Sequence alignment for CL0499

PF13425

R7NHG5_9MOLU/1-433MKK.RRLLEIFLL-TLPLLDL.......LTSLNNRM-----VENFLSVG-MIIK-----------GLAIIIAYIYVFFLS
Q81UH9_BACAN/9-459ANYFPHFLLLFIV-FQPILDL.......LTSFSIYV-----LHMSATVG-IVVR-----------FAFMLLALGYLLLHH
Q81JN2_BACAN/8-466SNKFENFLLIFIL-LQPILDL.......LTAFCIMV-----LKIDTTIG-VITR-----------LFVMFLGGIYILIQT
R7L2W3_9CLOT/8-429IYSSKVVQAIFII-L.PFVEF.......ITSYMVLN-----VDFPITLG-VIYK-----------TLFLIYGLGYLIFVD
I0JRN9_HALH3/7-475KDFYTKLLLLFII-FQPVLDI.......LTFLSIRW-----TDSSLTIG-IVVR-----------VLFMALSLWFILFGN
R5AA62_9CLOT/11-484SFSVGEVMTALLV-VQPLLDV.......LSYFMGLA-----GGTVFT..-TTLR-----------MLLLLAVCLYGFIIT
R5IY38_9CLOT/8-472TNNLINFFCIFVI-IQPIFDV.......LIYLLREV-----AQVNSNLI-SLIR-----------PFLATIIYFGLLISN
Q1G8D3_LACDA/2-497KEKTKSLLYWFIL-LQPFLDLDFFYRGKLATI....-----..LPFTIP-TIIR-----------IAGVIVLVGLLVWGQ
R6GEF5_9FIRM/3-434KEKKIILLNWYII-LQPIIDI.......LTSLGVRY-----GSDSITLG-VAIR-----------AVFVGIMAFYVMFIY
R5JB95_9FIRM/7-482ERFLKKILLIFLC-IQPILDCYILYTDEVINF....-----..FHFSPT-TILR-----------MLIIAFLFCSLFFNK
R6GWD7_9FIRM/3-437KFYNNRILTKFML-IQPLIDI.......ITSLMINE-----YNFHISLG-MICR-----------FIFLIYAGIYIIKNR
R5PWW6_9CLOT/19-494IFTMENLLCLLII-ICPILDV.......SSFIFRNF-----FNTNFSIS-TFVR-----------PIIPIVAITYIFFKD
R5Z3Y2_9MOLU/8-506NNILLKILTIFVL-LQPFLDTYILFDASFTGE....-----..IGFSPS-TLIR-----------YLFIMVLAILFVFTI
R6YI35_9FIRM/11-484SFPVGEVMAALLV-AQPLLDV.......LSYFMGQA-----DATWLT..-TALR-----------TVLLFAVGVYGFSIT
R7HK69_9FIRM/6-439NKKIANIFYVFLL-IQPILDL.......LTSLMTRF-----AGLPLTIG-MIVR-----------GLFLFGMIIYLVFIN
R6AIT2_9CLOT/1-436MMKHSRKLETYFL-LLPFLDM.......ITALLTRN-----TSLSVTPG-IIIK-----------SIFLLFMVLY.IFKT
Q74HR3_LACJO/2-501KKRLQTFLFWFIL-IQPFLDIYWLSRPPL.......-----..LKFSIP-TILR-----------VLGVFIAIILFFSIK
R5N8H6_9CLOT/21-493RSLIIDIICVSVI-LNPIFDI.......LSFIFRNY-----FETNISIS-TFLR-----------PVIPVGCAIYFFIKS
R6XB97_9CLOT/19-487YFTIENILCVFII-ICPILDI.......ASFLFRQY-----FNTNISIS-TFIR-----------PIIPIIAVIYIFFKD
R6BI42_9CLOT/16-491IITIENLLCFLII-ICPILDA.......ASFLFRNY-----FNTNISIS-TFIR-----------PIIPIIAICYIFFKD
R5XXD1_9CLOT/7-451NVNIKRICIVFIL-IQPILDI.......VTSILVRH-----INSIFTIG-IFIR-----------SIFMIFVVMYGILIS

PF04932

Q97ER0_CLOAB/210-348-------LYKFLL-I..VCIM----------------------LTLSRT..AIG-----------I..LLLYIIIKIIRS
Q4JZ62_STREE/213-343-------FTTWIL-I..ITIM----------------------TTTSTT.GVY.-----------...IIGLIFLYVLFS
Q6MI87_BDEBA/207-358-------SALVLA-GSFFAII----------------------LTGTRS.SAAA-----------A..VVAFIVTMVLHK
Q6ASB4_DESPS/185-338-------GGVALL-SFADIFY----------------------LQRSLT.GMVV-----------F..FALALLLLVQTL
A4B946_9GAMM/214-357-------ATLITP-A..LTIM----------------------GASSRG.SQLA-----------L..VAVLIYYFRWSL
Q9X4C1_ECOLX/176-341-------FYAIMF-I..FFLY----------------------MTNSRG.SILA-----------I..MAAFGYSLIKFK
Q4K127_STREE/198-353-------HNILIA-L..IILF----------------------LSLKRI.VFLS-----------V..LIIIPVFLVIYW
Q04RV1_LEPBJ/208-370-------QGIILL-SFLYVVF----------------------LNNARS.SMLG-----------AIFSSITAFLVLGIV
Q7UXE7_RHOBA/267-417-------LLALLM-L..AGCY----------------------STLTRS.VWLG-----------A..IAALGWIGMIYV
Q2BFT2_9BACI/241-418-------IGLVLM-L..GVIT----------------------LTYSRG.TYIG-----------F..VIAFVVYILLTK
A4CI06_ROBBH/191-347-------IILIFL-L..GILL----------------------LLSSRS..TIV-----------F..TLILSVFLLWRA
A4AI36_9ACTN/211-357-------GSVVLA-S..VVLV----------------------LSQSPL.AFGT-----------A..LVILAASAALYA
B1Z898_METPB/188-338-------LLLALA-A..LAIL----------------------RSISGA.ATLG-----------L..LAGAVMFGIGRF
Q09DA3_STIAD/195-349-------ASAVLS-G..VGVL----------------------LSLSRA.GIFF-----------F..LVGQVLVALGVL
Q5NZI1_AROAE/256-398-------AVCIAL-L..LGIV----------------------FARSRS.GIAL-----------G..MVGVVLSAVVLM
V6EXB6_9PROT/241-385-------IASGFL-W..LAVL----------------------ASHSRG.AFLV-----------T..GAGCLALLIAAT
Q98C91_RHILO/186-337-------PVVLLS-A..YLLV----------------------ISHSAT.SMAS-----------IPAVLALIALLAMTK
Q8RNK4_KLEPN/160-294-------LPVVIM-L..VMLL----------------------LTQSRG.PIIA-----------LVLAVGCTLHLHVFT
A0K2I1_ARTS2/235-362-------FPVGTI-T..VAAL----------------------LSVSRS.AIIG-----------V..LVAVVILLPSWS
Q9RZA8_DEIRA/165-323-------PAGLLA-L..ATFA----------------------AAGSRG.PLLA-----------L..GVGSLAALAFGG
Q2N6C0_ERYLH/230-383-------GMLVLF-S..LMAL----------------------ATGSRA.GIIA-----------TVLALPLGFAAVWGK
A4XML1_CALS8/220-429-------AASSFV-L..TAFF----------------------FTYSRG.SYVT-----------L..PIALLVFFILLP
O06944_SYNY3/232-381-------VALSLG-L..IDFY----------------------TTSSRG.GLLG-----------LATLLLLVIIGIGLL
A4AAF7_9GAMM/194-330-------FVCVCL-F..ATLI----------------------ALQAKG.TLLA-----------L..LLSGSWCFSGSH
A6QBN3_SULNB/185-344-------FFFITI-T..GNLF----------------------INEGRT.GQLA-----------F..LVGIFATVFIHY
Q0G5C8_9RHIZ/213-362-------LIAVLS-F..VFAY----------------------HSGSKT.TLAL-----------IPAVTLLVLSGRILG
A7VGX9_9CLOT/231-488-------FVLFLG-G..MAVI----------------------AANSDV.AYIG-----------I..GVPMVVLLLAGI
Q220X5_RHOFT/200-337-------TLMLLS-A..VSVL----------------------GSQSRG.ALLA-----------V...SAMGLVLWVRS
Q7NQD3_CHRVO/200-366-------ALVLWM-A..LMLG----------------------WAGSRT.ILLY-----------L..VALSALAGLWHW
Q89SN4_BRADU/265-409-------AGFAIC-T..IALA----------------------MTGSRA.GLLL-----------S..VGTFVLAIILYL
Q9AQJ1_STRAG/174-309-------GALLST-I..ILPI----------------------GSGSRA.GIIV-----------VLLQVIILLLNTIVI
Q7UKM5_RHOBA/239-382-------FVFVIS-S..ATMF----------------------ESMSRT.AVVS-----------C..AASVLAVMIDRL
Q11T24_CYTH3/244-416-------CLFLLS-S..SALI----------------------LSYSRA.AMMG-----------V..AGALCLFIVWRY
Q89PW4_BRADU/213-357-------LTFVLA-S..TCVL----------------------ASESRGAGAVA-----------LAACALLLTSMWSVI
A5G2R8_ACICJ/202-340-------ASMVLT-L..FAVV----------------------ATYSRG.GLIA-----------L...TAMGARLWWNS
A0A0E2TJC6_ECOLX/196-350-------INFMLS-L..CAVI----------------------VTETRA.AILV-----------FPFFALILIVMDSYI
Q4K230_STREE/187-326-------LLLILT-I..INCF----------------------FSDVSLSKVIA-----------LFMIVYIISYKLRKL
Q7MVK6_PORGI/277-409-------YGLVAL-S..CFAF----------------------ITQSRL.AMLF-----------I..PLSIMFFFLVRA
Q12C32_POLSJ/166-320-------AALAYL-C..NVLF----------------------VLNGRS.GHLV-----------A..IAMLSLAIMWEL
Q1J334_DEIGD/252-413-------WTLWFA-A..AALP----------------------ATRVRA.GFLA-----------I..AVAVLIVLLFRP
A6F4Q1_9ALTE/139-270-------LALAIL-L..LFLV----------------------ALERRT.GQVA-----------I..IVAIVTCIILYR
E1XBH8_HAEI1/179-336-------VAIILA-I..MTSA----------------------LSGARG.GWIG-----------L..PVVIGIILFLYK
Q832Q1_ENTFA/206-388-------MVIFLQ-F..SYVA----------------------LSGSRS.GVIQ-----------LISMVIFGMFFTIWF
Q9X5H1_HELPX/195-362-------LSVFVG-F..LVVI----------------------LSATRS.ATIA-----------FVATFLILSCFILYA
Q01XB1_SOLUE/184-329-------AAGIAI-G..ASLV----------------------AGYTRS.MWMG-----------A..ALGGGYLVWMRQ
A7BD98_9ACTO/223-370-------..LWLT-A..CGVV----------------------MLLTQS.ATVA-----------LSTVGCLVVVAGLVV
P74814_9SPHN/322-468-------LFDLAM-V..LSAY----------------------WSGARL.SMVG-----------M..VVAHATYLLLWG
H9L4P0_VIBCH/171-330-------LSVVAA-T..VATI----------------------LTLTRG.AILT-----------L..LFVFILFFIVNV
Q7V9G4_PROMA/203-353-------LVLLFI-A..ISLV----------------------LTNSRN.AWAS-----------M...FLSMPFVLGTA
Q65SG0_MANSM/195-350-------ALIFIM-G..LAIV----------------------ISASRS.VLLS-----------Y..LIMLMLILFLNA
Q7UPJ9_RHOBA/331-474-------LAAVVL-A..LALN----------------------DTHSRA.GLLS-----------VLIVGGCVLVDFVWA
Q6ABG2_PROAC/212-358-------ATAVTG-L..GLLL----------------------ATDSRI.IYAA-----------L..LLAVMVRLWAVR
A0A098GRN2_SALET/185-325-------IISFVL-F..IAIC----------------------MSLTRG.AIL.-----------...VAALIYALYIIS
D2AAY4_SHIF2/194-338-------VLSVIF-I..FLIL----------------------GTLSRG.AWLS-----------V..LVIGLIWILMFK
A6D015_9VIBR/218-369-------LTPVIT-L..PLIV----------------------VLGSRT.GWLG-----------A..LIGTLLLIPYLY
A0PZ10_CLONN/222-380-------LLNIYI-L..LTIA----------------------YTYSRT.GYIV-----------I..AIEFIIFNVLYL
A0Z5U1_9GAMM/194-332-------LGILGL-G..TLLV----------------------LGAVRT.AFIA-----------V..AVLACLSVFLYR
A7Z9C6_BACMF/261-409-------LFAICA-L..YLII----------------------LTGSRA.SLLG-----------I..CAGAAVYVFILL
Q2BRH4_NEPCE/186-340-------ATLFLI-TLHNLFF----------------------IENGRT.GYIL-----------I..ISLSALFFWQKL
Q97EP1_CLOAB/208-365-------ISFFVD-I..LGIV----------------------STNSRG.PFVA-----------T..GIAISVFFIIYY
A6M2N6_CLOB8/242-531-------IGTLLS-F..WLLF----------------------GSTARS.GIIG-----------V..LGALIFGIIIFY
A4ISY3_GEOTN/200-391-------AVYAIY-V..INLV----------------------LTYTRA.AWVA-----------M..LGGLVLVILLMP
Q7UWZ2_RHOBA/233-380-------LSSITC-V..AGLL----------------------LNGSRG.GVVA-----------A..LFGLVFAFGYVR
Q8AA03_BACTN/192-346-------VAFALM-L..CILP----------------------AGMSRS.AWLA-----------L..SFSSLWVLVIHF
A6GZ05_FLAPJ/236-385-------TLLLIM-A..FRGI----------------------ITFSRG.GMLS-----------SAVMIALLLLILFFV
O31347_BACCE/178-330-------PIMLIN-I..FVVF----------------------LTGSRK.ALLF-----------V..VLTIIAILLIQQ
A5UWM4_ROSS1/288-436-------ACALLS-L..TGVV----------------------VSFSRG.AWLA-----------S..VIAAVVLGAGWL
Q83VQ8_9PROT/239-380-------FIVLAM-V..GMLM----------------------LTQTRS.AWVA-----------F...FAFFTFYALFM
Q1MQ48_LAWIP/199-337-------VAVLLS-PGLFLWL----------------------GSFTRI.GYLA-----------L...LGALYILWICI
Q2T0U3_BURTA/206-363-------ALSVLL-S..VGLA----------------------LTVSRG.PWLQ-----------VGVMVVAGFWMAFAQ
A3DIW4_CLOTH/315-453-------IMALPP-L..LALF----------------------NTGSRS.SWIG-----------F..AVSVIVITFLLN
A3XRK0_LEEBM/177-345-------VFFVLS-V..VILL----------------------YINTRL.AIAN-----------A..FIGIILVSLADV
Q5FQI9_GLUOX/196-353-------AATVLA-V..GIMV----------------------LAGQRM.PLAL-----------S..LLGIGVCALLYR
Q609Q8_METCA/225-373-------IAVVIM-A..IGLV----------------------LTRSRM.GNVG-----------F..AVSLSVTGAVYL
Q8P5K1_XANCP/219-372-------GAAASV-G..VVLV----------------------LAGSRA.SWIT-----------Y..GVIVLLSGWQLL
A9WJ46_CHLAA/273-406-------LAMLGG-VQVLTLL----------------------LTFSRA.ALFG-----------L..IIAAAFLATVRY
A5UY10_ROSS1/144-293-------VGAALV-A..FGVL----------------------LTSSRG.AFVA-----------L..IAAGLLWGLVRL

PF01901

D3E122_METRM/9-372DLLNPFIIIAMVI-V--FIII.-------ALPMWYA-----YQK.LPSPSMDLF------------LYI..GLGLIFFIF
O26751_METTH/72-413HIFSPPSFIVFFS-M--FMAL.-------AAIP...-----.......VQKTLQ------------INI..LIGFSCFLL
A6USX2_META3/15-394KYDNPVIVILLGY-L--AIFV.-------LAIPYYY-----KF....NLFSLLN------------IFLVIFLLILSFAL
O27510_METTH/4-337DVFSPYSVVAVII-I--YLSL.-------ALTGTGL-----GLRGLEPPSALSI------------IYI..ATGTVALIG
R9SNY6_9EURY/64-410DLFNPMIIILLFS-L--FLIF.-------GLKA...-----.......ASNSLV------------ITI..IIGLIAFTI
Q2NHP9_METST/7-347DIFSPIIVVLLVI-L--YLVF.-------SFVAFNY-----HLKELVGINTNTI------------GII..FLGLMAYII
D7DRV2_METV3/10-352KVNPHDIFVLISC-M--FVILA-------SNIS...-----.......ITTGAI------------VLFCATFLYISFIV
Q6LY81_METMP/20-375GLDNPIVIIFIGY-F--LIFF.-------LAIPYFK-----EF....GVNSLLK------------MLLVVFGNLAIFSI
A5UMJ3_METS3/7-344DFFSPYIVAIAIM-V--FLSM.-------GYIGSFN-----YRFEYP.LSAETI------------GTV..LLATLVFLI
R9SIQ2_9EURY/7-375DWFNPYILILLLI-L--FVLI.-------SLPIHFK-----SRPLLPFPSGQLF------------LYI..LIGMIFLSL
Y420_METJA/14-363DLFHPVSIVIIGH-L--MIFI.-------LAFPYLD-----DI....GLYSLFK------------ILGVLSIFIVGFFL
B1L722_KORCO/85-415DIFLSPFILPIGF-L--FFFMV-------SLVR...-----.......VCEGTV------------LLL..LLTVISMLL
U6EAH7_9EURY/7-365DLFSPYIMVVIIA-I--YVGL.-------AAIAYQE-----HLRNLQWISSTTW------------LYV..LMGTLFFVV
Q8U4N5_PYRFU/1-307MRGLPLAIPIFLT-A--FVSL.-------.......-----.......GLARIK------------TIGVVSLFSILFVY
A6UX61_META3/12-346KIKIHHLFLMVGC-I--YISL.-------SSVS...-----.......YYSGFL------------AFFSLIFFYLSYIV
D3E1B0_METRM/66-429EIFSPLIVLVTFT-L--FILL.-------ATDP...-----.......VPRDLQ------------TTI..IIAFLSFFI
H3ZQY1_THELN/2-309RLKLPLVIPILFM-T--FIAL.-------.......-----.......GTASYK------------TLLVGTLFAMAFSY
A5UKQ8_METS3/66-411EAFNPLIVLVVFG-A--FLIL.-------SINA...-----.......VSASLA------------ITL..AIAFIAFFI
Q6LY80_METMP/11-337KIGPHHIFVGLSC-I--FVLL.-------SNVT...-----.......TLSACI------------VLFSSAFFYISFIA
Y419_METJA/11-336KIELHHVFVMLSC-I--YLIF.-------SDIS...-----.......INSAVV------------FLFSSIFFYISFTA

PF14296

R5XEE1_9FIRM/13-476MAITAVTFLILLL.I--IGVFNN....SEKVYVYNYVVDAVCLTVSVSLLLRLY.IKKDLDMF..EPIVVIGGLYILMYF
CAPE_STAAU/10-436IINFVTVLFSIFT.F--IGYLN.......NLIGFRV.....VTISLCITIAMTV.YLLYKKRK..GFLLVYLIYLFLTNF
A0A0U0LER3_STREE/11-477LTIVSYALTLVSG.I--VYLFN.......NNNVSLL.....STLLFLLVSSLIA.CWNDIKYY..LIHFIFYLTIFVFLV
F5VZJ2_9STRE/11-477VTIFSYIITIISG.F--AYLFT.......SNNVGLL.....TTLLLLLISSLLL.CWNNIKYY..LIHFIFFITIFIFLV
E8JYK2_9STRE/12-475ITLFSYVITIFLG.I--AYIYN.......NSIITLL.....ITLVMLIISSVLY.CFNNIKYY..VIHLIFYITIFLFLV
R6NPW6_9FIRM/14-489IIFICEILLFVIG.S--VLFLVSR...VENLFNLGL.....VAIMILFCMNILF.SIKNFKEN..FLYFFMQLTLFTFQI
E5VCR2_9BACE/8-476YLFFFLFLGLFSF.V--IGLLY.......QVYLFSL.....GAIFSVWILSMIY.AIADLNKR..YVFALFNVTFFTFLL
J8AZX0_BACCE/5-472IRYIILFFAVSMF.G--IGALF.......SNLNILL.....IAICGMLLHNLLY.SCEKFSER..IIFFAFNSTFFTFLV
R7GXX5_9FIRM/11-468MIAFLLLMSIL...G--IVAII.......VNVKPLY.....LFVLCCWLYLMFY.AYSDIDNR..GMLFAFLIAFFVFLL
C7RDM6_ANAPD/5-467FKMIKSFLLLFLFSI--LSIIF.......TEIHPLF.....VTLVSIWIICIVY.AFDDLDNR..GMLFSFFLCFFVFLI
K5ZBJ9_9PORP/11-476IIFRFSLAFFLIS.I--YILAV.......KDYSVVV.....ILPCMVFLLGIYF.SVKDIYNN..IFLFSFLICFFTFLL
A8U9E2_9LACT/8-452SMVIIMLFVMMGI.I--IAILS.......QNYQILA.....FILLADFLITLLM.FVKESQKK..IIPIMYLISIFTFIF
K6AW70_9PORP/7-478LIVLFFILIFLQF.I--LWVQSP.....SEVIVSFL....KYYSCSIYLFCIVL..LLVVKDVDSLLYTFYVLAFGVFIM
R7EEV2_9BACE/15-473ILIVSIFFALFVF.F--ARYVI.......ESIPCLQ.....YALILFIVYILVS.FLRFVKVV..SCIMIFIYGFILFLC
K1GGB2_BACFG/20-455YLNFALSILLFIVNL--ISGAT.......INYLFFS.....YYLLFSFLYITVV.SLKVFSLA..SAFNLFLFGYFMFQI
C5D952_GEOSW/7-469FVIHILIVIPLIL.L--SYAIYESWFITSSSFVSLL.....FLALCIWLL.ITS.KIERTSYF..NPYTLFLVAAILFNG
Q4JZ50_STREE/17-471YLFFWLVVSFGYF.F--MMPTFTE..DLEGVVSASL.....VQLLLFIIGYVYV.SYLNRSFI..SLYSIFMIVFYLFQN
M5J6L1_9LACO/12-465IEIVSIIVTIILL.T--SDIGSK.....NPFVFYSL.....YGFVIIALNLCII.ISTQKKVI..TGTTIIYSCFCLFQF
R6LMR5_9CLOT/10-464YIFIQIVFLLMSV.I--SFVLI......ESSIEFTFV...SFIALIYFLCTICSLVCYQKKIF..TAINCFYCVYVLFQI
C9AM09_ENTFC/4-437IINFIIILFFVSN.V--FLLLT.......VPTSFFV.....SISFLLFLVILIVGFVREL......ITSKIRLSLFIYIF

PF06899

WZYE_YERPE/1-448MTLGQFGGLFCIY-L--IAVIF--------------------------ILTLTYQEFRRVKFN--FNVLFSMLYLLTFYF
E0SKP9_DICD3/1-446MTEWAFFGLWLVW-L--GGGGV--------------------------VLWLSGREFRRWRFN--FNVLFSLLYLLTFYF
I2BE72_SHIBC/1-447MSLLQFCGLFVVW-L--CAVLF--------------------------IGTVTLQAFRQFRFN--FHAFFSLLFLLTFYF
C5BBC5_EDWI9/1-448MTLMQFAGLTLVY-F--FSLLF--------------------------VAFLTYKEFRRVRFN--FNVFFSLLFLLTFYF
E6WHF2_PANSA/1-446MTLMQFSGLLVVY-L--FSLGF--------------------------ILTLTWREFKRVRFN--FHLFFTILFLLTFYF
WZYE_SHIDS/1-447MSLLQFSGLFVVW-L--LCTLF--------------------------IATLTWFEFRRVRFN--FNVFFSLLFLLTFFF
Q2NQC5_SODGM/1-446MTLAQFGGLLVVY-I--LSLTL--------------------------VAALTYREFRWVRFN--FNVFFSLLYLLTFYL
I0DV18_PROSM/1-446MTLAELGGLSLVY-L--ISIIF--------------------------IGTLLYTEFRRVRFN--FNIFFSLLYLLTFYF

PF13425

R7NHG5_9MOLU/1-433ASKFKKVS....ILYYSGIIIYIVGYFLFKSDLL...NLNFLVSELKYILKFIYFPVLTFALLNIFD...ESGFEK....
Q81UH9_BACAN/9-459KQQGAKKY....ILYLCLFGIVLAIGLVNNLMIK...SPVSFGEEVKFIMKSVYPIVLLFGYIIALKELKNNEFAF....
Q81JN2_BACAN/8-466KKQGNIKY....ILYIILVGIVFTIGLVNNKLTK...DPMVLTEEMKFIAKALYPFVMLTCYVFVFKSLKEK..SH....
R7L2W3_9CLOT/8-429KENRKWNF.....ILLGLFAVTIIANIVFTLSSF...SMSALMNKAVSMTKYMCLPVTLFFLYRYLKNGNEFSLKT....
I0JRN9_HALH3/7-475SSRYKKPI....ILYLAALAAAFGFGLVYNYFAK...PIFDPFTELQFVAKTAYFSIMLGSYLLLFTTIEKVSTVR....
R5AA62_9CLOT/11-484DNRR.........AYYVMYGVVGGFWLLHMLNSF.RLGYQDPVGDAAEYFKLIQFPLWTMSFVTFFRQRKDLDYQT....
R5IY38_9CLOT/8-472NVGKRKKI..WSFLYLFIFSLYCVLHLINVKNNFFELSYGDLFDEMRQLVNYGYFLLQLINVYLIFSIATKDEKEK....
Q1G8D3_LACDA/2-497KQLPPAWL....WAYLDLLTLYGIFHLWHMQNFK...SLSPNDYGYSNFGEIFYLFRMLLPLALIWV.TKKLEISQ....
R6GEF5_9FIRM/3-434RGKYEKTV....KIYVAIISVYGLAFLANAAVCS...GTYTIITNIKMFIKMYYFLYVLLGLFCMYQQYQYVVSDW....
R5JB95_9FIRM/7-482ENKKNRKI...IYIYGGLIIIYTILHHLITSGVD...NSGYPTFSYSIITELFYIIRMLLPIVIIYL.TYLLKPTK....
R6GWD7_9FIRM/3-437DSKIN........TYIIIWIIYLLTSFVGHFLLD...SHFNIMSFGVNMAKLIYFPIILLFFTLYFKKNEELDRFT....
R5PWW6_9CLOT/19-494KIKPQIII..AGIAYL.GYAICHVYIFYKIKTGC...AYGNELREIQYLVNYTFMVMNLFIYIYFFAVKNREKEITQQTV
R5Z3Y2_9MOLU/8-506KSKKKYVY...YLVYGLMVIVYVILHHYYCLNMT...TLFPNNFNYSLMQEIEYIIRLTVPLVLIII.ASNLNINK....
R6YI35_9FIRM/11-484ENRR.........AYYVMYGVVGGFWVLHMLSCL.RLGYQDPVGDAAEYLKLVQFPLWTLSFVTFFRRRRNLDYRV....
R7HK69_9FIRM/6-439KSVHKKKS....LIYLAILCIFSILYIITKNGIL...SLGFLKTEVIYLFKYMYFPITALCLINVFD...EIKLEK....
R6AIT2_9CLOT/1-436KSKYKKAS....LGLLLLIFIYMIGYFLFKPDLL...NWTYIIKELTFIFKLIYFPISFMGLLCIYD...DNNYSK....
Q74HR3_LACJO/2-501NNWQRFRKQWWIIAYIGVLILYSICHLISVKNFT...GVDATGFHYSAKVEIFYLVRACLPLIVIYI.TSYSEFQA....
R5N8H6_9CLOT/21-493DKKEKLKLVGIGAIYL.LYAIIHLYIVSQNVTGW...SSGGASNELQYICNFTFLVVELYAYYCTFAINKKDSAKEIENK
R6XB97_9CLOT/19-487KIKIPLIF..VSFIYL.AYALGHIYTFNIVKNGC...AYGTMLNEIQYLVNYTFMIMNLFIYIYVFDYKSEGKNLS....
R6BI42_9CLOT/16-491KLKPYILM..AGGTYF.IYAICHLYIFYKKSTEC...AYGGITQEIQYLVNYTFMIMNLFIYIYFFVYKNREKELKNEDG
R5XXD1_9CLOT/7-451APKERKKI....LIYYGVLALYLVIFIATMCITN...GKNMIFTQIKGAIKCFYLPIILVALFTIFT.KKNIKINS....

PF04932

Q97ER0_CLOAB/210-348KNAK..............................----------------------------------------------
Q4JZ62_STREE/213-343KTSG..............................----------------------------------------------
Q6MI87_BDEBA/207-358TETN..............................----------------------------------------------
Q6ASB4_DESPS/185-338SWKK..............................----------------------------------------------
A4B946_9GAMM/214-357FKPK..............................----------------------------------------------
Q9X4C1_ECOLX/176-341KPFL..............................----------------------------------------------
Q4K127_STREE/198-353YDKK..............................----------------------------------------------
Q04RV1_LEPBJ/208-370RKEL............................PS----------------------------------------------
Q7UXE7_RHOBA/267-417PRRV..............................----------------------------------------------
Q2BFT2_9BACI/241-418EWKR..............................----------------------------------------------
A4CI06_ROBBH/191-347RKIA..............................----------------------------------------------
A4AI36_9ACTN/211-357LRRV.............................P----------------------------------------------
B1Z898_METPB/188-338APRA..............................----------------------------------------------
Q09DA3_STIAD/195-349RQRR.........................PGSGR----------------------------------------------
Q5NZI1_AROAE/256-398RNFG..............................----------------------------------------------
V6EXB6_9PROT/241-385IGRL..............................----------------------------------------------
Q98C91_RHILO/186-337LLSR..............................----------------------------------------------
Q8RNK4_KLEPN/160-294RRNL..............................----------------------------------------------
A0K2I1_ARTS2/235-362PAVR..............................----------------------------------------------
Q9RZA8_DEIRA/165-323QRRR..............................----------------------------------------------
Q2N6C0_ERYLH/230-383IRNR.............................A----------------------------------------------
A4XML1_CALS8/220-429REKRISFVFNLAIIGAIVLAFLNKVGAQLNPNGK----------------------------------------------
O06944_SYNY3/232-381RQLP..............................----------------------------------------------
A4AAF7_9GAMM/194-330RSAL..............................----------------------------------------------
A6QBN3_SULNB/185-344RINF..............................----------------------------------------------
Q0G5C8_9RHIZ/213-362GRIL..............................----------------------------------------------
A7VGX9_9CLOT/231-488RNRVKTY................DDRMVIGQNST----------------------------------------------
Q220X5_RHOFT/200-337ERKV..............................----------------------------------------------
Q7NQD3_CHRVO/200-366RSRD.............................E----------------------------------------------
Q89SN4_BRADU/265-409VPLE...........................LGR----------------------------------------------
Q9AQJ1_STRAG/174-309KRQT..............................----------------------------------------------
Q7UKM5_RHOBA/239-382ANRR..............................----------------------------------------------
Q11T24_CYTH3/244-416KIRW..............................----------------------------------------------
Q89PW4_BRADU/213-357CMRL..............................----------------------------------------------
A5G2R8_ACICJ/202-340RNRL..............................----------------------------------------------
A0A0E2TJC6_ECOLX/196-350NKRI..............................----------------------------------------------
Q4K230_STREE/187-326FWKR..............................----------------------------------------------
Q7MVK6_PORGI/277-409FFLS..............................----------------------------------------------
Q12C32_POLSJ/166-320PKRY..............................----------------------------------------------
Q1J334_DEIGD/252-413GRRW..............................----------------------------------------------
A6F4Q1_9ALTE/139-270NRVW..............................----------------------------------------------
E1XBH8_HAEI1/179-336EDIN..............................----------------------------------------------
Q832Q1_ENTFA/206-388FQKN.......................TSKAVIK----------------------------------------------
Q9X5H1_HELPX/195-362KKSL..............................----------------------------------------------
Q01XB1_SOLUE/184-329KRWL..............................----------------------------------------------
A7BD98_9ACTO/223-370QRRV..............................----------------------------------------------
P74814_9SPHN/322-468LRRW...........................IKE----------------------------------------------
H9L4P0_VIBCH/171-330RKIK...........................FKQ----------------------------------------------
Q7V9G4_PROMA/203-353TWFW..............................----------------------------------------------
Q65SG0_MANSM/195-350SAYF..............................----------------------------------------------
Q7UPJ9_RHOBA/331-474NAFG..............................----------------------------------------------
Q6ABG2_PROAC/212-358RWRW..............................----------------------------------------------
A0A098GRN2_SALET/185-325NRKM..............................----------------------------------------------
D2AAY4_SHIF2/194-338QWKL..............................----------------------------------------------
A6D015_9VIBR/218-369RHST..............................----------------------------------------------
A0PZ10_CLONN/222-380KQHS..........................KSIY----------------------------------------------
A0Z5U1_9GAMM/194-332GKRL..............................----------------------------------------------
A7Z9C6_BACMF/261-409PSLL..............................----------------------------------------------
Q2BRH4_NEPCE/186-340NLKT..............................----------------------------------------------
Q97EP1_CLOAB/208-365IYIM........................GRKQTI----------------------------------------------
A6M2N6_CLOB8/242-531KPLI..............................----------------------------------------------
A4ISY3_GEOTN/200-391KTFF...........................KNV----------------------------------------------
Q7UWZ2_RHOBA/233-380PRRG..............................----------------------------------------------
Q8AA03_BACTN/192-346KWIT....................KAKSYLQTHF----------------------------------------------
A6GZ05_FLAPJ/236-385TQRA..............................----------------------------------------------
O31347_BACCE/178-330KAGI..............................----------------------------------------------
A5UWM4_ROSS1/288-436LHRS............................QH----------------------------------------------
Q83VQ8_9PROT/239-380ERKY..............................----------------------------------------------
Q1MQ48_LAWIP/199-337WTKF..............................----------------------------------------------
Q2T0U3_BURTA/206-363TRRD............................PA----------------------------------------------
A3DIW4_CLOTH/315-453KRLL..............................----------------------------------------------
A3XRK0_LEEBM/177-345RKLR..............................----------------------------------------------
Q5FQI9_GLUOX/196-353PMRP..............................----------------------------------------------
Q609Q8_METCA/225-373LLAR..............................----------------------------------------------
Q8P5K1_XANCP/219-372GGRK..............................----------------------------------------------
A9WJ46_CHLAA/273-406RQLW..............................----------------------------------------------
A5UY10_ROSS1/144-293QRYA.........................QDSDA----------------------------------------------

PF01901

D3E122_METRM/9-372GILI...........................SNLLLNRFLKKDLSLDSLKDTIKISISKNP.......------..----
O26751_METTH/72-413FSVI.........................................MPGVILR................------..----
A6USX2_META3/15-394PFLLNVDIEGNNKISNFYRLYGLLLFIIIFYGVFVVMNSILFAVLCSLFVIGISNLYVKYKLYDNGQD------IK----
O27510_METTH/4-337GVYL................................................................------..----
R9SNY6_9EURY/64-410GALY.........................................LPKFFLNNQNN............------..----
Q2NHP9_METST/7-347GMIS.....................................IKYLLKNRKLSIKE.............------..----
D7DRV2_METV3/10-352GKRL..................................................IKLYMTSDDNENDD------NE----
Q6LY81_METMP/20-375PFFINFEKKMKLDKLNLKMFSGVLLGVSMFFGVFTLSGSVLSAVLFSGLVFLILHIFIKNY.......------..----
A5UMJ3_METS3/7-344GAGI...................................IKSQVTIYENESSPIY.............------..----
R9SIQ2_9EURY/7-375GIES...........................SIYI....LKKSKTLKNIKKRSSDVYSKDDNTKNLTD------YR----
Y420_METJA/14-363PFIFPMQIKFNRHI..LYLSFLLLSFLSIF.GAFKITHSLFLSIAYLLFILIIAELFVKF........------..----
B1L722_KORCO/85-415GIAL................................................................------.A----
U6EAH7_9EURY/7-365GAFL...........................PKFIYNRSAKLKSLWGGAKVTPENSAPWY........------..----
Q8U4N5_PYRFU/1-307GYNL................................................................------.G----
A6UX61_META3/12-346GEKL.....................................................YYNLKLDNLID------NA----
D3E1B0_METRM/66-429GAII.........................................FPRFILNNQLNQLNDETNTDNKE------SK----
H3ZQY1_THELN/2-309GIFK..............................................................GE------ET----
A5UKQ8_METS3/66-411GSAI.........................................LPRYFLNKEF.............------..----
Q6LY80_METMP/11-337GQNI..................................................FKKF.........D------FK----
Y419_METJA/11-336GKRL.....................................................YYLIG....ID------KE----

PF14296

R5XEE1_9FIRM/13-476FTPIYDLC......IGQYT....W.YG.YDLFKYGIKA......TLIAFAGFIGFYVFYEK.SFVWGNRSRRLRQV....
CAPE_STAAU/10-436GVFVTNIF.....LANPLV....EYHGDLSWYYINTSNLFSIATFAILTFTILSNFISVFS.KINPSR......KF....
A0A0U0LER3_STREE/11-477SRPTIDYF.....RDGALD....TYHP.IAYRFAFIVVMV.SILGLTTGGILARYFIAR.K.KIKVAN......IG....
F5VZJ2_9STRE/11-477SRPTIDYF.....RNGALD....TYQP.IAYRF......AFLVVIVSILGLTVGGFIASYY.LTRNSK......TVV..R
E8JYK2_9STRE/12-475SRPTIDYF...............KYGL.INTYQEDAYRFSFLAVIVSIIGLTIGGLLVSKK..ENNKK......EG....
R6NPW6_9FIRM/14-489SRPFIGMC......KGRKW....WEE...SFQKEENIWFALTLIVITETALYIGANIIKFF.HIKIRE......NNTRSS
E5VCR2_9BACE/8-476SRLFISPI......FGELQ....SEEG.LNFSSPQIINHILFSLYLSLFFLFVGFYMFQDK.RIVWFK......QK....
J8AZX0_BACCE/5-472ARLVVKPL......FGYYDKYNNNYYG.LDFDDEKVIWNIFISLFFCLLFLFLGYALVKNN...RAYK......GK....
R7GXX5_9FIRM/11-468GRDFLQEF......FKYKV....E.....N.FDQKTQNHAWISSSISLLTIIMVYPLCSKR.YK..KK......IS....
C7RDM6_ANAPD/5-467GRDFVKQY......FK.........YG.LETFYKDENIHAWMSYIISLVTILSGYILFTND..TTYDK......EK....
K5ZBJ9_9PORP/11-476GGQLLDKF......IN........VYG.YDFS.EDIELHTDLILLIGLTGLMLGYFLAD.K.AQGNKH......VF....
A8U9E2_9LACT/8-452YLPFKNLI......EQN...........NPMYNEKISFITLIILIIAFNGMKIGLLLGDFK.KKH..A......EN....
K6AW70_9PORP/7-478SRVFLDALGFEDAYFYVST....WAND.WSYFSLSIQFEMLNSIIFYLLFSFVGFLSSCLF..VDRYN......YK....
R7EEV2_9BACE/15-473SRVFLSIFDS..SILFESD....KYVF.YTFAD.TTVLEVLLILSVSFVSVIIGYLSSYAKSDFKAKD......YT....
K1GGB2_BACFG/20-455SALFVSLDT....LL.ERK....LMDN.LFLFSEEQINNTLCANSVILNAMFLGCLMS.....IIYLP......IK....
C5D952_GEOSW/7-469GQVLLYAL.......GLND....FILG.GKFQQ.ETINQTIFLVMVGLSFFHLGGLLSEHH.YNKTDK......IV....
Q4JZ50_STREE/17-471GQVLLYSL......GVEYD....YFYV.LRYDE..TI..VLQSVIFSTQCLIAAFMAGVF..STKKEV......SK....
M5J6L1_9LACO/12-465GLPIVATL......DKNYS....SYY..LSILPNEIKVLGAQFTILCIQFFTLGLLVFLNQ.SKDNLK......IS....
R6LMR5_9CLOT/10-464GVPLLYAV......VPEYS....NPY..MSFFSEDILVNAIEYTLLSLEIFGLTIFIFLRS.G.KRYY......SS....
C9AM09_ENTFC/4-437GYFFMYLSPI..MQLQYGS....FPNF.IMYNT.DKILKTNIIICVFYFLYLITDIFTRK....NNAK......QK....

PF06899

WZYE_YERPE/1-448GFPLTCMLV-------------------FQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRS------.Q----
E0SKP9_DICD3/1-446GFPLTALLT-------------------FRFGVETASPLNLLLALLSATAFYVIYYVSYKTRLRSAPP------VS----
I2BE72_SHIBC/1-447GFPLTSVLV-------------------FRFNVSVVPPEMLLQALLSATGFYGIYYVAYKTRLRR...------.A----
C5BBC5_EDWI9/1-448GFPLTCTLV-------------------FRFDVATVPAEEMLYALLSATAFYALYYVTYKTRLRSATS------.A----
E6WHF2_PANSA/1-446GFPLTSVLV-------------------FRFNMAVVPAEFLLQALLAATSFYAIYYVSYKVRLRPATA------.P----
WZYE_SHIDS/1-447GFPLTSVLV-------------------FRFDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVA------DV----
Q2NQC5_SODGM/1-446GFPFTCLLV-------------------FRYGVEVVPVDNLLEALLAATSFYGIYYVSYKTRLFARPR------.G----
I0DV18_PROSM/1-446GFPLTCALV-------------------FQFDVAVVPAEYLLYAQLAATSFYAIYYVAYKTRLTKSAT------.T----

PF13425

R7NHG5_9MOLU/1-433....---------------DKLDKI-MLW--NLIFYILIIIIP-----TILDINFKSY......................
Q81UH9_BACAN/9-459....---------------HKIITY-FLY--ATLILSISIITA-----MATGTDFPSY......................
Q81JN2_BACAN/8-466....---------------SKMRNY-ITY--ASLIIGVVMVAS-----ITTGTDYNSY......................
R7L2W3_9CLOT/8-429....---------------......-LVY--SAGIYATAILIS-----AITGTALPTY......................
I0JRN9_HALH3/7-475....---------------LRILQA-ISA--AMLIVSISLLVA-----ILTGTSTETY......................
R5AA62_9CLOT/11-484....---------------...IGV-LAA--NFGIILLVIALS-----YVVGHPVYTY...................DYP
R5IY38_9CLOT/8-472....---------------..IILS-LVC--ASALMASLYLMS-----VISGTSLLTY.....................K
Q1G8D3_LACDA/2-497....---------------DFLLKA-FAW--VSGLFTGTIVLS-----NLFVVSLKSYET...GVISGNIFTWF..MGPL
R6GEF5_9FIRM/3-434....---------------.....L-LVG--VYCEYTVSIFLS-----AITNTSFGTY......................
R5JB95_9FIRM/7-482....---------------DEFIKL-FLI--VGLITSGIIVCS-----NILEISLASYGG...GTIKGNIFDWF..FSNK
R6GWD7_9FIRM/3-437....---------------......-FII--IALIIGISLLTS-----VITKTAYCSY...................SSY
R5PWW6_9CLOT/19-494GKSL---------------EKVKKA-VLI--ALTIYIVLMYLA-----LITKTSSFTY......................
R5Z3Y2_9MOLU/8-506....---------------RLFNNV-CIW--ISLIISSIIVIT-----NIFKISIGAYYT...QTVQYNIFDWFNGIHNS
R6YI35_9FIRM/11-484....---------------...AGL-LAV--NVGLILLVIALS-----YAVGQPVYTY...................DYP
R7HK69_9FIRM/6-439....---------------EKIFKI-CII--EALLYSILIIMP-----EITNTAFSSY......................
R6AIT2_9CLOT/1-436....---------------ESIINI-IKK--TLIIYVFLLLIP-----LIFNAAYTTY......................
Q74HR3_LACJO/2-501....---------------KYFFRV-IQG--ISGIYSLTIVIS-----NLFLFSLTSYHTTEAKRISANIFSWF..TQTN
R5N8H6_9CLOT/21-493KRGI---------------DKLKKS-IIV--MSGIYVVSILFS-----IIISKSSYTY......................
R6XB97_9CLOT/19-487...I---------------SKLKKS-VLT--SLTIYIITMYLT-----LITNTSSFTY......................
R6BI42_9CLOT/16-491TKII---------------NKLKLS-VLI--SFTVYIVLMYIS-----LITGTSSYTY......................
R5XXD1_9CLOT/7-451....---------------....NI-YIY--TLLIYCFSIFIT-----KILGIAYPTY......................

PF04932

Q97ER0_CLOAB/210-348-------------------..SVVR-FGI--.ISLMVVLIGIT-----LW..............................
Q4JZ62_STREE/213-343-------------------..VKRY-VSS--LFILATICCFSI-----LW..............................
Q6MI87_BDEBA/207-358-------------------..QGRI-FKF--.ASLSVLLTFAL-----FF..............................
Q6ASB4_DESPS/185-338-------------------....MF-VGG--.LML.ALSLVVL-----VQ..............................
A4B946_9GAMM/214-357-------------------....IL-VSF--.SIILAMLWVIL-----PE..............................
Q9X4C1_ECOLX/176-341-------------------......-.VF--.TIFLLIQFFIV-----QE..............................
Q4K127_STREE/198-353-------------------..VSKL-GKE--RKILSLLNIFSL-----IF..............................
Q04RV1_LEPBJ/208-370-------------------AKILLF-ASG--.ILMLLLVLGIV-----LS..............................
Q7UXE7_RHOBA/267-417-------------------....RI-VAL--.AGVVVFSGAMA-----MG..............................
Q2BFT2_9BACI/241-418-------------------..ARNI-VIG--.ILIAVVLVNIP-----VT..............................
A4CI06_ROBBH/191-347-------------------.STPEF-LGI--.IAIIVLAVVFV-----FS..............................
A4AI36_9ACTN/211-357-------------------SGRRRY-WQF--.VLIGFVAAVAV-----IS..............................
B1Z898_METPB/188-338-------------------......-AAL--.ALAALILGLAF-----AL..............................
Q09DA3_STIAD/195-349-------------------RPSRSA-WGG--GLAVLLVLCASL-----GA..............................
Q5NZI1_AROAE/256-398-------------------....AG-FAT--.RMVGAVSALGV-----AL..............................
V6EXB6_9PROT/241-385-------------------..VRLR-QTL--ALLLVLIGLAGA-----AV..............................
Q98C91_RHILO/186-337-------------------..RYRR-VIF--VVGAGLIVVVAF-----VA..............................
Q8RNK4_KLEPN/160-294-------------------......-LIA--.AALAVLVALLL-----VM..............................
A0K2I1_ARTS2/235-362-------------------..RRAG-LAA--.VALVGVVWVMV-----PG..............................
Q9RZA8_DEIRA/165-323-------------------..VWVM-LPA--.VLV.MLAAFAT-----TS..............................
Q2N6C0_ERYLH/230-383-------------------AQMPKW-MSL--GAAVGAIASFAL-----AI..............................
A4XML1_CALS8/220-429-------------------EKLWLI-LLM--QFAVVWAAAYAF-----SF..............................
O06944_SYNY3/232-381-------------------...WRW-WLG--LGTLAIAVVGIF-----IC..............................
A4AAF7_9GAMM/194-330-------------------...RNV-WYA--.ALVLVLVSLTV-----LS..............................
A6QBN3_SULNB/185-344-------------------..RSII-AAL--.VLIVVIFTGAY-----TL..............................
Q0G5C8_9RHIZ/213-362-------------------...PVI-LVL--.VSVTAIGMMTL-----GT..............................
A7VGX9_9CLOT/231-488-------------------CDPFLG-WLI--.GYAGIVLGYTV-----MA..............................
Q220X5_RHOFT/200-337-------------------..VTGF-WFG--.VIALGLLALMP-----GS..............................
Q7NQD3_CHRVO/200-366-------------------NSRRMM-LAM--WAASGTILAAQF-----AL..............................
Q89SN4_BRADU/265-409-------------------SRKWLV-LGG--SAAAGLVLLQLV-----GG..............................
Q9AQJ1_STRAG/174-309-------------------....IR-FFL--.YLVPILILLLV-----IL..............................
Q7UKM5_RHOBA/239-382-------------------...GLA-MGL--CVVMGICLLMLA-----VG..............................
Q11T24_CYTH3/244-416-------------------....SY-IGI--.AAL.IVAVYIF-----SA..............................
Q89PW4_BRADU/213-357-------------------...YAV-LPF--.VMCLLAGALIF-----YF..............................
A5G2R8_ACICJ/202-340-------------------..TSFL-LFG--.IVMATAISFMP-----AD..............................
A0A0E2TJC6_ECOLX/196-350-------------------..NYKL-YCF--.ITI.ALLAGVF-----SF..............................
Q4K230_STREE/187-326-------------------..GRKI-SVV--.TFIASVVMLAL-----VI..............................
Q7MVK6_PORGI/277-409-------------------.QKKKL-LFT--SFMLIIVGGFIF-----NG..............................
Q12C32_POLSJ/166-320-------------------..RAAV-VLL--PFVLVGALFLSS-----HK..............................
Q1J334_DEIGD/252-413-------------------WKPLAL-ATF--.VLLSLLTFDVR-----VT..............................
A6F4Q1_9ALTE/139-270-------------------..FLLF-GAA--.VLCGILILIFY-----PE..............................
E1XBH8_HAEI1/179-336-------------------....KK-LII--.TLVTVITIGLT-----AL..............................
Q832Q1_ENTFA/206-388-------------------KVVQAV-LVS--.FFCGAIVFGGL-----QL..............................
Q9X5H1_HELPX/195-362-------------------....RP-LGY--.MIVVSLVLSTL-----YM..............................
Q01XB1_SOLUE/184-329-------------------....LL-APL--.PVL.LLLWANP-----FG..............................
A7BD98_9ACTO/223-370-------------------...PVH-LRL--.RVVGMFAGIGV-----LT..............................
P74814_9SPHN/322-468-------------------RGGLVG-IST--.TMMYPAFAVVL-----AV..............................
H9L4P0_VIBCH/171-330-------------------TLVFTL-ISF--.LLVSVSYQFSP-----RI..............................
Q7V9G4_PROMA/203-353-------------------...VLP-LMA--.LSLFPVLLSVL-----PF..............................
Q65SG0_MANSM/195-350-------------------..KAVY-LFF--.ACVIALFIFNL-----SW..............................
Q7UPJ9_RHOBA/331-474-------------------...RRV-VNA--SLLAISAVFAAL-----PL..............................
Q6ABG2_PROAC/212-358-------------------.....V-LPG--.VVMAVVVVIVV-----TH..............................
A0A098GRN2_SALET/185-325-------------------..LFCG-ITL--FVIIIPVLAIST-----NI..............................
D2AAY4_SHIF2/194-338-------------------......-...--.LLVGVMVSIIA-----LS..............................
A6D015_9VIBR/218-369-------------------RKRFRG-WTF--ASLAGVALGLFL-----GF..............................
A0PZ10_CLONN/222-380-------------------KKIYAT-HSI--.ILISIFIIILV-----IY..............................
A0Z5U1_9GAMM/194-332-------------------......-VSS--.LSAGLLLCVVG-----LW..............................
A7Z9C6_BACMF/261-409-------------------.KKLAL-YAA--.GAGAALCAVLF-----AG..............................
Q2BRH4_NEPCE/186-340-------------------....LC-ILL--.ALFIIACGLIY-----SL..............................
Q97EP1_CLOAB/208-365-------------------YKKICV-IIL--AFFVLILILLGL-----SY..............................
A6M2N6_CLOB8/242-531-------------------....KR-WKG--.ILIGVITLIIL-----FVGANFASKGSLFKRIPSLASDAFSIFKDTSD
A4ISY3_GEOTN/200-391-------------------IRPHIL-VSF--.AVLLTIVYFMP-----DV..............................
Q7UWZ2_RHOBA/233-380-------------------...LIG-LPV--.LAVVIAISVAI-----LT..............................
Q8AA03_BACTN/192-346-------------------YTATLL-YIT--.VAIIIVCASVL-----LY..............................
A6GZ05_FLAPJ/236-385-------------------AKIKLF-WMV--.VFSFVAFLIIW-----SY..............................
O31347_BACCE/178-330-------------------.KGKIK-ALI--GILVTLVISLYV-----IF..............................
A5UWM4_ROSS1/288-436-------------------RQAVRW-SAL--.AFIGALIVGMT-----GL..............................
Q83VQ8_9PROT/239-380-------------------......-IPV--.LLVLPVIGLAI-----PE..............................
Q1MQ48_LAWIP/199-337-------------------......-...--.SLLKVIVPPML-----LL..............................
Q2T0U3_BURTA/206-363-------------------ARRARA-WVI--PVVLGALFVAVN-----VA..............................
A3DIW4_CLOTH/315-453-------------------..PFII-LGG--....VMMIPFLP-----QY..............................
A3XRK0_LEEBM/177-345-------------------..SKKV-LKL--.LAVGVLGFALL-----SY..............................
Q5FQI9_GLUOX/196-353-------------------...AAL-AAA--.AMLPVLVLVAR-----VF..............................
Q609Q8_METCA/225-373-------------------..SSRF-SSG--.LVLAILSSIVL-----VD..............................
Q8P5K1_XANCP/219-372-------------------.....V-IAV--AALGAVLAAGVV-----AV..............................
A9WJ46_CHLAA/273-406-------------------...RHM-LAV--.SILGAVLLFGL-----GY..............................
A5UY10_ROSS1/144-293-------------------RIPRSI-WRS--.LVVAGAAGIGL-----IA..............................

PF01901

D3E122_METRM/9-372...K----KLSIFESY---SRKEMI-LVI--MVLIGIILQIIN-IVR-LGGIPLFSATLKAEAA----------------
O26751_METTH/72-413...G----DRYLRFSI---DDIRSM-GFT--LFIIGSAFLAIT-LTD-VGGIPLLKPSLRYLLN----------------
A6USX2_META3/15-394NKQH----EKYCKFKE---LLFKNM-DNI--IFAIGIMSFMAL-VII-HNAIPLFNYPVRMSLS----------------
O27510_METTH/4-337SSGF----RIGKIRTH---EGSEPF-LVA--LVIAGILIQAIN-LYL-LGGIPLLSGYLKARAV----------------
R9SNY6_9EURY/64-410...N----KRIIDFNP---KDIYSV-GFT--LFLIGLIFFFIN-IGY-VKGIPLFTPSLRYKLI----------------
Q2NHP9_METST/7-347...E----KLEKITS.---...EKI-ILS--CVILGILLQIIN-MIY-LGGIPLFSGYLKAHAA----------------
D7DRV2_METV3/10-352NFLT----KLKQNINY---EKQTKI-GLL--LITIGALFTVAD-LIW-VSGVPLFDPASRKFLN----------------
Q6LY81_METMP/20-375....----.....YSE---KI....-SKI--MFLIGVVSFLAM-VLI-YGTLPITDYTVRMAIS----------------
A5UMJ3_METS3/7-344...I----KINNFFN.---...QKI-LIT--LVLIAIILQSIN-MIL-IGGIPLFNSVLKSNAT----------------
R9SIQ2_9EURY/7-375ISLK----ELPLFGNY---SRIESV-LIV--LILFSLVLQLIN-FYN-LGGIPLFSGYLKSKAA----------------
Y420_METJA/14-363....----.....YKK---KIFV..-.DI--LFSIGIIAFLLI-VLI-YGAIPLFNYEVRMTIN----------------
B1L722_KORCO/85-415RAEE----EMEVIDPR---GFVLFL-GAS--MFLIGYAAFIVQ-IAN-AGGIPLLDEQVRRKLS----------------
U6EAH7_9EURY/7-365...N----KLLILLD.---...ERV-VLT--VAIVGILLQIVN-LYI-LGGIPILSGYLKFKAT----------------
Q8U4N5_PYRFU/1-307SKKG----GKLKLNPI---KEEVWW-GYI--GLILSLLAIVAN-LVK-VGDIPVFHPYLRTSLN----------------
A6UX61_META3/12-346NITG----KY..KINY---SKHYKF-GLI--LLFIGILFIFFN-LLW-VRGVPLFDPDSRRFLN----------------
D3E1B0_METRM/66-429TDKS----KQIPLFNS---YDVYSI-GFC--LSLIGIVFLFLS-IAS-VGGLPILKSSLRYSLK----------------
H3ZQY1_THELN/2-309PWKE----KEFKVIKE---EHLVW.-...--AFLISLLLIALQ-IFM-IKKVPLLDSSARHLLN----------------
A5UKQ8_METS3/66-411...K----KPAIEFKS---KDFYSI-GFC--LVLISILFFFVS-VAS-VGGIPILKTSLRYQLK----------------
Q6LY80_METMP/11-337PF..----....EVNY---KFHEKI-GLF--LLLFGIFFTIMD-LLW-VRGVPLFDPTSRKFLS----------------
Y419_METJA/11-336NL..----....KINL---KKHYNF-GIF--LMIVGLIAVTSD-LIW-VKDVPLFNPLSRKFLN----------------

PF14296

R5XEE1_9FIRM/13-476NNYC....YTND.Y.A...ESRKK..ILY..LTLIIYFFSLAA.NIY.YVIHVSGNSILYSLTFGLLGSGGVSE.KTT..
CAPE_STAAU/10-436DIKS....KGNN.L.F...YYTGIL.FII..GFTIQFLFYIIT...G.RLAI...NTYGDYVSS.......IQ..ELP..
A0A0U0LER3_STREE/11-477NSLK......EV.Y.I...KRLRFV.SLV..VFLLTYPFYFIR.LFE.RLLYRLQTSYYAYYAN.......FES.KLP..
F5VZJ2_9STRE/11-477VEKK....SNVN.Y.V...KNLRFV.SLS..VFLLTYPFYFLR.LFE.RLLFRLQTSYYNYYAN.......FES.QLP..
E8JYK2_9STRE/12-475YETQ....KSRL.F.I...HSIRKV.SLT..VFLISYPFYLIR.LIE.RLMYRINVSYYEYYAE.......FKS.ELP..
R6NPW6_9FIRM/14-489DSIF....CKAE.F.V...SNLRKV.SMI..VFYVTMLFYLIE.QFE.PLIKIGTGNYLDYYTN.......YSS.SLP..
E5VCR2_9BACE/8-476ERTK....YASD.I.V...KFRKKL.FLP..FLYVCAVAACCI.NIE.KMLFVLSNSYLSYYTD.......FSS.RLP..
J8AZX0_BACCE/5-472RSRF....FSEN.N.I...KNIALV.SKS..LFYITYIFNVLV.LWD.KAKFTNNVGYTELYAS.......YTS.SFP..
R7GXX5_9FIRM/11-468KRKK....ENKI.Y.T...LIAQKI.SRV..VYYFSWIFAVTS.KIV.VGMFVSARGFTDYYTD.......YSE.YLSGN
C7RDM6_ANAPD/5-467KLIQHRDLNNII.Y.K...KNIRKI.SIL..IYYISILFAVIT.QIE.IIKFVSKSSFTDYYVD.......YAY.YLKNN
K5ZBJ9_9PORP/11-476IAVD....YNST.Y.Y...VNVRTV.SKY..LFFVSYTLWMLI.LLD.NVLYVVQYGYISYYLS.......YSS.RVP..
A8U9E2_9LACT/8-452QDLK.........K.K...QNLSIA.ALL..LVCMTA.PAMIYRVYK.DTLIVSTQGYASLYQS.......VDT.Q....
K6AW70_9PORP/7-478TCVK.....NDS.L.I...FEIRRL.GFF..LFISFCVPYLLY.LYQ.AVKFVVENGYLAVYLN.......ESSTTVD..
R7EEV2_9BACE/15-473QFTS....QASS.Y.VYTDKQLQKI.LYY..LILLSAPGVLYK.GMH.DLMLIKQYGYLIMFME.......MP..PAP..
K1GGB2_BACFG/20-455TNIN....KANLIY.S...ERLQNW.GYL..LFWVALPFTLLK.FYL.EIKLVLTEGYYAYYTS.......SL..SIP..
C5D952_GEOSW/7-469NQKE.....KEK.F.S...DFELRVMGWL..LLSISIIPTFIL.LKN.SIEAVQQGGYFSLYQQ.......EKV.TSF..
Q4JZ50_STREE/17-471PLYS....YMDQ.LER...EKLITT.GKL..FWGAFAIFALPF.MMM.KLVITSTSGYFAMIRF........VG.SLP..
M5J6L1_9LACO/12-465ISYL....SDDK.L.I...IRAAKW.LAI..LSGLIVIPLYLI.TVE.KTIV...NGYSQQLRA.......TV..SSN..
R6LMR5_9CLOT/10-464RVVF....TKKK.A.V...NDERYV.YTIAKALFICTGMVTVP.LYTVVAYLTLKTGFSQVTRS.......LV..AAN..
C9AM09_ENTFC/4-437DTSF....QNLK.F.N...YKMQQY.YFV..FTLIFSIITFFMFRFE...YFTTRYTYSNLITN.......SSL.YL...

PF06899

WZYE_YERPE/1-448PRTP----....IFTM---NRVETNLTWV--LLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSS-----------DVS--
E0SKP9_DICD3/1-446RPLP----.....LTM---TRLEALLTAG--LLALVALVTAAVFFANNGLLLFKLSSYSQIFSR-----------DVA--
I2BE72_SHIBC/1-447PPAP----GGNGLFTM---NRVETNLMWG--LLMLVALVSVSVFFMHNGFLLFKLQSYSQIFSS-----------EVS--
C5BBC5_EDWI9/1-448PGSG----..SAWLQL---NRVEAQLTWI--LLALVALVTVTIFFLNNGFLLFKLHSYSQIFSS-----------GVS--
E6WHF2_PANSA/1-446PRKP----....WLQM---NRVETHLTCL--LLALVAIGTVTVFFMHNGLLLFRLTAYNQIFSS-----------EVS--
WZYE_SHIDS/1-447PRRP----....LFTM---NRVETNLTWM--ILMGIALVSVGIFFMHNGFLLFRLNSYSQIFSS-----------EVS--
Q2NQC5_SODGM/1-446PRPP----....WFSI---SRTEIHLLWL--LLALIALATVLIFFMQNGFLLFRLRAYSQIFSS-----------DVS--
I0DV18_PROSM/1-446AKRP----....LFTM---NKVETNLTCL--LLIAVAVVTVGIFFLQNGFLLFKLKSYSQIFSS-----------QVS--

PF13425

R7NHG5_9MOLU/1-433SNSSYAGSVGWYFSANEVSSILLLLFPFI...YVLLKKHK....VIFSLLF----ITSLFTISLIGTKV-TLFGIIIITF
Q81UH9_BACAN/9-459.PNSKIGSRGWFFAGNDLSSIFAIMFPIVVL.YSVHKTTS.FSKVYYWIPT----VLAMYASIMIGTKV-GYGAIVITLG
Q81JN2_BACAN/8-466.EWVKLGSRGWFYAGNELGSILAIMCPIVIL.YSIEKTKS.IGKAYYWIPS----ILVVYSLFAIGTKV-GVGAIFGSMA
R7L2W3_9CLOT/8-429DTAPERGISGWIYSGNELSAMMSLFYPIVI..YYAAKYKS....LSFMFIL----AVMTYGLLVIGTKT-ALIGLIGAIL
I0JRN9_HALH3/7-475.EWNKFGYKGWFFAGNELGSIVSISFPLVYL.YALYKIES.LKNSYLFIPV----VLLAIVSILIGTKV-PYFAVLMAAV
R5AA62_9CLOT/11-484DRDVFIGILGWFGVANSQSSILTLLVPPLLL.WGLRSRQL....WKFSLCC----LFGFGLLYFTGTRL-TYYGAILIAL
R5IY38_9CLOT/8-472GSLVKHGYKGWSISAHYIGHSLLLMFPIVI..YAIYNNLIKNNLIKAIVFL----LPIIPCVYLVGTKS-PLFGVLAILV
Q1G8D3_LACDA/2-497YGYSHSASKGFFYFTNTLSAILLMLAPVVF..YLLLERFS....WKTGLLA----LSQTLAMLEVGTKV-ALYGLAGTLA
R6GEF5_9FIRM/3-434..DYGKGYCGWFYAGNEVGAIISILAIVALF.WAVKSKKK....FVWISIG----FLCAFSGTYVGTKV-PLLASAMAVI
R5JB95_9FIRM/7-482YGSQDLASKGWFNSANQISGLMFILLPICV..YSLFDKIT....KPRVITI----ILLVISMIMLGTRV-ASYGWLLIFI
R6GWD7_9FIRM/3-437ENCYHKGIVSWFNSANEYGLILIALLGYSLIDYIKSKN......IYNIVSS----LITIIFLCILGTKA-SYVGCVGLLG
R5PWW6_9CLOT/19-494.GETQVGYKGWFESGNSIGTIMLLSLFIVLP.MLNKENKLAIRIWVLMITV----LVGAYLCTLLGTRT-GLFGFIIVVM
R5Z3Y2_9MOLU/8-506VSFMYTATRGYFNYANLISSLLFGLTIYIL..YLVISECN....FKNSICL----ILNFFAMFMLGTKV-ATLGMLICLI
R6YI35_9FIRM/11-484ERGVAIGILGWFGVANSQSSILTLLVPPLLL.WGLRSQRL....WQFCLCC----LGGFGLLYFTGTRL-TYYGAILIGC
R7HK69_9FIRM/6-439.LDDNKGTVGWFYAANEIGAIMVALFPFLY..YLLFEREG...IIKIALIF----TIVILAMTLLGTKT-SFLGMLITEI
R6AIT2_9CLOT/1-436.PKSLKGYIGLFYAGNEVANIMVMLFPIAYL.YLNNKKFN.......FLIL----FPIILSILLIGTKV-ATFGCLIITL
Q74HR3_LACJO/2-501YPFNALASKGVFFQANTLSAILFMIMPIML..YILYKEFN....VLNIVLV----SSQALAMLMLGTKV-GNFGLIISLV
R5N8H6_9CLOT/21-493.PETKTGYKGLIESGNSLSAILVLSLGIMI..QMIKSREYKWRIISTVISA----VTCIYLVTLIGTRV-GMIGSIMVIA
R6XB97_9CLOT/19-487.AEEKIGYKGWFESGNSIGTIMVLSLFIVVP.TIRTERKKIIKAWKIIVVL----LVGIYLCALLGTRT-GMFGYIIVMI
R6BI42_9CLOT/16-491.SEVQIGYKGWFESGNSIGTIMLLEMFIILP.NLGKNNKTGIRIWTFMTIV----LAGAYLCTLLGTRT-GLFGFIIVIL
R5XXD1_9CLOT/7-451SIGLNVGTTGLFFAANEIGIILGILAVILFRELFMKKVENKRNFILYIVTL----FLYIYSILEMGTKV-PILAFLGILC

PF04932

Q97ER0_CLOAB/210-348...................................................----....IAISKYNVYF-F.........
Q4JZ62_STREE/213-343...................................................----..............-..........
Q6MI87_BDEBA/207-358...................................................----....GSQVYDFARG-VATGQNALGT
Q6ASB4_DESPS/185-338...................................................----....TSPKFMNQGR-ELYNTVTNYQ
A4B946_9GAMM/214-357...................................................----......EQLGRFQN-..........
Q9X4C1_ECOLX/176-341...................................................----....TYPTWVSMGK-IMSENANYTV
Q4K127_STREE/198-353...................................................----....ITGIFFYVYS-VKSDFIYTFI
Q04RV1_LEPBJ/208-370...................................................----....FTQVGQKITD-PLF.......
Q7UXE7_RHOBA/267-417...................................................----....LKDQMMSMKR-DKALSA....
Q2BFT2_9BACI/241-418...................................................----....KGANYFKLQG-LDQDVPRTET
A4CI06_ROBBH/191-347...................................................----....NRALIEKFKD-AVNFDGQYEV
A4AI36_9ACTN/211-357...................................................----....WLSRVAIVAS-..........
B1Z898_METPB/188-338...................................................----....APVEGDLLHR-LMPEAA....
Q09DA3_STIAD/195-349...................................................----......GGYVAWEK-LVAEASTA..
Q5NZI1_AROAE/256-398...................................................----...AVAIGLAPVFA-R.........
V6EXB6_9PROT/241-385...................................................----....LADGDITLAR-M.........
Q98C91_RHILO/186-337...................................................----....LNLGLMDFVL-GL........
Q8RNK4_KLEPN/160-294...................................................----....TPVGDMLLAR-F.........
A0K2I1_ARTS2/235-362...................................................----....MVGTIKGLF.-..........
Q9RZA8_DEIRA/165-323...................................................----....LNVPFKPLD.-..........
Q2N6C0_ERYLH/230-383...................................................----....GASILLGRAA-AIERL.....
A4XML1_CALS8/220-429...................................................----....VEKRLYVLKN-EVYIISALTI
O06944_SYNY3/232-381...................................................----....TNDRLLTSFT-GIMG......
A4AAF7_9GAMM/194-330...................................................----....FFPALDLITH-..........
A6QBN3_SULNB/185-344...................................................----....SDKFQTRVQA-AQHDITKIEK
Q0G5C8_9RHIZ/213-362...................................................----...VLSDTLDSILQ-S.........
A7VGX9_9CLOT/231-488.....................FLTTGTGKGYDKLTGLAKLVDHRLILTIES----IVLVIGSLLYGWGS-RKKADCVVAQ
Q220X5_RHOFT/200-337...................................................----....WEQRMNTIGS-..........
Q7NQD3_CHRVO/200-366...................................................----...PLFNHLISLLT-HSDVENASGV
Q89SN4_BRADU/265-409...................................................----....LVAGRI....-..........
Q9AQJ1_STRAG/174-309...................................................----....RFDNLVSIYN-RII.......
Q7UKM5_RHOBA/239-382...................................................----....LLSEGSDVGS-RVVAVGTKTG
Q11T24_CYTH3/244-416...................................................----....RDQFYMQMKR-NNADSKTKKT
Q89PW4_BRADU/213-357...................................................----....YATGYDAIHV-..........
A5G2R8_ACICJ/202-340...................................................----....WKARMFTILH-..........
A0A0E2TJC6_ECOLX/196-350...................................................----....KDTLLMRMND-LNNDLVNYSH
Q4K230_STREE/187-326...................................................----....FGYFLPYL..-..........
Q7MVK6_PORGI/277-409...................................................----....LL........-..........
Q12C32_POLSJ/166-320...................................................----....VRDRLIMMKM-EVESHSAH..
Q1J334_DEIGD/252-413...................................................----....VGQSRNTISA-ESLLLNLKSI
A6F4Q1_9ALTE/139-270...................................................----..............-..........
E1XBH8_HAEI1/179-336...................................................----....IANPKFGIEK-RYNAAKSDIV
Q832Q1_ENTFA/206-388...................................................----....IEKGYIATAN-SVNIEVPKVL
Q9X5H1_HELPX/195-362...................................................----....GSNALEKKGA-IEQSRVQNQS
Q01XB1_SOLUE/184-329...................................................----....VGERMRSVYK-P.........
A7BD98_9ACTO/223-370...................................................----....AIAAFFCRHM-IADA......
P74814_9SPHN/322-468...................................................----....MIMVVPAVHN-RVLGG.....
H9L4P0_VIBCH/171-330...................................................----....QERVDFTIFE-ISSIASNN..
Q7V9G4_PROMA/203-353...................................................----....VPTEIQFIAR-KIVPEGLWSR
Q65SG0_MANSM/195-350...................................................----....LQEVFILLAK-IDWLERPIER
Q7UPJ9_RHOBA/331-474...................................................----....AARGWFGTGW-I.........
Q6ABG2_PROAC/212-358...................................................----....LHQAGLVWHR-FIGVLIHHN.
A0A098GRN2_SALET/185-325...................................................----....FDNYTEILIG-RFTDSS....
D2AAY4_SHIF2/194-338...................................................----....VIFTHKEMTA-KLTY......
A6D015_9VIBR/218-369...................................................----....GNTSSQNLI.-..........
A0PZ10_CLONN/222-380...................................................----....KLDLSNNLIS-LL........
A0Z5U1_9GAMM/194-332...................................................----....FRGQLFPM..-..........
A7Z9C6_BACMF/261-409...................................................----...RITNAVLNLFS-APQAMPG...
Q2BRH4_NEPCE/186-340...................................................----....ADLSHIRILG-NLNALSSSGP
Q97EP1_CLOAB/208-365...................................................----....LTSYTGNVNN-QVLNYLIYRA
A6M2N6_CLOB8/242-531LDYTNYTPVKDIKYIDSTTEVVLPNDTLKITYESGNPVFKDSNGEVVPYAL----NGKVLSTNIETFKN-ITFAFGKLDK
A4ISY3_GEOTN/200-391...................................................----....QSRTYSAVYA-MEKIISRHLH
Q7UWZ2_RHOBA/233-380...................................................----..VPMQLNLESITR-LEMISA....
Q8AA03_BACTN/192-346...................................................----..............-..........
A6GZ05_FLAPJ/236-385...................................................----....SSSQTNGLIA-KRYANEDASG
O31347_BACCE/178-330...................................................----....NVELLYTIIG-VRMEHLFSYI
A5UWM4_ROSS1/288-436...................................................----........ALTLRG-..........
Q83VQ8_9PROT/239-380...................................................----....IRDRLLDLTS-GNQVVA....
Q1MQ48_LAWIP/199-337...................................................----....VVLSMFGIAR-L.........
Q2T0U3_BURTA/206-363...................................................----..VRWANAHYHLGL-AESAAER...
A3DIW4_CLOTH/315-453...................................................----....VYNRILTIFR-..........
A3XRK0_LEEBM/177-345...................................................----....GFVKIFPYSI-EKFSEVTFAH
Q5FQI9_GLUOX/196-353...................................................----....SPGSFFHLVT-LARQ......
Q609Q8_METCA/225-373...................................................----..LVIVGSYFGIEE-VARRLE....
Q8P5K1_XANCP/219-372...................................................----....APQARERLQR-TTLAFTDGE.
A9WJ46_CHLAA/273-406...................................................----....ADEFINRVLS-GV........
A5UY10_ROSS1/144-293...................................................----....LLVNLPATQD-AL........

PF01901

D3E122_METRM/9-372---GKIWLASYIIFLP--FINILLA.............E--FNRDSHYLLV----FLGLL...L-FTLT-GYRTTPIAIV
O26751_METTH/72-413---PKLTIPVY.LMIP--GTAFMLAYITDKMQKSVIDRS--TARFRAITVS----LTCLV...M-LALL-GYRTPLVAVI
A6USX2_META3/15-394---ADP......LRLI--STGALVY..............--.GGINNIFYF----IIAFI...L-LILL-GYKMGVLIVF
O27510_METTH/4-337---TKLWFISYLLFLP--SINILLA.............A--YPRRKYYIPL----IMGAI...L-FALT-GYRTTVVVIL
R9SNY6_9EURY/64-410---AALTMPVF.LMIP--GIGIMESYYVCLMKEGKLTRS--QVRFRFLSLS----LTGIV...L-LLFL-AYRTPILAIL
Q2NHP9_METST/7-347---TRIWLLSYLLFLP--SINILLA.............K--YHDRRYYILF----IVGLL...L-FVCT-GYRTTAIAIV
D7DRV2_METV3/10-352---VGFTAFAH.LLPL--GWAIVVS.............C--V.EMSKKKVF----TYSLVFATL-IALL-GYRTQVIILL
Q6LY81_METMP/20-375---DDP......LRLI--SSGALTF..............--.ASLFNFGYF----LVSFA...I-LAVT-GYKANVLVLI
A5UMJ3_METS3/7-344---TNIWRIAYPLFLI--MINLLIA.............K--YYKKRYLILV----LIGAL...I-FGLN-GYRTSVLGIL
R9SIQ2_9EURY/7-375---TRIWFLSFMLFLP--SINILLS.............K--YNRKTHYVLL----FLGLL...C-FALT-GYRTTPIAIL
Y420_METJA/14-363---SEP......LRLI--SMGALIY..............--.AGIENKVYF----IIAFM...I-LVLL-GYKAGVLMLF
B1L722_KORCO/85-415---AELNYLSW.TTVP--GAAFILS...........SSK--VRRCEAIIFS----IIGFI...P-SFLL-AFRTEMIAYI
U6EAH7_9EURY/7-365---TDLWRFAYPLFLP--AITILLA.............K--YPRKLTYALF----IIGLV...V-FAIN-GYRTTTMAIL
Q8U4N5_PYRFU/1-307---PKLTALTYLFGVP--SSVYLVL.............K--GKK.......----.IGFSFPFL-VALY-GYRTPILTSA
A6UX61_META3/12-346---VPFTALSR.LLLI--GWAITVA.............S--NLNLNRLKIL----IYSLVFSSL-IMLL-GYRTNGMILL
D3E1B0_METRM/66-429---PAFTMPVF.LIIP--GIGLMASHYLNQYKNNEISRS--QTRFRFLVLT----AIGIG...T-VLTL-QYRTPIIAIL
H3ZQY1_THELN/2-309---PHLTALTYFLGVP--SSVYLFS.............K--GKK.......----.YSLVYPFL-VALY-GYRTPVLVSF
A5UKQ8_METS3/66-411---PLFTMPVF.LIIP--GVCILASAYLKKFQENKITRS--QARFRFLILI----GISCV...F-LLAL-GYRTPLLAVL
Q6LY80_METMP/11-337---VIYTAFSH.TLPL--GWAIVVS.............S--S.KLSNKKIF----LYSGVFASL-VVLL-GYRTQVVVLL
Y419_METJA/11-336---VYFTTLSH.LFLV--GWAIVVA.............S--S.NIDKKKIL----LYTIIFSIL-IMLL-GYRTNVLVLL

PF14296

R5XEE1_9FIRM/13-476...TSIGFISMFSYCLPSATLLYWE-------------F..GNVKTMKWIL....FLI..MFSL.QMTR-GFRFFIIAIA
CAPE_STAAU/10-436...MYT..YGIFFFSI..GIAFAFS-------------N..VKKTH.IKYL....VIILTPQVLFFLIT-GNRGEVFYPI
A0A0U0LER3_STREE/11-477...YFTYILSTFTVYA..MCMYLAT-------------K..PKKLQATAVL....VSFIAANTI.HLAI-GTRNPFILSI
F5VZJ2_9STRE/11-477...YFTYILSTFTVYA..MCVYLAT-------------K..PKKSHATMVL....VAFITANLI.HLVI-GTRNPFILSL
E8JYK2_9STRE/12-475...YFTYTLSTFVVYA..MCIYLAT-------------K..PSKRHSTIVL....GLFVTANII.NLLI-GTRNPFVLSL
R6NPW6_9FIRM/14-489...GFFHTLASFARYS..ICVFLAT-------------L..PEKKKTFIPL....SLYVLSTIP.SLLI-GVRNPAMLSL
E5VCR2_9BACE/8-476...HFIGFIGSSFNLF..FFLYLST-------------M..PSKRELKYPF....LVFLLINTL.SLGY-GQRNGVVLAF
J8AZX0_BACCE/5-472...IWITKLAEMCPTA..LFIYLGT-------------L..PTKKKSFIPL....ILYVLLGCL.SLAV-GQRNNFVLNI
R7GXX5_9FIRM/11-468SYLYIISKMELIMPVA..WCIYLAT-------------L..PSKKQIKIPL....ILYILYLIV.SLGS-GQRSTAILGI
C7RDM6_ANAPD/5-467STLYFISKVESVMPVA..WAVYLGT-------------G..PDKKDMRFPL....TIYFIYLMI.TLGT-GQRSKFMLGI
K5ZBJ9_9PORP/11-476...ALIRVFGYMAPSA..FFLYLAT-------------M..PKKGEAKIVI....IMYFFYLLL.SLGT-GRRIYFMTGI
A8U9E2_9LACT/8-452....LFERIANFNTAY..IYIFLAT-------------L..PSKKLLRKSY....IIIIPLLLI.DLLT-GRRGIAIVNI
K6AW70_9PORP/7-478...NPILRISDDLCVA.GIYLYLST-------------F..PIGKKYILVS....CFYIFTLLI.LLGT-GGRSATFTQV
R7EEV2_9BACE/15-473...LFARASWGFFNIV..FPMLLMF-------------V..PSRKQFKYYC....VLFFLVSSV.SFLK-GSRSTLLAPI
K1GGB2_BACFG/20-455...FLISISRFIFEIG..FFLFLTS-------------L..PPKKKFLTVS....KVYILVMCL.FFLI-GVRNRVILSF
C5D952_GEOSW/7-469...KAASSVLSDFLIP..GTLFLLG-------------G..SNLKNKKIPLIISFILIIIYTFI.QFML-GSRSSAIMPL
Q4JZ50_STREE/17-471...TITVLFEKMFIAS.SVFLIVYL-------------K..SEETWSKFLK....VVILGWSIM.AALT-GDRTVGLAGI
M5J6L1_9LACO/12-465...GLF.NIATALFMP..ACLLIYC-------------Y..ESKRKHTFLN....IIYITSCIL.SLII-GDRTSGIGWI
R6LMR5_9CLOT/10-464...GLFNLARALFIPA..FFLLIIY-------------G..EDKK.FTKFS....KLVFFYMCVASLLS-GIRTDGILWL
C9AM09_ENTFC/4-437...IFFSATKGIATAS..LIMEAQK-------------FLTHHKNIRRLLV....SSFLFIYNV.NPFN-VSRYYISYVV

PF06899

WZYE_YERPE/1-448---GVALKRFFYFFIPAMLVVYFLK----------------QDRRAWFFFL----ASTVAFGILTYVIVGGTRANIIIAF
E0SKP9_DICD3/1-446---GVALKRFFYFFIPAMLMWYFLH----------------QTRRAWLIFL----LTTVAFGGLTYLLVGGTRANIIIAF
I2BE72_SHIBC/1-447---GVALKRFFYFFIPAMLVVYFLN----------------PTFKMWLFFL----ASTVAFGFLTYVIVGGTRANIIIAF
C5BBC5_EDWI9/1-448---GVALKRFFYFFIPAMLVVYFLR----------------QTQAAWLFFL----VSTVIFGLLTYVIVGGTRANIIIAF
E6WHF2_PANSA/1-446---GVALKRFFYFFIPAMLIRYFLN----------------PTQRQWLLFL----LVSVAFGLLTYALVGGTRANIIIAF
WZYE_SHIDS/1-447---GVALKRFFYFFIPAMLVVYFLR----------------QDSKAWLFFL----VSTVAFGLLTYMIVGGTRANIIIAF
Q2NQC5_SODGM/1-446---GVALKRFFYFFIPAMLLIYFLQ----------------PTRRRWIIFL----ITTVAFGIFTYLVVGGTRANIIIAF
I0DV18_PROSM/1-446---GVALKRFFYFFIPAMLIVYFLR----------------PSQKRWLFFL----VSTVAFGFLTYVIVGGTRANIIIAF

PF13425

R7NHG5_9MOLU/1-433LIFITIIVK.........KK---KILNNIVIISFSAFL----ITIIYMSENYSVMNL...KNSISVEETQ..........
Q81UH9_BACAN/9-459IALFFLFIEYMMHRKKEGKG---FTY.....LVNTIVA----AVVLGGLL..VLTPQ...TPIAKNMSIHLQIYEYKKSV
Q81JN2_BACAN/8-466IAVVMCFIQAFTQRKDGKKH---AYL......LNGFLA----MTVFVGIL..AYTPF...SPFMKNMGFHFQLIEQEQSA
R7L2W3_9CLOT/8-429GILIFSIIA.YAWKRKKIAK---STL.........IIT----LILTVAVA..IAMPY...SPSYKYIEGKINKIINQSKN
I0JRN9_HALH3/7-475IVFFSYLIYWLIQWKKKQKG---SLL..TLRLVLSFCF----LLLFA.....AVSPF...SPAFSNVAGDIGAIEEKTAE
R5AA62_9CLOT/11-484AFLALLVFR..........R---QQLLFCIPLCVALIA----VI........ACRGI...SPMAERQALTADSYAIYQEK
R5IY38_9CLOT/8-472FTSLLLLIR.LILRKEKLNF---INV......LIVLTT----FLVIFTFT..STYGY...ENFYNQKKMYDKDIKTDKPA
Q1G8D3_LACDA/2-497VSLIAWLVHLFCLKNVKFSK---GGL.........VTL----LALAGITG..VCWQV...SPAVQRYKYEIYLANS....
R6GEF5_9FIRM/3-434VLGFVCLIQKILYKTSSRN.---............IIR----CVIILLAYCTLYMAN...SPVRQNNGIMVTEHYEESVV
R5JB95_9FIRM/7-482MMIILYLFFALIMKNIKFEW---KKF.......LIIFL----IMIFGIFL..MLNAPIVSSNIDHHESTEE.........
R6GWD7_9FIRM/3-437CAFIFYFAYNKLIIKHKLNL---KSLFFLGGILLSIFV----FTIKLPIYTNLIGSY...ERAYENSGGNYCETCCPKFD
R5PWW6_9CLOT/19-494AYIAFTVLY.NLLNKNKLNK---KIL......TIGVII----LVLVGIAV..TIFGS...KTIERRRELKNKENEIYDTM
R5Z3Y2_9MOLU/8-506IMILCYFFF.IIIKKERFVL---KPF.........III----VVLIGLWF..VIYPY...SPCYNRLNGNNNDNN.....
R6YI35_9FIRM/11-484AFLALLLLR..........R---QQLLFCVPLAVALVV----LV........ACRGI...SPMAERQALTGDSYAIYQEK
R7HK69_9FIRM/6-439IYALYFIFN.........YK---KNRAYGLKWSIIIIV----ISFGLIPNIPAVKNL...QNAIS...............
R6AIT2_9CLOT/1-436ITLVFSVIK.........NK---FKMTYTVIKCLAVFI----FTLVLSLNSYAVYNYNYTKNNYYKDEQKEIVIDESNVV
Q74HR3_LACJO/2-501VFVLVFLIHSLILKNTRFSA---KFL.........ITL----ICILTASA..AIFPY...SPTLRRSSLESGVAQKRSNL
R5N8H6_9CLOT/21-493MYVAIEIIF......NKNKK---VAIIGSVICIIGVVA----FGIVGS............NTIKRRIQMKDAQFDIIDEK
R6XB97_9CLOT/19-487SYLILVVMY.KLIKNKKLNK---KNI......ILCVIC----FVNIAILV..ITIGS...ETLERRKQLNERRQEIQDDM
R6BI42_9CLOT/16-491MYCIICIIN.SLIKNSKLNK---KAL......PAFLLA----LVVIGIAV..IAFGS...KTIERRKDLQERENQIIDTM
R5XXD1_9CLOT/7-451VTIIMCIVN.AIKINKKIFM---KKILGILGILIFIVL----ILPYTAVGININRNYGINTDLLSRIKINGKEIENKS..

PF04932

Q97ER0_CLOAB/210-348....................---...............----..............S-----------------------
Q4JZ62_STREE/213-343....................---...............----..............D-----------------------
Q6MI87_BDEBA/207-358....................---...............----..............R-----------------------
Q6ASB4_DESPS/185-338EEIS................---...............----..............H-----------------------
A4B946_9GAMM/214-357....................---...............----..............M-----------------------
Q9X4C1_ECOLX/176-341SSAAQGID............---...............----..............F-----------------------
Q4K127_STREE/198-353....................---...............----..............Q-----------------------
Q04RV1_LEPBJ/208-370....................---...............----..............G-----------------------
Q7UXE7_RHOBA/267-417....................---...............----..............A-----------------------
Q2BFT2_9BACI/241-418PADQTEQPSDEERRFK....---...............----..............E-----------------------
A4CI06_ROBBH/191-347....................---...............----..............T-----------------------
A4AI36_9ACTN/211-357....................---...............----..............F-----------------------
B1Z898_METPB/188-338....................---...............----..............H-----------------------
Q09DA3_STIAD/195-349....................---...............----..............R-----------------------
Q5NZI1_AROAE/256-398....................---...............----..............F-----------------------
V6EXB6_9PROT/241-385....................---...............----..............S-----------------------
Q98C91_RHILO/186-337....................---...............----..............F-----------------------
Q8RNK4_KLEPN/160-294....................---...............----..............E-----------------------
A0K2I1_ARTS2/235-362....................---...............----..............G-----------------------
Q9RZA8_DEIRA/165-323....................---...............----..............R-----------------------
Q2N6C0_ERYLH/230-383....................---...............----..............I-----------------------
A4XML1_CALS8/220-429AALGIIGFIIALNMHLIPTS---IVDKIKSI.......----..............S-----------------------
O06944_SYNY3/232-381....................---...............----..............G-----------------------
A4AAF7_9GAMM/194-330....................---...............----..............F-----------------------
A6QBN3_SULNB/185-344....................---...............----..............G-----------------------
Q0G5C8_9RHIZ/213-362....................---...............----..............V-----------------------
A7VGX9_9CLOT/231-488KKGLRSVKDKKQASTMGCWK---VIFWSVVGILILTAF----VTVVTGVGNQWEIFT-----------------------
Q220X5_RHOFT/200-337....................---...............----..............Y-----------------------
Q7NQD3_CHRVO/200-366ARL.................---...............----..............A-----------------------
Q89SN4_BRADU/265-409....................---...............----..............V-----------------------
Q9AQJ1_STRAG/174-309....................---...............----..............N-----------------------
Q7UKM5_RHOBA/239-382D...................---...............----..............V-----------------------
Q11T24_CYTH3/244-416SVEDQFKSITN.........---...............----..............M-----------------------
Q89PW4_BRADU/213-357....................---...............----..............G-----------------------
A5G2R8_ACICJ/202-340....................---...............----..............F-----------------------
A0A0E2TJC6_ECOLX/196-350....................---...............----..............D-----------------------
Q4K230_STREE/187-326....................---...............----..............R-----------------------
Q7MVK6_PORGI/277-409....................---...............----..............S-----------------------
Q12C32_POLSJ/166-320....................---...............----..............A-----------------------
Q1J334_DEIGD/252-413TDSTGD..............---...............----..............E-----------------------
A6F4Q1_9ALTE/139-270....................---...............----..............F-----------------------
E1XBH8_HAEI1/179-336SYLEK...............---...............----..............N-----------------------
Q832Q1_ENTFA/206-388DNKENEILGNKKITTKRPDV---...............----..............E-----------------------
Q9X5H1_HELPX/195-362FEEDLKRYAK..........---...............----..............K-----------------------
Q01XB1_SOLUE/184-329....................---...............----..............A-----------------------
A7BD98_9ACTO/223-370....................---...............----..............F-----------------------
P74814_9SPHN/322-468....................---...............----..............G-----------------------
H9L4P0_VIBCH/171-330....................---...............----..............I-----------------------
Q7V9G4_PROMA/203-353LTDLQF..............---...............----..............A-----------------------
Q65SG0_MANSM/195-350FSLVIFS.............---...............----..............M-----------------------
Q7UPJ9_RHOBA/331-474....................---...............----..............D-----------------------
Q6ABG2_PROAC/212-358....................---...............----..............D-----------------------
A0A098GRN2_SALET/185-325....................---...............----..............Q-----------------------
D2AAY4_SHIF2/194-338....................---...............----..............K-----------------------
A6D015_9VIBR/218-369....................---...............----..............E-----------------------
A0PZ10_CLONN/222-380....................---...............----..............D-----------------------
A0Z5U1_9GAMM/194-332....................---...............----..............D-----------------------
A7Z9C6_BACMF/261-409....................---...............----..............Q-----------------------
Q2BRH4_NEPCE/186-340IS..................---...............----..............M-----------------------
Q97EP1_CLOAB/208-365KSIFD...............---...............----..............W-----------------------
A6M2N6_CLOB8/242-531KSVISDSLLLNINNQPTFLF---KLNDNKIFHLIDMST----KNYIDLQTPETFGFK-----------------------
A4ISY3_GEOTN/200-391SDSTNHVDGNSSDEDGGFLD---EEPDDE.........----..............E-----------------------
Q7UWZ2_RHOBA/233-380....................---...............----..............N-----------------------
Q8AA03_BACTN/192-346....................---...............----..............Q-----------------------
A6GZ05_FLAPJ/236-385....................---...............----..............R-----------------------
O31347_BACCE/178-330LGK.................---...............----..............G-----------------------
A5UWM4_ROSS1/288-436....................---...............----..............G-----------------------
Q83VQ8_9PROT/239-380....................---...............----..............Y-----------------------
Q1MQ48_LAWIP/199-337....................---...............----..............S-----------------------
Q2T0U3_BURTA/206-363....................---...............----..............M-----------------------
A3DIW4_CLOTH/315-453....................---...............----..............A-----------------------
A3XRK0_LEEBM/177-345LDKVGKLD............---...............----..............E-----------------------
Q5FQI9_GLUOX/196-353....................---...............----..............Q-----------------------
Q609Q8_METCA/225-373....................---...............----..............Q-----------------------
Q8P5K1_XANCP/219-372....................---...............----..............Q-----------------------
A9WJ46_CHLAA/273-406....................---...............----..............Q-----------------------
A5UY10_ROSS1/144-293....................---...............----..............A-----------------------

PF01901

D3E122_METRM/9-372LSILITLYYT--------RN...IKFKYQVLFLGLFLVIAVALLLAIGFIAVQ---A------ISWQHWSL..NPI-ELV
O26751_METTH/72-413LITFIMGYYS--------GL...FEIWEVLGSFAVALM....IIMGIGYF..R---S------VEEYSLSNL.GPL-TVL
A6USX2_META3/15-394IAFLVYRYQT--------KK...IKIKYILLSIIGLIG.....LLALMSKAIL---Y------TSNQNWNI..GVF-GIL
O27510_METTH/4-337LSGTITLYYS--------AR...PSWRELGVLISALAV....AALLVGYVAVK---S------IEWQTWTL..NPV-ELL
R9SNY6_9EURY/64-410LLMIIIGYYG--------DS...VSIGEVIVLALIGLA....GIIGIGYL..R---S------VNEMLITTSTNPF-YTL
Q2NHP9_METST/7-347LSVLITIYYT--------RN...LPWKYLFIALVAIFI....LLLVVGYVAVQ---S------IEWQTWTL..NPL-ELL
D7DRV2_METV3/10-352LSTIFVMYYN--------NK...LSNKQVVYPVVGLAL....IVLVMSVL...---.------.RFYALNIGGNP.-..I
Q6LY81_METMP/20-375VAFLLYNYKN--------NK...ISAKKIFLIGIFTVL.....FLGIMAKAIL---S------SSGQSWSL..NFL-EIL
A5UMJ3_METS3/7-344ASIFITMYYI--------NK...INRKIGILFVGLIII....GLLAIGYIASQ---S------ISGQHWML..NPL-ELI
R9SIQ2_9EURY/7-375LSSFITIFYT--------RN...ISRKTKILFVALIIV....LLLAIGFIAVR---S------IEWQHWTL..NPL-ELI
Y420_METJA/14-363IAYIIYRY..--------RN...ILFKYMVLLAFALLI.....FLGIMGKIIL---L------SSNQNWDL..NPI-ELL
B1L722_KORCO/85-415LAILTVLYNR--------KL...IGLGFITTAFMMLII....SFIGVGAF...---.------.RSIATGLVQNPI-ISV
U6EAH7_9EURY/7-365LSGFITIYYT--------RK...MKTSHILIAILLIGL....VGIAAGYIAVM---S------IQWQQWSL..NPL-QLV
Q8U4N5_PYRFU/1-307IALALPYLYE--------MKEGTIKKGLLVGVIGGIVA....LLLSIL.....---.------..........RGS-TEF
A6UX61_META3/12-346LSILFVAYYS--------NR...IKTKELIYSSGGLFL....ILIAMSLQ...---.------.RLYTMGIGGIP.-..L
D3E1B0_METRM/66-429LMMIIIGYYG--------KI...LSVWEVILGALLGVC....AIIGIGYL..R---S------LNELAISSNTNIF-STL
H3ZQY1_THELN/2-309LAFAVAYFDG--------KD...IELKHLAGFSLLILA....GLVGIALA...---.------........RGEAL-GTQ
A5UKQ8_METS3/66-411LIMIIIGYYG--------NI...LAVWEVVVGALIGVC....AIIGIGYF..R---S------VEEYTVTSATNPF-YTL
Q6LY80_METMP/11-337LSTIFAMYYS--------EK...IKNKLMIYSLIGLAL....VVFGLSFL...---.------.RHFILNIGGNP.-..I
Y419_METJA/11-336ISVGAILYYK--------NK...ISNREILKYGILVFV....ILLGLSIL...---.------.RLYALGVEGNP.-..I

PF14296

R5XEE1_9FIRM/13-476ITFFAYYYIKAN......RR---PKMKTVLLAVLAIIF----VVVFMTIFRSAIRTG......NGVDFSQFNAENIKEAF
CAPE_STAAU/10-436LSALGVLIVRNY.......K---IK...WWMIITIVFT----LFFVIPFIKVF.RNM......DSSSIEKVD.INW.FSS
A0A0U0LER3_STREE/11-477LFAFVYYFMREQTEKG..KW---IGFKEKLAIFVGSPI----LMLAMGVLNYV.RDN......VQVSHTGFW.DIL.LDF
F5VZJ2_9STRE/11-477IFAFVYYFMREQTEKG..KW---IGFKEKIAIYLGTPV----LMLAMGALNYV.RDN......AQVSHSGVF.DLL.LDF
E8JYK2_9STRE/12-475IFSFIYYFMRNQTEKG..VW---IGIKEKAILYIGTPI----MMLVMGFLNYA.RDG......AGIGNMSFS.ELL.IDF
R6NPW6_9FIRM/14-489LFVLSYYLLRDFLVDD.KKW---IGKIEKGLLAICTPA----LIIFMGVYAYI.RSG......LKIVTGNFL.TLI.ADF
E5VCR2_9BACE/8-476CFLIAYLILRNTVNSGGKVW---FGKREYIICGIITPF----ALSFLLAFGYI.RNE......LDHESKNIF.DSA.ISF
J8AZX0_BACCE/5-472LIVLVYLCLRNYTDKK.EKW---FGKKEITACICALPF----MILLLNAVSYL.RMD......NSVEH.SFS.DGI.IEF
R7GXX5_9FIRM/11-468LFVFVYFIYRNGMNSE.EKW---LTKKMIVGIILILPF----LAVFVSAYNIW.REG......GNASSLNFF.EGI.LNF
C7RDM6_ANAPD/5-467LTIFTYYTLRNQ...EGEIW---VSKKMMFKIVLSLPF----LAMFISLYDIW.REG......NPVESINFF.ESI.IKF
K5ZBJ9_9PORP/11-476LIIFAYMMLRNIVNPERKPW---INKKQLIYICVLVPV----LLTFMYLFEYI.RSE......HAVGTASAY.SPL.LGF
A8U9E2_9LACT/8-452MVLITYEILRLVISNRNLNK---LNFKYLFPISLITII----VLFSANIVSQI.RLD......EQ...IKIE.SIF.SSF
K6AW70_9PORP/7-478LAFLVYLGIRGIRVN..WRW---MLR.....FVLIGFS----LIYVAQLVNDF.RDSGFKDLDQKKDDVVFT.QLI.QSF
R7EEV2_9BACE/15-473VYFIWFYYSFYST.....KK---ISVK.NIACFILFVA----..FVAQGILFL.RDK......DASFNLSIS.QML.FAL
K1GGB2_BACFG/20-455LFVLWFYY.RFYSKKS..PK---ILF..LLIISISSVA----LLLLVQLV....RQA......GVFLLSDDR.SIF.SYF
C5D952_GEOSW/7-469IAYLWLFDMKI.......KK---IP..RLPLLSAGAII----LFIIFPFIGFI.RNS......TE...LNLL.DAF.REF
Q4JZ50_STREE/17-471VTLALIQTL...IGNR.KKK---IKFSQYALLVGAAVV----VMYLMSFAFQF.RMQ......QDSKVSGLQ.TAV.VEM
M5J6L1_9LACO/12-465V.AFVFYRYSERSKNMKKNS---IS..RPLIIGIIFCL----IIYLSFYIGYA.RVN......SEISSLSPI.KVL.ESF
R6LMR5_9CLOT/10-464LTYLYTS.....VKKGNKKK---LNIKYLVLLVG...I----VMV.AIYVGQS.RVG......ST.IGSSVG.DVL.VKV
C9AM09_ENTFC/4-437ILFMLIFFT.........KK---IKVNQMLILLIL..G----MFFIFPLLNFF.RNG......LTFVD...F.SSY.INL

PF06899

WZYE_YERPE/1-448SLFLFIGIVR--------GW---ITLWMLAAAGVFGIV----GMFWLALKRYG----------LDVNGAEAF-----YTF
E0SKP9_DICD3/1-446ALFLFIGLQR--------GW---IAWWMLAAAGGGGIV----AMFWLALKRYG----------LDVQGEEAF-----YTF
I2BE72_SHIBC/1-447ALFLFIGIVR--------GW---ISLWMLASAGAAGVV----GMFWLALKRYG----------LNVSGDEAF-----YTF
C5BBC5_EDWI9/1-448ALFLFIGIQR--------GW---ITLWMLALAGVVGVV----GMFWLALKRYG----------LAVSGDEAF-----YTF
E6WHF2_PANSA/1-446ALFLFIGITR--------GW---ITLWMLAGAGVMAIG----GMFWLALRRYN----------LDVMGDEAF-----YTF
WZYE_SHIDS/1-447AIFLFIGIIR--------GW---ISLWMLAAAGVLGIV----GMFWLALKRYG----------MNVSGDEAF-----YTF
Q2NQC5_SODGM/1-446ALFLFIGIQR--------GW---ITLWMLAGAGVVAIG----GMFWLALKRYG----------LNVSSDEAF-----YTF
I0DV18_PROSM/1-446ALFLFIGIVR--------RW---ITLWMLVAAGVASII----GMFWLALKRYG----------LDVSGAEAF-----YTF

PF13425

R7NHG5_9MOLU/1-433..............ETIEIENE......................................................ISKY
Q81UH9_BACAN/9-459Q.............DEKDRKEG................................................KVVKEEEHK.
Q81JN2_BACAN/8-466K.............KEEKKKEE..........................................AKEHKPPVTQQEKEKE
R7L2W3_9CLOT/8-429P.............DGEENNQS..........................................................
I0JRN9_HALH3/7-475Q.............EEKDKPSD.....................................TGDQDPGDKESEGSSDSDQAK
R5AA62_9CLOT/11-484ADEIMGEDKDFVYKKGEEIPPE..............ILEKITKVYTDVYGQPGLYGATLLEDLIEEFGLEAVMEQYDYAT
R5IY38_9CLOT/8-472L.............EDYIREEN.....................INKITDDKYNSEHIYK..........NDFEIILSKAI
Q1G8D3_LACDA/2-497..............HDSKIDQENALLKAGLAKYKNDPDKLKEFEKYFLAKYYQKYALNK..........RFITKSYPYKY
R6GEF5_9FIRM/3-434E.............KEEALENE..........................................................
R5JB95_9FIRM/7-482..............ELQKMRDE......................NVPTIKMLGYIGMNE..........EYYKEIYPYKD
R6GWD7_9FIRM/3-437K.............TSEEIRNE..........................................................
R5PWW6_9CLOT/19-494TNQTAHVTGDTVELVKKIKAGQ.........................MDENYMSESMQ...........QAYLNLYNIAN
R5Z3Y2_9MOLU/8-506..............KNNEVIEDGKFNKFLLTLNSLSEYDKINYSKTFIKENYKYFGIRK..........DYMFKKYSYEY
R6YI35_9FIRM/11-484ADAILGEDAGYTHQPGEEVPPE..............LLEKITRVYTEVYDQPGIYGVTLLSDLIDEFGLEAVMEQYNYAT
R7HK69_9FIRM/6-439..............ESSHIKEE.................................................VKEDNEKEN
R6AIT2_9CLOT/1-436..............EVETIKNN..........................................................
Q74HR3_LACJO/2-501G.............DKKRLDQE.....LNAGLERYKGKKQEDYLKEFIKKNYWVYSLKH..........DLVLEHYTYQN
R5N8H6_9CLOT/21-493TGEIGCLTGDMLRIKNKIIDNT.........................LEDNYLRDDEK...........QSVIDLYEFAK
R6XB97_9CLOT/19-487TSKTAHVTGDIVKIVKKIKNNE.........................MDSKYMSREMQ...........DAYLKLYNIAN
R6BI42_9CLOT/16-491TGKTAHVTGDIVDIVKKIKNNE.........................IDEGYMPESMQ...........KTYLELYDIAN
R5XXD1_9CLOT/7-451..............NTEKIFNN..........................................................

PF04932

Q97ER0_CLOAB/210-348--------------ASYIKAD.----------------------------------------------------------
Q4JZ62_STREE/213-343--------------NKSGTGS.----------------------------------------------------------
Q6MI87_BDEBA/207-358--------------EAQDGIA.----------------------------------------------------------
Q6ASB4_DESPS/185-338--------------GKFNNVS.----------------------------------------------------------
A4B946_9GAMM/214-357--------------GEDQTSV.----------------------------------------------------------
Q9X4C1_ECOLX/176-341--------------QRVGTFI.----------------------------------------------------------
Q4K127_STREE/198-353--------------EHNINSM.----------------------------------------------------------
Q04RV1_LEPBJ/208-370--------------KEKHTDS.----------------------------------------------------------
Q7UXE7_RHOBA/267-417--------------DAAKSVE.----------------------------------------------------------
Q2BFT2_9BACI/241-418--------------TFEMSTVE----------------------------------------------------------
A4CI06_ROBBH/191-347--------------EYWGGRG.----------------------------------------------------------
A4AI36_9ACTN/211-357--------------DASGDLT.----------------------------------------------------------
B1Z898_METPB/188-338--------------ERLTQSS.----------------------------------------------------------
Q09DA3_STIAD/195-349--------------SVETLRR.----------------------------------------------------------
Q5NZI1_AROAE/256-398--------------AQDATAD.----------------------------------------------------------
V6EXB6_9PROT/241-385--------------GEGDLTG.----------------------------------------------------------
Q98C91_RHILO/186-337--------------GKDSTLT.----------------------------------------------------------
Q8RNK4_KLEPN/160-294--------------ELGTQSG.----------------------------------------------------------
A0K2I1_ARTS2/235-362--------------GQDPSLK.----------------------------------------------------------
Q9RZA8_DEIRA/165-323--------------LLNDQTS.----------------------------------------------------------
Q2N6C0_ERYLH/230-383--------------VADEIGG.----------------------------------------------------------
A4XML1_CALS8/220-429--------------FKDRNFV.----------------------------------------------------------
O06944_SYNY3/232-381--------------QGAGQFA.----------------------------------------------------------
A4AAF7_9GAMM/194-330--------------SLPPSLL.----------------------------------------------------------
A6QBN3_SULNB/185-344--------------QFTSSWG.----------------------------------------------------------
Q0G5C8_9RHIZ/213-362--------------MPGTTFT.----------------------------------------------------------
A7VGX9_9CLOT/231-488--------------FDDEWGN.----------------------------------------------------------
Q220X5_RHOFT/200-337--------------EQDHSAM.----------------------------------------------------------
Q7NQD3_CHRVO/200-366--------------ANGDDMG.----------------------------------------------------------
Q89SN4_BRADU/265-409--------------EHGLIDP.----------------------------------------------------------
Q9AQJ1_STRAG/174-309--------------LRSGSSE.----------------------------------------------------------
Q7UKM5_RHOBA/239-382--------------NELTSAT.----------------------------------------------------------
Q11T24_CYTH3/244-416--------------NTDVSNM.----------------------------------------------------------
Q89PW4_BRADU/213-357--------------DASVDLT.----------------------------------------------------------
A5G2R8_ACICJ/202-340--------------HHSNSAN.----------------------------------------------------------
A0A0E2TJC6_ECOLX/196-350--------------NTRTSVG.----------------------------------------------------------
Q4K230_STREE/187-326--------------YFDFTFN.----------------------------------------------------------
Q7MVK6_PORGI/277-409--------------HRFFADG.----------------------------------------------------------
Q12C32_POLSJ/166-320--------------QPNTSSG.----------------------------------------------------------
Q1J334_DEIGD/252-413--------------ARDGSRR.----------------------------------------------------------
A6F4Q1_9ALTE/139-270--------------ILSRGLS.----------------------------------------------------------
E1XBH8_HAEI1/179-336--------------NRNTSLG.----------------------------------------------------------
Q832Q1_ENTFA/206-388--------------GKDDISN.----------------------------------------------------------
Q9X5H1_HELPX/195-362--------------DADSSIG.----------------------------------------------------------
Q01XB1_SOLUE/184-329--------------GDLDSNQ.----------------------------------------------------------
A7BD98_9ACTO/223-370--------------GRSPDMS.----------------------------------------------------------
P74814_9SPHN/322-468--------------ATQASND.----------------------------------------------------------
H9L4P0_VIBCH/171-330--------------HAAASSG.----------------------------------------------------------
Q7V9G4_PROMA/203-353--------------TDRPIEA.----------------------------------------------------------
Q65SG0_MANSM/195-350--------------GDDKSVG.----------------------------------------------------------
Q7UPJ9_RHOBA/331-474--------------ALPESVR.----------------------------------------------------------
Q6ABG2_PROAC/212-358--------------EGPSSFA.----------------------------------------------------------
A0A098GRN2_SALET/185-325--------------ASRGSTQ.----------------------------------------------------------
D2AAY4_SHIF2/194-338--------------LQQTNSS.----------------------------------------------------------
A6D015_9VIBR/218-369--------------QKASFTD.----------------------------------------------------------
A0PZ10_CLONN/222-380--------------KNNISNI.----------------------------------------------------------
A0Z5U1_9GAMM/194-332--------------QTDKSLG.----------------------------------------------------------
A7Z9C6_BACMF/261-409--------------QPLPSNL.----------------------------------------------------------
Q2BRH4_NEPCE/186-340--------------TAIQQID.----------------------------------------------------------
Q97EP1_CLOAB/208-365--------------NSDGSNL.----------------------------------------------------------
A6M2N6_CLOB8/242-531--------------GKEKLGS.----------------------------------------------------------
A4ISY3_GEOTN/200-391--------------ATQDEETT----------------------------------------------------------
Q7UWZ2_RHOBA/233-380--------------ADTLQKD.----------------------------------------------------------
Q8AA03_BACTN/192-346--------------MKADSAN.----------------------------------------------------------
A6GZ05_FLAPJ/236-385--------------VKSTLLS.----------------------------------------------------------
O31347_BACCE/178-330--------------ANEGSIN.----------------------------------------------------------
A5UWM4_ROSS1/288-436--------------PGGGSVD.----------------------------------------------------------
Q83VQ8_9PROT/239-380--------------AKLNSYA.----------------------------------------------------------
Q1MQ48_LAWIP/199-337--------------WETMLND.----------------------------------------------------------
Q2T0U3_BURTA/206-363--------------RDAGQIA.----------------------------------------------------------
A3DIW4_CLOTH/315-453--------------AQDTSTQ.----------------------------------------------------------
A3XRK0_LEEBM/177-345--------------LDNPEASA----------------------------------------------------------
Q5FQI9_GLUOX/196-353--------------LTHFGQS.----------------------------------------------------------
Q609Q8_METCA/225-373--------------TTVAEAS.----------------------------------------------------------
Q8P5K1_XANCP/219-372--------------GVDQALS.----------------------------------------------------------
A9WJ46_CHLAA/273-406--------------FRDQAQQ.----------------------------------------------------------
A5UY10_ROSS1/144-293--------------SAALRAA.----------------------------------------------------------

PF01901

D3E122_METRM/9-372SYRA----------AFTLNVL-----------------------------------------------------------
O26751_METTH/72-413KMRA----------SFTMSIL-----------------------------------------------------------
A6USX2_META3/15-394SYRA----------YFDIMVL-----------------------------------------------------------
O27510_METTH/4-337LYRA----------GYTLTVF-----------------------------------------------------------
R9SNY6_9EURY/64-410QSRA----------DFTIHVL-----------------------------------------------------------
Q2NHP9_METST/7-347FYRA----------GYTLQVL-----------------------------------------------------------
D7DRV2_METV3/10-352VSRI----------QLTMNIL-----------------------------------------------------------
Q6LY81_METMP/20-375SYRA----------YFDLMTL-----------------------------------------------------------
A5UMJ3_METS3/7-344FYRA----------GFTLEVF-----------------------------------------------------------
R9SIQ2_9EURY/7-375SYRA----------AFTLNVL-----------------------------------------------------------
Y420_METJA/14-363CYRA----------YFDLYVL-----------------------------------------------------------
B1L722_KORCO/85-415LYRP----------TITVAAL-----------------------------------------------------------
U6EAH7_9EURY/7-365AYRA----------GFTMMVF-----------------------------------------------------------
Q8U4N5_PYRFU/1-307LVRI----------QGTTSVL-----------------------------------------------------------
A6UX61_META3/12-346ISRI----------DLTMSVF-----------------------------------------------------------
D3E1B0_METRM/66-429NSRA----------NFTMHVL-----------------------------------------------------------
H3ZQY1_THELN/2-309LVRV----------QATTSVL-----------------------------------------------------------
A5UKQ8_METS3/66-411ESRA----------DFTLNVL-----------------------------------------------------------
Q6LY80_METMP/11-337LSRI----------DLTMSIF-----------------------------------------------------------
Y419_METJA/11-336TSRI----------SLTMSIY-----------------------------------------------------------

PF14296

R5XEE1_9FIRM/13-476DEAI..........WDNFRIY-----------------------------------------------------------
CAPE_STAAU/10-436LVEI..........GYTLRPL-----------------------------------------------------------
A0A0U0LER3_STREE/11-477IYKQ..........GTSFGVL-----------------------------------------------------------
F5VZJ2_9STRE/11-477IYKQ..........GTSFGVL-----------------------------------------------------------
E8JYK2_9STRE/12-475IYKQ..........GTSFGVL-----------------------------------------------------------
R6NPW6_9FIRM/14-489FYGQ..........GVTFNVT-----------------------------------------------------------
E5VCR2_9BACE/8-476FQGQ..........GVSVNVI-----------------------------------------------------------
J8AZX0_BACCE/5-472FYAQ..........GVSVNLI-----------------------------------------------------------
R7GXX5_9FIRM/11-468FYDQ..........GVTGNVL-----------------------------------------------------------
C7RDM6_ANAPD/5-467FYDQ..........GVTSNIV-----------------------------------------------------------
K5ZBJ9_9PORP/11-476FVRQ..........GTSINVI-----------------------------------------------------------
A8U9E2_9LACT/8-452FNQQ..........SQTYEMI-----------------------------------------------------------
K6AW70_9PORP/7-478FWQQ..........GTSIQTI-----------------------------------------------------------
R7EEV2_9BACE/15-473FYSQ..........GATYVLL-----------------------------------------------------------
K1GGB2_BACFG/20-455FYAQ..........STNFYIL-----------------------------------------------------------
C5D952_GEOSW/7-469FMVQNPAIAILNEMGGSMSTV-----------------------------------------------------------
Q4JZ50_STREE/17-471IGTL..........GFSFFPL-----------------------------------------------------------
M5J6L1_9LACO/12-465VAEM..........GFNFTTI-----------------------------------------------------------
R6LMR5_9CLOT/10-464VEEM..........GFNFTTI-----------------------------------------------------------
C9AM09_ENTFC/4-437IREQ..........FVSLHFD-----------------------------------------------------------

PF06899

WZYE_YERPE/1-448LYLT----------RDTFSPW-----------------------------------------------------------
E0SKP9_DICD3/1-446LYLT----------RDTFSPW-----------------------------------------------------------
I2BE72_SHIBC/1-447LYLT----------RDTFSPW-----------------------------------------------------------
C5BBC5_EDWI9/1-448LYLT----------RDTFSPW-----------------------------------------------------------
E6WHF2_PANSA/1-446LYLT----------RDTFSPW-----------------------------------------------------------
WZYE_SHIDS/1-447LYLT----------RDTFSPW-----------------------------------------------------------
Q2NQC5_SODGM/1-446LYLT----------RDTFSPW-----------------------------------------------------------
I0DV18_PROSM/1-446LYLT----------RDTFSPW-----------------------------------------------------------

PF13425

R7NHG5_9MOLU/1-433YEKNKFLSSIKNLGSILLSDRDVY-AL-NSYY-------IYS..EN----YRPSYLLFGMG-------------------
Q81UH9_BACAN/9-459....QGELTDSEMKSLIYSDRDKF-LK-VYKQ-------YYK...E----APLSQKLFGMG-------------------
Q81JN2_BACAN/8-466KEKEKVAEKKEETQALIFSGRQLF-EQ-MYKD-------FYN...E----APMSQKLLGMG-------------------
R7L2W3_9CLOT/8-429...........SVENLIFNGREKY-VY-EQKQ-------LAG...N----ASPLELLIGLK-------------------
I0JRN9_HALH3/7-475QEEEQAKLMDSPILVILLSARNLY-FA-ELYQ-------DYT...N----ADIVQKTFGMG-------------------
R5AA62_9CLOT/11-484DPQT............LYNSRVKK-LT-AMEM-------VWQ...D----QDALTKLLGVE-------------------
R5IY38_9CLOT/8-472KKYKTPDFAS.......FDNRTVQ-LK-INKE-------LFK...L----SPIKDRLLGYG-------------------
Q1G8D3_LACDA/2-497DPQFWIDLLKEPA.SVRLANRKVE-EA-MLKQ-------VVK..YD----NDPLDKWLGIG-------------------
R6GEF5_9FIRM/3-434..ENIQKNKAYLVINWLLSNRLVY-VE-GTIN-------RYC...T----GTVSEKLLGLG-------------------
R5JB95_9FIRM/7-482HKDFWQYVLDDVAPTRRVGNRNSQ-QL-VTND-------VAK..TY----EDFPRSLFGLG-------------------
R6GWD7_9FIRM/3-437...........ISSSLVFNGRDDF-LI-ANKA-------MYK...N----STLFSKLYGLT-------------------
R5PWW6_9CLOT/19-494EKQISNT...........NMRTLQ-LI-YHSN-------LIK..EQ----NSIPMLLFGNG-------------------
R5Z3Y2_9MOLU/8-506DPLFWIEMYNEDTFNKK.DNRFIA-EK-VLQR-------IEQNNTN----NKTGVKLFGEG-------------------
R6YI35_9FIRM/11-484DPQT............LYNTRVKK-LT-AMEM-------VWQ...K----QDFLTRILGFE-------------------
R7HK69_9FIRM/6-439NKYASSSPSVQRIIKVALSGRDKF-FY-NTLE-------IYD...N----ANIDDKLLGIG-------------------
R6AIT2_9CLOT/1-436ILRFYDTNKLSKIVKPLISGRDML-LA-NTLS-------VYD..DI----NDDSNIWFGIG-------------------
Q74HR3_LACJO/2-501DPYYWLEVMKRPA.NERLNYRHLE-KD-ILNR-------VMK..TD----KNKSNKLFGIS-------------------
R5N8H6_9CLOT/21-493EHKFAGN...........DTRRQQ-FI-YNTF-------LMK..NQ----KSISKLLFGNG-------------------
R6XB97_9CLOT/19-487EKQISNT...........DRRRLQ-II-YHSY-------LIK..EQ----KNILTIMLGNG-------------------
R6BI42_9CLOT/16-491EKQIQNT...........NMRALQ-FI-YHSR-------LIK..NQ----DSIPMLLFGNG-------------------
R5XXD1_9CLOT/7-451.........KEEVTTAALSGRNLF-LR-NNMN-------EFT...E----GKGANKLFGIG-------------------

PF04932

Q97ER0_CLOAB/210-348--------------.....NRWIK.WQ.VAIE-------YIK--.K----Y......WAIG...................
Q4JZ62_STREE/213-343--------------...ATIRFDD.YK.AGFL-------AWQ--.K----SPI....WGLG...................
Q6MI87_BDEBA/207-358--------------.....SRWEE.VE.RGSQ-------IFL--.Q----QPW....LGHG...................
Q6ASB4_DESPS/185-338--------------.....LRIA..WQINSLK-------LIA--.E----APF....LGTG...................
A4B946_9GAMM/214-357--------------.....QRMLY.WT.NGID-------MIA--.D----HPM....TGVG.Y..YNF..........IP
Q9X4C1_ECOLX/176-341--------------.....DRLYYLWP.RAFD-------NFI--.H----SPL....LGLG.F..GSY......DDLYYR
Q4K127_STREE/198-353--------------.....ARTDL.WK.GVES-------TYN--.F----APIF...MGRG.................IG
Q04RV1_LEPBJ/208-370--------------.....GRTFI.WD.STFP-------LIR--.D----NFF....AGVG.P..GNY......DREIEK
Q7UXE7_RHOBA/267-417--------------.....LRPLL.AL.VAYE-------MFL--.D----RPL....GGHG..............YGNYF
Q2BFT2_9BACI/241-418--------------LSKTTGRLFI.VN.KGFE-------IFK--.D----HPV....IGTG.F..............ATY
A4CI06_ROBBH/191-347--------------.....FRELI.WD.CTAH-------VIE--.A----NPA....LGTG.Y..GDQ...........Q
A4AI36_9ACTN/211-357--------------.....YRLRV.WR.QLWS-------LGE--.I----HRL....EGWG.................WI
B1Z898_METPB/188-338--------------.....SRARVAIA.QSFG-------AAV--AQ----APW....IGSG.YGMGLR............
Q09DA3_STIAD/195-349--------------.....GKVEL.WP.MMAE-------AAW--.A----FPV....LGMG...................
Q5NZI1_AROAE/256-398--------------.....ARWPI.LD.ATLE-------AAS--AF----FP.....FGSG..................M
V6EXB6_9PROT/241-385--------------.....DRPNL.MR.LTWI-------AIG--.D----APL....TGHG..................L
Q98C91_RHILO/186-337--------------.....GRTYL.WE.QGWN-------AAQ--.R----SPI....LGVG..............YAAYW
Q8RNK4_KLEPN/160-294--------------.....LRLSI.WH.HTLS-------EMA--.S----QPW....LGRG...................
A0K2I1_ARTS2/235-362--------------.....SRTDS.YD.VVSS-------FVE--.M----NPL....LGRG...................
Q9RZA8_DEIRA/165-323--------------.....GREYV.WQ.DAVS-------GWE--.T----SPL....GGVGPYQGGPYLTYLFKDGCQLT
Q2N6C0_ERYLH/230-383--------------.....IRQEA.LP.TILD-------MIR--TY----FPFG...TGIG...................
A4XML1_CALS8/220-429--------------.....ERLVF.YK.DGLK-------IFL--.K----SPI....FGYG...................
O06944_SYNY3/232-381--------------.....YRLIN.FE.IGWR-------MGS--.A----HPW....TGIG.................LG
A4AAF7_9GAMM/194-330--------------.....ERRRI.YA.ELLL-------QLW--.E----SPF....TGFG...................
A6QBN3_SULNB/185-344--------------.....MRVAM.YI.VAAD-------IIK--.D----HPL....IGVG.V..GDF........RDAA
Q0G5C8_9RHIZ/213-362--------------.....GRTDL.WR.FTLD-------LMR--.P----QQW....IGYG.I..DSF...........W
A7VGX9_9CLOT/231-488--------------.....YRGYV.WN.RLFR-------IYQ--.D----LPFVNKVFGTG................NES
Q220X5_RHOFT/200-337--------------.....GRIEA.WK.MTIN-------LAN--.R----HV.....FGGG...................
Q7NQD3_CHRVO/200-366--------------.....ARRFAEMH.KAWL-------AFK--.A----HPL....WGVG.............WSQYAA
Q89SN4_BRADU/265-409--------------.....QRIAA.YQ.ASLG-------IIA--.D----HQL....LGIG..................L
Q9AQJ1_STRAG/174-309--------------.....SRFSL.YK.DTVH-------SVI--TD----SLF....LGKG...................
Q7UKM5_RHOBA/239-382--------------.....GRTEI.WA.EAIR-------FIA--.Q----RPL....TGWG...................
Q11T24_CYTH3/244-416--------------.....ERLNR.WS.SAIR-------MIK--.D----KPF....LGFG.Y..GMY...QHKYFPYQK
Q89PW4_BRADU/213-357--------------.....ERTFI.WH.YAIS-------HFD--.D----APL....LGFG..................I
A5G2R8_ACICJ/202-340--------------.....ERMTV.WR.DAFG-------IAL--.H----NPL....TGGG...................
A0A0E2TJC6_ECOLX/196-350--------------.....ARLAM.YE.VGLK-------TYS--..----.P.....IGQS.L.............EKRA
Q4K230_STREE/187-326--------------.....GRYQI.WR.IVYA-------TIL--.Q----VKW....FGYG...................
Q7MVK6_PORGI/277-409--------------.....ERMQM.RD.IAMD-------AIN--.R----HPW....TGIR...................
Q12C32_POLSJ/166-320--------------.....LRLHF.WM.NSIQ-------MIA--.R----HPV....AGSG...............VGSW
Q1J334_DEIGD/252-413--------------.....WRLNW.WN.DIVN-------YTV--.H----GPY....FWTG.................KG
A6F4Q1_9ALTE/139-270--------------.....WRPAI.WM.STLD-------SIG--.S----APF....FGHG...................
E1XBH8_HAEI1/179-336--------------.....ARFDM.WE.NALI-------AIK--.E----API....FGHG................SNG
Q832Q1_ENTFA/206-388--------------.....SRFAL.WQ.SAID-------LMK--.L----NPI....FGTS...................
Q9X5H1_HELPX/195-362--------------.....WRLER.WK.EALT-------VLR--.L----RPL....FGMA.............ASEKCQ
Q01XB1_SOLUE/184-329--------------.....FRVVC.RR.AGWA-------IVK--.Q----HPW....FGIG.P..EQV..........NQ
A7BD98_9ACTO/223-370--------------.....GRSVI.WH.AVAP-------LVR--.Q----RPI....GGWG................WFI
P74814_9SPHN/322-468--------------.....GRHEQ.IR.MGLP-------KLA--.M----RPV....FGYG...................
H9L4P0_VIBCH/171-330--------------.....GRLQL.WY.AAVE-------AFK--.H----NPI....WGTT.Y.............SERE
Q7V9G4_PROMA/203-353--------------.....TRIFQ.WK.DAIA-------LFY--.Q----KPW....FGYG...................
Q65SG0_MANSM/195-350--------------.....YRTEI.YT.TFLD-------NFK--..----ILW....LGYG...................
Q7UPJ9_RHOBA/331-474--------------.....YRFQY.WD.ATWR-------LVE--.Y----SPW....TGSG...................
Q6ABG2_PROAC/212-358--------------.....VRTTL.LA.WGLA-------LVM--.E----YPL....LGAG...................
A0A098GRN2_SALET/185-325--------------.....GRIDM.AI.NSLN-------FLS--.E----HP.....SGIG...................
D2AAY4_SHIF2/194-338--------------.....YRYANGTQGSALD-------LIL--.E----NPV....IGYG...............YGNV
A6D015_9VIBR/218-369--------------.....IRATI.YS.QSID-------MLI--.E----KPF....TGYG.L..GKF........EPEY
A0PZ10_CLONN/222-380--------------.....TRFTS.QK.ISLD-------LGI--.N----NFV....FGVG.LGQYAF.........YFK
A0Z5U1_9GAMM/194-332--------------.....LREAL.FE.QGVN-------AFL--.A----TPW....FGGG................YQA
A7Z9C6_BACMF/261-409--------------.....ARANL.LK.NAFH-------YVI--.D----SWG....FGVG...................
Q2BRH4_NEPCE/186-340--------------.....IRAEY.YI.LSFL-------TFL--.Q----NWF....IGCG.L..GCF.........PEA
Q97EP1_CLOAB/208-365--------------.....LRKYY.WI.SFIN-------LFR--.R----NFL....YGIG...................
A6M2N6_CLOB8/242-531--------------.....SRGYI.WS.RSLP-------LIK--.N----TMI....LGTG.P..DTF..........VF
A4ISY3_GEOTN/200-391--------------NRAVVSRVTL.WK.TGWV-------MMK--.E----NPV....IGVG.I..GNY............
Q7UWZ2_RHOBA/233-380--------------.....GRLLH.WQ.DGWN-------AAM--AY----LP.....MGSG...................
Q8AA03_BACTN/192-346--------------.....GRLFI.WK.TTCK-------VIA--.N----KPL....LGYG.P..GTF.....SHVYGEM
A6GZ05_FLAPJ/236-385--------------.....GREEI.IG.SEFD-------MFL--.A----NPI....FGIG...................
O31347_BACCE/178-330--------------.....IRANM.ID.MGLD-------WFQ--.E----RPI....TGYG...................
A5UWM4_ROSS1/288-436--------------.....ARLLL.WR.EALV-------YLR--.Q----NP.....LGLG.I..DQF........YYYH
Q83VQ8_9PROT/239-380--------------.....WRKYL.WD.SALH-------WMQ--VS----KYL....TGYG...................
Q1MQ48_LAWIP/199-337--------------.....PRIEL.WI.RAIE-------VGK--.E----HLW....LGTG.................SS
Q2T0U3_BURTA/206-363--------------.....PRLAL.WK.YGLT-------MFR--.E----HPL....LGVG...................
A3DIW4_CLOTH/315-453--------------.....TRVKI.LQ.TVEP-------MFK--.H----YML....SGVG...................
A3XRK0_LEEBM/177-345--------------YNGLVTRLSI.WK.SSLE-------VAL--.E----HPI....IGVG................AAD
Q5FQI9_GLUOX/196-353--------------.....PYGEI.YT.HAVV-------MAQ--.A----HPW....IGQG.Y..DAY...RHFCAAPST
Q609Q8_METCA/225-373--------------.....NRVDL.YD.YAVP-------YVL--DY----LP.....FGAG...................
Q8P5K1_XANCP/219-372--------------.....GRAQI.WG.AALC-------MIR--.E----HPL....NGVG..............ARGFR
A9WJ46_CHLAA/273-406--------------.....MRLDE.YA.NAIA-------IIQ--.R----YPV....FGIG...................
A5UY10_ROSS1/144-293--------------.....DRLAV.YR.NSFF-------LAL--.D----FPF....SGIG...................

PF01901

D3E122_METRM/9-372-------------------GHAIS-..-.NQF-------ATA---G----KLFYSTLTGFF.....THTDPR--------
O26751_METTH/72-413-------------------NRLSA-LA-GMTG-------VMH---G----DLTLSMIPG.......AGSGPR--------
A6USX2_META3/15-394-------------------EKIIN-..-.YPY-------MLL---G----AISLN.............PIGE--------
O27510_METTH/4-337-------------------DRIIS-..-.LQG-------ATG---G----KLLYYTLTGYI.....HSTDPR--------
R9SNY6_9EURY/64-410-------------------DLLNA-LS-GNLG-------LMH---G----GFILKSIPG.......SDYGPR--------
Q2NHP9_METST/7-347-------------------DHAVL-..-.LQG-------STH---G----QLLYNTLMGFF.....KSSDPR--------
D7DRV2_METV3/10-352-------------------DMVIQ-..-NFEG-------SLQ---G----ILH.TAIFSSYGLIPGVSSGPR--------
Q6LY81_METMP/20-375-------------------EKIIM-..-.YPT-------ALY---G----KIAFT.............PGGE--------
A5UMJ3_METS3/7-344-------------------QRILN-..-.LGG-------TTH---G----HI....LSMIF.....SSGSPR--------
R9SIQ2_9EURY/7-375-------------------DRITY-..-.HQA-------ITG---G----NLLYSTLTGYF.....TSTDPR--------
Y420_METJA/14-363-------------------SKIVE-..-.SNI-------LTL---G----KITLT.............PNGE--------
B1L722_KORCO/85-415-------------------DTIVR-LY-GFRP-------VTN---G----YIHLAAISS.LGLISGSRYGPR--------
U6EAH7_9EURY/7-365-------------------DKVVH-..-.MAG-------ATA---G----DLFYQALS.........TGHPR--------
Q8U4N5_PYRFU/1-307-------------------DVIVK-RC-SLVG-------FYH---G----ELQFSGITSYLT....GGLGPR--------
A6UX61_META3/12-346-------------------DIIVK-..-DFNG-------AFL---G----LLHYSAIFSYFGM....ASGAR--------
D3E1B0_METRM/66-429-------------------NLLNY-IS-GNFG-------LMH---G----KMIASAMPG.......SDLGPR--------
H3ZQY1_THELN/2-309-------------------DVIID-RT-PWHG-------FYH---G----YLQWTGIRSYLL....GGYSPR--------
A5UKQ8_METS3/66-411-------------------NLLDF-IG-GNFG-------VTH---G----KLLASSIPG.......SDLGPR--------
Q6LY80_METMP/11-337-------------------DLIVK-..-NFNG-------NFQ---G----VIH.NAIFSSYGLIDGPKYGPR--------
Y419_METJA/11-336-------------------DIIFN-..-NFNG-------VFN---G----YIHYSAVFSYLGL....CNGAR--------

PF14296

R5XEE1_9FIRM/13-476-------------------NNFYA-MT-DKIPSV.Y.P.YVH---G....RQ......MLLGT.LAMVI.PR........
CAPE_STAAU/10-436-------------------GYVTR-WI-DGGESIVY.G.KSY---L....APIQNIFSYI....IPGLQ.P.........
A0A0U0LER3_STREE/11-477-------------------ARGFL-FN-SSLPYRDFRN.FTF---G....PVLDYFARGSLGA.IFGGK.AFEH.T....
F5VZJ2_9STRE/11-477-------------------ARGFL-YN-SSLPYRDFRN.FTF---G....PIVDYFARGSIGI.IFGAK.PFEH.T....
E8JYK2_9STRE/12-475-------------------ARGYL-YG-SNLPIREFRN.YTF---S....PIIEYITRGNLGI.LFGGT.PF.V.S...A
R6NPW6_9FIRM/14-489-------------------AIAYG-YR-EGIRLSPHLN.FTF---G....DIIDYIYRGSIGQKIFHTE.GL.T.S....
E5VCR2_9BACE/8-476-------------------GYAKE-CE-GTYPETNI.S.YTF---G....PIIQELKHNPVSN.FFGLF.PF.Y.K....
J8AZX0_BACCE/5-472-------------------GYAQT-LA-SQLPEGK..I.YTI---G....RLIDFINSNAITQ.FLIDV.PK.Y.V....
R7GXX5_9FIRM/11-468-------------------KRAYM-YK-NQIPKQ...I.YTL---........EFLHSGILAR.LFNI..KV.Y.H....
C7RDM6_ANAPD/5-467-------------------KRAYT-YK-DIIPDQ...I.YTL---........EFFHSGILSR.IFDI..PV.Y.H....
K5ZBJ9_9PORP/11-476-------------------KYTEL-FE-TRLNPDA..Y.YSL---Y....NTLKWLSDSWIDH.LLNLNLNFEF.G....
A8U9E2_9LACT/8-452-------------------ESSIY-YA-PELKMISN.N.YSL---Q....ALYNGVK..PLGV.AMN....W.I.L....
K6AW70_9PORP/7-478-------------------GRTIQ-YV-DEVANG.W.L.YFV---G....PITNSFRENRLME.YLGL..GI.P.N....
R7EEV2_9BACE/15-473-------------------GNYLD-YS-SDFANS......TR---Y....SILFSLCTTFL.W.FF..N.PL.YRK....
K1GGB2_BACFG/20-455-------------------PLLQY-YD-L...HTEV.P.FVF---................AP.FFNLD.TS.Y......
C5D952_GEOSW/7-469-------------------AYTIE-LI-PNIK.....N.FEF---G....MSYIYGLSTILPN.IFGGI.H..P......
Q4JZ50_STREE/17-471-------------------VLTIR-IV-PT....SI.N.FFR---G....KSY.......IAAIITGLI.P.........
M5J6L1_9LACO/12-465-------------------CFVMM-YV-PGITP......YKL---G....KT..YIEALILMI.PKSID.PT.G.T...I
R6LMR5_9CLOT/10-464-------------------CFVMM-YI-PSSTKFQI.G.GTY---L....KSILAMYPNSL.D.FLGIF.SN.I......
C9AM09_ENTFC/4-437-------------------SYSQL-VA-D.LYYVDI.NGYTN---GWQFLSALFFFIPR...A.IFPGK.SE.G.SGALI

PF06899

WZYE_YERPE/1-448-------------------ENLGL-LL-QNYDKIDFQGLAPI---V----RDFYVFIPSALWPERPDLV-----------
E0SKP9_DICD3/1-446-------------------ENLAM-LW-QHLDQITLQGLAPI---V----RDFYVFIPAWLWPDRPALV-----------
I2BE72_SHIBC/1-447-------------------ENLGL-LL-QNYDKIDFQGLAPI---V----RDFYVFIPSWMWPSRPGIV-----------
C5BBC5_EDWI9/1-448-------------------ENLAL-LL-QHYTQIDFQGLAPI---A----RDFYVFIPGWMWPDRPHLV-----------
E6WHF2_PANSA/1-446-------------------ENLAL-LL-QHYDKISFQGLAPM---W----RDFYVFIPSWLWPGRPSMV-----------
WZYE_SHIDS/1-447-------------------ENLAL-LL-QNYDNIDFQGLAPI---V----RDFYVFIPSWLWPGRPSMV-----------
Q2NQC5_SODGM/1-446-------------------ENLAL-LL-QNYGHIDFQGLAPI---V----RDFYVFIPGWLWPDRPSLV-----------
I0DV18_PROSM/1-446-------------------ENLAL-LL-SHYDKIEFQGLAPI---V----RDFYVFIPSWLWPERPDTV-----------

PF13425

R7NHG5_9MOLU/1-433--------FSNTDRISNSRVE-------------KLIEIDFLDIFFHLGLLAIF---IVA.FPFIY--TFIIYLKK..-R
Q81UH9_BACAN/9-459--------YAG..NYTTK..M-------------KLVEMDFHDLFFAFGIVGFL---MYL.LPLLY--FGIKIFIR.L-I
Q81JN2_BACAN/8-466--------YAG..NYKEQ..P-------------KLIERDFHDWFYSFGIIGFI---LLV.IPFLY--FGIKFIAC.I-F
R7L2W3_9CLOT/8-429--------DEHR.VIDDTGNY-------------TVVERDFHDVKFGYGIIGLG---IYL.VPIFI--IAISFFIR.L-F
I0JRN9_HALH3/7-475--------YAG..NYTDMEDR-------------KLIEMDFFDLFFSYGILGFT---LIL.LPFLF--I.IGLFVKLL-F
R5AA62_9CLOT/11-484--------YAQCHVGDHIYDP-------------...ENDLPALLYYYGYLGVA---LYG.LFVLY--FIASCVRG.L-L
R5IY38_9CLOT/8-472--------YYTMINCTW....-------------..VETDTFAIFFSFGIVGFL---LILFIPLML--FVIEGL...L-T
Q1G8D3_LACDA/2-497--------YMRQTNISN....-------------..LERDFTAQYYSLGLVGAF---LYL.AFYPA--IILYGAFEWL-K
R6GEF5_9FIRM/3-434--------YSY..TVGKGLNS-------------NLIEMDFLALLFYHGIVGLM---IYI.LPICF--FAVYCIRA.L-W
R5JB95_9FIRM/7-482--------YSRFINAKLY...-------------..LEKDFVVHFYTIGIIGIV---LLI.FPYVF--IAIYGLFKSI-K
R6GWD7_9FIRM/3-437--------YDDR.IYQGIHYE-------------KNVERDFHDLLFQYGIIGFI---IELSLP.LY--LLLSILIK.I-I
R5PWW6_9CLOT/19-494--------YMS......HYYE-------------MIFEMEVPAFLFNFGVIGFF---LYF.IPFLI--IAVYGIY..V-I
R5Z3Y2_9MOLU/8-506--------YSRMTNTIY....-------------..LEKDFLSQYYTIGIIGIL---LFI.LPYIL--IPFVSLFYIL-F
R6YI35_9FIRM/11-484--------YAQCHVGSHIYDP-------------...ENDFPALLYYYGYLGVG---LYG.AFCLY--FVLISLKG.L-V
R7HK69_9FIRM/6-439--------FVNRNEINNKRIE-------------KLIEIDPLDVFFHYGIIGFI---IYF.SPLIY--IVYRTLKSIF-K
R6AIT2_9CLOT/1-436--------FSNTEKVNNTNIA-------------RLIEIDICDLYFHFGIMGLI---ISL.YPIIF--IGYLLIIN..-.
Q74HR3_LACJO/2-501--------FSRENNIAP....-------------..LERDFLAQYYSMGILGVI---LLD.VIYLF--VLGYGIFYWL-F
R5N8H6_9CLOT/21-493--------YKN......KFRE-------------MCMENELPAFLFNFGVIGFI---LYV.GPFIA--IMIKAAIDII-K
R6XB97_9CLOT/19-487--------YMS......HFYE-------------MTLEMEILAFLYNFGFIGFI---LYF.VPFFS--ILIYGVY..I-L
R6BI42_9CLOT/16-491--------YMV......HFYE-------------MIFEMEVPAFLYNFGVIGFF---LYF.MPFLA--IAMYGTY..M-A
R5XXD1_9CLOT/7-451--------YVDI.NSKGTVER-------------KTVEIDYCDILFMQGIAGFI---LFW.LPIAY--IIFYIIKYTI-K

PF04932

Q97ER0_CLOAB/210-348.APFNIKVQMYAYVNSAITSV-------------EFSDNLFLEIASRFGVPLIA---CIF--------------------
Q4JZ62_STREE/213-343..ISDGLRAIEQHMDRTVRYN-------------LGYSNSFFVVLAQGGIMLAS---YYF--------------------
Q6MI87_BDEBA/207-358..LLSKFASGNEVDVSNYNAM-------------KDPHNIFVSAGVIGGWPLIV---LAG--------------------
Q6ASB4_DESPS/185-338.PASFPVVHGELIRGTRVPPM-------------KGPHNAFLLVGVEAGLAGMA---LFI--------------------
A4B946_9GAMM/214-357YYTDVYPNDMHFVNRQGERVA-------------ELPHNIFIQIGTDAGVPALM---FYI--------------------
Q9X4C1_ECOLX/176-341YSDVIPHLLAIKEGAMVRHSE-------------AHAHNSTFTILAELGVVGYL---LFI--------------------
Q4K127_STREE/198-353FVTKWMDNNWMTLNINGLTGS-------------MGIHNDILKYYIEIGFVGLF---IYF--------------------
Q04RV1_LEPBJ/208-370SRKEHSEKYRELYYFYETTQR-------------GHAHNDYFHLFAVFGFPGIF---LFL--------------------
Q7UXE7_RHOBA/267-417DAAEPYHAIRRHGVPLENARP-------------YMQHNVFLSTLVDLGLFGFS---MHL--------------------
Q2BFT2_9BACI/241-418GDSAAKSYSSPIYDDYGIEND-------------IYSDNQYIQIIAQTGAVGVI---LFA--------------------
A4CI06_ROBBH/191-347TELELCFRRHRYQALLLKGNT-------------FNAHNLFLQITLATGLVGLV---LFL--------------------
A4AI36_9ACTN/211-357GPWNADLAPFTAFGNFGGRVP-------------GSAHNAYLDVWFQLGLVGFL---IFV--------------------
B1Z898_METPB/188-338.FAEVPAAQALEPEMRAMLAV-------------GHPHNTFLQIWSELGVVGAG---LAA--------------------
Q09DA3_STIAD/195-349.RGAFEAAFPRYQSEPNPNTL-------------THPENAVLQLAAEFGVPGLV---LLA--------------------
Q5NZI1_AROAE/256-398GTFPAVIRAFHPAEIGGEVYI-------------NHAHNDFAEWWMEGGVPVLV---LML--------------------
V6EXB6_9PROT/241-385GTFTSAIMPYRDTSLPRPVLY-------------NHAHNSWEEVIMDLGWPAGL---CLL--------------------
Q98C91_RHILO/186-337VQGFAEAERLWNEFYITTRTG-------------FHFHNTYVEALVELGFTGAV---MIS--------------------
Q8RNK4_KLEPN/160-294......FSYELDFINYSGEHI-------------TTTHSVYMGALLKGGILGLL---LLL--------------------
A0K2I1_ARTS2/235-362.............FGTFLPDY-------------RILDNQYLVTLIDMGILGLI---ALC--------------------
Q9RZA8_DEIRA/165-323PTLQRNKIECPQQLSRWSSVW-------------LIAHNAWLHWLLESGIIGLS---GLL--------------------
Q2N6C0_ERYLH/230-383.TFDPAYRIAEPARNLSYSYF-------------NQAHNDVLQTSLDGGMFGLL---LLL--------------------
A4XML1_CALS8/220-429...GGTWVSLYFMYQSYLYFT-------------TQSHNYFLQVLLDTGLFGFA---ILM--------------------
O06944_SYNY3/232-381NVPLQYQLYRPVWAGRESEFI-------------YQLHSTPAQLFAELGVWGIL---IPS--------------------
A4AAF7_9GAMM/194-330....LNTYKDLVLQFGTAPHY-------------TMPHSIYLESLFSFGFVGSA---FLL--------------------
A6QBN3_SULNB/185-344TEALKKNNHNFNKKVVQFIPK-------------YHFHSQYLNVLVQNGFIGFF---LLL--------------------
Q0G5C8_9RHIZ/213-362PTPIVMAAEAPFELGWDPRGI-------------VNAHNGYLDIAITLGWPGLA---FAL--------------------
A7VGX9_9CLOT/231-488IYTLMSARYSDEMIEVTGTVY-------------DSAHNEYLQYLVTMGIVGLI---TYL--------------------
Q220X5_RHOFT/200-337..FEIYRPDIYAIFAPDSQQQ-------------QGAHSIYFSVLGEHGYVGLL---LFF--------------------
Q7NQD3_CHRVO/200-366ESVRLQPLPQFAAAGYNSGLF-------------TNAHNLLMQLLAEMGGVVTA---LVV--------------------
Q89SN4_BRADU/265-409GNFEAVFPAYRPAVLGSLGIW-------------DRAHSTPVEIAVELGIPAFA---VIA--------------------
Q9AQJ1_STRAG/174-309..........VKELWLNSDLP-------------LGSHSTYIGYFYKTGLFGLI---NVI--------------------
Q7UKM5_RHOBA/239-382.........LNSAPLLLEDFS-------------YHTHNLLLHAIFSAGIFAGI---CVS--------------------
Q11T24_CYTH3/244-416ANEMTYISIHNSQPKYKSGTG-------------GTTHSEYLLISSENGIITGV---VYI--------------------
Q89PW4_BRADU/213-357NGFWTIPSIYDYFEQNHGWVL-------------DNYHSGYIAILMETGFLGYT---LFA--------------------
A5G2R8_ACICJ/202-340..FQATAMPGVIHRYFPMAHQ-------------RATHSVWFEILGDQGFPALF---VWI--------------------
A0A0E2TJC6_ECOLX/196-350EKIHELEEKEPRLSGALPYVD-------------SHLHNDLIDTLSTRGIPGVV---LTI--------------------
Q4K230_STREE/187-326...LFGFQFKLPWQKLGEVGI-------------NYTHNQVLQLALDSGIVGII---SFF--------------------
Q7MVK6_PORGI/277-409...LGTMDNILQAQIDTDILL-------------KHPHNQLLADGMQLGIPGMV---VLV--------------------
Q12C32_POLSJ/166-320STEYNRIQRDLDPAHKDIAGN-------------FNPHQEFLLWAVQLGIPGLL---LLC--------------------
Q1J334_DEIGD/252-413YGINLANADGYQINLRDPSKL-------------RSPHNGTLNILARSGVPGLL---AWV--------------------
A6F4Q1_9ALTE/139-270ITNKVTPVVVFDHEQGVIQQF-------------RHPHNMALSVIYFLGLFGFV---FWV--------------------
E1XBH8_HAEI1/179-336YEEFRHKQVKSKQMAKTTLHF-------------GSLHNQYLESWVKRGLVGFI---ALI--------------------
Q832Q1_ENTFA/206-388PKGFADIAKDKLPQSHIAKTA-------------QTPHSFFFYLLAATGISGTI---VFL--------------------
Q9X5H1_HELPX/195-362RLEEILSLSKSYRAKDLILCY-------------ERYDNQIIHVLATRGIIGFL---IWL--------------------
Q01XB1_SOLUE/184-329NAQLLSYIPADEPRPLPTGAY-------------VHLHNLYLQYAAERGVPALL---FFL--------------------
A7BD98_9ACTO/223-370GWPTEKEPFASLVIRPDGTPT-------------NQAHNVYVEAALTTGFVGAA---MIT--------------------
P74814_9SPHN/322-468.....PFQSAEVVGWRSQSGF-------------LSIDSGFLSTAVDYGVLGFI---AFY--------------------
H9L4P0_VIBCH/171-330SLNIELFKEGKVDEWTSTVPR-------------GHAHSQYFEAIASNGTLGIL---AIF--------------------
Q7V9G4_PROMA/203-353.....AAAFSVLYPLRQGIWH-------------GHAHNLPLELTVAHGLPVAI---LLV--------------------
Q65SG0_MANSM/195-350..PRDYIQYFDQIKLSFPLGY-------------TNPHSFFIELYLAFGIFAFL---AFI--------------------
Q7UPJ9_RHOBA/331-474.PGNYQQAYHQFRLPESHEII-------------ADPHHFVAETLGAGGLPAGA---LLV--------------------
Q6ABG2_PROAC/212-358.PGGYRANILAAPKRWFPHGK-------------SDPHNGILEIASQYGLVVTA---LVA--------------------
A0A098GRN2_SALET/185-325.....LGTQGSGNMLSVKDNR-------------LNTDNYFFWIALETGIIGLI---INI--------------------
D2AAY4_SHIF2/194-338AYKDVYNKRVIDYPEWTFRQS-------------IGPHNFALFIWFGTGLLGLV---SLM--------------------
A6D015_9VIBR/218-369MVYTARQHQLNNHFSAGVPAL-------------DHPQNELLFWGIEGGLLPIL---GIL--------------------
A0PZ10_CLONN/222-380DIIKNYPINDELYTVLISNIW-------------PATHNIYCRIFCELGIIGLV---IWG--------------------
A0Z5U1_9GAMM/194-332ARAISWPSELQQFAGAQTMAT-------------TNTHVQWLEMLVSYGLLGGL---LFT--------------------
A7Z9C6_BACMF/261-409..AGNVSYYLKAEPVYDTGGV-------------VEVHNWLVEIMANFGVLTML---GYL--------------------
Q2BRH4_NEPCE/186-340YAAKHSEVGTFW......SPT-------------VNAHNEFLQIAVQTGLIGAT---LFV--------------------
Q97EP1_CLOAB/208-365........ISSTGALVDTVSI-------------GPTESGVLKRFVELGIFGAA---IYY--------------------
A6M2N6_CLOB8/242-531DFPQGDLIGKYYAYDTPNIVV-------------DKAHNLYLQIAINYGVIALV---GFI--------------------
A4ISY3_GEOTN/200-391.LVRYKEYVTKYPELYIGHDQ-------------YSVHNSYLKVGAETGFLGLI---AFV--------------------
Q7UWZ2_RHOBA/233-380.ISTYGYSYLPYQSQSPGPWF-------------EHADNLWLEMLVETGLPGVA---IAA--------------------
Q8AA03_BACTN/192-346QSTYFASEKYTEQEERVAGAP-------------EYAFNELLQLCVEGGIILLM---LFL--------------------
A6GZ05_FLAPJ/236-385......VGKGRENRLESTGES-------------IASHNEISRMLAEHGSLGAL---GIV--------------------
O31347_BACCE/178-330....IDNFRSLYGIEAIGGEF-------------TYSHNNLVELLVGIGIIGTF---LFY--------------------
A5UWM4_ROSS1/288-436NPAFGRSAIDPSLVGTSEEFA-------------AHPHNLLLDAWVNVGPLGVL---AFG--------------------
Q83VQ8_9PROT/239-380..ADAFLHYSPMFFPLSTDKP-------------TAAHNVYVQTFFDLGLFGTL---AYI--------------------
Q1MQ48_LAWIP/199-337TFILALQKQGIILQSVPSMDL-------------GHPHNIYIQFFIDGGLIGFT---SYI--------------------
Q2T0U3_BURTA/206-363WGEFPIHQFELVRRLGGVEIA-------------NNSHDIFIDLLAKSGLLGLG---VLF--------------------
A3DIW4_CLOTH/315-453LGSDIFRQLIQNYKLYTKAVP-------------PHTHILYLQIWIEMGLAGFV---TFM--------------------
A3XRK0_LEEBM/177-345GKQAVIDRFEETNQHFLAKYK-------------FPVHNQFLDFWIKFGILGLL---VVA--------------------
Q5FQI9_GLUOX/196-353FHGIAGLSDAIPEQGWLSLCV-------------QHPHNHYLQALVNAGVPGLI---LFV--------------------
Q609Q8_METCA/225-373.AGSFVASFLPYGGAEVVIPY-------------DHAHNDYLEFLGEWGVVGWL---PTA--------------------
Q8P5K1_XANCP/219-372QAYPACNPAPDQAPAWGDGPA-------------FHAHQILLEILAETGVIGLL---LWL--------------------
A9WJ46_CHLAA/273-406...........FGQAPDLDLS-------------AGVSSIYLAIGQRMGLVGLA---VFL--------------------
A5UY10_ROSS1/144-293.PGAFGPMYSRFQLLILPTFI-------------SYAHNLFLGVWLAQGIVGLI---GFA--------------------

PF01901

D3E122_METRM/9-372------VLVGQATLGR.....-------..NH--SITSTIFGPALLDFGLIGMC---IQMLLIGFI--LKTLHSIQKH-K
O26751_METTH/72-413------ALIGKLVLWR.T...-------..GV--TITPTLFGQMLVEFGTIGVA---FGMSILGLI--LGIGYRIMQK-T
A6USX2_META3/15-394------GLIATTLLGYSN...-------..PH--NITSTMFGPILLDFGLWGGL---....LFAFL--LGLASKLIYG-.
O27510_METTH/4-337------AIVGEVVLGY.....-------..SH--STTSTIFGPSLLDFGLHAML---FQMFILGLL--LGLMHRIQGV-L
R9SNY6_9EURY/64-410------MMVGKLISWR.S...-------..GV--TITPTIIGPMLIDFGRIGVA---VGMCLIGFI--LGIGYKLLKI-T
Q2NHP9_METST/7-347------VIVGLTTLGY.....-------..AH--STTSMIFGPALLDFGLYAML---IQMFIIGGL--MNILYYIQRS-L
D7DRV2_METV3/10-352------TIVANNLGIE.....-------..GV--TITPTIFGAVFADFGYLGLV---SYFGLLGMF--IGALHYISSK-L
Q6LY81_METMP/20-375------SLIGEIIHGY.....-------..RH--NITSTLFGPIYLDLGYYSL.---....IFSLI--FGIISKLIYK-K
A5UMJ3_METS3/7-344------TFIGLYVLTD.....-------..NV--CITSTMFGPAYLDFGLTGVL---IQMFFMGIF--LKVLNIVGKY-K
R9SIQ2_9EURY/7-375------VLVGEAVLLK.....-------..HH--SITSTIFGPVLLDFGTVGMI---IQMFLMGFV--LETLHILQKY-N
Y420_METJA/14-363------HFIGELLFKY.....-------..PH--NITTTLFGTIYLDFGIFGG.---....LFAML--LGVISKYIYE-.
B1L722_KORCO/85-415------NLIGRYTLGR.T...-------..DV--STTATLIGGPLLDWGILGVL---ASSLIYSYM--LALSHRFSRG-R
U6EAH7_9EURY/7-365------VTVGQVVLNYPVSGS-------TPTT--SITSTIFGPAVLDFGFYAMA---LQMFIIGAL--LRIIYATQVK-A
Q8U4N5_PYRFU/1-307------MLISRYLGVS.....-------..GV--TTTATLIGGMYLDFGILSG.---....IEMFF--LGMYYGAMEN-L
A6UX61_META3/12-346------NIIANNIGVT.....-------..SV--SITPTIFGAVIGDYGILGII---PYFGILGIF--LGLFYKIAEK-L
D3E1B0_METRM/66-429------MMVGKLIAWR.T...-------..EV--TVTPTLLGQMLVDFGKLGVA---VEMCLLGFL--LGTGYKIVKI-T
H3ZQY1_THELN/2-309------VLVARFLHMT.T...-------..GV--SITPTLLGGMYLDFGVFSI.---....IEGFL--LGVYYGMISK-A
A5UKQ8_METS3/66-411------MMIGKLIAWR.T...-------..EV--TVTPTLIGQMVIDFGKVGVA---VEMCGLGFI--LGIGYKIMKK-T
Q6LY80_METMP/11-337------TLIANSIGVT.....-------..GV--TITPTIFGAVLMDFGTLGLV---PYFGIFGLL--MGLSNEVSKK-L
Y419_METJA/11-336------TVIAKTLGIY.....-------..NV--SITPTIVGAVIGDYGTLAII---PYFGILGIF--LGFFYKLAKD-V

PF14296

R5XEE1_9FIRM/13-476..AIWPQKISTKAGVGLEYIV..GKA..LVDT..GQAYPNIGEYYYAFGTIGVI...VFMCIYGIY..ARRVKK..CYFH
CAPE_STAAU/10-436.VNYEMVGYGFRYR.........L.......P..GMGFNVIAEAYYNGAIVGVL...IVMVLLVLL..LWKFTN..F...
A0A0U0LER3_STREE/11-477TNSVELAIDSNSYAHNLSYLV..LNKEYLKGH..GIGSSYIMELYTDYGMIGVF...LLSFLLGVL.FIAMLQV..AY.R
F5VZJ2_9STRE/11-477TNSIELAIDSNSYAHNLSYLV..LNKEYLKGH..GIGSSYIMELYTDYGMLGLF...LLSLLLGML.FIAMLQV..AY.R
E8JYK2_9STRE/12-475NNSIELALESDRYAHNISYIV..LRQDYLAGH..GIGGSYIMEIYTDYGMIGIF...LLSIIMGIC..FIFMMK.TSY.K
R6NPW6_9FIRM/14-489ANSEFNALHSNNLSHILSYLS..MKEDYLNGR..GRGSNYLVETWFDFGYVGAF...IFSIILGII..LLYMVY..GF.G
E5VCR2_9BACE/8-476SQELEAVYHNNNFGATITYLV..DPQRFLGGG..GLGSSYIAEAWVDFGYVGII...VVNFVFGIL..LSQLHK..WF.R
J8AZX0_BACCE/5-472PQSLDSALYGNNLAERVSYIL..SPNRYLNGW..GYGSSYVSELYKDFSYLGII...IGNFVLGII..LGLMNK..LF.R
R7GXX5_9FIRM/11-468GNTVDHAMYGGSFTHTLGYTV..MNSAYLAGR..GTGSSYIAELYQDFGYTGII...LGNILYSFL..LARITK..NEDN
C7RDM6_ANAPD/5-467GNTIEHALYGGSFTHSLAYVV..MESSYLSGR..GTGSCYIAELYQDFGYLGVI...IGNLIYSFI..IAKLSN..LS.S
K5ZBJ9_9PORP/11-476RQSLETAISGTYLADFVSYNA..NPTTYLTGM..GYGSCYLEELYVDFGYIGVF...LGNVIYGIL..LCVLLK..NAVN
A8U9E2_9LACT/8-452PENGQEEFFQSNLGNALTYIR..DPIYYRLGG..RFGTSYIAELFLDFSYLGVF...IFNLILGFI..LSSISK..SN.F
K6AW70_9PORP/7-478GQTLGTVREGYSWADWLSYKV..SPRYYLNGH..GMGSSAIAESYLLGNMFGVM...IVGYMCTFI..IMRFAG..RC.K
R7EEV2_9BACE/15-473GQSEELVQHTLSLDDQLMYAV..NPELYLSGV..GYGSSYIAELYQLGGVLALI...IGSYLIGRI..IKWYER..NY.N
K1GGB2_BACFG/20-455...YDPNGINNLLGNAIAFRI..SPDEFREGH..GLGSSFIAELY.DLGIVFMS...ILSIGLGFV..MGWFER..NV.K
C5D952_GEOSW/7-469.......AATKKLADWLVSTI..DPSFASIGG..GYGYSFIAEAYANFGWLGSP...LALLIIGYL.YRSFILK.AQI.S
Q4JZ50_STREE/17-471.SNFDFLHLTNTLSEWNAYPTELLDTIYHYGF..GLDYSLIAEAYINFGSYGWIAIFFLCSLIAYF..VRDVDF..KR.K
M5J6L1_9LACO/12-465RNMVE......NLPHEWLYSL..IHITYNGGLDFGVGFSPIGESFLNFGWLGVI...IMFVLGSVV..GRFFGKSDWT.K
R6LMR5_9CLOT/10-464....ENTIGCQWLNDQNHMRF...GS..LLDF..GSGFSAIGESYMNFGWGGVL...VSCVIAIIVTSLYVDGK..NA.V
C9AM09_ENTFC/4-437GQFLNENTGFYYIARGFSNVS..N..............PFIGEIFLNFGFIGVV...FVPILLVYF..MKWVEY..K...

PF06899

WZYE_YERPE/1-448------LNTANYFTWDVLDNH--------SGL--AISPTLIGSLVVMGGVLFIP---LGAIVVGLI--IKWFDW--LY-E
E0SKP9_DICD3/1-446------LNSANYFTWEVLNYH--------AGL--AISPTLLGSLLIMGGPLLIP---AGAVAVGLL--IKGFDA--LY-R
I2BE72_SHIBC/1-447------LNTANYFTWEVLNNH--------SGL--AISPTLIGSLFVMGGPWLLA---PGAVVVGLI--IKWFDW--IY-L
C5BBC5_EDWI9/1-448------LNSANYFTWQVLDNH--------SGL--AISPTLIGSLVVMGGAAFIP---LGAIAVGLI--IKWFDW--LY-T
E6WHF2_PANSA/1-446------LNSANYFTWEVLNNH--------SGL--AISPTLLGSLLVMGGVWFIP---LGAVAVGLL--MKGFDN--LY-A
WZYE_SHIDS/1-447------LNSANYFTWEVLNNH--------SGL--AISPTLIGSLVVMGGALFIP---LGAIVVGLI--IKWFDW--LY-E
Q2NQC5_SODGM/1-446------LNTANYFTWEVLVNH--------SGL--AISPTLIGSLVVMGGVGFIP---LGAVVVGLV--IKGFDT--LY-E
I0DV18_PROSM/1-446------LNSANYFTWEVLNNH--------SGL--AISPTLIGSLVVMGGVPFIL---LGAIVVGLI--IKWFDW--IY-G

PF13425

R7NHG5_9MOLU/1-433KSETIKFNTNIFFY-------LM.IIFLTLGISSTAGHTYLAPAVSIYISIYFIYLLNEIKSF-----------------
Q81UH9_BACAN/9-459TNFKKLFSVKHMLL-------AS.TLVLSLGIGFMSGHVLTAPAVSIFFVVILAYLIVDLEIE-----------------
Q81JN2_BACAN/8-466TKFKQIFTVKYAMV-------IA.AILLGLGISFMAGHILIAPGVSFYLVVIMAYLIVDLEIE-----------------
R7L2W3_9CLOT/8-429KNFKEEFTVRNFCV-------GL.SGLLGIGIAYIVGHVLLAPTVAMFLGAVFIKFNDRQNKE-----------------
I0JRN9_HALH3/7-475QVPGRLLHPENLLI-------LL.SIGFGTGIAFIAGHVLYAPAVSIYLAVAMSLLIINMLKM-----------------
R5AA62_9CLOT/11-484EDWHRVLCVEFGVP-------AM.VFALMLAGAQFSGQVLRKPSVTVYGSVAAALLYVYLHPT-----------------
R5IY38_9CLOT/8-472LINYKKLNLNKLIL-------GF.STCIAVGLITFVGYTIHF.SQTVFYFIMLLVISNNVFKE-----------------
Q1G8D3_LACDA/2-497EKACRTLYLTSLLI-------...ASALLLGASYMSGNVLDFPTSNLLLAFLGGGLLAYIKEE-----------------
R6GEF5_9FIRM/3-434KAIKKIFENESAIV-------YTYGILIGLACAAVSGHVLIAPAVSIYIAILIIKLVDNSDNN-----------------
R5JB95_9FIRM/7-482NKKFNLFIVTVLAI-------LV....LPLGVSYFSGHIVDELIISLYLGFIGGYILCECKEA-----------------
R6GWD7_9FIRM/3-437KTKKNRIDEEICIL-------AT.STAFVLLGSYLAGHFLFAPAVSIYVAYSIALLSKKVGNI-----------------
R5PWW6_9CLOT/19-494LKKFRVVKVEFAMA-------LS.GLWFAIIISFLSGYTFFNSSTMMIIIALSVIVINQIKDI-----------------
R5Z3Y2_9MOLU/8-506NRKYFTFENISIII-------...CIFASLAGAYFCGNTLDGLTWSIIYSFIFGYLISKLFKK-----------------
R6YI35_9FIRM/11-484GDWRRVLCIEFGVP-------AM.MLALMLGGAQFSGQVLRKPSVTVYGSVAAALLYVYLHPA-----------------
R7HK69_9FIRM/6-439NKFRLSFFKLTNIY-------...VIGIITMISMMAGHVYSAPAVSIYVSFAMAMLDSALTKG-----------------
R6AIT2_9CLOT/1-436...YKKLTLNCYYL-------IT.ILLLLAGISTLSGHVLFAPAVSIYLVLYLLLITEELNLT-----------------
Q74HR3_LACJO/2-501NKKVRSFLNSSLLL-------...SEGFILFAAFYAGNVLEYLSATLVMAFILGFLLQNIRYS-----------------
R5N8H6_9CLOT/21-493RSISKKLNGMYVMN-------FI.LGALIYALSWLSGYVFFATSCMSIIIIIHIIILNESNKE-----------------
R6XB97_9CLOT/19-487FKEFKKIDIEFIMT-------LE.GLGLAIVIAFLAGYTFFNSSTMVVIVALCTIIIKKIRNI-----------------
R6BI42_9CLOT/16-491VKKIKNMNIEFMMS-------TL.GLWFAIFISFLSGYTFFNSSSMMIIIVLVTLIFNGCKDL-----------------
R5XXD1_9CLOT/7-451NIKYNILDVEIISK-------YI.IIGLAFCVAMFAGHTLVAPAVSIYIALAVVKLYMDLKEN-----------------

PF04932

Q97ER0_CLOAB/210-348--------------------------------------------------------------------------------
Q4JZ62_STREE/213-343--------------------------------------------------------------------------------
Q6MI87_BDEBA/207-358--------------------------------------------------------------------------------
Q6ASB4_DESPS/185-338--------------------------------------------------------------------------------
A4B946_9GAMM/214-357--------------------------------------------------------------------------------
Q9X4C1_ECOLX/176-341--------------------------------------------------------------------------------
Q4K127_STREE/198-353--------------------------------------------------------------------------------
Q04RV1_LEPBJ/208-370--------------------------------------------------------------------------------
Q7UXE7_RHOBA/267-417--------------------------------------------------------------------------------
Q2BFT2_9BACI/241-418--------------------------------------------------------------------------------
A4CI06_ROBBH/191-347--------------------------------------------------------------------------------
A4AI36_9ACTN/211-357--------------------------------------------------------------------------------
B1Z898_METPB/188-338--------------------------------------------------------------------------------
Q09DA3_STIAD/195-349--------------------------------------------------------------------------------
Q5NZI1_AROAE/256-398--------------------------------------------------------------------------------
V6EXB6_9PROT/241-385--------------------------------------------------------------------------------
Q98C91_RHILO/186-337--------------------------------------------------------------------------------
Q8RNK4_KLEPN/160-294--------------------------------------------------------------------------------
A0K2I1_ARTS2/235-362--------------------------------------------------------------------------------
Q9RZA8_DEIRA/165-323--------------------------------------------------------------------------------
Q2N6C0_ERYLH/230-383--------------------------------------------------------------------------------
A4XML1_CALS8/220-429--------------------------------------------------------------------------------
O06944_SYNY3/232-381--------------------------------------------------------------------------------
A4AAF7_9GAMM/194-330--------------------------------------------------------------------------------
A6QBN3_SULNB/185-344--------------------------------------------------------------------------------
Q0G5C8_9RHIZ/213-362--------------------------------------------------------------------------------
A7VGX9_9CLOT/231-488--------------------------------------------------------------------------------
Q220X5_RHOFT/200-337--------------------------------------------------------------------------------
Q7NQD3_CHRVO/200-366--------------------------------------------------------------------------------
Q89SN4_BRADU/265-409--------------------------------------------------------------------------------
Q9AQJ1_STRAG/174-309--------------------------------------------------------------------------------
Q7UKM5_RHOBA/239-382--------------------------------------------------------------------------------
Q11T24_CYTH3/244-416--------------------------------------------------------------------------------
Q89PW4_BRADU/213-357--------------------------------------------------------------------------------
A5G2R8_ACICJ/202-340--------------------------------------------------------------------------------
A0A0E2TJC6_ECOLX/196-350--------------------------------------------------------------------------------
Q4K230_STREE/187-326--------------------------------------------------------------------------------
Q7MVK6_PORGI/277-409--------------------------------------------------------------------------------
Q12C32_POLSJ/166-320--------------------------------------------------------------------------------
Q1J334_DEIGD/252-413--------------------------------------------------------------------------------
A6F4Q1_9ALTE/139-270--------------------------------------------------------------------------------
E1XBH8_HAEI1/179-336--------------------------------------------------------------------------------
Q832Q1_ENTFA/206-388--------------------------------------------------------------------------------
Q9X5H1_HELPX/195-362--------------------------------------------------------------------------------
Q01XB1_SOLUE/184-329--------------------------------------------------------------------------------
A7BD98_9ACTO/223-370--------------------------------------------------------------------------------
P74814_9SPHN/322-468--------------------------------------------------------------------------------
H9L4P0_VIBCH/171-330--------------------------------------------------------------------------------
Q7V9G4_PROMA/203-353--------------------------------------------------------------------------------
Q65SG0_MANSM/195-350--------------------------------------------------------------------------------
Q7UPJ9_RHOBA/331-474--------------------------------------------------------------------------------
Q6ABG2_PROAC/212-358--------------------------------------------------------------------------------
A0A098GRN2_SALET/185-325--------------------------------------------------------------------------------
D2AAY4_SHIF2/194-338--------------------------------------------------------------------------------
A6D015_9VIBR/218-369--------------------------------------------------------------------------------
A0PZ10_CLONN/222-380--------------------------------------------------------------------------------
A0Z5U1_9GAMM/194-332--------------------------------------------------------------------------------
A7Z9C6_BACMF/261-409--------------------------------------------------------------------------------
Q2BRH4_NEPCE/186-340--------------------------------------------------------------------------------
Q97EP1_CLOAB/208-365--------------------------------------------------------------------------------
A6M2N6_CLOB8/242-531--------------------------------------------------------------------------------
A4ISY3_GEOTN/200-391--------------------------------------------------------------------------------
Q7UWZ2_RHOBA/233-380--------------------------------------------------------------------------------
Q8AA03_BACTN/192-346--------------------------------------------------------------------------------
A6GZ05_FLAPJ/236-385--------------------------------------------------------------------------------
O31347_BACCE/178-330--------------------------------------------------------------------------------
A5UWM4_ROSS1/288-436--------------------------------------------------------------------------------
Q83VQ8_9PROT/239-380--------------------------------------------------------------------------------
Q1MQ48_LAWIP/199-337--------------------------------------------------------------------------------
Q2T0U3_BURTA/206-363--------------------------------------------------------------------------------
A3DIW4_CLOTH/315-453--------------------------------------------------------------------------------
A3XRK0_LEEBM/177-345--------------------------------------------------------------------------------
Q5FQI9_GLUOX/196-353--------------------------------------------------------------------------------
Q609Q8_METCA/225-373--------------------------------------------------------------------------------
Q8P5K1_XANCP/219-372--------------------------------------------------------------------------------
A9WJ46_CHLAA/273-406--------------------------------------------------------------------------------
A5UY10_ROSS1/144-293--------------------------------------------------------------------------------

PF01901

D3E122_METRM/9-372KE.VYSAFY.GILL-------AQTIIWIETG--------------PTDVVVWIFY-------------------------
O26751_METTH/72-413RDSFYIMLY.SIVM-------AYCLISIETG--------------ILDQLVVIYI-------------------------
A6USX2_META3/15-394GDRKLYAIYASILL-------SMCEVGINYG--------------FLIIVFVMLY-------------------------
O27510_METTH/4-337DG.FFTGIY.SIIL-------AQTIVWVETG--------------PTDLVVWVFY-------------------------
R9SNY6_9EURY/64-410ENYFYIGLY.SLLL-------TYTILGIETG--------------ILDIQVLIYF-------------------------
Q2NHP9_METST/7-347GG.IYVALY.AMLI-------AHVIIWIETG--------------PTDLVIILFF-------------------------
D7DRV2_METV3/10-352NG.IFMGIY.AILI-------AYLLAGIETG--------------LLDLDVVCFF-------------------------
Q6LY81_METMP/20-375SDTKIYSIYGAVLL-------SMCEIGINYG--------------FLVTMLMFLY-------------------------
A5UMJ3_METS3/7-344KE.VGIGIY.SIIL-------THTLIWIETG--------------PTDIMIWFLY-------------------------
R9SIQ2_9EURY/7-375HG.VCTAFY.SIIL-------AQSIIWLETG--------------PTDLIVFIFY-------------------------
Y420_METJA/14-363GDKKLYAIYASLLL-------AYCEIGINYG--------------FLVVLSLLLY-------------------------
B1L722_KORCO/85-415E..ALLGPY.AVLY-------SYLVVGIETG--------------VLDLNVYIYL-------------------------
U6EAH7_9EURY/7-365NG.ALTALY.AIVL-------THTMIWVETG--------------PTDSVVYLFY-------------------------
Q8U4N5_PYRFU/1-307KSNVGRALY.YSTL-------AYGIVGVETG--------------ILDLPVYLMF-------------------------
A6UX61_META3/12-346KG.VYLGVF.AIVV-------SYLIVSIETG--------------LLDFDVLLYY-------------------------
D3E1B0_METRM/66-429ENSFYIALY.GLIL-------TYSIVGVETG--------------ILDIQILAYF-------------------------
H3ZQY1_THELN/2-309KSLLLKVIY.YTTL-------AYGIVGVETG--------------ILDLPVYLFF-------------------------
A5UKQ8_METS3/66-411NDFAYIGLY.SLLL-------TYSILGVETG--------------ILDIQVLAYF-------------------------
Q6LY80_METMP/11-337KG.LYLGFY.SIMV-------SYLIVGIETG--------------ILDFDVVVMY-------------------------
Y419_METJA/11-336KG.IYLGIY.GILF-------AYTLIGIESG--------------ILDIDVILYY-------------------------

PF14296

R5XEE1_9FIRM/13-476SENALDIILYSVLL-------GANLQLIIRGYTP....SNFWYL.VFSILPVVIIKLLFTQRK-----------------
CAPE_STAAU/10-436KSFEM..LSMGTAI-------VSVLINNIRNAFSFVPAYILI...IIVIVIILLFIDSYLKKE-----------------
A0A0U0LER3_STREE/11-477SRTIL..FALSLLI-------LNNLFFMPRSSFSESFFNLFTMQFWGIVLVIIFVAKMLTKEN-----------------
F5VZJ2_9STRE/11-477SRPIL..FALSLLI-------LNNLFFMPRSSFSESFFNLFTMQFWGIVLIIIFVAKMLTKEN-----------------
E8JYK2_9STRE/12-475PGILL..FSITLLI-------LNNLFFMPRGSFTESFFNLVTLQYWGIVIVIFFVAGLINRKV-----------------
R6NPW6_9FIRM/14-489KRALL..STIILVS-------LQNIFFIPRAEATGWLTFIVYIQFWLCIAVCYGGTLFCYKTK-----------------
E5VCR2_9BACE/8-476QGGFI..AVMGMLM-------FSGLLYAPRGSVSDCIYPIINFRNAFLLVFIYLILKTFYKNK-----------------
J8AZX0_BACCE/5-472TGILG..AWMCLSM-------TRLLLYAPRDTFTSFIVSTFSLINILTVCLILLGSIILSGKK-----------------
R7GXX5_9FIRM/11-468DSLLK..KSIKFMI-------ITQLLWAPRGSFTYFISQNLTPTTIATLLLVFGISYLWEKRK-----------------
C7RDM6_ANAPD/5-467TNYIR..NGYKLFI-------MPYIFWAVRASFTYFLSQTLSPITIVTFLIIFITSKLMLKNN-----------------
K5ZBJ9_9PORP/11-476RGNIW.RIAIGLFM-------IDAIFKAPRATFDAFFGSFLYFNSWGPFLLIFIFVNVCMTKN-----------------
A8U9E2_9LACT/8-452LNWIT..FSFVLFL-------VKTFYFLPRESTFNAINQILSVTNILAMLTVWILSLV.LKQK-----------------
K6AW70_9PORP/7-478KKYSY..MYILFYV-------LPVFFMSPRAEPLSVITALYR...PFCVLFCVQLI.YWFKRK-----------------
R7EEV2_9BACE/15-473KSYTY..VYFSWFI-------IPHLIWTSRGSYFP..SPFLIMIGVLFYVTLRAVVVTWNKRK-----------------
K1GGB2_BACFG/20-455NNRAL..LAISFYA-------ITNCIYISRSSL...FRNVYMFPLLIILVFIALKIRYPFKMK-----------------
C5D952_GEOSW/7-469GETAK..LVMVSSF-------LAYFFFFARGESISQFRPLIWYS.IIPYLGLYLIKDICMMYN-----------------
Q4JZ50_STREE/17-471DNLFS..QYASLIL-------LYSWFTLPRRKS.YFIFNNFFWYVLFFGLALILVSRSI.KQR-----------------
M5J6L1_9LACO/12-465LNNFE..KYTYVVL-------LAGLLTFPRRTTYEFL.KVYEYSIIFILLYLWMFCSLFKKLH-----------------
R6LMR5_9CLOT/10-464SKWDR..FVETVLF-------L.ALLTFPRRAFNEFVSNIEYSIFIIGLILIVMYRKRFAGKN-----------------
C9AM09_ENTFC/4-437....N..EFIYMII-------CSYAIFIMRGDFMSSFAYA.....IGSIVFISIIPQIKYERN-----------------

PF06899

WZYE_YERPE/1-448QGKAESNRYKAAILQSFCFGAVFNIIVLAREGLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTP
E0SKP9_DICD3/1-446YGRQAENRYLSAVLQAFCFGAVFNLIVLVREGLDAFVSRVVFFCLVFAVCLLAAKLLYWLLLRAGAVAARA..PSQGETE
I2BE72_SHIBC/1-447RANQTPNRYKAAVLYSFCFGAVFNMIVLAREGLDAFASRVVFFMVIFGLCLLVAKLLYWLLDSAGLVHARS..SAMLRRS
C5BBC5_EDWI9/1-448RGCTASNRYRGAVIQAFCFGAVFNMIVLAREGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRART..AIAAPSV
E6WHF2_PANSA/1-446RGRQESNRYNGAILQSFCFGAVFNMIVLAREGLDAFGSRVVFFCVIFAACLLVAKLLYWLLDRAGLIRQRG..EPVLPSP
WZYE_SHIDS/1-447LGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACLMIAKLLYWLFESAGLIHKRT..KSSLRTQ
Q2NQC5_SODGM/1-446RGKAAGDRYRASLLQSFCFGAVFNMIVLAREGVDAFVSRVVFFCLIFGLCLLVAKLLFLLFRHAGFIRPRT..AGLNDYN
I0DV18_PROSM/1-446MSLKESNRYKAAIMQAFCFGAIFNIIVLAREGVDSFVSRVVFFCLIFGLCLILAKLLYWLFESAGLIRAKT..ASYLGSQ

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window