NP.L---------------------RPD.WDG--------SW.R
A0A0D2XJJ8_FUSO4/20-126L.MD..................QH--V-----TIL-NP.N---------------------RPD.WDS--------TW.K
H3GTN6_PHYRM/285-389...AIPL............LRTAG--I-----PVY-VP.F---------------------ADY.LSF--------GLSS
E4ZGB9_LEPMJ/74-178L.SP..................LP--I-----TVN-NP.R---------------------RGH.WDP--------TV.T
G0RX56_HYPJQ/19-123L.LN..................LP--I-----TIY-NP.K---------------------RDD.WDS--------TW.R
S3CPA1_OPHP1/16-127V.VE..................LP--V-----TVI-DP.V---------------------RTD.WGP--------DWTE
B2VZJ4_PYRTR/54-158L.SD..................LP--I-----SVC-NP.R---------------------GRE.WNA--------AI.T
E6XC92_CELAD/16-114L..P..................NS--Y-----QFL-DP.T---------------------NEH.HD.--------....
A0A0C4ECV9_MAGP6/43-148L.SE..................TP--V-----TIY-NP.Y---------------------RAD.WDS--------TW.R
Q12WB5_METBU/4-107LKDL...................G--F-----DVF-VP.Q---------------------EDS.NDT--------...E
Q0UL03_PHANO/21-123L.SD..................LP--V-----DIL-DP.R---------------------RDD.WDS--------SW.I
B7P1W0_IXOSC/23-113...AIPK............LKAYG--I-----SYY-NP.Q---------------------VTQ.WIP--------EL..
A3CYE1_METMJ/140-241LEAH...................L--F-----DVY-LP.Q---------------------EVG..DT--------...S
R1ERD8_BOTPV/31-135I.AH..................LP--I-----TIL-NP.R---------------------RPD.WNN--------SW.K
D7E641_METEZ/4-106VAKK...................G--F-----PVY-LP.Q---------------------EHT.EDT--------...V
D5E7K8_METMS/3-106IEGA...................G--Y-----DVF-LP.Q---------------------RDS.TDT--------...E
V4II58_9ACTN/15-116LAD.....................--F-----TVF-NP.R---------------------RRH.FPI--------D...
E0VD46_PEDHC/3-94...AIPE............LENMN--I-----SYY-NPQQ---------------------VGE.WRP--------EL..
Q24ZT6_DESHY/231-331LESA...................G--I-----RVL-SP.S---------------------REN....--------GVIG
E3RE45_PYRTT/24-128L.SD..................LP--I-----AIL-DP.T---------------------CDA.WDS--------TW.I
T1FMG7_HELRO/145-235...AIPF............LKKHG--I-----TYY-NP.Q---------------------VCN.WKP--------NL..
C3ZHY4_BRAFL/353-443...AIPL............LRKHG--I-----TYF-NP.H---------------------LPV.WNL--------RY..
W4YFJ1_STRPU/135-225...AIPL............LKQYS--L-----TFY-NP.Q---------------------VES.WSP--------DL..
D3PWT7_STANL/21-126L..EAS...............GVD--V-----TVY-NP.R---------------------RAN.FDV--------T...
F4W7J2_ACREC/24-115...AIPT............LQNLG--I-----TYY-NP.Q---------------------VSQ.WGP--------EL..
K1R891_CRAGI/425-516...AIPM............IRKYG--L-----SYT-NP.N---------------------VRTEWKY--------KF..
Q0UX75_PHANO/110-214L.ED..................LP--I-----TIC-NP.R---------------------RGT.WDP--------QI.Q
R5LK94_9MOLU/14-117LNELG................FDG--.-----IVY-VP.E---------------------YST....--------....
E1REK1_METP4/142-243LEEH...................L--L-----DVY-LP.Q---------------------EVG..DT--------...S
D1A6W5_THECD/19-124LRDRWK..............APGR--L-----VVF-VPEH---------------------RHG....--------....
D6WAD7_TRICA/459-558...AIPT............LKKYN--I-----.RY-NP..---------------------....VST--------NGYE
R6SVN4_9CLOT/14-118LQNIN................YDG--.-----IVY-VP.E---------------------LKD....--------....
A2SPZ5_METLZ/139-240LRQN...................F--F-----FVY-LP.Q---------------------EAA..DT--------...E
L0HB91_METFS/144-245LREN...................F--F-----SVH-LP.Q---------------------DAG..DD--------...S
N4V4C4_COLOR/57-165LSARLP...............STT--I-----TVL-NP.R---------------------RGN.WDG--------GW.V
C3ZHY4_BRAFL/64-161...AIPL............LKQYG--L-----TYF-DP.V---------------------HEI.WGP--------EL..
G9P4H0_HYPAI/21-126L.SM..................YP--I-----TIF-NP.N---------------------RPD.WDN--------TW.R
G2QVT9_THITE/23-127V.SL..................LP--V-----TLF-NP.L---------------------RPD.WDS--------SW.R
R0ILK1_SETT2/51-155L.SH..................LP--I-----TVC-NP.R---------------------RGH.WNT--------KI.T
G4NHQ6_MAGO7/32-137L.AH..................LP--V-----TWV-DP.S---------------------RPE.WDE--------SW.R
T1KY10_TETUR/147-237...AIPM............LKALN--I-----TYY-DP.Q---------------------KDH.WEP--------EL..
V6JDP9_STRNV/16-123LAEQWT..............GPEI--L-----TVL-TP.E---------------------SRG....--------....
T1FMG7_HELRO/415-504...AIPI............LRKNG--I-----SYF-NP.Q---------------------VHC.WNA--------HC..
C7ZCF7_NECH7/13-117L.SE..................HA--V-----TIF-NP.K---------------------RGD.WDS--------TW.K
M7UKY8_BOTF1/34-167LLARSRSKSTDDKNGTNEPSSFAP--V-----TII-DP.Y---------------------NPA.WDS--------TW.R
G7YEE9_CLOSI/49-140...AIPI............LEEHD--I-----TYC-NP.Q---------------------VEE.WSE--------EM..
T1IR01_STRMM/382-473...AIPI............LRKTG--L-----TFF-NP.Q---------------------TNY.WSG--------NR..
A9AZW5_HERA2/17-121L.TN..................DE--L-----LLL-NP.R---------------------RDA.WDS--------SW.E
A7IB55_METB6/144-245LRSR...................C--F-----DVF-LP.Q---------------------ETG..DN--------...R
D0MXH6_PHYIT/72-162...AMPM............LDAAS--V-----HYF-NP.Q---------------------VDE.WFE--------EL..
Q2FP85_METHJ/144-245LTGY...................A--M-----QVH-LP.Q---------------------DCG..DS--------...E
E3S628_PYRTT/77-181L.SD..................LP--I-----TVC-NP.R---------------------KGK.WNP--------AV.T
I0GUV7_SELRL/54-159LEHN...................G--Y-----QVF-LP.Q---------------------RDG.IEA--------ALLQ
I4AQY7_FLELS/16-121FKEN..................QS--L-----YFL-NP.R---------------------RKD.WDS--------SW.E
R8BX59_TOGMI/36-142L.VA..................LP--V-----TVY-NP.L---------------------RPD.WDG--------SW.R
E0VD46_PEDHC/263-353...AVPM............LNQEN--L-----SYF-IP.K---------------------IKE.GKE--------QF..
G4V7S9_SCHMA/78-169...AIPI............LDRLG--L-----TYY-NP.Q---------------------VDD.WSP--------EL..
Q2GRH7_CHAGB/23-123V.SH..................LP--I-----TVL-NP.L---------------------RLD.WDH--------TWGP
S3CVC4_GLAL2/28-132L.SH..................LP--I-----TIL-NP.L---------------------RRD.WDS--------TW.K
C9SYP4_VERA1/23-124I.EH..................HP--V-----TIF-NP.L---------------------RLD.WD.--------.W.S
H1Z0K3_9EURY/139-240LRRS...................Y--F-----EVF-IP.Q---------------------EHG..DD--------...G
C7QF56_CATAD/15-121LDAAWQ..............APRT--L-----HIL-VP.E---------------------NPG....--------....
Q4WMH8_ASPFU/20-125L.SD..................LP--V-----TIY-SP.Y---------------------RPD.WDS--------SW.R
L0KW01_METHD/4-107LVEY...................G--F-----SVF-LP.Q---------------------EDG.SDD--------...T
K1R891_CRAGI/151-241...AIPF............YKKKG--I-----TFY-NP.Q---------------------VQT.WRP--------EL..
A6L9R1_PARD8/43-145F.RALP...............EGR--Y-----LLF-NP.R---------------------RDK.GLS--------GE.M
K4MDC8_9EURY/4-107LLEM...................G--F-----KVF-LP.Q---------------------VDG.EDN--------...L
Q8TK51_METAC/4-106LLNN...................S--F-----SVF-LP.Q---------------------EEA.EDS--------...A
T1IR01_STRMM/86-176...AIPL............LKKWR--I-----TYY-NP.Q---------------------VGH.WKP--------EL..
E4ZNI1_LEPMJ/22-126L.SD..................LP--I-----AIL-NP.R---------------------RDD.WDS--------SW.I
F7XKZ0_METZD/2-105LNKN...................G--F-----NVF-LP.Q---------------------EDA.FDN--------...S
G9MES0_HYPVG/13-117L.SS..................LP--I-----TIY-NP.Y---------------------RND.WDA--------TW.R
K3WUG2_PYTUL/124-214...AIPL............LEEAH--V-----KYY-NP.Q---------------------VDD.WYE--------EL..
U7Q6W0_SPOS1/18-131V.GN..................LP--V-----TVF-DP.L---------------------RPD.WDA--------SW.T
B2AQB5_PODAN/21-125I.AH..................LP--I-----TVF-NP.L---------------------RPD.WDS--------SW.K
A8NV21_BRUMA/75-166...VIPY............LEKRA--I-----SYY-DP.Q---------------------RSV.WNE--------HM..
D6WAD7_TRICA/186-276...AIPE............LQKHG--I-----TFY-NP.Q---------------------VSM.WVP--------EL..
E9EQF8_METRA/36-140L.SQ..................YP--V-----TFL-DP.T---------------------NKN.WDS--------TW.T
F2KPY9_ARCVS/3-103LRDN...................G--F-----EVW-MA.Q---------------------ENP.F..--------...I
I1FY95_AMPQE/147-238...SIPL............LENEG--V-----TYY-NP.Q---------------------VDH.WTP--------EL..
H6L323_SAPGL/16-120L.LK..................ED--L-----LIL-NP.R---------------------RDG.WDS--------SW.E
R6SWJ3_9BACE/43-144F..EKA...............PGN--W-----VLF-NP.R---------------------QEF.WDP--------GR.E
F2TZC5_SALR5/813-902...QEQL.............RRAG--L-----SSF-NP.S---------------------IPR.WTA--------DM..
D2V4M3_NAEGR/31-141L..KKKCLKN......DHVREKCC--V-----KLY-NP.R---------------------REN.FDV--------S...
J1AN41_9EURY/138-239LEAA...................L--Y-----EVY-LP.Q---------------------EVG..DN--------...D

PF05014

Q74CV5_GEOSL/3-131LKSL-------------------G--H....-DVF.DP-WEQDHF----------AGRIEQAFR-IES.--.....FHAR
DNPH1_TETNG/3-110LQSF-------------------A--T....-VLT.EH-V.....----------.......GR-REL.--.....GDTG
DNPH1_MOUSE/12-119LRRY-------------------G--KV.LT-EHV.AD-A.....----------........E-LEP.--.....RGEE
Q3XZF0_ENTFC/3-117IREL-------------------S--SE..L-SIY.LP-QEN...----------......EAI-NDK.--.....T...
Q831Y8_ENTFA/4-118IRQL-------------------D--KT..I-DLY.LP-QEN...----------......AAI-NDK.--.....S...
Q037S4_LACC3/3-117IRRA-------------------L--PD..V-DMY.VP-QEN...----------......AAI-NNK.--.....E...
Q38VK0_LACSS/3-117LRQA-------------------M--PT..L-DIY.LP-QEN...----------......AAI-NDK.--.....E...
Q5FMM8_LACAC/8-127LKQN-------------------P--TVDLE-NSY.VP-LENQYK----------...DIRVDE-HPE.--.....YLH.
Q38YB9_LACSS/5-123LAAN-------------------P--TV..G-YIH.SP-QEHQYK----------...DVTEDN-DPN.--.....GLFG
Q5FIN0_LACAC/10-130LEQN-------------------P--TV..V-RVH.FP-FDQNFV----------...DPEEKD-PEA.--.....DGLR
Q4K9G5_PSEF5/5-138CSAQ-------------------G--L....-HGL.FP-L.....----------........D-NQA.--.....PPRL
C1DJ67_AZOVD/4-137CAEH-------------------G--L....-EGL.YP-L.....----------........D-NRL.--.....PPGL
Q2KTK9_BORA1/4-141CREH-------------------G--Y....-EGL.YP-L.....----------........D-NQA.--.....PAHL
Q0KDU3_CUPNH/46-184CAAH-------------------G--F....-SGL.YP-L.....----------........D-KSA.--.....PDGL
Q1LQW3_RALME/4-142CMRY-------------------G--Y....-EGL.YP-L.....----------........D-KAA.--.....PSGL
Q47ET2_DECAR/3-138CRQH-------------------G--H....-QAL.IP-L.....----------........D-G...--.........
Q2RU71_RHORT/7-150CAAQ-------------------G--L....-VGV.FP-L.....----------........D-SAL.--.....DLAG
A5FTP2_ACICJ/9-159CAAH-------------------G--V....-TGV.YP-A.....----------........D-NDMV--AGIDTMLRA
Q2W5R7_MAGSA/7-146CGQH-------------------G--L....-VGV.AP-F.....----------........E-PDA.--......EQR
A1U4X5_MARHV/25-160LREA-------------------G--C....-EGI.DP-L.....----------........D-TAL.--.....TFSD
A9CG29_AGRFC/36-179AREA-------------------G--F....-VPL.SP-G.....----------........D-LQI.--.....PPAD
A4YQ35_BRASO/3-141CDRH-------------------G--L....-IGL.YP-L.....----------........D-NTV.--.....DLAA
Q89RW2_BRADU/3-141CERF-------------------G--L....-TGL.YP-L.....----------........D-NEI.--.....DLTA
Q21A75_RHOPB/3-141CARH-------------------G--M....-TGL.YP-L.....----------........D-NAF.--.....DAAA
A5G297_ACICJ/7-142AAGH-------------------G--I....-DAL.VP-L.....----------........D-APA.--.....PERQ
Q0BQQ5_GRABC/21-153CEHY-------------------G--L....-HAR.AP-V.....----------.........-....--......AES
A7IM74_XANP2/3-145CTRF-------------------G--F....-IGL.YP-L.....----------........D-GDP.--.....LLDA
B0T4X8_CAUSK/7-152CADN-------------------G--F....-TGLTAP-AIV...----------......ETD-ADN.--.........
Q9A6H7_CAUCR/7-151CLES-------------------G--F....-EAL.AP-ARM...----------......PIS-DTG.--.........
Q57VC7_TRYB2/4-128LKKE-------------------N--V....-MPL.IP-T.....----------........D-NEA.--.........
Q4QAY0_LEIMA/7-130LKEK-------------------G--V....-VPL.IP-V.....----------........D-NIA.--.........
Q4DGS2_TRYCC/4-128LGMH-------------------G--V....-VPL.IP-V.....----------........D-NMV.--.........
YQ65_SCHPO/20-174CKDA-------------------G--V....-QGV.AP-F.....----------........D-GQE.--.....GVEE
Q5FND5_GLUOX/8-164CAEY-------------------G--L....-DGV.AP-F.....----------........D-GQA.--.....EARL
Q5NX98_AROAE/5-139CEAR-------------------D--I....-YPL.FP-G.....----------........D-DEI.--.........
Q7VB88_PROMA/6-120LEDL-------------------G--A....-EVW.EP-FSR...----------......NAQ-YEN.--.....L...
A5GSS0_SYNR3/13-127LESL-------------------G--A....-DVW.EP-FER...----------......NNQ-IDL.--.....S...
B5E901_GEOBB/16-144LNQL-------------------H--C....-TVF.DP-WDQEEV----------GRRIEDALG-TAF.--.....GPER
Q7NFW9_GLOVI/18-124LAPL-------------------G--.....-RVF.LP-Q.....----------.........-....--........A
Q6AQB0_DESPS/15-129LIDC-------------------C--.....-DVF.LP-QED...----------......GLL-LDE.--.....LVSL
Y063_UREPA/7-134FKDE-------------------L--PNYEL-DLF.NP-I.....----------.........-.EV.--.....NDEL
A5VK58_LACRD/9-128IKAN-------------------P--TVDVE-NSY.VP-LQHQ..----------....YKGLR-VDE.--.....HPEL
B2U7I3_RALPJ/5-137CAEF-------------------G--F....-SGL.YP-L.....----------........D-NTI.--.....APQA
Q04FG4_OENOB/4-122IKQN-------------------K--TVDWK-YAF.YP-LDHQYK----------...GFSIPD-HP..--.......EL
Q1G8M7_LACDA/7-128LAAN-------------------P--TV..E-HVH.FP-FDQQV.----------...TDPAED-PNV.--.....GFGD
Q2K9H8_RHIEC/4-146ARQF-------------------G--F....-EPT.GP-G.....----------........S-DEN.--.....Q..T
Q46LL2_PROMT/6-120LEFM-------------------G--A....-SVL.EP-F.....----------........D-RNS.--.....HIDI
Q9I6Y7_PSEAE/4-145CAEF-------------------G--F....-VGL.YP-L.....----------........D-HAL.--.....PADI
Q9I6Y8_PSEAE/42-183CARY-------------------G--F....-EGL.YP-L.....----------........D-NAL.--.....PKQL
V6F0F5_9PROT/7-146CAEN-------------------G--L....-EGV.SP-L.....----------........D-GEG.--.....KWQN

PF14359

Q2NSU1_SODGM/3-92AARE---------------LKQGG..D-----TVL-NP-----------------------ATL------------....
B2JD24_BURP8/3-94EAAR---------------LEALG..F-----EVE-NP-----------------------ALV------------....
A5I2H3_CLOBH/3-91AETK---------------LKEDG..Y-----VCM-NP-----------------------SIL------------....
D9SWF2_CLOC7/7-95VEEK---------------LIKEG..H-----LVM-NP-----------------------AIL------------....
C5CJN4_VARPS/4-95VAKG---------------LRELG..Y-----HVE-NP-----------------------AEN------------....
C8WLV1_EGGLE/6-97AADE---------------LAACG..Y-----IVR-IP-----------------------HWD------------....
C4Z5Z6_EUBE2/3-89AEEY---------------IRGLG..H-----IVL-NP-----------------------SFL------------....
C8WA55_ATOPD/35-125FARD---------------LVEFGGAA-----KIY-SP-----------------------AVR------------....
Q12J43_SHEDO/10-99AADV---------------QRELG..H-----VVL-NP-----------------------ATL------------....
D4IIW9_9BACT/4-96TETK---------------LKAQG..Y-----EVI-NP-----------------------LKN------------....
Q8NPR6_CORGL/6-107AANK---------------FRAAG..Y-----TVL-SP-----------------------AED------------EYES
Q2NSN9_SODGM/3-92AAVR---------------LSAQG..A-----IPL-NP-----------------------AML------------....
D4L1U8_9FIRM/28-119AEKE---------------LIENG..Y-----SVI-NP-----------------------AKV------------N..A
Q8ECZ5_SHEON/4-92AAEQ---------------LAETG..R-----VVL-HS-----------------------AGL------------....

PF11071

D3FX91_BACPE/6-145AKNR-----------------NLP--L-----HFT-GP-----------------------MEN-HDRS--DDIGEEILG
U5LEP3_9BACI/6-145AKAL-----------------QLP--V-----HFV-GP-----------------------MEN-HERS--DKIGEEILG
B8BWK8_THAPS/26-165VQAK-----------------SLP--V-----RLT-SP-----------------------NTS-HEDS--DDCGAIILG
Q5WEA2_BACSK/6-145ASEK-----------------QLP--I-----VFK-GP-----------------------MEN-HGKS--DAIGEDILG
Q1GL75_RUEST/6-143..AR-----------------DLD--V-----QFS-SP-----------------------VTD-HDAS--DDCGVAILG
K0J0D1_AMPXN/6-145AEKR-----------------NLP--L-----TFV-GP-----------------------QTD-HDRS--DQIGEAIIG
A8FGC3_BACP2/6-145SQSL-----------------KLP--V-----TFV-GP-----------------------MEN-HDRS--DHIGEDILG
I0JPU7_HALH3/6-145AKEK-----------------KLP--L-----QFV-GP-----------------------QEN-HERS--DNIGESIMG
F2F8P8_SOLSS/6-145AKVK-----------------NLP--L-----QFV-AP-----------------------QTD-HDRS--DNIGEEILG
J9Z0F9_9PROT/5-144CKSA-----------------NLD--I-----HFS-SP-----------------------VTN-HENS--DNCGVEILG
V4J0N1_9DELT/6-144CRRR-----------------NLD--V-----TFT-SP-----------------------VTD-HEAS--DAAG.DHLH
G8PSA2_PSEUV/7-146AADA-----------------GLP--V-----HFD-SA-----------------------VTD-HEAS--DDCGVEILG
Q8EP80_OCEIH/6-145AKSK-----------------NLP--L-----HFV-SP-----------------------QTT-HDRS--DDIGETVIG
H2FX43_OCESG/9-148CEAR-----------------GLK--V-----RFS-SA-----------------------VTD-HDAS--DMVGVNILG
K7AD99_9ALTE/7-145CEDL-----------------GLD--I-----SFT-SP-----------------------VTD-HDSS--DAAG.DFLG
A1U6Z6_MARHV/6-144AEAA-----------------GLP--V-----EFT-SA-----------------------NTD-HESS--DAAG.DFLG
B1VFR0_CORU7/6-144AEAA-----------------GLD--V-----VFT-AP-----------------------VTD-HPAS--DAAG.DHLG
U4K8X0_9VIBR/6-144SKAA-----------------GLN--I-----TFT-SA-----------------------VTN-HEAS--DAAG.DVLG
E6U185_BACCJ/6-145AKQM-----------------QLP--L-----TFV-AP-----------------------MEN-HERS--DNIGEEILG
D3FC17_CONWI/9-148VMEE-----------------DLD--V-----ELS-AP-----------------------VTN-HEAS--DDCGVAILG
D5BQ04_PUNMI/6-143..SA-----------------DLD--V-----TFS-SP-----------------------VTD-HAAS--DDCGVAILG
D5DE71_BACMD/6-145AEQL-----------------NLP--L-----TFV-GP-----------------------MTD-HDRS--DNIGEEILG
Q4FSH8_PSYA2/6-144AKEH-----------------GLA--I-----KFT-SA-----------------------VTE-HEAS--DAAG.DVLG
M5DS25_9GAMM/6-145IAEK-----------------DLQ--V-----TLT-SP-----------------------NTD-HASS--DDCGDEILG
G4T0P2_META2/6-145IENN-----------------DLD--I-----EVL-GP-----------------------ITD-LNIS--ENIGAEILG
Q0VTM0_ALCBS/7-146CIDK-----------------ELD--I-----EFS-GP-----------------------VTD-HEAS--DKVGVSILG
E0TC70_PARBH/7-146AKAR-----------------ALP--V-----VFS-AP-----------------------VTD-HPAS--DDCGVAILG
Q31G06_THICR/6-144CEAH-----------------NLF--I-----EFT-SA-----------------------VTD-HAAS--DAAG.DLLG
L0F1C2_DESDL/6-146ATAL-----------------DLP--I-----EFV-GP-----------------------MQD-HDYS--DIIGEQVLG
Q47W56_COLP3/6-144CQES-----------------NLN--I-----VFS-SA-----------------------VTH-HETS--DSAG.DHLG
F2I1N1_PELSM/5-144CQKE-----------------KLE--V-----QFS-SP-----------------------VTN-HENS--DNCGVEILG
Q9K7V4_BACHD/6-145AKKQ-----------------DLP--F-----VFL-GP-----------------------MED-HTRS--DNIGEEILG
D6XSI6_BACIE/6-145AEKK-----------------KLP--L-----SFF-GP-----------------------MEN-HDRS--DNIGEEILG

PF09152

A8GFA5_SERP5/2-112ANII-----------------EAG--H-----AVF-SQ-----------------------VTM-S...--.HPINLQLA
A7ILK0_XANP2/11-118AHLI-----------------KMG--F-----IPF-SP-----------------------ISH-S...--.HPI..ARV
Q4KJD5_PSEF5/2-112AQIL-----------------EAG--H-----AVF-SQ-----------------------VSM-S...--.HPINLCLA
Q3IVN8_RHOS4/48-169VRLQ-----------------QVG--V-----TAI-SP-----------------------VAL-SGVA--VHATLYPRP
Q3IW66_RHOS4/60-180ARLL-----------------EVG--V-----TAI-SP-----------------------VVL-SAAA--LHATMFPRL
Q9I3M0_PSEAE/2-112ATIV-----------------RAG--H-----VVF-SQ-----------------------VSM-S...--.HPINLCLA

PF02267

F6QEE7_MACMU/57-297ISKY----------------...P--CNITE.EDY-QPLVKLGTQ......T...V..PCNKTLLWSRI..KDLAHQFTQ
H2PCY6_PONAB/41-280LDKD----------------...P--CSVLP.SDY-DLFINLSRH......S...I..PRDKSLFWENS..YLLVKSFAE
G3NMH1_GASAC/2-226VGRD----------------...P--CKVPV.AAY-GPLIAAAPF......P...P..KCNQRIFWSKT..KAVVHDFTK
F6WMZ1_ORNAN/53-298IQKN----------------...P--CEITV.KDY-QPLMELAAH......SANKV..PCNKTLLWSKS..YDLAHRFAK
CD38_RABIT/53-294VSKD----------------...P--CNITK.EDY-QPLIDLVTQ......T...V..PCNKTLFWSRS..KELAHQYSG
I3JGM5_ORENI/40-267VNKD----------------...P--CKVPV.EAY-DPLIAAAPF......K...P..QCNRMMFWSKT..KDVVHGFTE
M4A1C9_XIPMA/3-246VQHA----------------...S--CNVTE.EHY-CEMFNMMPQ......V...W..PCDRFLFWSKT..RMLVHSYAA
A0A0D2X2X5_CAPO3/27-255ADVD----------------...P--LSVTA.ASF-DPYFAIANF......S...T..PVDKAMFWSGS..QYYVHQLSD
T1FV69_HELRO/36-278MYKD----------------...P--CNVKS.EDY-QDFLNEADH..........YMDTKDKTMYWSGM..TDFVIAYTA
H2UBF5_TAKRU/48-277VGRD----------------...P--CKIPT.DAY-NPLFQVAPI......T...M..TCGKAMFWSKT..KDVVHAYNE
F6ZFL7_MONDO/56-295ISKN----------------...P--CNITE.QDY-QPLMELAAH......P...I..LCNKTLLWSKT..NELAHQYTK
W5KGC3_ASTMX/46-287VRRT----------------...P--CSVRV.KDY-QRMFRAVPQ......T...L..PCDRLLFWSKT..RDLMHSYAA
G7YGU8_CLOSI/32-273TDSR----------------LEHL--CTMDP.NMF-DQFVSELFK..........FEPEMKKPFFWSRS..GTLAMAVCR
W5MUD4_LEPOC/54-285VAKD----------------...P--CKISV.EAY-DGLMNTAKQ......K...V..PCNEMVFWSKT..KQMAHKFTQ
H2S9L5_TAKRU/26-267CRQT----------------...P--CNTTV.EDY-RHMFYAMAQ......A...WAPPCGRFLFWSKT..KTFVQTFVA
F1PKL7_CANFA/63-304LSKD----------------...P--CGSTE.QDY-RPLMELTTQ......I...V..PCDKTVFWSKS..SELAHDYTR
E1C8Y0_CHICK/57-298VHKN----------------...P--CNATT.EDY-RPLMELTSH......P...V..PCNKSLFWSRT..YDLVHLYSK
G3U406_LOXAF/31-277YLSD----------------...P--SPPLPRQDY-IYSVSLKNHHTTLTTA...V..EEEKSLFWENN..HLLVTSYAD
G1L422_AILME/37-297LRKD----------------...P--CSVFP.SDY-DLFINLSRH......S...I..PRDKSLFWENN..HLLVMSYTE
G7YGU9_CLOSI/32-273TGEQ----------------LSLL--CTMDP.KLF-DPFVDSLFK..........HQPKLSKPFFWSGA..RTFAIQFCR
F6XI43_XENTR/38-277VGKD----------------...P--CLVLP.EHY-ELFINLTLH......D...I..PASKSVFWENN..KQLVHRYSD
G1PDG1_MYOLU/63-304LSKD----------------...P--CNSSE.QDY-QLLLKLTNQ......T...T..PCHTSVFWSKS..NQLAHLYTR
H0WV24_OTOGA/63-304LSKN----------------...P--CNITE.EDY-QPLMKLASQ......T...V..PCNKSVFWSKS..SELAHHYTQ
B3RIX9_TRIAD/24-272VNRE----------------...P--CEVDP.TQY-SRFLIESSS......P...V..PPNKALFWSGV..YDFVSSYVQ
W5KGB4_ASTMX/49-278VGKD----------------...P--CDVPP.EAY-DPLIKSITQ......H...V..ACSRMLFWSRT..KDMVHAFTD
I3NBZ0_SPETR/34-275LDKD----------------...P--CSVLP.SDY-DLFINLSRH......S...I..PRDKADWWQGS..FILVRSRRN
B3RIY0_TRIAD/24-258AFKE----------------...P--CAVNA.SEY-DNFIKEVSS..................VFWSGT..YSFAHLYIR
H0ZHK5_TAEGU/57-298IYKN----------------...P--CNITP.EDY-QPLMELASH......P...I..PCNKSLFWSKT..GDLVHRYTK
CD38_MOUSE/59-300VSKN----------------...P--CNITR.EDY-APLVKLVTQ......T...I..PCNKTLFWSKS..KHLAHQYTW
G3VL69_SARHA/73-312LRKS----------------...P--CSVLP.SDY-DLFMNLSRH......S...I..PRDKSLFWENN..YYLVSAYAD
G3NMG7_GASAC/25-263VFRS----------------...S--FNATV..DY-SQMFDAIPQ......T...W..PCNTCLFWSKT..RNLMHSYAA
F6ZFG5_MONDO/39-279FHKD----------------...P--CSVLP.SDY-DLFINLSRH......P...I..PRDKSLFWENN..YDVVTAYAQ
W4ZBI8_STRPU/28-287RNMD----------------...P--CATPD.NAY-DEFLNMVPP......T...T..VRGTTMFWSGVMGNNIPQDVAQ
F6WHT8_XENTR/55-295YKKN----------------...P--CNITE.EDF-KPLAALASQ......T...I..PCNKSLLWSKT..NSLVHRYTK
I3M660_SPETR/62-303LSKN----------------...P--CNITK.EDY-QPLLKLDTQ......T...I..ACNKTLFWSKL..KDLAHQYTG
BST1_MOUSE/35-273LDKD----------------...P--CSVLP.SDY-DLFINLSRH......P...I..PRDKSLFWENN..HLLVMSYGE
U3IER2_ANAPL/39-280INKH----------------...P--CNILP.KDY-ELFIKLAFH......T...I..PANKSLFWENN..QLLVKSFTS

PF15891

T1IEI4_RHOPR/4-94.....--..------..---..VTVEHN--------AK.......E-S.A--------------CILFYVLDR-....RT
X2J5A2_DROME/193-284.....--..------..---..IELEHR--------AK.......E-K.A--------------RVLFFVMDS-......
R0I588_SETT2/52-156PLARD--AE------FR---AQVEWELS--------AL.......E-Q.V--------------DVICFFFDV-....KT
H9JE69_BOMMO/75-165.....--..------..---..IEVEHR--------AK.......A-A.A--------------RALLFVLDS-......
G3JGW9_CORMM/20-125EDVDN--AP------YR---EQVEWELE--------KQ.......D-Q.A--------------DTVVVYFHP-....AT
Q93174_CAEEL/75-166.....--..------..---..IYEESI--------AK.......E-S.S--------------SLFLFVIDP-......
H1UV03_COLHI/23-124EDVSD--AR------FK---GQVEWELE--------MQ.......E-R.A--------------DIIVVYFEP-....DT
G8XAS8_FLACA/18-121QKIEN--PD------FK---AQVLWELN--------AL.......E-E.S--------------DIIIMYFAE-....DT
R0KPG9_SETT2/22-127EDISF--QP------FR---EQVEWEMD--------YA.......R-V.A--------------DVIAFYFAG-....EA
M2SPH0_COCSN/22-128EDISF--PP------FK---EQVEWEMD--------HA.......R-I.A--------------DIIVFYFAG-....EP
B3RNW2_TRIAD/383-473.....--..------..---..LGIEAE--------AK.......K-H.S--------------RLLLYFIGN-......
X1WIH3_ACYPI/191-281.....--..------..---..IEIEHA--------AK.......E-S.A--------------TILFYVIDS-......
G4UZT0_NEUT9/26-130EDISF--KP------FR---DQVEWELD--------MQ.......E-R.A--------------DIVLIYYGP-....NT
A9FNG6_SORC5/15-119QSLEN--PS------FV---EQVLWELR--------GL.......E-E.A--------------DVILMYFAP-....GS
F2TZC5_SALR5/498-589.....--..------..---..MQEEER--------AK.......Q-A.A--------------DVLLFVFDH-......
G2PI08_STRVO/16-123.GQRA--DR------YE---TQVDWETA--------AR.......T-A.A--------------TVVLFWVPR-......
G2QGY7_THIHA/19-130EDPSF--AP------FR---EQIEWELD--------MQ.......E-R.A--------------DLVVVYLGP-....GT
A0A0D2XJJ8_FUSO4/20-126EDFSD--KR------WE---EQVWWELD--------MQ.......E-A.A--------------DIIVFFFHP-....ST
H3GTN6_PHYRM/285-389AAEKH--VQ------AL---AEHFQEIE--------TQ.......K-AIA--------------ELILFVIPR-......
E4ZGB9_LEPMJ/74-178PEAKD--EA------FR---QQVEWELS--------AL.......E-Q.A--------------DVICFFFDV-....NT
G0RX56_HYPJQ/19-123EDFSD--DR------WA---EQVQWELE--------MQ.......D-K.A--------------DVVVVFFHG-....VS
S3CPA1_OPHP1/16-127DPDAC--EP------FR---EQVQWELR--------MQ.......T-TDA--------------THVVFYFDP-....HK
B2VZJ4_PYRTR/54-158PDAQY--QE------FR---DQVDWELE--------AL.......E-Q.V--------------DVIAFFFDV-....KT
E6XC92_CELAD/16-114.TLNA--LQ------MK---KHVEWELD--------AM.......A-M.A--------------DIVLLNFLP-....NA
A0A0C4ECV9_MAGP6/43-148EDINF--AP------YR---QQVEWELD--------KQ.......E-K.A--------------DMVVVYFHP-....AT
Q12WB5_METBU/4-107AAREE--MD------SN---KIFQLNLE--------AV.......D-N.C--------------DIVVAVLDG-G.SDID
Q0UL03_PHANO/21-123EDISF--PK------FK---GQVEWEMD--------CA.......K-V.A--------------DVIVFYFPP-....GL
B7P1W0_IXOSC/23-113.....--..------..---..IELENQ--------AK.......E-N.A--------------KVMFFVIDN-......
A3CYE1_METMJ/140-241RTRSR--EE------HR---DIFAQHAA--------AL.......R-D.V--------------DAVVAVID.-G.ADAD
R1ERD8_BOTPV/31-135QSASD--PQ------FR---EQVEWELD--------QQ.......E-R.C--------------DVIAMYFDP-....NT
D7E641_METEZ/4-106DMRHE--HK------QN---YIFQNNVE--------II.......D-D.S--------------DIILAVLD.-G.ADVD
D5E7K8_METMS/3-106SMRKK--QD------SA---ELFRKNSE--------AI.......D-R.A--------------DLIIAILDG-G.SDVD
V4II58_9ACTN/15-116...DP--GQ------TP---VQIAWEYH--------HL.......E-L.A--------------DLTLFWFPA-CDPSRT
E0VD46_PEDHC/3-94.....--..------..---..LEVEYQ--------AK.......E-N.A--------------TVMFFVIDN-......
Q24ZT6_DESHY/231-331QYENW--EQ------RK---TIFEQDLV--------LL.......E-N.A--------------DLVVAILDH-....DD
E3RE45_PYRTT/24-128EDISF--QP------FK---DQAKWEMD--------HA.......G-V.A--------------DVIVFHFGG-....KS
T1FMG7_HELRO/145-235.....--..------..---..MELEDQ--------AK.......Q-T.A--------------QLLFFVIDN-......
C3ZHY4_BRAFL/353-443.....--..------..---..LPLENE--------AK.......A-N.C--------------TVFLAVITG-......
W4YFJ1_STRPU/135-225.....--..------..---..IEIEDQ--------AK.......R-L.A--------------DLLLFVIDN-......
D3PWT7_STANL/21-126...DP--AA------HE---QQVRWEYR--------HL.......H-I.A--------------DIVMFWFPA-CDPAVT
F4W7J2_ACREC/24-115.....--..------..---..IAQEYE--------AK.......Q-T.A--------------RVLLFVIDN-......
K1R891_CRAGI/425-516.....--..------..---..IPMQVA--------NR.......E-K.C--------------RVLLYVITG-......
Q0UX75_PHANO/110-214PKKGD--PN------FY---EQVNWELN--------SL.......A-K.V--------------DVIVFFFDC-....NT
R5LK94_9MOLU/14-117.WKPK--EN------YI---DQAMWERE--------AL.......I-E.S--------------TVIMFWIPR-......
E1REK1_METP4/142-243VTRHK--EE------HA---RIFGMHLA--------AL.......E-D.C--------------DYIVSVVD.-G.ADAD
D1A6W5_THECD/19-124...VY--DD------YT---GQVEWEER--------CL.......H-L.A--------------DEIVFWVPR-......
D6WAD7_TRICA/459-558VLDNK--SV------SD---EDVLEWKQ--------MM.......D-G.A--------------DVLLFVITE-......
R6SVN4_9CLOT/14-118ETPVF--KT------KD---EQVSWERD--------CY.......M-N.S--------------NVLLFWVPR-......
A2SPZ5_METLZ/139-240DGREG--SR------EQ---IIYEKNLS--------EL.......K-R.A--------------DIVVGVID.-G.SDAD
L0HB91_METFS/144-245AGREK--DV------QA---RLFTTNLS--------AL.......D-A.A--------------DIVVAVID.-G.ADAD
N4V4C4_COLOR/57-165QSIHN--AQ------FK---EQVDWELD--------AQ.......D-T.C--------------DVIAMYFSP-....GT
C3ZHY4_BRAFL/64-161.....--..------..---..VEVENQ--------AKKVSCQDLK-G.A--------------DLLLFVFDD-......
G9P4H0_HYPAI/21-126EDITF--DP------YR---EQVLWELD--------KQ.......D-K.A--------------DLVVVYFHP-....AT
G2QVT9_THITE/23-127EDPEF--EP------FR---EQVQWELD--------MQ.......E-K.A--------------DVVVVYFGP-....GT
R0ILK1_SETT2/51-155PLARD--KD------FK---TQVEWELT--------AL.......E-Q.V--------------DVICFYFDV-....ST
G4NHQ6_MAGO7/32-137EDYDH--EP------FR---EHVKWELD--------MK.......R-R.A--------------DLVVVHLAA-....SS
T1KY10_TETUR/147-237.....--..------..---..IELEDK--------AK.......K-N.A--------------EVLFFVIDN-......
V6JDP9_STRNV/16-123.GKRA--AH------YD---DQVGWETA--------AR.......Q-A.A--------------TAVLFWIPR-......
T1FMG7_HELRO/415-504.....--..------..---..IPREAS--------IK.......D-S.C--------------LVLLYVITQ-......
C7ZCF7_NECH7/13-117EDFSD--NR------WE---EQIWWELD--------MQ.......E-A.A--------------DIVVVFLHG-....AT
M7UKY8_BOTF1/34-167EDPSD--KR------FV---TQVNIELE--------GL.......E-L.A--------------DIVVVGFIG-....PD
G7YEE9_CLOSI/49-140.....--..------..---..VKIEAE--------AK.......S-T.S--------------VVFLYVFET-......
T1IR01_STRMM/382-473.....--..------..---.FTPIEAT--------AI.......D-N.C--------------RVLLFVITN-......
A9AZW5_HERA2/17-121QTIEN--PL------FR---GQVEWELD--------GL.......A-L.A--------------DLIVIYFAP-....QT
A7IB55_METB6/144-245AVREK--NK------NA---QICQCNKQ--------AI.......R-D.A--------------DIIVAIID.-G.ADAD
D0MXH6_PHYIT/72-162.....--..------..---..IQIEAK--------AK.......E-T.A--------------QIVLMVVDG-......
Q2FP85_METHJ/144-245HSREL--SI------QR---EIFEKNVQ--------AI.......H-N.A--------------DIVVAVID.-G.ADAD
E3S628_PYRTT/77-181PEAKH--QA------FR---EQVEWELG--------AL.......E-Q.V--------------DVIVFFFDT-....RT
I0GUV7_SELRL/54-159GKTEE--EL------VK---MIFGLDAG--------EV.......R-K.A--------------DIIFMNLD.-G.RVPD
I4AQY7_FLELS/16-121QTIEN--TH------FN---EQVIWELD--------AL.......E-M.A--------------DLIVFYFAP-....TS
R8BX59_TOGMI/36-142EDVSF--AP------FR---EQVQWELE--------KQ.......D-A.A--------------DVVVVYFHP-....AS
E0VD46_PEDHC/263-353.....--..------..---..TNVEAA--------AM.......D-N.S--------------RVLLFVITG-......
G4V7S9_SCHMA/78-169.....--..------..---..MELERK--------AK.......S-V.S--------------DILLFVFEN-......
Q2GRH7_CHAGB/23-123EQIS.--..------..---AQVEWELD--------MQ.......E-L.A--------------DVVIVFFGP-....ET
S3CVC4_GLAL2/28-132NSPSD--PK------FV---EQTSWELE--------CL.......E-R.A--------------DLVVVNFGS-....LT
C9SYP4_VERA1/23-124NDMSD--SR------FS---EQVTWELD--------MQ.......E-A.A--------------DLVVVLFHH-....ST
H1Z0K3_9EURY/139-240EERAD--DR------MR---IIFERNLS--------AL.......D-H.S--------------DIVVAVID.-G.ADAD
C7QF56_CATAD/15-121.GLRE--TE------YE---DQIEWEWE--------GL.......D-R.A--------------SAILFWIPR-......
Q4WMH8_ASPFU/20-125EDIDF--AP------YR---EQVEWELD--------KL.......D-K.S--------------DTVVIYFHP-....AT
L0KW01_METHD/4-107EKRLE--LK------QK---NIFDKDLK--------GI.......D-D.C--------------DIVVAVLDG-G.SDVD
K1R891_CRAGI/151-241.....--..------..---..MELEAQ--------AK.......E-S.A--------------ELLLFVIDN-......
A6L9R1_PARD8/43-145SDFE.--..------..---HQVNWELE--------HL.......E-K.A--------------DLIIMNILA-....SS
K4MDC8_9EURY/4-107SSRMH--ER------QM---CIFENDIE--------GI.......D-E.S--------------DIILAVLDG-G.SDVD
Q8TK51_METAC/4-106MGRES--QN------QE---YIFMKCAE--------GV.......N-A.S--------------DLVVAVLD.-G.VDVD
T1IR01_STRMM/86-176.....--..------..---..IELENQ--------AK.......E-N.A--------------EVLFFVIDN-......
E4ZNI1_LEPMJ/22-126EDIAF--PK------FK---EQVEWEMD--------YA.......Q-V.A--------------DVIVFYFAP-....EA
F7XKZ0_METZD/2-105TLRDE--NK------NL---IIFENNIQ--------GI.......D-S.S--------------DVMVAILDG-G.SDVD
G9MES0_HYPVG/13-117EDGSD--KR------WS---EQVGWELE--------ML.......D-K.A--------------DLVVVFFHG-....GS
K3WUG2_PYTUL/124-214.....--..------..---..IQIETR--------AK.......E-T.A--------------KIVLMVIDN-......
U7Q6W0_SPOS1/18-131EDANF--SP------FR---QQVDWELE--------MQ.......E-Q.S--------------TLIAFFFDP-....GR
B2AQB5_PODAN/21-125EDIDF--AP------FR---EQVEWEFD--------RL.......N-Q.A--------------DLVVVYFGP-....QT
A8NV21_BRUMA/75-166.....--..------..---..INEESV--------AK.......E-N.S--------------NLFLFVLDP-......
D6WAD7_TRICA/186-276.....--..------..---..VAQEHD--------AK.......Q-A.A--------------SVLLYVVDN-......
E9EQF8_METRA/36-140EDFSD--TR------WT---RQIRWELD--------LQ.......E-Q.A--------------DIVVVFFHE-....ST
F2KPY9_ARCVS/3-103SDGSE--EE------KR---RIFEMDLS--------AL.......K-G.C--------------DAVVAVLD.-G.ECID
I1FY95_AMPQE/147-238.....--..------..---..MEIEEE--------AK.......K-N.A--------------VGLLFVIDN-......
H6L323_SAPGL/16-120QSIDH--PE------FK---AQVDWELK--------GL.......E-E.A--------------DFRLFHFEP-....QS
R6SWJ3_9BACE/43-144NEMD.--..------..---YQVNWELS--------HL.......E-K.A--------------DFILMNFLP-....DS
F2TZC5_SALR5/813-902.....--..------..---..IPLEAA--------AK.......R-R.C--------------RSMLYFIGS-......
D2V4M3_NAEGR/31-141...DK--SQ------SD---VQIRWEHS--------YL.......H-T.V--------------EAVSFWFCS-....ET
J1AN41_9EURY/138-239AARSA--GD------GR---AIFEHNLE--------DL.......K-G.V--------------DIVVAVID.-G.ADAD

PF05014

Q74CV5_GEOSL/3-131VEEFR--SI------AS---GIGEINES--------GI-------I-A-C--------------DGLLAILDG-AE....
DNPH1_TETNG/3-110.EHVT--QG------DR---FIHDRDVD--------WL-------R-Q-S--------------DVVVAEVTQ-......
DNPH1_MOUSE/12-119...AA--GG------DQ---FIHERDLA--------WL-------R-Q-A--------------DVVVAEVTQ-......
Q3XZF0_ENTFC/3-117...AY--AD------SR---MIALADTE--------KV-------L-A-S--------------DLMIALLDG-LT....
Q831Y8_ENTFA/4-118...AY--AD------SK---MIALADTE--------NV-------L-A-S--------------DLLVALLDG-PT....
Q037S4_LACC3/3-117...AY--AD------SK---MIAEADTK--------RL-------L-S-A--------------DLMIAILDG-PV....
Q38VK0_LACSS/3-117...AY--AN------SE---MIAQADTE--------QL-------V-A-S--------------DLVIAVLDG-PT....
Q5FMM8_LACAC/8-127...DI--EW------AS---ATYHNDLI--------GI-------K-S-S--------------DIMLGVYLP-EE....
Q38YB9_LACSS/5-123...GY--EW------AN---QTYQNDIT--------AM-------D-L-A--------------DMAVVLWDM-AD....
Q5FIN0_LACAC/10-130...SM--TW------RL---ATYNNDLS--------GI-------I-N-A--------------TCGVFLYDM-DN....
Q4K9G5_PSEF5/5-138..TPE--AT------AQ---WIYRQNLQ--------MI-------R-G-C--------------DALLANLND-FRG.LE
C1DJ67_AZOVD/4-137..TPA--AA------AR---WTLEANIA--------LL-------R-S-A--------------DAVLANLEP-FRG.LE
Q2KTK9_BORA1/4-141..AGQ--AL------AD---WIYRQNVT--------LI-------R-R-A--------------DLVMANLNR-FRG.AE
Q0KDU3_CUPNH/46-184..SGA--DT------AR---WIYDANLA--------LL-------R-R-A--------------DMVMANLDD-FRGPGE
Q1LQW3_RALME/4-142..SGS--AT------AQ---WIYEANIA--------LI-------R-R-A--------------DVVMANLDD-FRGSGE
Q47ET2_DECAR/3-138...VE--TT------AR---GIYHANIE--------QI-------R-S-A--------------DAVLANLNP-FRG.CE
Q2RU71_RHORT/7-150.KPPA--VQ------AK---LIYEANIA--------LI-------G-Q-C--------------AGVAANMSP-FRG.PS
A5FTP2_ACICJ/9-159GQPPS--EV------AR---AIFRANAD--------RL-------R-T-C--------------DAVLANIDP-FRS.PG
Q2W5R7_MAGSA/7-146ALPPA--EL------AA---LIRQGNME--------RI-------R-A-C--------------DVVIACVSP-FRG.PG
A1U4X5_MARHV/25-160QETKP--AR------GH---RIYQANRE--------LM-------D-S-C--------------DAIIANLTP-FRG.IS
A9CG29_AGRFC/36-179..TRI--GH------GC---NINEVDER--------MM-------L-E-A--------------DAVIANLTP-FRG.IA
A4YQ35_BRASO/3-141..S..--DA------SR---QIFHGNEA--------MM-------D-G-A--------------DAIIANLTP-FRG.PG
Q89RW2_BRADU/3-141..P..--DA------SR---QIFCGNEA--------MM-------D-A-A--------------DAIIANLTP-FRG.AG
Q21A75_RHOPB/3-141..P..--QL------SL---SIFRSNEA--------MM-------L-K-A--------------QAIVANLTP-FRG.PS
A5G297_ACICJ/7-142..PGE--AL------WR---AIFRQDVG--------MM-------E-A-S--------------DIIIAHLTP-FRG.AS
Q0BQQ5_GRABC/21-153GTVKL--PP------WE---RIFRANLV--------MM-------E-A-C--------------DVVIANLTP-FRG.AS
A7IM74_XANP2/3-145..AAG--AA------SH---SIFAANLA--------LM-------R-S-A--------------DALIANLTP-FRG.IS
B0T4X8_CAUSK/7-152...VE--IL------AR---ELYAERMA--------KL-------R-Q-A--------------DAGVINLTP-WRG.PS
Q9A6H7_CAUCR/7-151...DE--LE------AR---QFYATRMA--------QL-------R-Q-A--------------DAGVINLTP-FRG.PA
Q57VC7_TRYB2/4-128.....--TG------AL---DIRQKNIQ--------MI-------K-D-C--------------DAVIADLSP-FRG.HE
Q4QAY0_LEIMA/7-130.....--TG------AL---SIRNKNID--------MI-------R-A-C--------------DAVIADLSP-FRS.KE
Q4DGS2_TRYCC/4-128.....--SG------AG---EIRAKNLE--------MI-------R-H-C--------------DAVIADLSP-FRS.HE
YQ65_SCHPO/20-174MAPGA--ET------SL---KIAELDRK--------LM-------D-R-C--------------DGGIFCLDP-FRRAPD
Q5FND5_GLUOX/8-164LPPGR--ET------IL---AFVRADRD--------LM-------D-R-C--------------AAGLFCIDP-FRRSPE
Q5NX98_AROAE/5-139.....--SD------SK---VIFRENVA--------KI-------R-E-A--------------HLLIANLNP-FRSSVE
Q7VB88_PROMA/6-120...QP--GW------AH---DIALADLR--------DV-------R-N-S--------------DGILAVVNG-TP....
A5GSS0_SYNR3/13-127...KP--GW------AY---QVACADVR--------DV-------E-Q-A--------------DGFFAIVNG-TP....
B5E901_GEOBB/16-144AGAIE--EA------AR---CAGRVNAE--------GI-------R-A-A--------------DVVLAVLDG-TE....
Q7NFW9_GLOVI/18-124EIPAD--AG------AE---EVFARCVA--------GI-------D-A-S--------------AVVVANLSG-AD....
Q6AQB0_DESPS/15-129GTPLK--VA------EK---SIYEADIS--------AM-------K-N-A--------------DILLAVLDG-AC....
Y063_UREPA/7-134GANAH--KP------NI---FFYESDIK--------FI-------D-Q-T--------------DIAIIDIDN-......
A5VK58_LACRD/9-128.LQDR--EW------ST---ATYNGDRV--------GV-------S-T-S--------------DMLLAVYIP-EE....
B2U7I3_RALPJ/5-137..DGP--AT------AA---EIYRQNIA--------LI-------D-L-A--------------DAVIANVAD-FRG.HE
Q04FG4_OENOB/4-122.LEDT--EW------QL---GTFNGDMN--------GI-------N-S-S--------------DLIVAMYLP-NE....
Q1G8M7_LACDA/7-128.ERSL--LW------KQ---QTYQNDIN--------GL-------S-M-A--------------NCGVFLYDM-DE....
Q2K9H8_RHIEC/4-146..PIK--RT------AA---EIYARNDV--------AM-------R-R-A--------------EICLANITP-FRG.VS
Q46LL2_PROMT/6-120..SAP--GW------AN---KVANSNLN--------DL-------R-Q-A--------------DGLFAIVNG-SP....
Q9I6Y7_PSEAE/4-145.REPA--AQ------AA---WIYRANVG--------LI-------E-R-A--------------DCVLANLEP-FRG.SE
Q9I6Y8_PSEAE/42-183.AEPR--EQ------AA---WIYRANIG--------LI-------E-R-A--------------DAVLANLNF-FRG.AE
V6F0F5_9PROT/7-146.LPQE--QQ------AA---AIRQANID--------LI-------R-A-C--------------DAVIACISP-FRG.PG

PF14359

Q2NSU1_SODGM/3-92..PDG--LF......EA---DYMRIVLA--------ML-------Q.C-A--------------QGIFMLED------WQ
B2JD24_BURP8/3-94DLGPF--AT......WL---DYMRVDIK--------LA-------V.D-C--------------DGIAMLPG------WE
A5I2H3_CLOBH/3-91..PEG--FP......YE---AYMPICTS--------MI-------D.Q-C--------------DSIYMLNN------WE
D9SWF2_CLOC7/7-95..PEG--FP......WE---AYMPICYA--------MI-------D.A-C--------------DTVCMLGN------WI
C5CJN4_VARPS/4-95TPPTC--GS......WE---GYMRLAVA--------QL-------V.T-C--------------DEIHMLRG------WR
C8WLV1_EGGLE/6-97.VRPG--EK......WP---AAMRITLM--------AI-------IAQ-A--------------DGLAMLDG------WE
C4Z5Z6_EUBE2/3-89..PEG--LS........---DYYEINKA--------MI-------D.Q-C--------------DAIYVLLN------YE
C8WA55_ATOPD/35-125.IPAR--FS......WE---QAMKHCLS--------EI-------T.G-Y--------------DTVVMLPE------WE
Q12J43_SHEDO/10-99..PAG--LS......EP---EYMSICMP--------ML-------M.C-C--------------DMIYLLDG------WE
D4IIW9_9BACT/4-96GIPAT--AS......WE---AHVAMDVL--------LL-------M.G-C--------------DAIYLLPD------WG
Q8NPR6_CORGL/6-107QLTAP--LPENAEHKYD---HYLRLGIE--------KL-------L.K-A--------------DAVHMLQG------WQ
Q2NSN9_SODGM/3-92..PDG--LS......EA---DYMRIGLT--------ML-------Q.C-A--------------DGIYLLDG------WQ
D4L1U8_9FIRM/28-119MLPED--AT......WE---EYIKVSLT--------LL-------S.I-C--------------TGVYMMPG------WR
Q8ECZ5_SHEON/4-92..PFG--LT......EP---QYMDICYA--------MI-------R.A-C--------------NEIVMLPG------WR

PF11071

D3FX91_BACPE/6-145TMPTS--ILKDEAASSI---NNLRTQIL--------LQ-------K---A--------------DVVIALFGE.TYKQWN
U5LEP3_9BACI/6-145EQPGP--VYLDQASSSI---NNLRTQLL--------ME-------K---S--------------DLVIALFGE.QYKQWN
B8BWK8_THAPS/26-165MEEKR--PNWDKIGANM---NNIRTKNL--------IQ-------D---A--------------DVVVVRFGD.KYKQWN
Q5WEA2_BACSK/6-145KQPNA--VLRDEAASSI---NNFRTRIW--------LQ-------R---A--------------DAVIALFGE.DYRQWN
Q1GL75_RUEST/6-143AEDSK--FWHDHKGAKL---NAIRTRKG--------IE-------D---A--------------DIVVVRFGD.KYKQWN
K0J0D1_AMPXN/6-145EQPGD--YYRDEAASAI---NNFRTELL--------IQ-------K---A--------------DVVIGLFGE.KYRQWN
A8FGC3_BACP2/6-145EQPNA--IFKDDAASDL---NNFRTEIL--------LN-------K---S--------------DIVIARFGE.KYKQWN
I0JPU7_HALH3/6-145EQPDN--LYRDDAASSI---NNFRTQVL--------LH-------K---S--------------DAVIALFGE.SYKQWN
F2F8P8_SOLSS/6-145IQPSA--YYKDNAASDI---NNFRTQVL--------MQ-------K---A--------------DIVIALFSE.KYKQWN
J9Z0F9_9PROT/5-144KEEKN--FWKDQKGANI---NSIRTQKS--------IK-------D---S--------------DIVIVKFGE.KYKQWN
V4J0N1_9DELT/6-144QSGIP--FWRDHVSAKL---NAIRTKTL--------IE-------M---S--------------DLVVIRFGD.TYKQWN
G8PSA2_PSEUV/7-146AEESN--FWRDHKGAKV---NAIRTRTL--------LS-------E---A--------------DIVVVRFGD.KYRQWN
Q8EP80_OCEIH/6-145KQPSN--LHRDDAASSI---NNFRTQVL--------LS-------K---S--------------DIVIALFGE.SYKQWN
H2FX43_OCESG/9-148SEEDN--FWRDRKASGI---NSIRTSTH--------IK-------E---A--------------DLVVVRFGP.KYKQWN
K7AD99_9ALTE/7-145HENIQ--FWRDHKSSKV---NAIRTQAL--------LK-------A---S--------------DIAIIRFGD.KYKQWN
A1U6Z6_MARHV/6-144KPENN--FWRDHQSSKV---NAIRTKTL--------LE-------Q---C--------------DLAVIRFGD.KYKQWN
B1VFR0_CORU7/6-144EAPAG--FWRDHQSSKV---NSIRTRTL--------IE-------K---A--------------DMVVVRFGD.QYKQWN
U4K8X0_9VIBR/6-144EEESG--FWRDHKSAKV---NAIRTKTH--------IE-------N---C--------------DLAVIRFGD.KYRQWN
E6U185_BACCJ/6-145TQPNS--YYKDEAASKI---NNLRTHVL--------LE-------K---S--------------DVVIALFGE.KYKQWN
D3FC17_CONWI/9-148DEDKP--FWKDHVGAGL---NAIRTRTL--------IE-------Q---S--------------DVVVVRFGE.QYRQWN
D5BQ04_PUNMI/6-143PETDK--YWHDHKGAMV---NAIRTRKA--------IQ-------E---A--------------DIVVVRFGE.KYKQWN
D5DE71_BACMD/6-145KQPNA--VLKDEAASQI---NNLRTQVL--------LK-------K---S--------------DVVIALFGE.KYKQWN
Q4FSH8_PSYA2/6-144KDENG--FWRDHKSSKV---NAIRTKNM--------IQ-------K---C--------------DIAIIRFGD.KYKQWN
M5DS25_9GAMM/6-145TEATP--FWKDHKAAKI---NALRTRKL--------IS-------D---A--------------DIVVVRFGD.KYKQWN
G4T0P2_META2/6-145PEENN--FWRDHKSAKI---NALRNNHY--------LG-------Q---A--------------DLVVVRFGE.KYKQWE
Q0VTM0_ALCBS/7-146AEEKR--FWEDRLGAGI---NGIRTRKL--------ID-------E---A--------------DLVVVRFGP.KYKQWN
E0TC70_PARBH/7-146SEDSK--VWHDRKGAQL---NAIRTQTL--------IK-------A---A--------------DIVIVRFGD.KYRQWN
Q31G06_THICR/6-144AEEKN--FWRDHKSAKV---NAIRTKTL--------IE-------N---C--------------DVAVVRFGD.KYKQWN
L0F1C2_DESDL/6-146TQPNP--ILRDEAASKI---NNLRTQVL--------LG-------K---S--------------DLVIAHFGENKYRQWN
Q47W56_COLP3/6-144AETEQ--FWRDNKSAKV---NAIRTKTL--------IE-------R---C--------------DVAIIRFGD.KYKQWN
F2I1N1_PELSM/5-144AEEKN--FWKDSKGANI---NSIRTKKS--------IQ-------D---C--------------DVVIVKFGE.KYKQWN
Q9K7V4_BACHD/6-145KQPDP--VLKDDAASSI---NNLRTTIL--------LN-------K---A--------------DVVIALFGL.QYKQWN
D6XSI6_BACIE/6-145KQADP--IAKDEAASQL---NNLRTRLL--------ME-------K---S--------------DVVIAKFGE.SYKQWN

PF09152

A8GFA5_SERP5/2-112KTDKA--EI------GK---MWAPVDAL--------FL-------D-LME--------------ELVILDLAG-----WD
A7ILK0_XANP2/11-118GGIDP--RS------HE---IWMAQNDA--------FM-------E-ACS--------------AMVAVHIPG-----WE
Q4KJD5_PSEF5/2-112GKDNA--AI------GK---LWAPVDAL--------YM-------A-MME--------------ELIVLDLPG-----WK
Q3IVN8_RHOS4/48-169.MLDP--LD------AV---LWAEWCRP--------IL-------D-TCS--------------AVVVPDIRG-----WS
Q3IW66_RHOS4/60-180.RIDP--FA------PV---LWEDWCRP--------IL-------S-VCA--------------AVVVPEIRG-----WT
Q9I3M0_PSEAE/2-112ELDRA--AI------GR---LWAPVDAF--------YM-------D-HLE--------------ELIVLDLPG-----WR

PF02267

F6QEE7_MACMU/57-297VQRDM..FTLEDMLLGYLA.DDLTWCGE.FNTF...EI-------NYQSCPDWRKD.CSNN...PVSVFWKTVSR.RFAE
H2PCY6_PONAB/41-280NTRRF..MPLGDVLYGRVA.DFLSWCRQ.KNAS...GL-------DYQSCPTS.ED.CENN...PVDSFWKRASI.QYSK
G3NMH1_GASAC/2-226KRKCF..ETVEDTLLGSVL.DGQTWCGK.EGSN...ET-------FATGCPGW.TD.CETS...AVRSFWNGASA.AFAD
F6WMZ1_ORNAN/53-298AQRDF..FTLEDTLLGYIA.DGITWCGN.SESS...EV-------NYQSCPQW.NE.CTNS...PESVYWKTASK.MFAE
CD38_RABIT/53-294IQKEM..FTLEDTLLGYIA.DNLVWCGD.PRTS...EV-------KEEFCPYRNEN.CSST...ATSVFWTVVSQ.KFAE
I3JGM5_ORENI/40-267KRDCF..VTLEDTLLGSVL.DGLTWCGK.EGSK...DT-------NTTGCPGW.SD.CENN...TVRSFWIRASA.AFAD
M4A1C9_XIPMA/3-246VFRHF..WTLEDTLVGFLF.NDLIWCGQ.EEDS...DF-------NFNSCPAW.ST.CRTH...PVYSLWKRASQ.NFAE
A0A0D2X2X5_CAPO3/27-255AGLRY..FTMEDTVGGFVQ.NGLHWCGS...SS...GY-------NYTSCPPGFRNTTTDTWYGAELAFWQHAST.TFAR
T1FV69_HELRO/36-278YSKTY..TTIRDQLAVYILKNSDVWCGQ.EGKP...DM-------NFKQCPGF.EN.CPNS...AVGAFWKQMSK.HFAS
H2UBF5_TAKRU/48-277NTKCF..VTMEDTLLGSVL.DNLIWCGK.EGSN...KT-------FTSGCPDW.NA.CKDN...PVRSFWTQGST.KFAE
F6ZFL7_MONDO/56-295VQGSL..LTLEDTLLGYMA.DKVTWCGS.PSST...EM-------NYQSCPRW.NE.CTNN...SNTIYWKMASK.IFAE
W5KGC3_ASTMX/46-287VTGRF..WTLEDTLVGFIF.NDLIWCGQRERDR...GF-------DFQSCPEW.ST.CVTH...PVYSLWKRASQ.NFAA
G7YGU8_CLOSI/32-273KLGIC..DILEGTLPGFIF.NELNWCDRRLTAG...TV-------YQTQCG......CSGE.AQLVYAFWKSASK.LYSQ
W5MUD4_LEPOC/54-285AKKCF..MTLEDTLLGFIM.DGLTWCGS.QDGN...DT-------YTSGCPNW.NT.CEQN...PVRSFWSRASA.HFAE
H2S9L5_TAKRU/26-267ALRYF..WTLEDTLAGYMF.NDLLWCGQ.EDND...GF-------DFGSCPGW.SA.CERH...PVYSLWRRASQ.NFAE
F1PKL7_CANFA/63-304VQRDM..YTLEDTLLGYMA.DGLKWCGD.TSSS...EM-------NYQSCPHWRED.CSNN...SVSVFWNTVSK.RFAE
E1C8Y0_CHICK/57-298CNHHF..LTLEDTFLGYML.DGLSWCGD.PSAP...GI-------NYESCPKW.SE.CERS...SGSVFWKMASK.MFAE
G3U406_LOXAF/31-277NARRF..MPLRDVLYGRVG.DFLSWCRQ.KNAS...GL-------DYQSCPTS.DD.CENN...PVDSYWKRASIQQYST
G1L422_AILME/37-297SGHRL..MPLCNVLYGRIG.DFLSWCRQ.ENGS...GL-------DYQSCPSS.ED.CENN...AVDSFWRRASM.QYSR
G7YGU9_CLOSI/32-273NLGTC..DILESTLPGYTF.NDLDWCDTKQTAG...KV-------YRTQCG......CTGK.AELVYAFWKSASS.AYSK
F6XI43_XENTR/38-277KTSRY..MPLGDTLAGWMV.DNLDWCGS.LSTP...GL-------EYSSCPTT.AE.CENN...PQEAFWRIASV.TYAK
G1PDG1_MYOLU/63-304VQQDM..FTLEDTLMGYIA.DGLNWCGD.AGSS...EM-------NYQSCPHWGKD.CINN...PKSVFWDTVSK.RFAE
H0WV24_OTOGA/63-304IRRDM..FTLEDTLLGYLA.DELSWCGD.SGTS...EM-------NYQSCPHRRKD.CPNN...PVSVFWKLVSW.RFAE
B3RIX9_TRIAD/24-272AVDDV..LVISQTFTGFLL.DKLTWCGRFKSTPQSEGI-------NYLYCNDS.QG.CSHR...NMLSFWALASR.EFAK
W5KGB4_ASTMX/49-278KRECL..FTVEDTLLGFLF.DELTWCSK.IDSK...ET-------FTTDCPGW.GD.CENN...TVRSFWIRASL.NFAV
I3NBZ0_SPETR/34-275FPKSTISMTLCDVLYGRVA.DFLSWCRQ.KHGS...GL-------DYQSCPTS.ED.CENN...PVDSFWKRASI.QYSR
B3RIY0_TRIAD/24-258AVKNL..ETLENTFPGYLV.NSLSWCGQ.LALP...GI-------NYNDCHDP.QH.CNNK...NSGIFWSKMST.WFAQ
H0ZHK5_TAEGU/57-298SNQNF..LTLEDTLLGYMA.DRVSWCGD.PSAP...GI-------NYESCPKR.NE.CESN...PGSVFWKMASK.MFAE
CD38_MOUSE/59-300IQGKM..FTLEDTLLGYIA.DDLRWCGD.PSTS...DM-------NYVSCPHWSEN.CPNN...PITVFWKVISQ.KFAE
G3VL69_SARHA/73-312NTQRL..MTLSDTLYGGVA.DLLMWCRE.ENGT...DF-------DYQSCPTE.KD.CENN...AVDSFWKRLSS.QFAY
G3NMG7_GASAC/25-263VERHF..WTLEDTLVGFMF.NDLVWCGQ.EKHS...GF-------GFSSCPPW.AA.STHH...PVYSLWRHASQ.NFAE
F6ZFG5_MONDO/39-279NGRRL..LPITNMLYGRIV.DLLDWCRK.ENSS...EL-------DYQSCPTT.ED.CENN...AMDSFWKKASS.QYAY
W4ZBI8_STRPU/28-287VTPEF..SVLEETFPGYMA.GNLSWCGATDGDGTGLGL-------NFTVCPTWTSETCPNN...TKAAFWARASK.MLAT
F6WHT8_XENTR/55-295ASQDF..LTLEDTFLGSMF.DGLMFCGK.SYSS...EM-------NYDSCPAW.DE.CDHN...AISAFWKTASA.TFAK
I3M660_SPETR/62-303VQQEL..VTLEDTLLGYMA.DRLTWCGD.PSTS...DL-------NYQSCPHWRND.CSNN...PGSVFWKAISQ.KFAE
BST1_MOUSE/35-273NTRRL..VALCDVLYGKVG.DFLSWCRQ.ENAS...GL-------DYQSCPTS.ED.CENN...AVDSYWKSASM.QYSR
U3IER2_ANAPL/39-280GARRY..MSLSDALFGFVA.DFLVWCGQ.ANST...GL-------DYESCPTM.EE.CENN...AVDSFWRMASI.TYAQ

PF15891

T1IEI4_RHOPR/4-94R..N.....VVGI......VEAANF.AGA.HR------N.LVLVMDSY--------------------------------
X2J5A2_DROME/193-284...E.....TRASA...GAIEAAHI.AGQNCK------Q.LVLVLHPY--------------------------------
R0I588_SETT2/52-156K..S.....PVSL......LELGLW.AAS.DK------V.VVCCGDDF--------------------------------
H9JE69_BOMMO/75-165...E.....TRAVA...ASVEAAHL.AAA.PR------D.LLLVLRPY--------------------------------
G3JGW9_CORMM/20-125Q..A.....PVSL......LEFGLS.ARTRGK------V.IVLCPEGY--------------------------------
Q93174_CAEEL/75-166...A.....TVNAT...SFLEIAYF.AARKSP------K.LVVVFLGK--------------------------------
H1UV03_COLHI/23-124E..A.....HISL......LELGLC.ARS.GK------A.IVACSEGY--------------------------------
G8XAS8_FLACA/18-121K..S.....PISL......LEFGLY.AKS.KK------M.KVVVDKAF--------------------------------
R0KPG9_SETT2/22-127EVLQ.....PITL......LELGLY.AGT.GK------A.VVCCPKGF--------------------------------
M2SPH0_COCSN/22-128KVLQ.....PITL......LELGLY.ADT.GK------A.VVYCPKGF--------------------------------
B3RNW2_TRIAD/383-473...E.....SRCVA...SMVEIAYY.IGL.GR------N.VVLCIQNF--------------------------------
X1WIH3_ACYPI/191-281...Q.....TRNVV...SDIETANF.AGN.HN------N.LVLVIHPQ--------------------------------
G4UZT0_NEUT9/26-130L..A.....PISL......LELGLC.ART.GK------A.IVCCHKDY--------------------------------
A9FNG6_SORC5/15-119K..A.....PISL......LELGLF.GRS.GK------M.HVVCPEGF--------------------------------
F2TZC5_SALR5/498-589...T.....TRGVA...SMVEVAVN.AATRPQ------S.LVVALSPL--------------------------------
G2PI08_STRVO/16-123...D.....LRTLPAMTTNVEFGLD.VAT.GR------V.VLGCPPDC--------------------------------
G2QGY7_THIHA/19-130D..A.....PVSL......LELGLC.ARS.GK------AVVVACYPGY--------------------------------
A0A0D2XJJ8_FUSO4/20-126E..A.....PISL......MELGLA.AKTKPE------RSIVCALDGY--------------------------------
H3GTN6_PHYRM/285-389...N.....LRSIAAMTEAVELVSS.....HQ------A.LLLVIEPA--------------------------------
E4ZGB9_LEPMJ/74-178M..S.....PVTL......LELGIW.AAS.DK------V.VVCCDPKY--------------------------------
G0RX56_HYPJQ/19-123P..A.....PISL......LELGLC.VRS.GR------A.IVCSLEGY--------------------------------
S3CPA1_OPHP1/16-127D..G.....MVSL......LELGLSLGRDRVQ------TVAVCCPRGY--------------------------------
B2VZJ4_PYRTR/54-158S..S.....PVSL......LELGLW.AAS.DK------V.VVCCGKDY--------------------------------
E6XC92_CELAD/16-114L..S.....PISL......VELGLY.ASF.KK------L.YVVCPKAF--------------------------------
A0A0C4ECV9_MAGP6/43-148Q..A.....PISL......LELGLC.ARAPGK------A.VVYCPEGY--------------------------------
Q12WB5_METBU/4-107SGTA...............WEIGYA.YSK.KK------T.IIGLKTDF--------------------------------
Q0UL03_PHANO/21-123L..T.....PVAL......LELGMH.AGT.GK------A.LVCCPEGF--------------------------------
B7P1W0_IXOSC/23-113...Q.....TRSVA...CMIETAHI.AGT.QR------K.LILILNEQ--------------------------------
A3CYE1_METMJ/140-241SGTS...............WEMGYA.YAL.GK------R.VVALRTDF--------------------------------
R1ERD8_BOTPV/31-135K..A.....PISL......LELGLF.AQT.GR------M.VVCCPDGF--------------------------------
D7E641_METEZ/4-106SGTA...............WEIGYA.YAK.GK------M.IFGLRTDF--------------------------------
D5E7K8_METMS/3-106SGTA...............WEIGYA.YAK.TI------P.VIGLRTDF--------------------------------
V4II58_9ACTN/15-116T..Q.....PITM......YELGAA.AATPAR------RIVVGVDPGY--------------------------------
E0VD46_PEDHC/3-94...Q.....TRGVS...ALIEVAHL.AGN.RR------K.LILVIQSY--------------------------------
Q24ZT6_DESHY/231-331PGTC...............FEMGYA.YNK.KI------P.IIGLKTSI--------------------------------
E3RE45_PYRTT/24-128D..Q.....PITL......LELGLY.AHT.GK------A.VVCCQEDF--------------------------------
T1FMG7_HELRO/145-235...K.....TRSSA...SMVEVAYI.AGC.DR------Q.LILVVKKF--------------------------------
C3ZHY4_BRAFL/353-443...E.....TRGLA...SMIEIAFF.IGQ.DR------D.LVLSLEDI--------------------------------
W4YFJ1_STRPU/135-225...S.....TRSIA...SMVEASFL.AGA.QR------P.LILVLRGL--------------------------------
D3PWT7_STANL/21-126V..Q.....PIAL......AELYAA.MERRHQ------YRLIGAAPGY--------------------------------
F4W7J2_ACREC/24-115...Q.....TRNSA...GIIEAAQL.AATRSE------S.LVLVIYPY--------------------------------
K1R891_CRAGI/425-516...K.....TRSLS...SMIEAGYY.IGK.GC------K.VVLCVQKM--------------------------------
Q0UX75_PHANO/110-214S..S.....PITL......LELGLW.ASS.GK------V.IVCCDQRY--------------------------------
R5LK94_9MOLU/14-117...S.....LPDMFAFTTNVEFGYW.LHS.GK------V.IYGRPDNA--------------------------------
E1REK1_METP4/142-243SGTS...............WEMGYG.YAK.GK------T.VISLRTDF--------------------------------
D1A6W5_THECD/19-124...D.....MRTMPALTTNVEWGMW.HDS.GK------V.VFGAPPQA--------------------------------
D6WAD7_TRICA/459-558...D.....TRSLT...TMILAAHY.IAI.GK------N.LVLCVQHL--------------------------------
R6SVN4_9CLOT/14-118...K.....FPSMLGLTTNVEFGYW.LKS.KK------C.IYGRPDGA--------------------------------
A2SPZ5_METLZ/139-240SGTA...............WEMGYA.FAS.GK------R.VIALRTDF--------------------------------
L0HB91_METFS/144-245SGTA...............WEMGYA.FAK.GK------K.IVALRTDF--------------------------------
N4V4C4_COLOR/57-165K..S.....PISL......LELGLY.AAS.GK------I.VVCCPEGF--------------------------------
C3ZHY4_BRAFL/64-161...V.....TRGIA...AMVEVAYL.VGQ.GR------P.VILVVMGL--------------------------------
G9P4H0_HYPAI/21-126V..A.....PISL......LEFGLS.ARTPGK------V.VAVAPQGY--------------------------------
G2QVT9_THITE/23-127D..A.....PISL......LELGLC.ARA.GK------G.VVACHKEY--------------------------------
R0ILK1_SETT2/51-155K..S.....PVSL......LELGLW.AGS.DK------I.VVCCGEEY--------------------------------
G4NHQ6_MAGO7/32-137R..P.....SDGL......LELGEM.AGARRR------C.KVVCENGY--------------------------------
T1KY10_TETUR/147-237...Q.....TRSIA...SMIEVSFI.AAT.TK------K.LVLVIDLF--------------------------------
V6JDP9_STRNV/16-123...D.....LAALPGFTTNVEFGLD.IGT.GR------A.VLGCPPGC--------------------------------
T1FMG7_HELRO/415-504...D.....TRAMT...SMLEAGYF.IGK.KC------N.VILCIE.F--------------------------------
C7ZCF7_NECH7/13-117V..A.....PISL......LELGLA.VKS.GR------A.IVCVMDDY--------------------------------
M7UKY8_BOTF1/34-167VCSGKIGTGGTAL......VELGTALERKGQK------V.IVCVEKGF--------------------------------
G7YEE9_CLOSI/49-140..WR.....TRAIS...SFVEAASL.AGR.NA------R.VVFVISNT--------------------------------
T1IR01_STRMM/382-473...T.....CRSLS...TMAIAAHY.IGL.NC------K.VVLCIQYL--------------------------------
A9AZW5_HERA2/17-121Q..A.....PISL......LELGLF.ARS.GK------V.VVCCPEGF--------------------------------
A7IB55_METB6/144-245SGTA...............WEMGYA.SAL.GK------T.VIALRTDF--------------------------------
D0MXH6_PHYIT/72-162...L.....TRSIV...CINEAVEY.ICR.GR------K.VMLVVDDI--------------------------------
Q2FP85_METHJ/144-245SGTS...............WEIGYA.FGL.GK------K.IIALRTDF--------------------------------
E3S628_PYRTT/77-181R..S.....PVSL......LELGLW.AAS.DK------V.IVCCGPRY--------------------------------
I0GUV7_SELRL/54-159EGAC...............VELGIA.YGI.GK------R.CYGFKTDT--------------------------------
I4AQY7_FLELS/16-121Q..A.....PISL......LELGLF.ARN.KN------V.IVCCPTGY--------------------------------
R8BX59_TOGMI/36-142K..A.....PISL......MELGLS.TRRAGR------S.VVCCPEGY--------------------------------
E0VD46_PEDHC/263-353...T.....ARSIS...AMAIAGHY.IGR.GA------N.VVLCIQYL--------------------------------
G4V7S9_SCHMA/78-169..WR.....TRGLV...SLLEATYL.ASQ.KK------P.LVLCISKV--------------------------------
Q2GRH7_CHAGB/23-123D..A.....PISL......LELGLS.ARS.GK------A.IVACHRDY--------------------------------
S3CVC4_GLAL2/28-132S..A.....PISL......MEMGFA.LGMKKR------V.VVCCPEGY--------------------------------
C9SYP4_VERA1/23-124A..A.....PISL......LEFGLA.ARS.GK------V.IAACLESE--------------------------------
H1Z0K3_9EURY/139-240SGTA...............WEMGYA.YAK.GK------R.VISLRTDF--------------------------------
C7QF56_CATAD/15-121...D.....LRTLPGFTTNVEFGFV.AGS.GR------T.VLGCPPEC--------------------------------
Q4WMH8_ASPFU/20-125Q..A.....PISL......LELGLC.ARVPGK------A.LVVCPEGY--------------------------------
L0KW01_METHD/4-107SGTA...............WEIGYA.YAK.GK------K.LIGLRTDL--------------------------------
K1R891_CRAGI/151-241...R.....TRAVS...SMIETAYL.TAR.GR------Q.VITVMDDY--------------------------------
A6L9R1_PARD8/43-145K..S.....PITL......LEMGLF.MRS.GK------L.RVICEPGF--------------------------------
K4MDC8_9EURY/4-107SGTA...............WEMGYA.YAR.GK------K.VLGLKTDF--------------------------------
Q8TK51_METAC/4-106SGTA...............WEIGYA.YAK.GK------P.VIGLRTDF--------------------------------
T1IR01_STRMM/86-176...Q.....TRSVA...SVIEAAHI.AGC.QK------K.LILVVKEF--------------------------------
E4ZNI1_LEPMJ/22-126Q..T.....PITL......LELGLC.AGT.GK------A.IVCCPEGF--------------------------------
F7XKZ0_METZD/2-105SGTA...............WEVGYA.YSR.KV------P.VYGIRTDF--------------------------------
G9MES0_HYPVG/13-117L..A.....PISM......LELGMC.IRS..R------KVIVCAMPDY--------------------------------
K3WUG2_PYTUL/124-214...A.....TRAMV...CIIEAVEY.ICR.GR------R.VVLVVDDI--------------------------------
U7Q6W0_SPOS1/18-131D..G.....SVSL......LELGLC.AGRAAS------A.IVGCPPGY--------------------------------
B2AQB5_PODAN/21-125D..A.....PISL......LEFGLF.ARS.GK------L.IVCCHKDY--------------------------------
A8NV21_BRUMA/75-166...A.....TVNAT...SFLEIAHF.AARKAP------K.LVVVFLGQ--------------------------------
D6WAD7_TRICA/186-276...Q.....TRSTV...GMIEVAYL.VAS.GR------C.VVIVAHSY--------------------------------
E9EQF8_METRA/36-140L..A.....PVSL......LELGMH.ARS.GK------A.IACAMPGY--------------------------------
F2KPY9_ARCVS/3-103SGTA...............FELGYA.YAM.GK------P.IIGIKTDY--------------------------------
I1FY95_AMPQE/147-238...Q.....TRACS...SIVETAYL.IGRQEE------A.IVVVVNDF--------------------------------
H6L323_SAPGL/16-120Q..S.....PITL......MELGLF.GPK.KG------S.IVHCPKDF--------------------------------
R6SWJ3_9BACE/43-144K..S.....PITL......LELGLF.ARS.GK------V.YVVCTEGF--------------------------------
F2TZC5_SALR5/813-902...E.....TRAVG...SLVEAAYY.VGK.AR------R.AFLAVESM--------------------------------
D2V4M3_NAEGR/31-141L..C.....PITL......YELGKI.SMMPSV------KLFVGVHPDY--------------------------------
J1AN41_9EURY/138-239SGTA...............WEMGYA.YAR.GI------P.VVALRTDF--------------------------------

PF05014

Q74CV5_GEOSL/3-131IDSG-------------TAGEVGFA-SAL-GR......K-CYGLRTDIRD............-------...........
DNPH1_TETNG/3-110PSLG-------------VGYELGRA-VDM-KK......K-VLCL...FRP............-------...........
DNPH1_MOUSE/12-119PSLG-------------VGYELGRA-VAL-GK......P-ILCL...FRP............-------...........
Q3XZF0_ENTFC/3-117IDAG-------------VASEIGVA-YAK-GI......P-VIGLYTDTRQ............-------...........
Q831Y8_ENTFA/4-118IDAG-------------VASEIGVA-YAK-GI......P-VVALYTDSRQ............-------...........
Q037S4_LACC3/3-117IDNG-------------VASEIGVA-YAA-KI......P-ILGLYTDSRR............-------...........
Q38VK0_LACSS/3-117IDVG-------------VASEIGVA-YAR-NI......P-IVGLYTDSRQ............-------...........
Q5FMM8_LACAC/8-127EDVG-------------LGMELGYA-LSQ-GK......Y-ILLVIPDEDY............-------...........
Q38YB9_LACSS/5-123EDTG-------------TAFEVGYL-NAS-HT......P-IVFVCEDDLQ............-------...........
Q5FIN0_LACAC/10-130IDDG-------------SAFEIGFM-RAF-HK......P-VILVPFTNDP............-------...........
Q4K9G5_PSEF5/5-138PDSG-------------TAFEVGAA-VAL-GK......P-VWAYFEGPATLRRQVPHD....-------...........
C1DJ67_AZOVD/4-137PDSG-------------TVFEVGMA-VAL-GK......P-VWACFAPAGDLRAQVPHG....-------...........
Q2KTK9_BORA1/4-141PDSG-------------TAFEVGYA-VAL-GK......P-VWAYTDETHPLVQQVPGQRA..-------...........
Q0KDU3_CUPNH/46-184PDSG-------------TAFEVGFA-VAL-QK......P-VWAYSADAGTLRERVTVATD..-------...........
Q1LQW3_RALME/4-142PDSG-------------TAFEVGFA-VAL-EK......P-VWGYAADAGTLLDRVRVRTD..-------...........
Q47ET2_DECAR/3-138PDSG-------------TCVEVGFA-LAL-GK......R-VVGYLAAAETTTERVARLFGRE-------L..........
Q2RU71_RHORT/7-150MDPG-------------TAFEIGYA-AAL-GK......P-VVGYASNAGDYLTRVRAWAGGT-------L..........
A5FTP2_ACICJ/9-159ADNG-------------TAWEMGMA-YGL-GL......P-VFAYTSDLRTTREKISNWHCAP-------F..........
Q2W5R7_MAGSA/7-146ACPG-------------TTWEMGYA-EGL-GK......P-VVAWSEDMRPYMERVPHDRDA.-------...........
A1U4X5_MARHV/25-160ADPG-------------TVFEVGYM-IGQ-GK......A-AFGFTMDCRHYRERAGA.....-------...........
A9CG29_AGRFC/36-179ADTG-------------TSYELGFM-CAL-GK......P-VFAYTNVAANHFTRIKAHYSDV-------V..........
A4YQ35_BRASO/3-141ADAG-------------TVYELGYM-AGT-GK......L-CLGYCNDPTVYAERARRFTALS-------...........
Q89RW2_BRADU/3-141ADPG-------------TVYELGYM-AGR-RK......L-CLAYSNDGATYADRVGRFVDVT-------...........
Q21A75_RHOPB/3-141ADAG-------------TVYELGFM-AGH-GK......L-CLGYSNDPLPYPKRVAARGAVS-------...........
A5G297_ACICJ/7-142ADAG-------------TLVELGWF-LGR-RR......P-CFGYSNASTPFAARSRRQI...-------...........
Q0BQQ5_GRABC/21-153ADAG-------------TLVELGWF-GGK-GR......P-VYGYSNDAASFASRSYAHI...-------...........
A7IM74_XANP2/3-145ADPG-------------TAFEVGFA-FAL-GK......P-VAAYSNLPGELKHRAHSTIGVA-------G..........
B0T4X8_CAUSK/7-152CAAA-------------AAFEAGVL-AGL-GR......P-IMAYLNISDESEAEYVDRVEVH-------VG........A
Q9A6H7_CAUCR/7-151ADTA-------------TVFEAGVL-AGL-GK......P-TFAYMNVTSELRAEYVARVDAD-------LG........A
Q57VC7_TRYB2/4-128PDCG-------------TAFEVGYA-AAL-NK......M-VLTFTSDRRNMREKYGS.....-------...........
Q4QAY0_LEIMA/7-130PDCG-------------TAFELGYA-AAL-GK......L-LLTFTTDTRPMVEKYG......-------...........
Q4DGS2_TRYCC/4-128PDCG-------------TAFEVGYA-AAL-GK......T-VLTFTSDRRSMREKYGG.....-------...........
YQ65_SCHPO/20-174MDPG-------------TAVELGYM-AAQ-GK......P-LAGFTTDGRMYPEKVRSYRKQA-------WGDAL..KPRF
Q5FND5_GLUOX/8-164MDPG-------------TAVEIGYM-MGL-GK......P-MEAYTVDGRLYSEKVETYWRDV-------LKQDLRKREES
Q5NX98_AROAE/5-139PDSG-------------TAFECGLA-WSS-GI......P-VIGVCQDRRPMMLRIDPATHLC-------...........
Q7VB88_PROMA/6-120PDEG-------------VMIELGAA-IAL-GK......P-TFLFRDDFRR............-------...........
A5GSS0_SYNR3/13-127PDEG-------------VMVELGIA-IAL-HK......P-IFLFRDDFRV............-------...........
B5E901_GEOBB/16-144PDSG-------------TVAEVGFG-AGI-GK......R-CFGLRTDIRD............-------...........
Q7NFW9_GLOVI/18-124ADSG-------------TAFEVGYA-YAR-SK......P-VYALRSEM..A...........-------...........
Q6AQB0_DESPS/15-129IDDG-------------VAFELGYA-KAI-NK......V-CLGFQTDVRR............-------...........
Y063_UREPA/7-134TDDG-------------TMAEMGYF-VAL-QKHVKPTLK-IYILNTDWRVH...........-------...........
A5VK58_LACRD/9-128EDVG-------------MGVELGMA-RAL-GK......Y-IMVVIPDED.............-------...........
B2U7I3_RALPJ/5-137PDSG-------------TCFEIGYA-IAR-GK......E-VWCYNVPAVPLIGQVQNA....-------...........
Q04FG4_OENOB/4-122PDEG-------------IAWELGYA-YAI-HK......P-MVLVVPNEKN............-------...........
Q1G8M7_LACDA/7-128LDDG-------------CAFEIGFL-RAQ-NK......P-VIIVPFTNQP............-------...........
Q2K9H8_RHIEC/4-146ADPG-------------TVYEIGFM-IAL-GK......S-VFAYTNHPDDYGLRVRSIWYAG-------ME.........
Q46LL2_PROMT/6-120PDEG-------------VMVEIGVA-IAL-GK......T-TFLFRDDFRK............-------...........
Q9I6Y7_PSEAE/4-145PDSG-------------TAFEVGYA-LAL-GK......P-VYAYLSDAGAYAERLARLAPEW-------...........
Q9I6Y8_PSEAE/42-183PDSG-------------TAFEVGYA-TAL-GK......P-VYGYVDDAGSYAERIRRHAPEL-------...........
V6F0F5_9PROT/7-146ADAG-------------TAWEMGFA-EAL-GK......K-VFSWCEETRPYLERVEHQRDD.-------...........

PF14359

Q2NSU1_SODGM/3-92DSEG-------------ALAEFHLA-RKL-RL------Y-IRFQ------------------------------------
B2JD24_BURP8/3-94QSRG-------------APIERNLL-RDL-GL------P-VYRA------------------------------------
A5I2H3_CLOBH/3-91TSRG-------------ARAELEYA-KVT-GK------K-ILYQ------------------------------------
D9SWF2_CLOC7/7-95DSKG-------------ARMEYVYA-KKQ-GK------V-LMFE------------------------------------
C5CJN4_VARPS/4-95QSRG-------------ALVEHRLA-VDL-GL------L-VSGA------------------------------------
C8WLV1_EGGLE/6-97RSEG-------------AQLEAHVA-RSL-MM------P-VKTV------------------------------------
C4Z5Z6_EUBE2/3-89NSKG-------------TKKEIEYA-EST-GK------Q-VIYQ------------------------------------
C8WA55_ATOPD/35-125ASDG-------------ARLEHDVA-LAC-GI------H-VVDF------------------------------------
Q12J43_SHEDO/10-99DSNG-------------AKAEYALA-KKL-GL------L-IVYQ------------------------------------
D4IIW9_9BACT/4-96FSKG-------------ATLEKNLA-ELT-GK------T-IIYE------------------------------------
Q8NPR6_CORGL/6-107SSAG-------------ATLEHDIA-QKL-RL------A-ITYE------------------------------------
Q2NSN9_SODGM/3-92DSAG-------------ACAEVALA-KKL-GL------A-FRFQ------------------------------------
D4L1U8_9FIRM/28-119ESRG-------------AVLEFMQA-RRN-EM------Q-IYE.------------------------------------
Q8ECZ5_SHEON/4-92RSAG-------------ATAEYYYA-KKI-GL------K-IVF.------------------------------------

PF11071

D3FX91_BACPE/6-145-----------------SAMDAATA-IAL-QK------PLILIRPEKL-----------------------------HHP
U5LEP3_9BACI/6-145-----------------TSMDASTA-LAL-KK------PLILIRPEKL-----------------------------HHP
B8BWK8_THAPS/26-165-----------------AAFDAGYA-AAL-GK------SIITLHPPNI-----------------------------SHM
Q5WEA2_BACSK/6-145-----------------TAMDAATA-IEA-GK------PLILIRPEKL-----------------------------HHA
Q1GL75_RUEST/6-143-----------------AAFDAGYA-AAL-GK------SIIVLSQPDH-----------------------------QHA
K0J0D1_AMPXN/6-145-----------------TAMDVTRA-ISL-NK------PTIIIRPESL-----------------------------IHP
A8FGC3_BACP2/6-145-----------------TAMDASAA-IAK-GK------PLILIRPKEL-----------------------------HHP
I0JPU7_HALH3/6-145-----------------TAMDASAA-IQL-RK------PLILIRPKSL-----------------------------IHP
F2F8P8_SOLSS/6-145-----------------TAMDVSTA-IAL-NK------PTIIIRPESL-----------------------------IHP
J9Z0F9_9PROT/5-144-----------------AAFDAGYA-AAL-KK------SIIVIHSDDH-----------------------------QHA
V4J0N1_9DELT/6-144-----------------AAFDAGYC-AAL-GT------PYITLHGENI-----------------------------IHP
G8PSA2_PSEUV/7-146-----------------AAFDAGFA-SAL-GK------SIIVLHDPAL-----------------------------THP
Q8EP80_OCEIH/6-145-----------------TAMDASIA-LTL-GK------PTIIVRPESL-----------------------------IHP
H2FX43_OCESG/9-148-----------------AAFDAGFA-VAS-GV------PIITLHDAEH-----------------------------DHP
K7AD99_9ALTE/7-145-----------------AAFDAGYC-AAL-GK------TYITLHNENI-----------------------------IHP
A1U6Z6_MARHV/6-144-----------------AAFDAGYC-AAM-GT------PYITLHDEDI-----------------------------VHP
B1VFR0_CORU7/6-144-----------------AAFDAGYC-AAL-DK------PYVTLHGDDI-----------------------------VHP
U4K8X0_9VIBR/6-144-----------------AAFDAGYC-AAH-GK------PYITLHDEAL-----------------------------IHP
E6U185_BACCJ/6-145-----------------SAMDAATA-IAK-NK------PLILIRPETL-----------------------------HHP
D3FC17_CONWI/9-148-----------------AAFDAGYA-AAL-GK------PLITLHPEQH-----------------------------DHA
D5BQ04_PUNMI/6-143-----------------AAFDAGYA-AAL-GK------SLIILHGAEH-----------------------------QHA
D5DE71_BACMD/6-145-----------------SAMDAATA-IAL-DK------PLILVRPEKL-----------------------------HHP
Q4FSH8_PSYA2/6-144-----------------AAFDAGYC-AAL-GK------PYITLHAEDI-----------------------------IHP
M5DS25_9GAMM/6-145-----------------AAFDAGYA-AAL-GK------SLIVQHDPAL-----------------------------THP
G4T0P2_META2/6-145-----------------AAFDAGLA-IGM-GI------PIVVMHDPEL-----------------------------THA
Q0VTM0_ALCBS/7-146-----------------AAFDAGYT-AAL-GT------PMIILHDEEH-----------------------------DHP
E0TC70_PARBH/7-146-----------------AAFDAGVA-AAL-GK------PLIVNHGPDL-----------------------------IHP
Q31G06_THICR/6-144-----------------AAFDAGYC-AAL-GT------PYITLHDEDI-----------------------------IHP
L0F1C2_DESDL/6-146-----------------TAMDASTA-LAL-NK------PLIIIRPEAL-----------------------------HHP
Q47W56_COLP3/6-144-----------------AAFDAGYC-AAL-DK------PYITLHSEEL-----------------------------IHP
F2I1N1_PELSM/5-144-----------------AAFDAGYA-SAL-NK------SIIVIHNDDH-----------------------------QHA
Q9K7V4_BACHD/6-145-----------------TTMDAASA-LAL-QK------PLILIRPKEL-----------------------------HHP
D6XSI6_BACIE/6-145-----------------SAMDASAA-VTL-GK------PLILIRPKNL-----------------------------HHP

PF09152

A8GFA5_SERP5/2-112NSAG-------------IKREIEFY-QSR-NQ------R-VSLWSE----------------------------------
A7ILK0_XANP2/11-118DSIG-------------MKMEREAF-ARM-GK------P-VVEMEM----------------------------------
Q4KJD5_PSEF5/2-112DSGG-------------IKREIEVF-ETS-GR------R-VSLWSQ----------------------------------
Q3IVN8_RHOS4/48-169RSLG-------------IWHEVRAA-LAR-QT------S-VFVYAE----------------------------------
Q3IW66_RHOS4/60-180QSTG-------------IRHEVASA-LTA-QV------P-VFIYG.----------------------------------
Q9I3M0_PSEAE/2-112DSAG-------------IRREMEFF-EAG-GQ------R-VSLWSE----------------------------------

PF02267

F6QEE7_MACMU/57-297TACG-----VVHVMLNGSRSK.IFDKNSTFGS------VEVHNLQPEKVQALEAWVIHGGRE..DS...RDLCQDPTIKE
H2PCY6_PONAB/41-280DSSG-----VIHIMLNGSEPTGAYPIKGFFAD------YEIPNLQKEKITRIEIWVMHEIGG..PN...VESCGEGSMKV
G3NMH1_GASAC/2-226AACG-----DVTVMLNGAVAT.PFYNKSVFAT------IEVPRFRSPKVRSLKVVLVTQENS.......LTSCENESLKD
F6WMZ1_ORNAN/53-298AACG-----VVHVMLNGSLGRDAFKNNSIFGS------VEALHLDPKKVHSVQIWVMHNIGG..PA...NDSCKGSSVNY
CD38_RABIT/53-294SACG-----TVYVMLNGSRTT.AFSKASTFGS------VEVFNLHPDRVHTLHAWVMHDIGG..VE...RDSCLGSSIKE
I3JGM5_ORENI/40-267VACG-----NVTAMLNGSINT.PFNPTSIFAS------VEVPRFIASRVKNLNVVMVIQKNN.......ISNCTDPSLKN
M4A1C9_XIPMA/3-246MACG-----NITVLLNGSITN.AFNRKSMFGS------VELDSLNPQRVNYVNIKVVTSPEG..PH...IESCSQGSIVE
A0A0D2X2X5_CAPO3/27-255QATG-----RVSVLLGSPYGGSAYRNSSFFAL------YELPNMNTSLVTAIDVYVITNG.........TERCGSGSLVA
T1FV69_HELRO/36-278KVRG-----TVHLMLNASSPA.AFRENSIFAT------HELPNLNRANTPRLFVHMVSNLGS..TP...VEECVTGSVAR
H2UBF5_TAKRU/48-277AACG-----DATVMLNGNIAT.PFDNSSVFGS------VEVPKLNSAKVRKLTVVLV..TAT..TP...VSDCSNESLNE
F6ZFL7_MONDO/56-295AACG-----VVYVMLNGSISQ.PFRNSSIFGS------VEIHHLNPEKVPLVKIWVMHNIEE..QS...SDSCSDSSIKD
W5KGC3_ASTMX/46-287AACG-----NITVLLNGSIHN.AFNRKSMFGS------VELDNLNPRMVSHVHIKVVPNLEG..PF...VESCSKGSILD
G7YGU8_CLOSI/32-273LVEG-----DVGLLLNGSLVT.PYDKNRTFGS------SELPNLYYPRVKKLTAYLAYNLEE..EDVRPNAGCNSESLLN
W5MUD4_LEPOC/54-285SACG-----NVTAMLNGSIDK.PFSAKSIFGS------VEIKKFNPMKINYVNVVLI..GRE..NY...PMSCKNDSLQE
H2S9L5_TAKRU/26-267MACG-----NVTVLLNGSVVD.AFNRESMFGS------VELDSLDPCRVDHVNIKVLTDRDG..PF...MESCSRGSVLD
F1PKL7_CANFA/63-304DACG-----VVHVVLNGSISN.TFDEKSTFGR------VEVFNLHPEKVHTLKAWVMHNIES..VP...SDSCSSSSVNN
E1C8Y0_CHICK/57-298AACG-----VVHVMLNGSIEAGAFRTSSVFGS------VEIFNLNPDKVSEIRIWLMNDIGG..PQ...SDSCSGYSIKK
G3U406_LOXAF/31-277DSSG-----VIYVMLNGSDPKGAYPVRGFFAD------YEIPNFQKDKITRFEIWVMHEIGG..PN...VESCGEGSVKI
G1L422_AILME/37-297DSSG-----VIHVMLNGSEPAGAYPDKGFFAD------FEIPYFQKDKITRIEVWVMHDIGR..PK...VDSCGEGSVKT
G7YGU9_CLOSI/32-273LVEG-----DVGLFLNGSFAT.PYDRNRTFGS------SELPNLNFPRVTKLTTYLVYPLEE..VEFRPRVGCNSENLMT
F6XI43_XENTR/38-277HSSG-----EIQIMLNGSTLGGAFPVPSFLAD------FEIPNFQRDRVSNISIMVMDEIGG..PD...IDSCGKNSIAV
G1PDG1_MYOLU/63-304NACG-----VVQVVLNGSISN.TFDKNSTFGR------VEIHNLHPEKVSRLQAWVMHDIGG..VR...SHSCSSPLIND
H0WV24_OTOGA/63-304AACG-----VVQVVLNGSVSN.TFDRNSTFGS------VEIFHLNPEKVHTLQAWVMHDVGG..GP...SESCQRPPLSD
B3RIX9_TRIAD/24-272SASG-----LVRVLLTSDNKTPAFNNQSIFGS------IELPNLSPQKVSKVEIMVMHGLNSKPNQ...IDRCGIGSIKE
W5KGB4_ASTMX/49-278TACG-----NVSAMLNGSLES.PFSTTSVFGS------VEVKNLDPDKVDSLTVLLV..AKE..TD...PSTCESPSFQD
I3NBZ0_SPETR/34-275DSSG-----VIYVMLNGSEPTGAYPVKGFFAD------FEIPYLQKDKITRIEIWVMHEIGG..TN...VESCGEGSVKI
B3RIY0_TRIAD/24-258GSSG-----TVRVLLNSSRIP.AFAPYSFFAR------YELPNLSPSKVNKIEIIVVHDLDMKVNQ...SERCGAGSIKT
H0ZHK5_TAEGU/57-298AACG-----VVQVMLNGSVEAGAFRSSSIFGS------IEIFNLDPDKVSEVHIWLMQNIGG..PQ...SESCSGQSIQR
CD38_MOUSE/59-300DACG-----VVQVMLNGSLRE.PFYKNSTFGS------VEVFSLDPNKVHKLQAWVMHDIEG..AS...SNACSSSSLNE
G3VL69_SARHA/73-312DSSG-----VIHVMLNGSEPTGAYPVKGFFAD------YEIPNFQKDKVTRFEIWVMHDIGG..PY...LESCGEGSMKI
G3NMG7_GASAC/25-263MACG-----NITVLLNGSISN.AFNRESMFGS------VELDGLDPCRVDYVNIKVVTNLEG..PF...TESCSKGSIAD
F6ZFG5_MONDO/39-279DSSG-----VIYVMLNGSEPSGAYPVKGFFAD------YEIPNFQKDKVTRFVIWVMHEIGQ..PH...IESCGEGSMKI
W4ZBI8_STRPU/28-287QAVG-----DVYVVLNAQRAGGAFNNGSIFAT------IEAPNLNQDVVTNVAIYLIPDFTLPIPNEMYRETCTNGSVLY
F6WHT8_XENTR/55-295ASCG-----VVNVMLNGSADGGVARKESILRT------VEVPSMNVNAVSEVRLWIMDNLEG..PD...KNSCNTESVLE
I3M660_SPETR/62-303AACG-----VVQVMLNGSLTE.PFDKNSIFGS------VEIFNLRPEKVHTVQVWVMQDIGK..GP...SDSCSGSSLNE
BST1_MOUSE/35-273DSSG-----VINVMLNGSEPKGAYPTRGFFAD------FEIPYLQKDKVTRIEIWVMHDVGG..PN...VESCGEGSVKI
U3IER2_ANAPL/39-280HSSG-----VIHVLLNGSAEGGAYPVKGFFAD------YEIPNLQKDKISKIVIWVVDDIQG..PD...RDSCGKNTVKI

PF15891

T1IEI4_RHOPR/4-94-------------------------------------
X2J5A2_DROME/193-284-------------------------------------
R0I588_SETT2/52-156-------------------------------------
H9JE69_BOMMO/75-165-------------------------------------
G3JGW9_CORMM/20-125-------------------------------------
Q93174_CAEEL/75-166-------------------------------------
H1UV03_COLHI/23-124-------------------------------------
G8XAS8_FLACA/18-121-------------------------------------
R0KPG9_SETT2/22-127-------------------------------------
M2SPH0_COCSN/22-128-------------------------------------
B3RNW2_TRIAD/383-473-------------------------------------
X1WIH3_ACYPI/191-281-------------------------------------
G4UZT0_NEUT9/26-130-------------------------------------
A9FNG6_SORC5/15-119-------------------------------------
F2TZC5_SALR5/498-589-------------------------------------
G2PI08_STRVO/16-123-------------------------------------
G2QGY7_THIHA/19-130-------------------------------------
A0A0D2XJJ8_FUSO4/20-126-------------------------------------
H3GTN6_PHYRM/285-389-------------------------------------
E4ZGB9_LEPMJ/74-178-------------------------------------
G0RX56_HYPJQ/19-123-------------------------------------
S3CPA1_OPHP1/16-127-------------------------------------
B2VZJ4_PYRTR/54-158-------------------------------------
E6XC92_CELAD/16-114-------------------------------------
A0A0C4ECV9_MAGP6/43-148-------------------------------------
Q12WB5_METBU/4-107-------------------------------------
Q0UL03_PHANO/21-123-------------------------------------
B7P1W0_IXOSC/23-113-------------------------------------
A3CYE1_METMJ/140-241-------------------------------------
R1ERD8_BOTPV/31-135-------------------------------------
D7E641_METEZ/4-106-------------------------------------
D5E7K8_METMS/3-106-------------------------------------
V4II58_9ACTN/15-116-------------------------------------
E0VD46_PEDHC/3-94-------------------------------------
Q24ZT6_DESHY/231-331-------------------------------------
E3RE45_PYRTT/24-128-------------------------------------
T1FMG7_HELRO/145-235-------------------------------------
C3ZHY4_BRAFL/353-443-------------------------------------
W4YFJ1_STRPU/135-225-------------------------------------
D3PWT7_STANL/21-126-------------------------------------
F4W7J2_ACREC/24-115-------------------------------------
K1R891_CRAGI/425-516-------------------------------------
Q0UX75_PHANO/110-214-------------------------------------
R5LK94_9MOLU/14-117-------------------------------------
E1REK1_METP4/142-243-------------------------------------
D1A6W5_THECD/19-124-------------------------------------
D6WAD7_TRICA/459-558-------------------------------------
R6SVN4_9CLOT/14-118-------------------------------------
A2SPZ5_METLZ/139-240-------------------------------------
L0HB91_METFS/144-245-------------------------------------
N4V4C4_COLOR/57-165-------------------------------------
C3ZHY4_BRAFL/64-161-------------------------------------
G9P4H0_HYPAI/21-126-------------------------------------
G2QVT9_THITE/23-127-------------------------------------
R0ILK1_SETT2/51-155-------------------------------------
G4NHQ6_MAGO7/32-137-------------------------------------
T1KY10_TETUR/147-237-------------------------------------
V6JDP9_STRNV/16-123-------------------------------------
T1FMG7_HELRO/415-504-------------------------------------
C7ZCF7_NECH7/13-117-------------------------------------
M7UKY8_BOTF1/34-167-------------------------------------
G7YEE9_CLOSI/49-140-------------------------------------
T1IR01_STRMM/382-473-------------------------------------
A9AZW5_HERA2/17-121-------------------------------------
A7IB55_METB6/144-245-------------------------------------
D0MXH6_PHYIT/72-162-------------------------------------
Q2FP85_METHJ/144-245-------------------------------------
E3S628_PYRTT/77-181-------------------------------------
I0GUV7_SELRL/54-159-------------------------------------
I4AQY7_FLELS/16-121-------------------------------------
R8BX59_TOGMI/36-142-------------------------------------
E0VD46_PEDHC/263-353-------------------------------------
G4V7S9_SCHMA/78-169-------------------------------------
Q2GRH7_CHAGB/23-123-------------------------------------
S3CVC4_GLAL2/28-132-------------------------------------
C9SYP4_VERA1/23-124-------------------------------------
H1Z0K3_9EURY/139-240-------------------------------------
C7QF56_CATAD/15-121-------------------------------------
Q4WMH8_ASPFU/20-125-------------------------------------
L0KW01_METHD/4-107-------------------------------------
K1R891_CRAGI/151-241-------------------------------------
A6L9R1_PARD8/43-145-------------------------------------
K4MDC8_9EURY/4-107-------------------------------------
Q8TK51_METAC/4-106-------------------------------------
T1IR01_STRMM/86-176-------------------------------------
E4ZNI1_LEPMJ/22-126-------------------------------------
F7XKZ0_METZD/2-105-------------------------------------
G9MES0_HYPVG/13-117-------------------------------------
K3WUG2_PYTUL/124-214-------------------------------------
U7Q6W0_SPOS1/18-131-------------------------------------
B2AQB5_PODAN/21-125-------------------------------------
A8NV21_BRUMA/75-166-------------------------------------
D6WAD7_TRICA/186-276-------------------------------------
E9EQF8_METRA/36-140-------------------------------------
F2KPY9_ARCVS/3-103-------------------------------------
I1FY95_AMPQE/147-238-------------------------------------
H6L323_SAPGL/16-120-------------------------------------
R6SWJ3_9BACE/43-144-------------------------------------
F2TZC5_SALR5/813-902-------------------------------------
D2V4M3_NAEGR/31-141-------------------------------------
J1AN41_9EURY/138-239-------------------------------------

PF05014

Q74CV5_GEOSL/3-131..............CGDFVGIPINLQ-----------
DNPH1_TETNG/3-110.................SSGRRLSAM-----------
DNPH1_MOUSE/12-119.................QSGRVLSAM-----------
Q3XZF0_ENTFC/3-117..............QGGTHPKKIAAL-----------
Q831Y8_ENTFA/4-118..............QGADNHQKLDAL-----------
Q037S4_LACC3/3-117..............LGAANQQKLGAL-----------
Q38VK0_LACSS/3-117..............QGATNSQKVAAL-----------
Q5FMM8_LACAC/8-127...................GKPINLM-----------
Q38YB9_LACSS/5-123...................ENPINLM-----------
Q5FIN0_LACAC/10-130.................NKEKKMNLM-----------
Q4K9G5_PSEF5/5-138.....HAGRDAQGFAVEDFNLPRNLM-----------
C1DJ67_AZOVD/4-137.....ADGRDARGWLVEDFGLPRNLM-----------
Q2KTK9_BORA1/4-141...ADGRWVDAQGYTVEDFGLPLNLM-----------
Q0KDU3_CUPNH/46-184...EDGAPLDARGFVVEDFGLGKNLM-----------
Q1LQW3_RALME/4-142...ADGNARDARGYVVEDFGLSMNLM-----------
Q47ET2_DECAR/3-138.EVHDGRPVDHDGMFVEDFGLALNLM-----------
Q2RU71_RHORT/7-150.RRDGGRWRDGQGWEVEDFGLSDNLM-----------
A5FTP2_ACICJ/9-159.SVQDGITRDRDGMMVEDFGEVDNLM-----------
Q2W5R7_MAGSA/7-146...DGRLFCRQHGMLVEDFGLVENLM-----------
A1U4X5_MARHV/25-160......ADRDELGHSIEDFEMSDNLM-----------
A9CG29_AGRFC/36-179ALDETGRYRGPDGLSIENFDMVDNLM-----------
A4YQ35_BRASO/3-141..EQDDRLVDAEGLTVEDFGLPDNLM-----------
Q89RW2_BRADU/3-141..SEDGRLVDAQGLTVEDFGLVDNLM-----------
Q21A75_RHOPB/3-141..ARDGVLRDAHGHVVEDFGLADNLM-----------
A5G297_ACICJ/7-142....AALPDPVSDIAVEDFGLGDNLM-----------
Q0BQQ5_GRABC/21-153....ARCPDPVAGMEVEDFGLPDNLM-----------
A7IM74_XANP2/3-145.DAEAVPTLLADGLHVEDFGHFDNLM-----------
B0T4X8_CAUSK/7-152QRDELGIWRDGDGCVVEDFGLPETVM-----------
Q9A6H7_CAUCR/7-151ILDENRVWRDPDGCMIEDHGLPETVM-----------
Q57VC7_TRYB2/4-128.......EVDKDNLRVEGFGLPFNLM-----------
Q4QAY0_LEIMA/7-130.......GEMAEGLSVENFGLPFNLM-----------
Q4DGS2_TRYCC/4-128.......AFDASGRTVEDFGLPFNLM-----------
YQ65_SCHPO/20-174TKGGSGSMEDADGLIVHSEGFLQNVM-----------
Q5FND5_GLUOX/8-164DAPSSGSMEDPDGMLVHSEGLLQNGM-----------
Q5NX98_AROAE/5-139..NEDGLLTCSDGAVIENFGFPVNLM-----------
Q7VB88_PROMA/6-120..............CSDSEEYPLNLM-----------
A5GSS0_SYNR3/13-127..............CSDSEDYPLNLM-----------
B5E901_GEOBB/16-144..............CGDLPGLPLNLQ-----------
Q7NFW9_GLOVI/18-124.............YGYPDRALYPNLM-----------
Q6AQB0_DESPS/15-129.................QAPTGNNPM-----------
Y063_UREPA/7-134............KHRNEVLNKFLDGM-----------
A5VK58_LACRD/9-128..................FGKPINLM-----------
B2U7I3_RALPJ/5-137......NGNDADGWAVEDFGLPRNLM-----------
Q04FG4_OENOB/4-122....................KPVNLM-----------
Q1G8M7_LACDA/7-128.................EKKPIMNLM-----------
Q2K9H8_RHIEC/4-146IDETSGRPRGPDGIAIENHGMADNLM-----------
Q46LL2_PROMT/6-120..............CSDSNEYPLNLM-----------
Q9I6Y7_PSEAE/4-145..LGEHPGEDRDGWQLEGFGLPLNLM-----------
Q9I6Y8_PSEAE/42-183..IGEDPTRDRDGMTLEEFGLPLNLM-----------
V6F0F5_9PROT/7-146...DGRCFCQQHGMIVEDFGLVDNLM-----------

PF14359

Q2NSU1_SODGM/3-92-------------------------------------
B2JD24_BURP8/3-94-------------------------------------
A5I2H3_CLOBH/3-91-------------------------------------
D9SWF2_CLOC7/7-95-------------------------------------
C5CJN4_VARPS/4-95-------------------------------------
C8WLV1_EGGLE/6-97-------------------------------------
C4Z5Z6_EUBE2/3-89-------------------------------------
C8WA55_ATOPD/35-125-------------------------------------
Q12J43_SHEDO/10-99-------------------------------------
D4IIW9_9BACT/4-96-------------------------------------
Q8NPR6_CORGL/6-107-------------------------------------
Q2NSN9_SODGM/3-92-------------------------------------
D4L1U8_9FIRM/28-119-------------------------------------
Q8ECZ5_SHEON/4-92-------------------------------------

PF11071

D3FX91_BACPE/6-145LKELANKAQVVVETPEQAIQALSYVF-----------
U5LEP3_9BACI/6-145LKELSQKANATVETVNQAIKILSYVF-----------
B8BWK8_THAPS/26-165LKEVNASASVVCEDAEQVVDTLAYVI-----------
Q5WEA2_BACSK/6-145LKELSNKAQVVVETPAQAIAALSYVF-----------
Q1GL75_RUEST/6-143LKEVHAAALAVADEPRQVVEILTYVL-----------
K0J0D1_AMPXN/6-145LKELSNKANVTVETIEQALDVLAYVY-----------
A8FGC3_BACP2/6-145LKELSNKANITVETVNQAIKALSYVF-----------
I0JPU7_HALH3/6-145LKELSNQADVTVETIDQALAVLSYIY-----------
F2F8P8_SOLSS/6-145LKELSNKANVTVETVDQAIEVIRYIF-----------
J9Z0F9_9PROT/5-144LKEVDAAASAVASNNEQVVRILKYVL-----------
V4J0N1_9DELT/6-144LKEVDAAAMAWATTTEQVIEILAYLL-----------
G8PSA2_PSEUV/7-146LKEVDAAALAVAEDPDQVVDLLRYVI-----------
Q8EP80_OCEIH/6-145LKEISNKANVTVETVEQALEVIAYIY-----------
H2FX43_OCESG/9-148LKEVDEAAKATCRHPEQVVEILAYLM-----------
K7AD99_9ALTE/7-145LKEVDAAAMAWAQTPEDVVTLLHYVI-----------
A1U6Z6_MARHV/6-144LKEVDAAAMAWAKTPGQVVELLKYVT-----------
B1VFR0_CORU7/6-144LKEVDAAAQAWCTTTDQVVEILRYVL-----------
U4K8X0_9VIBR/6-144LKEVDASAQAWATSPSQVVEILTYLL-----------
E6U185_BACCJ/6-145LKEISEKAQVTVETVDQALKALSYIF-----------
D3FC17_CONWI/9-148LKEVDRAALAVAREPEQVVDVLRYVL-----------
D5BQ04_PUNMI/6-143LKEVDAAALAVAENPKAVADILRYVL-----------
D5DE71_BACMD/6-145LKELSNKAQVVVETPEQALQALAYIF-----------
Q4FSH8_PSYA2/6-144LKEVDAAARAWAQTPEQVVELLKYVT-----------
M5DS25_9GAMM/6-145LKEVDAAAMAVCETPQQIVEILSYIS-----------
G4T0P2_META2/6-145LKEIDAAALAVTQDSLQVIEILKYIS-----------
Q0VTM0_ALCBS/7-146LKEVDAAADAVARTPEQVVEMLAYIL-----------
E0TC70_PARBH/7-146LKEVDAAALAVAETSDQIVEILDYVI-----------
Q31G06_THICR/6-144LKEVDAAALAWATTPEQVVEILKYVV-----------
L0F1C2_DESDL/6-146IKELSQKANVTVESIDQAIKVISYIF-----------
Q47W56_COLP3/6-144LKEVDASAQAWATSVEKVITTLKYIS-----------
F2I1N1_PELSM/5-144LKEVDASAAAVAKDQNQAFRILKYIL-----------
Q9K7V4_BACHD/6-145LKELANKAQVVVETPDQALQALKYII-----------
D6XSI6_BACIE/6-145LKELSERAQVTVETAEQAVKCLAYLF-----------

PF09152

A8GFA5_SERP5/2-112-------------------------------------
A7ILK0_XANP2/11-118-------------------------------------
Q4KJD5_PSEF5/2-112-------------------------------------
Q3IVN8_RHOS4/48-169-------------------------------------
Q3IW66_RHOS4/60-180-------------------------------------
Q9I3M0_PSEAE/2-112-------------------------------------

PF02267

F6QEE7_MACMU/57-297LESIISKR.NIRFFCKNIY.RPDKFLQCVKNPEDSSC
H2PCY6_PONAB/41-280LEKRLKDM.GFQYSCINDY.RPVKLLQCVDHSTHPDC
G3NMH1_GASAC/2-226LQRKLDG..GITYSCKAV..PEAQINDCSSHPEKP..
F6WMZ1_ORNAN/53-298LKSILEKR.NIKSFCEDNY.RPVKFIQCAENPDHRDC
CD38_RABIT/53-294LKSIVNQR.NISFFCQDDY.RPARFVQCVRHPEHPSC
I3JGM5_ORENI/40-267LRQSIDT..GITFSCKDV..SESRIQECGS.......
M4A1C9_XIPMA/3-246LIQILWSR.GFRWTCTDSD.LTLVILQCIQDLNQPSC
A0A0D2X2X5_CAPO3/27-255LVQDIKHHLGLTPSCYDNP.DMVRFILCENN......
T1FV69_HELRO/36-278LKELVEKK.GMAFHCDLNN.RSIRHFQCVDAADHKGC
H2UBF5_TAKRU/48-277LRQKLDS..KIGYECK.....ENKILKCVKSALKHLC
F6ZFL7_MONDO/56-295LKSIIEGR.NIAFSCENDH.RDVQFIQCVRNPEQKAC
W5KGC3_ASTMX/46-287LINVLESR.GFRWSCTDRDNRTLMILQCMKNPRQSSC
G7YGU8_CLOSI/32-273LKADVLRK.NITYVCTEQP.AFVFHYLCAANPTNKRC
W5MUD4_LEPOC/54-285LEKTLIP..KFKYTCTTV..LLSTILKCLEDPQKP..
H2S9L5_TAKRU/26-267LLEILRTR.GFRWTCADND.RTQMILQWIWNSEQSSC
F1PKL7_CANFA/63-304LKQILKTR.NIIFICQNNY.RPVRLLQCVKNPEHSSC
E1C8Y0_CHICK/57-298LRNILEER.NFKITCEDNY.RPVQLLQCVHNPDHPDC
G3U406_LOXAF/31-277LEERLKEM.GFQYSCINDH.LPVKLLQCVDHSTHPDC
G1L422_AILME/37-297LEDRLRKM.GFQYSCINDH.PPVKLLQCVDHSTHPDC
G7YGU9_CLOSI/32-273LKVDVQKK.NISYECIEQP.AFALHYLCASNPTSKQC
F6XI43_XENTR/38-277LETILASR.NFPFKCFDNY.RPVRLLQCVDSPNHPEC
G1PDG1_MYOLU/63-304LKFILSQR.KISFTCQDDY.RPIKFLQCVKNPDHSSC
H0WV24_OTOGA/63-304LKLIISKR.NMTFICHDNY.RVIRFIQCVQNPEHASC
B3RIX9_TRIAD/24-272LQNILTSH.NFTWSCQDNP.KSVLHHLCTKNPNNFHC
W5KGB4_ASTMX/49-278LKSTLNP..NIAYNCRQV..PYNRVEGCISD......
I3NBZ0_SPETR/34-275LEERLQSM.GFRSSCLDDY.LPVKLLKCVDHSTHSDC
B3RIY0_TRIAD/24-258LQDLIQQR.NIAWSCSDNP.SSVQDILCAANPTHFQC
H0ZHK5_TAEGU/57-298LISILEER.NFKIICEDNY.RPVQLLQCVHNPDHRDC
CD38_MOUSE/59-300LKMIVQKR.NMIFACVDNY.RPARFLQCVKNPEHPSC
G3VL69_SARHA/73-312LENRLKNM.EYKYECINNY.RSVKFLQCLDHTAHSDC
G3NMG7_GASAC/25-263LIQVLRSR.GFRWTCTHND.ETLMILQCVQNPEQSSC
F6ZFG5_MONDO/39-279LENRLKEM.EFKYECINDY.RPVKLLKCLDYSTHPEC
W4ZBI8_STRPU/28-287LQNFLMNM.NFNVTCEENP.KEIMWLQCARFANSPYC
F6WHT8_XENTR/55-295LKAYIEQH.NLAFSCVDNY.KPVQLLQCIETPDLPAC
I3M660_SPETR/62-303LKLIVNKR.NMTFVCQNNY.RPARFVQCVKNPEHPSC
BST1_MOUSE/35-273LEDRLEAL.GFQHSCINDY.RPVKFLMCVDHSTHPDC
U3IER2_ANAPL/39-280LEDRLKAL.GYDVTCTDNY.KPVLFLLCVDYPDDSNC

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window