Sequence alignment for CL0499

PF04932

A4CI06_ROBBH/191-347-----------------------------II-LIFL..LGILLLLSSRS-T----I...VFTLILS-------VF--LLW
A3GY30_VIBCL/171-330-----------------------------LS-VVAA..TVATILTLTRG-A----I...LTLLFVF-------IL--FFI
Q4UYH3_XANC8/219-372-----------------------------GA-AASV..GVVLVLAGSRA-S----W...ITYGVIV-------LL--SGW
A4TX99_9PROT/241-386-----------------------------IA-SGFL..WLAVLASHSRG-A----FLVTGAGCLAL-------LI--AAT
A3DIW4_CLOTH/315-453-----------------------------IM-ALPP..LLALFNTGSRS-S----W...IGFAVSV-------IV--ITF
Q89PW4_BRAJA/213-357-----------------------------LT-FVLA..STCVLASESRG-A----G....AVALAA-------CA--LLL
A5LYT8_STRPN/187-326-----------------------------LL-LILT..IINCFFSDVSL-S----K...VIALFMI-------VY--IIS
Q7UXE7_RHOBA/267-417-----------------------------LL-ALLM..LAGCYSTLTRS-V----W...LGAIAAL-------GW--IGM
A2TSG4_9FLAO/201-377-----------------------------LT-LFVS..FTALFYVGART-A----V...LSATVIF-------SL--LII
B1Z898_METPB/188-338-----------------------------LL-LALA..ALAILRSISGA-A----T...LGLLAGA-------VM--FGI
Q7UWZ2_RHOBA/233-380-----------------------------LS-SITC..VAGLLLNGSRG-G----V...VAALFGL-------VF--AFG
A0PZ10_CLONN/222-380-----------------------------LL-NIYI..LLTIAYTYSRT-G----Y...IVIAIEF-------II--FNV
Q7UPJ9_RHOBA/331-474-----------------------------LA-AVVL..ALALNDTHSRA-G----L...LSVLIVG-------GC--VLV
Q97ER0_CLOAB/210-348-----------------------------LY-KFLL..IVCIMLTLSRT-A----....IGILLLY-------II--IKI
A4AI36_9ACTN/211-357-----------------------------GS-VVLA..SVVLVLSQSPL-A----F...GTALVIL-------AA--SAA
A7VGX9_9CLOT/231-488-----------------------------FV-LFLG..GMAVIAANSDV-A----Y...IGIGVPM-------VV--LLL
A0K2I1_ARTS2/235-362-----------------------------FP-VGTI..TVAALLSVSRS-A----I...IGVLVAV-------VI--LLP
Q1ZI48_9GAMM/245-403-----------------------------IV-PACSGTFMAMVMTGGRT-G----Y...ASWAVLG-------LF--FAV
A4XML1_CALS8/220-429-----------------------------AA-SSFV..LTAFFFTYSRG-S----Y...VTLPIAL-------LV--FFI
Q2BFT2_9BACI/241-418-----------------------------IG-LVLM..LGVITLTYSRG-T----Y...IGFVIAF-------VV--YIL
Q0G5C8_9RHIZ/213-362-----------------------------LI-AVLS..FVFAYHSGSKT-T----L.....ALIPA-------VT--LLV
A3EK85_VIBCL/216-360-----------------------------LG-LVIM..VIALVLTRSRM-G----N...VAFFVAL-------SI--GSL
Q7NQD3_CHRVO/200-367-----------------------------AL-VLWM..ALMLGWAGSRT-I----L...LYLVALS-------AL--AGL
Q7MVK6_PORGI/277-409-----------------------------YG-LVAL..SCFAFITQSRL-A----M...LFIPLSI-------MF--FFL
Q5FQI9_GLUOX/196-353-----------------------------AA-TVLA..VGIMVLAGQRM-P----L...ALSLLGI-------GV--CAL
A3XRK0_LEEBM/177-345-----------------------------VF-FVLS..VVILLYINTRL-A----I...ANAFIGI-------IL--VSL
RFC_SALMU/185-325-----------------------------II-SFVL..FIAICMSLTRG-A----I...LVAALIY-------AL--YII
Q98C91_RHILO/186-337-----------------------------PV-VLLS..AYLLVISHSAT-S----M...ASIPAVL-------AL--IAL
Q12C32_POLSJ/166-320-----------------------------AA-LAYL..CNVLFVLNGRS-G----H...LVAIAML-------SL--AIM
Q0SYF1_SHIF8/194-338-----------------------------VL-SVIF..IFLILGTLSRG-A----W...LSVLVIG-------LI--WIL
Q9X4C1_ECOLX/176-341-----------------------------FY-AIMF..IFFLYMTNSRG-S----I...LAIMAAF-------GY--SLI
A0ZHE8_NODSP/234-386-----------------------------TM-FVAN..GACLVLTFSRG-G----W...IALVVGL-------LT--AIA
Q7V9G4_PROMA/203-353-----------------------------LV-LLFI..AISLVLTNSRN-A----W...ASMFLSM-------PF--VLG
Q6ABG2_PROAC/212-358-----------------------------AT-AVTG..LGLLLATDSRI-I----Y...AALLLAV-------MV--RLW
Q609Q8_METCA/225-373-----------------------------IA-VVIM..AIGLVLTRSRM-G----N...VGFAVSL-------SV--TGA
A4ISY3_GEOTN/200-391-----------------------------AV-YAIY..VINLVLTYTRA-A----W...VAMLGGL-------VL--VIL
Q7UKM5_RHOBA/239-382-----------------------------FV-FVIS..SATMFESMSRT-A----V...VSCAASV-------LA--VMI
Q2T0U3_BURTA/206-363-----------------------------AL-SVLL..SVGLALTVSRG-P----W.LQVGVMVVA-------GF--WMA
Q01XB1_SOLUE/184-329-----------------------------AA-GIAI..GASLVAGYTRS-M----W...MGAALGG-------GY--LVW
A0Z5U1_9GAMM/194-332-----------------------------LG-ILGL..GTLLVLGAVRT-A----F...IAVAVLA-------CL--SVF
A4AAF7_9GAMM/171-307-----------------------------FV-CVCL..FATLIALQAKG-T----L...LALLLSG-------SW--CFS
Q9X5H1_HELPX/195-362-----------------------------LS-VFVG..FLVVILSATRS-A----T...IAFVATF-------LI--LSC
Q6ASB4_DESPS/185-338-----------------------------GG-VALL..SFADIFYLQRS-L----T....GMVVFF-------AL--ALL
Q4JZ62_STRPN/213-343-----------------------------FT-TWIL..IITIMTTTSTT-G----V.....YIIGL-------IF--LYV
Q11T24_CYTH3/244-416-----------------------------CL-FLLS..SSALILSYSRA-A----M...MGVAGAL-------CL--FIV
Q6MI87_BDEBA/207-358-----------------------------SA-LVLAGSFFAIILTGTRS-S----A...AAAVVAF-------IV--TMV
Q8AA03_BACTN/192-346-----------------------------VA-FALM..LCILPAGMSRS-A----W...LALSFSS-------LW--VLV
Q1J334_DEIGD/252-413-----------------------------WT-LWFA..AAALPATRVRA-G----F...LAIAVAV-------LI--VLL
A5UWM4_ROSS1/288-436-----------------------------AC-ALLS..LTGVVVSFSRG-A----WLASVIAAVVL-------GA--GWL
Q4K127_STRPN/198-353-----------------------------HN-ILIA..LIILFLSLKRI-V----F...LSVLIII-------PV--FLV
A6GZ05_FLAPJ/236-385-----------------------------TL-LLIM..AFRGIITFSRG-G----M...LSSAVMI-------AL--LLL
A5G2R8_ACICJ/202-340-----------------------------AS-MVLT..LFAVVATYSRG-G----L...IALTAMG-------AR--LWW
Q5NZI1_AROAE/256-398-----------------------------AV-CIAL..LLGIVFARSRS-G----IALGMVGVVLS-------AV--VLM
A7Z9C6_BACA2/261-409-----------------------------LF-AICA..LYLIILTGSRA-S----L...LGICAGA-------AV--YVF
Q9RZA8_DEIRA/165-323-----------------------------PA-GLLA..LATFAAAGSRG-P----L...LALGVGS-------LA--ALA
Q89SN4_BRAJA/265-409-----------------------------AG-FAIC..TIALAMTGSRA-G----LLLSVGTFVLA-------II--LYL
Q9ZIT0_ECOLX/196-350-----------------------------IN-FMLS..LCAVIVTETRA-A----I...LVFPFFA-------LI--LIV
A4ND37_HAEIF/179-336-----------------------------VA-IILA..IMTSALSGARG-G----W...IGLPVVI-------GI--ILF
O06944_SYNY3/232-381-----------------------------VA-LSLG..LIDFYTTSSRG-G----L...LGLAT.L-------LL--LVI
A5UY10_ROSS1/144-293-----------------------------VG-AALV..AFGVLLTSSRG-A----F...VALIAAG-------LL--WGL
Q9AQJ1_STRAG/174-309-----------------------------GA-LLST..IILPIGSGSRA-G----I.....IVVLL-------QV--IIL
Q65SG0_MANSM/195-350-----------------------------AL-IFIM..GLAIVISASRS-V----L...LSYLIML-------ML--ILF
Q832Q1_ENTFA/206-388-----------------------------MV-IFLQ..FSYVALSGSRS-G----V...IQLISMV-------IF--GMF
Q83VQ8_9PROT/239-380-----------------------------FI-VLAM..VGMLMLTQTRS-A----W...VAFFAFF-------TF--YAL
Q97EP1_CLOAB/208-365-----------------------------IS-FFVD..ILGIVSTNSRG-P----F.VATGIAISV-------FF--IIY
A7BD98_9ACTO/223-370-----------------------------LW-LTAC..GVVMLLTQSAT-V----A...LSTVGCL-------VV--VAG
Q220X5_RHOFD/200-337-----------------------------TL-MLLS..AVSVLGSQSRG-A----L...LAVSAMG-------LV--LWV
Q04RV1_LEPBJ/208-370-----------------------------QG-IILLSFLYVVFLNNARS-S----M...LGAIFSS-------IT--AFL
A6F4Q1_9ALTE/139-270-----------------------------LA-LAIL..LLFLVALERRT-G----Q...VAIIVAI-------VT--CII
Q09DA3_STIAD/195-349-----------------------------AS-AVLS..GVGVLLSLSRA-G----I...FFFLVGQ-------VL--VAL
B9LD61_CHLSY/273-406-----------------------------LA-MLGGVQVLTLLLTFSRA-A----L...FGLIIAA-------AF--LAT
A4B946_9GAMM/214-357-----------------------------AT-LITP..ALTIMGASSRG-S----Q......LALV-------AV--LIY
Q8RNK4_KLEPN/160-294-----------------------------LP-VVIM..LVMLLLTQSRG-P----I...IALVLAV-------GC--TLH
Q72XI7_BACC1/178-330-----------------------------PI-MLIN..IFVVFLTGSRK-A----L...LFVVLTI-------IA--ILL
Q2BRH4_9GAMM/186-340-----------------------------AT-LFLITLHNLFFIENGRT-G----Y....ILIISL-------SA--LFF
A6D015_9VIBR/218-369-----------------------------LT-PVIT..LPLIVVLGSRT-G----W...LGALIGT-------LL--LIP
Q1MQ48_LAWIP/199-337-----------------------------VA-VLLSPGLFLWLGSFTRI-G----Y...LALLGAL-------YI--LWI
P74814_9SPHN/322-468-----------------------------LF-DLAM..VLSAYWSGARL-S----M...VGMVVAH-------AT--YLL
Q2N6C0_ERYLH/230-383-----------------------------GM-LVLF..SLMALATGSRA-G----I...IATVLAL-------PL--GFA
A6QBN3_SULNB/185-344-----------------------------FF-FITI..TGNLFINEGRT-G----Q...LAFLVGI-------FA--TVF
A6M2N6_CLOB8/242-531-----------------------------IG-TLLS..FWLLFGSTARS-G----I...IGVLGAL-------IF--GII

PF13425

C6IFG7_9BACE/266-414K.I.......Y.......F..I.......IV.IIAA..IYGMGISGTRA.A....I---ALPIGAL.......GS..FII
A0LW89_ACIC1/221-359R.L.......I.......A..R.......IS.TALI..LVAMPMTVARS.A....I---VGLATVL.......II..LFF
A0YRC8_LYNSP/311-457R.M.......V.......G..L.......GG.MALV..FVNSAISGQRI.A....L---ALVPLVT.......VI..LLV
A0YY08_LYNSP/334-480R.T.......A.......G..W.......LS.LSLV..VLNSILCGQRT.A....L---LAVPIIF.......VV..LVI
A0ZBK6_NODSP/316-462R.L.......V.......G..L.......GS.LATV..LINAVISGQRV.A....F---AIVPISF.......VI..LLV
A1BHF5_CHLPD/216-365S.V.......P.......T..L.......YL.LGML..LFTTIMMQSVG.A....I---ALLFIGL.......LV..LIL
A1KBI4_AZOSB/182-311A.V.......G.......L..L.......VL.TAAC..VLCAMIFQARS.A....L---LGFGLFI.......AA..YIV
A1VT05_POLNA/222-357Q...............................AMIL..LAALMAATSKT.G....F---VIAALAV.......WI..SIL
A1WA83_ACISJ/201-342K.I.......I.......F..I.......AA.FFLG..IYLAFASASRG.P....L---LTLFFIG.......LL..AAC
A1YVC7_LACJH/222-358K...............................VLVL..IMAIISTVSST.G....Y---ICLLLTM.......GY..LLL
A1YZN9_PSEAI/186-321T.R.......C..................IA.HAVA..IACLYINGARS.E....F---VAYALFA.......AT..YEF
A1ZS85_9BACT/258-408K.A.......F.......Y..A.......IT.AVLC..LYGMMISGTRG.A....L---AVPGIGF.......FM..YFV
A2CCT3_PROM3/195-349K.G.......L.......G..L.......IG.TVSG..YLLCIGSGSRM.A....T---VAFPLSA.......LL..AWL
A2SDP8_METPP/225-368K.R.......L.......P..R.......IG.AFAL....ALLLTYSGT.G....I---LALFIGL.......LF..PLG
A2WDK3_9BURK/260-410R.W.......F.......A..G.......AA.GFVS.....FALCLVRS.T....W---GGWVIAL.......AI..QLV
A3F4D2_LACLC/174-305R.I.......T.......I..I.......FI.AIVT..FIIFYFTQSRT.S...GY---ILFFILS.......I...LFV
A3HV81_9BACT/249-392N.W.......L.......Y..I.......LV.MACS..LGSLVFSASRA.A....F---GAFFLMI.......FF..LAL
A3IMI1_9CHRO/286-429K.S.......V.......G..C.......TS.IITV..LVATLISGQRA.A....L---LLVPIIY......LLL..FLL
A3IUA7_9CHRO/225-379P.I.......T.......W..L.......VC.ALI....ITFILIKSTG.A....Y---LYLIYGV.......FI..LFV
A3K8X9_9RHOB/235-384G.L.......K.......F..L.......MA.AIWL..TTVLVLAKSLG.A....L---IFLVALAP.....LVV..LVP
A3KU19_PSEAI/248-385R.G.......L.......G..L.......AV.AVLG..AAAILLASSRG.A....M---LSLAVVL.......FW..MSL
A3P2Q6_BURP0/171-296D.L.......G.......H..A.......AA.CVS.....FVVLTGSLS.A....A---VALAACA.......FV..LNA
A3SPZ3_9RHOB/245-394R.A.......R.......A..L.......LA.GIYL..LGVLVLCKSLA.S....M---LYAMALV......PAV..LFA
A3V694_9RHOB/192-341I.F.......L.......K..L.......MM.YGVC..LWLLFNTFSRS.G....Y---ILFVVAT.......AV..VVF
A3W1Y4_9RHOB/173-312T.L...............A..L.......FA.ATFT..LGMSFLSLSSA.P....L---LACAMQI.......GL..LVW
A3WFB0_9SPHN/222-363R.F.......I.......G..W.......AG.SMFA......AFTMSSA.A....L---LGLVVGL.......AM..YAY
A3XD73_9RHOB/304-453R.L.......N.......L..A.......LA.AAYL..FVVLVLCKSFA.S....L---AYGLSFV.......PL..VAL
A3Y9Z7_9GAMM/195-353K.L.......F.......S..F.......LG.MLFF..LLLILLTQSRT.V....L---ISLVITL.......FI..IPF
A3ZP84_9PLAN/227-386R.A.......G.......A..L.......GG.IAIG..LFCIYLSQVRS.V....L---IMTGICC.......CV..LLA
A4AEK4_9ACTN/190-334K.A.......A.......L..L.......LT.FAAI.....LLATGSRT.T....L---IVVAIAM.......VL..AVA
A4EDX8_9RHOB/194-345R.W.......L.......A..M.......PL.AGLV..VLLIIKTSSSQ.A...VL---LGAAVPV.......IM..AVF
A4EWL1_9RHOB/245-394R.A.......R.......F..A.......IA.CAYL..FVVLFLCKSLA.S....F---TYALAFL.......PL..VAL
A4F0R9_9RHOB/216-356R.S.......F.......Y..A.......FS.IGLC.....CFFSLSSG.A....V---LAMAIQA.......LL..MMW
A4TXA3_9PROT/212-353F.W.......L.......A..L.......GV.LLVG..MIGVWQSGTRG.A....M---LILLIAV.......PV..FLV
A4XMK9_CALS8/198-350K.S.......L.......IQKV.......IL.LVFF..NVTLLKTISRS.S....I---LGLFLVV.......FFNTALI
A4YQ66_BRASO/187-322G.W.......I.......G..V.......AV.RVLS..FAMVTLVSSRF.A....M---AGCIAAF.......LL..HQA
A4YX51_BRASO/206-352T.L.......A.......A..R.......ASRMALL..AAGLLCSYSGT.G....L---TMLALFL.......PF..YFV
A5CP65_CLAM3/221-356A.R.......L.......G..M..........TALM..MLAAVLTFSRV.G....M---LGAVLGL.......AL..SIV
A5EAQ5_BRASB/235-388R.S.......A.......P..A.......GAVTFYL..GVVLVLCKSGA.A....L---VYGAVLV.......PL..VRW
A5FL57_FLAJ1/219-339K.I.......F.......I................V..ILALLLTLSRT.V....W---IGLLFFF.......LI..L.Y
A5FL58_FLAJ1/161-315K.I.......L.......L..I.......VI.CIVL..LASLVIVNARM.I....L---FSTLFLTG....LNCY..FFF
A5G2F5_ACICJ/218-369E.W.......A.......W..I.......GA.NFLI.....LLASGARA.P...LA---LATFATL.......AT..LLS
A5GEM1_GEOUR/220-381R.L.......L.......S..F.......IF.IGVS..LWVSYATVVRS.L....W---IFLFLGF.......LF..LMI
A5GQB5_SYNR3/178-326R.V.......L.......A..G.......VA.TALA..AVMVWQTGSRA.A....F---VAAVVSA.......AL..LWI
A5PAQ9_9SPHN/298-451R.L.......A.......A..L.......GT.LPLI..WLSIMRTDSRL.G....F---VGFFMSF.......LL..FLI
A5V8X2_SPHWW/271-405G.P.......M.......L..A.......LG.IATL...LGLAATLSRS.G....M---VAIAVGI.......MV..FQL
A5ZV75_9FIRM/172-330K.W.......L.......Y..I.......NV.AINI..LVTAVLGGRMS.A....V---ISACMIL.......FA..YVY
A6BIH2_9FIRM/191-358G.K.......V.......F..I.......YC.VACM...YVATVCELKI.Y....F---LEFVLIV.......VI..QLL
A6CBU1_9PLAN/250-380R.F.......L.......W..I.......VG.MIIL..GIGLIYTRSRG.G....L---LTLGIAG.......MV..FVL
A6DE00_9PROT/193-358R.Y.......Y.......K..K.......FL.FITL....VMILSSSRM.T....I---LFLIIIP.......LS..FAI
A6DFC8_9BACT/220-366L.L.......L.......S..L.......IT.SALL..IFGIMLSSSMG.A...CL---LGVISIV.......TS..YLF
A6DMP1_9BACT/236-371R.I.......L.......M..W.......TI.TLALPLVFCLLITRSRG.A....F---VAFFIAS......VIT..FSL
A6DZI5_9RHOB/235-384R.I.......F.......Y..L.......LA.ALYL..GAVLVLCKSLG.S....L---MYGVYLA.......PL..ALF
A6E8K4_9SPHI/180-325K.S.......T.......V..F.......LL.CI.....VFLFLGMQRS.A....F---IAFMAVV.......AV..FML
A6ETG3_9BACT/167-314P.Y.......L.......F..S.......LC.VSLS..LVIILCATSFP.T....L---VGGVILL.......LL..YFL
A6F673_9GAMM/263-423V.Y.......G.......W..L.......IP.VVVL...LALYLNSTRA.I....S---LAMTCSS.......FL..AFF
A6FK24_9RHOB/260-408K.P.......L.......W..F.......MA.GLWL..FMVLFLMKSLG.A....F---ALTLLVV......PGV..LFL
A6L5V9_BACV8/222-366K.V.......T.......K..L.......LY.FLPL....CTILTGTRA.G....Y---VAILIGI.......LP..YLL
A6L7F9_BACV8/212-352H.F.......T.......N..L.......WY.I.LF..VVAIFLTGAKT.A....L---LCALVLL.......IA..IKL
A6LGX1_PARD8/196-333K.V.......V.......Y..L.......LI.VIFS...YAAFVTLKRM.S....F---IAIILSL.......LY..FVY
A6N385_ARTOX/264-390R.L.......A.......M..L.......AA....I..GATLFFAYARA.G....I---LIFLVVT.......VI..YFI
A6UIW2_SINMW/253-393R.Y.......S.......K..A.......G....TI..AFTVALSLSAG.P....L---LGIALQS.......LL..IAW
A6WE97_KINRD/230-374R.W.......Q.......L..V.......VL.VAAQ..LTAVVMAVTVT.S....F---IWLAVAV.......LV..AAA
D7HGD2_VIBCL/212-351R.K.......A.......I..M.......FL.ILFG..MISIFLTRSGT.G....L---ITLVTLF.......VI..LIV
A7AHI1_9PORP/175-336R.I.......L.......F..I.......IM....L..SIGLISGRSKFYG....F---FTLSVMV.......II..YFS
A7B4B5_RUMGN/180-334Y.V.......E.......L..A.......IT.VLIG..GLIYIFCGART.N....A---LCIWLLA.......GV..LFY
A7B9B7_9ACTO/214-354R.F.......I.......V..A.......AV.CALS..VIPAAATLNRG.M....Y---IGLIVIV.......VW..VGF
A7BWS2_9GAMM/221-377K.L.......P.......K..LPILTVPQVL.TLGL..AAGVFAPLSRA.P....W---LGTLLGI.......IT..VFI
A7GLQ7_BACCN/204-397K.I.......Y.......Y..W.......IP.TLLA..MYASIMVGTKV.G....Y---GAIVVTL.......GI..ALF
A7IL98_XANP2/205-360L.A.......V.......N..V.......AL.WPFM..GWAIQTSTSKT.A....L---GIFVIYV.......MM..FIF
A7JJ42_FRANO/186-334K.F.......C.......N..L.......IF.HFLI..LVGAILSYQKA.A....L---LGVISIY.......FI..YLS
A7JMT4_FRANO/187-383K.L.......V.......M..I.......FV.GILI.VFIDLFVNRSKA.G....Y---IIEFVVL.......IY..YFF
A7M5X5_BACOV/176-343H.I.......R.......L..S.......LI.VL.....VVELLTFTTI.A....Y---TAFLLIF.......VT..WCY
A7NGA7_ROSCS/365-564R.LGLVLESVG.......A..W.......TI.ATLL..LAAIFFTQSRG.P....W---LGGFASL.......FV..FFT
A7V9S7_BACUN/180-319K.F.......L.......F..L.......IG.SFLS..VYCAVRVQSRT.C....I---VAILILM.......LM..SLI
A7VV00_9CLOT/206-361K.V.......L.......L..A.......VL.ILVD..AFTLYLARSMG.A....I---GIGALAI.......GV..MFL
A8GC50_SERP5/204-356K.I.......K.......I..I.......LA.TAF...LAGAIATLYKT.A....I---IGIAAYTI....IKLF..LIF
A8LUD1_DINSH/214-355R.I.......M.......L..A.......FA.IIIS.....TVMSVSSG.A....L---LPLMIQI.......SL..IAW
A8LXZ5_SALAI/235-376R.W.......L.......L..L.......GS.LPLS..LAPAFLTLNRV.M....F---LSLGVGL.......LV..LGV
A8RK65_9CLOT/197-346F.M.......R.......N..I.......VV.YLLC..IIGFVLAGSRT.G....F---VLGVVIL.......IY..HLF
A8RKN0_9CLOT/193-357R.S.......F.......W..L.......FY.I.ID..GFLILLTKSTG.I....F---LGWTLLAA....GSGC..ICI
A8RSJ4_9CLOT/221-350K.W.......V.......I..............LIT..VIGVALTASKS.A....I---AIFLVLL.......IV..LYV
A8SGY7_9FIRM/208-357R.V..............................IVI..TFTIFTTQSSA.G....I---ILLIIVV.......LL..LIL
A8U9G8_9LACT/218-351K.G.......F.......T..I.......FI.SL......TIFLTFSYS.A....M---GIMLMIQ.......AL..HFI
A8UCK5_9LACT/210-361I.H.......L.......I..F.......LA.LGIM...VLLKSAFTLA.I....L---LFAVFSL.......LI..MIT
A8YA87_MICAE/331-478R.L.......A.......A..L.......VG.LTLV..LINAVVSGQRL.A....F---FAVPMIV.......GL..MTI
A9A0Y0_DESOH/253-403R.P.......F.......P..L.......IN.YALA..GIAVLLLQSRS.T....I---AVFLGGT.......IL..LLY
A9CEI7_AGRT5/239-386I.F.......A.......S..F.......VA.IYLV....SFSATLNRS.G....M---GTVVLIG.......LI..SYM
A9E2E9_9RHOB/245-394R.W.......K.......M..L.......LL.AAYL..AVVLLLCKSLA.S....M---AYALLLV......PVV..LLI
A9EBQ8_9FLAO/78-235K.L.......M.......L..L.......AG.ILFA..MIALGLSGSRT.S....Y---VGLLVFL.......GY..FFI
A9ETU3_SORC5/228-355R.A.......L.......M..V.......FGSLLLI..ATAIILTQSRG.G....Q---LVFATVL.......GV..YFV
A9GB69_9RHOB/245-394K.R.......R.......Y..T.......MA.AIYL..FAVLILCKSIA.S....L---VYGLIFT.......PF..VAM
A9GIB7_SORC5/278-406R.A.......L.......P..V.......TAVIAAI..GAMVVLSRSRS.G....V---IVYLAVL.......GI..SFI
B0CE59_ACAM1/222-374D.I.......P.......M..I.......WC.VLAL..GVTFILLRSTG.A....Y---ALLLISL......ILL..FAV
B0CEF6_ACAM1/212-353R.I.......P.......T.............LSLA..GLGLLLSQARA.A....W---LCFLITL.......TI..FLF
B0JPJ8_MICAN/292-437R.V.......A.......G..W.......VA.MVLV..FLATLVSGQRL.P....L---LLVPLFY.......LV..LFI
B0KB87_THEP3/245-390K.M.......A.......N..I.......LL.YLTI...AEIILTTSST.G....Y---IGLLFFV.......SI..YTI
B0M993_9FIRM/208-351K.L.......T.......Y..L.......LS.LVTL..FCCLLIAHTNT.S....T---VCAVFIL.......AA..DFV
B0M9A4_9FIRM/196-348L.K.......Y.......M..L.......MA.TFFG..VATL.....RG.K....A---LGFFAVY......WFV..YII
B0N359_9FIRM/240-375L.L.......Y.......F..F.......TC.IVYL..GIGTLIVNART.G....L---YAFVAVS.......IV..FLL
B0T732_CAUSK/201-343R.P.......I.......L..A.......LA.AGMI...ITSVIGSSDA.C....L---VALAAGG.......AA..WLL
B0TYH5_FRAP2/172-367K.I.......L......MF..A.......AG.LLVI..FIDLFVNRSKA.G....Y---VIEFVVF.......IY..YSF
B0ULV1_METS4/257-396T.A.......L.......L..A.......AP.AALS.....LLLSMYRT.G....W---LFLAAAV.......LF..CLL
B0V6K1_ACIBY/174-325D.Y.......Y.......L..L.......LI.ILLS..TFLTLVSNSRI.S....F---ISSCLCL.......IV..LFL
B0VGS8_CLOAI/260-411N.T.......Y.......L..N.......LI.IIIG..FITILLSATRG.W....I---IAILILF......ASV..FFM
B1C0Q0_9FIRM/182-328K.I.......I.......L..F.......IA.VIFA..IYNSLVTASRT.A....L---IIMIIVF.......VV..NIF
B1FZC5_9BURK/272-424R.V.......R.......W..V........A.AALG..FFSFALSLVRS.T....W---GGWVIAL.......LI..QLI
B1R2U0_CLOBU/208-343D.R.......L.......W..I.......VC.VATI....GICLTSSKS.G....L---ILLGVAI.......VL..LYR
B1RNR5_CLOPF/189-330N.L.......K.......F..I.......FI.TIIL.....LILTGSSV.N...LM---VSILLVI.......KI..MLI
B1WSH8_CYAA5/286-429K.G.......I.......S..F.......AS.IITV..LIATLISGQRT.A....L---LLVPIID......LLL..FLL
B1X0A2_CYAA5/338-485R.N.......C.......G..L.......VG.MAMV..FVNSIICGQRL.A....L---AAVPAIL.......IA..MLF
B1Y725_LEPCP/205-349R.K.......T.......A..I.......AG.AVAA..LTLVLASGSSG.P....F---LGAIYAT.......GA..LLF
B1ZT82_OPITP/197-358P.I.......L.......V..A.......SG.LAV...LIALPVSISRT.A....M---IATGIVV.......AA..FVA
B2AHI9_CUPTR/221-375W.L.......Y.......A..L.......VV.LGSL..LVSVLVSGSRA.T....V---LLLPGLF.......AV..AAL
B2ILP9_STRPS/194-329T.I.......I.......F..A.......F.....L..LEVLVLSKSRI.A....I---VAMLIYI.......AF..AVV
B2J995_NOSP7/327-473R.L.......V.......G..L.......GS.LVTV..FINAVISGQRI.A....L---ALVPICF.......GI..LLL
B2JKN4_BURP8/242-388K.L.......A.......G..A.......LA.I.SA..GTLLLMSTSGT.A....Y---VGLAAYM.......CV..QVF
B3C6G3_9BACE/158-317K.V.......V.......V..A.......VA.GILI..LCVLPATMSRS.A....W---VAAAVGC.......GW..VAY
B3DZJ9_METI4/232-389K.I.......L.......L..A.......PS.GISV..LLTLLVSGSRF.A....F---FSSGIVL.......VF..SLV
B3EF24_CHLL2/226-378K.I.......LS....VPT..R.......YL.LMLL..ACTAIMMQSVG.S....L---VLLVIGL.......IV..IFL
B3Q3Q8_RHIE6/200-358A.I.......LATL.DRRL..I.......AT.IVLT..GFVAICSGNRS.P....M---LGLAVFF.......CL..YLA
B3QV51_CHLT3/220-371K.L.......I.......Y..Y.......IF.ILLS..WMIIYYGFSRS.G....W---LSGFIQI.......AA..WLF
B3W8Q4_LACCB/236-408S.L.......G.......E..G.......IV.LILG..SLSIILSETRG.L....Y---LGILVGI.......GT..YIA
B3WWQ6_SHIDY/179-312K.W.......K.......K..S.......IL.LTII...ILIILSLSRA.A....I---VALILTE.......CI..RML
B3ZZ03_BACCE/196-346R.L.......L.......W..L.......SI.GLGL.....ILLSGSRT.S....F---VLLPAIIF.....SCS..LLL
E0UAN3_CYAP2/223-375R.I.......P.......I..N.......WL.VGIM..LLTFILLRSSG.A....Y---IYFLYAL.......II..LFA
B4D1K5_9BACT/198-355R.W.......L.......S..Y.......TA.VPAM..ALAIGVSGSRT.A....V---ISVAIVC......SL...VLY
B4SDC8_PELPB/170-319L.F.......I.......W..I.......IM.AFIT..VFLILISVSRA.G....T---MAMILSL.......VI..FAF
B4SFN3_PELPB/228-374R.V.......R.......T..E.......YV.LLML..MFTFIMMQSQG.A....I---VLLLIGV.......FV..LY.
B4VS49_9CYAN/220-377Q.W.......I.......S..T.......VE.IALL..IANSFMTGARG.L....V---LFEVLFFG.....GYV..SLI
B4VUT2_9CYAN/289-432R.L.......V.......G..W.......VA.MVAV..LAVAVISGQRI.A....L---AIVPATF.......VL..LVL
B5CP97_9FIRM/225-366K.W.......F.......F..P.......VS.NLVF..LFGIVISHTYT.A....L---FAAVLIY.......AG..LAL
B5GZE0_STRCL/202-343G.T.......S.......A..A.......VI.IVPT..LILLALTHTRT.A....T---VGLLAGL.......VL..AIG
B5L3Q0_SHIDY/193-354E.V.......T.......L..S.......YS.V.IV..LFVILNTFSLV.G....Y---IYIIICL.......IV..ALY
B5L3W7_SHIBO/182-338K.A.......I.......F..I.......SA.FLLA.....LIIT.SKA.A....I---ITMCIYF.......LW..NIY
B5QM83_LACRH/213-382E.G.......G.......V.............LVVG..SLSIILSESRG.L....Y---LGILTGI.......GT..YVA
B5VX91_SPIMA/313-459R.I.......T.......G..L.......IG.MALV..FVNAVISGQRI.A....L---ALVPVVT.......II..LLV
B5VYV0_SPIMA/317-463Q.I.......T.......G..G.......FS.LFLI..MINAVISGQRT.A....F---LAVPVVL.......IL..LMV
B5Y6R2_COPPD/204-356R.F.......V.......W..G.......LS.FLGF..LLAQLLTYARG.G....L---LASAFGL.......FV..ALA
B6B6U9_9RHOB/187-338R.F.......L.......V..T.......LLIFAVS..FYATWIASSRA.A....T---LHLLLAY.......GL..ALP
B6B8S8_9RHOB/245-394R.L.......R.......L..A.......LA.AAYL..FAVLVLCKSLA.S....L---AYALAFV.......PV..VAL
B6JES5_OLICO/169-318A.A.......R.......N..T.......FA.LCII..CMAIFLAFSRG.A....W---AIFVAAS.......II..TTT
B6VUA4_9BACE/257-407R.L.......F.......Y..L.......IV.GMAG..FYGLLISGTRS.A....I---AVPIAGL.......GL..FLF
B6VYZ2_9BACE/224-375Y.W.......P.......L..V.......VG.LMLM.....CVFCGSRS.A....L---VPMLLAI.......AI..YVV
B7AH28_9BACE/205-353K.F.......L.......L..N.......VV.IGVT..LFVSVFTLSPS.T....Y---MEFFFLF.......LI..MIF
B7BDU4_9PORP/175-316H.V.......L.......L..L.......VL.LPII....SFFVSTKST.C....I---ISSVFIL.......VY..YIH
B7J3X6_ACIF2/185-346R.W.......A.......N..A.......IL.AVAF..LLQLGMGAGRT.G....Q---LLFVILMP.....LAV..WVL
B7K071_CYAP8/337-484R.N.......C.......G..L.......VS.MGLV..FMNAVICGQRL.A....F---GAVPGII.......LI..LMV
B7K694_CYAP8/286-429R.W.......I.......S..W.......GA.IASV..LVATIISGQRT.A....F---LVVPLIY.......LI..LFL
B7RNS7_9RHOB/202-356R.R.......A.......G..M.......VM.LVLG..WTGCLLSGSMT.S....L---FAAVTAVLI...SQAV..LMI
B8CL34_SHEPW/174-319K.L.......K.......F..I.......FS.MLLG..LYLVFITLSFG.A....F---LAIPIIL.......FY..IAY
B8CL64_SHEPW/214-355R.F.......Y.......G..F.......SG.SLSM.....VLLSQSRL.A....F---VCYLLLA.......GF..FMF
B8FWJ7_DESHD/228-369P.W.......L.......L..F.......AL.IGLV..IKLEFLTISRT.A....L---FGIALLY.......II..LCA
B8G9F2_CHLAD/225-362T.A.......V.......L..A.......LA.LWCI...YGVFLTGARQ.S....L---SGSGIAA......ALI..FGW
B8HEF1_ARTCA/210-341Q.W.......L.......L..I.................GGIVVSLSRG.P....L---VAMVVTL.......GL..GAV
B8HLI8_CYAP4/219-378R.L.......A.......G..I.......GS.GAIG..LFCIYLSQVRS.V....L---IFSVICL.......AIIGFVL
B8HNC8_CYAP4/218-375N.L.......I.......N..L.......CT.ASLI..AITGFMTGSRT.S....L---IAIGFMF......TGF..TFM
B9D396_WOLRE/190-376R.I.......L.......V..A.......LL.CLAA..VGLDVLSGVRG.S....W---GAMLACF.......IM..FGF
B9JKY3_AGRRK/181-340L.L.......G.......A..G.......VV.GLMA..AYCLLASQSAT.S....V---LVTGLVVMLSIGMRVI..LFL
B9XD26_9BACT/204-347R.K.......L.......A..L.......VC.IGCC..VLIVWACNSGG.P....M---GAAGAGV.......IG..SVL
B9YBP1_9FIRM/190-362K.W.......F.......M..S.......V..SLIM..LVWIVLSGTRG.Y....T---IEFAASM.......AL..IFY
D7E0N9_NOSA0/308-454R.L.......I.......S..L.......VT.LGLV..FFNAVISGQRI.A....L---ALVPVCF.......AL..LLL
C0C2D1_9CLOT/195-372K.I.......L.......N..L.......LC.IWFS..IAFAVYSRGRT.I....T---VVLASVI.......IA..AFI
C0CGX9_9FIRM/216-373M.F.......A.......Y..I........A.SAIM..AAFVLLSFSKT.A....I---LLIAVEVT....GYIV..FLI
C0QGY0_DESAH/188-336R.A.......F.......F..L.......VC.FGFI...FLILCTKSRA.A....F---GICGLVL.......SF..YLY
C0VIY2_9GAMM/185-331R.V.......L.......G..V.......FL.FSIM..AYVILINGSRT.G....A---FLILLSF.......LF..LIL
C0WW30_LACFE/203-350K.N.......I.......L..I.......VL.FSI....FIILNSGSRT.P....V---LAVGISL.......VV..YLV
C0ZT43_RHOE4/202-356P.K.......P.......L..V.......LG.VGIL..FVAQVSTFTFA.P....I---LVAIVTM.......LY..TAV
C1A313_RHOE4/214-369N.I.......I.......F..L.......AA.TPIM..VVGMGVSIVRA.S....Y---IGLAVGL.......LW..IAV
C1AWF5_RHOOB/210-389R.V.......W.......M..V.......IA.AVAV..PLGVIGSQTRT.A....V---FCLAAGL.......IV..YLV
C1AY50_RHOOB/263-416R.I.......V.......A..A.......AV.ALAC..AYSVYLTHTRA.V....W---LAFAIVL.......VG..GAL
C1F0J2_BACC3/223-353R.L.......S......................LIL..LCSLLLTASTT.A....F---IGIILYY.......CY..AIL
D5UK63_CELFN/214-352Q.F...............A..L.......VA...LF..VGGTVVTQSRT.G....V---VLVGVLA.......VW..VVI
D7B6S8_NOCDD/245-400R.W.......G.......G..L.......AA.AALA..VVPAVYSLNRA.L....W---AGLALSA.......AF..AAL
D5SX75_PLAL2/208-338R.F.......A.......W..I.......IP.IITL..WIGLFDTRSRG.G....L---LAAGAAM.......MT..LAV
C2EPL4_9LACO/200-348K.I.......L.......Y..G.......LF.LVLW.FMYTTIVYQSRM.Q...AV---IGIFTVL.......FL..IYV
C2H8B0_ENTFC/192-326R.I.......I.......G..A.......IA.VVAA..FLGIWVCQSRG.A....L---VALIVFA.......IL..DLF
C2JZS3_LACRH/195-345A.R.......N.......Y..L.......FP.ICCF..LISHFVANSRG.A....T---VGLLLLL.......AF..SFV
C2MCR4_9PORP/284-433Q.A.......E.......C..L.......LL.GVI....LYAYALQARY.L....L---LMALLLV.......AY..AVA
C2NRN1_BACCE/206-352R.L.......F.......I..K.......TL.TLA.....FLLLSTIRS.A....L---LLWLVFQ.......FL..MFI
C2PN12_BACCE/193-346N.L.......L.......K..G.......II.FILI..TLAMLISFSRY.L....I---AIYVLVL......LYV..YIY
C2Q801_BACCE/208-396K.F.......Y.......Y..W.......IP.TVLA..MYASIMVGTKV.G....Y---GAILVTL.......GV..ALL
C2U9X7_BACCE/204-397K.I.......Y.......Y..W.......IP.TILA..MYASIMVGTKV.G....Y---GAIVITL.......GV..ALF
C2V7V1_BACCE/208-389K.I.......Y.......Y..W.......IP.TVLA..MYASIMIGTKV.G....Y---GAIVITL.......GI..ALF
C2ZKF6_BACCE/208-401K.I.......Y.......Y..W.......IP.TILA..MYASIMVGTKV.G....Y---GAIVLTL.......GV..ALL
C3GAX2_BACTU/276-404T.I.......F.......Y.............FVIL..IIALLLSLSKG.G....M---LSFAIVV.......LF..KVF
C3PKS4_CORA7/215-355M.W.......G.......V..L.......AI.ALVS..LPPALATLNRG.M....F---IGLGVVA.......VW..VGF
C3Q1B3_9BACE/197-337R.Y.......F.......Q..I.......IL.LLLG..LFAVWSCNSRG.C....I---AVWLLIL.......TYRLFFY
C3R6E0_9BACE/193-346D.V..........................LV.IFFL..FFIIVLTQQRA.P....L---LFIVLST.......VF..FYI
C3WCW0_FUSMR/165-294K.V.......I.......G..V.......IL.ILSQ...LTYKVTNSRT.G....Y---ILIFIFL.......IL..ILI
C4RGH6_9ACTO/357-512R.L.......T.......G..Y.......LV.VVAA..VFPIVYSLNRG.L....W---IGLVIGA.......VY..VAV
C5BIC6_TERTT/235-383K.Q.......G.......M..........LK.VFYL..FAILILCKTWS.A....A---IYSILSF.......FI..IFF
C5E895_BIFLI/204-349K.W.......I.......N..Y.......LT.LLVS..VIMLFGSASRN.A....I---SGFIIFS......LCY..LFM
C5RCC2_WEIPA/221-380Y.W.......T.......A..I.......IL.GAAS..LGVLLLAKTTT.G....F---LLIGILA.......LV..YWL
D9RUY4_PREMB/174-313K.L.......V.......F..Y.......IG.LASM..VGNLILSGSYR.Y....L---IIGAVVA.......TM..YYL
C6IJ43_9BACE/203-357T.F.......A.......C..L.......FA.FFVI...AVIGNMISRT.T....S---VGLFLGI.......VY..LIC
C6M735_NEISI/182-343Y.L.......F.......G..W.......IL.FLSL..GAIVFASASRT.A....T---MSYIILF.......IL..NLI
C6NU22_9GAMM/224-372K.S.......L.......A..A.......IG.FVLA..LVATYMTLTRA.TYVEVL---LAVTTAA.......LI..TFF
C6R555_9MICC/204-343K.I.......E.......V..I.......LA.VVVF..SALLWATGSRT.S....I---AAYVAGL.......I...WIV
C6RIN3_9PROT/199-385R.V.......A.......C..G.......TL.CLAA..VGLDVLSGVRG.S....W---GAMLVCF.......VL..FGF
C6W3M0_DYAFD/200-366R.L.......F.......L..F.......FS.ILFG..MGVVVLSLAKS.S....Y---LGLGIAF.......GA..YFL
C6XK30_HIRBI/203-344K.Y.......N.......S..W.......IV.FIFL...ILLVATQNRT.C....L---AFASIFM...........FFN
C6XVP4_PEDHD/210-354R.K.......Y.......L..I.......PV.RIIV..LLGALASFSTA.S....W---IVFAIVGLL...NFFY..I.F
C6Z207_9BACE/221-375L.F.......I.......Y..W.......LM.IIGL..IWMCVCCGARS.A....L---VPVLLVL.......AI..YIV
C7G9J0_9FIRM/181-318I.W.......W.......F..F.......GT.CLTA..FIFYKITFCRT.G....I---IVFFFAW.......GI..ILF
C7MGH4_BRAFD/211-348K.T.......L...................A.VALI..VAGTVVTFSRA.G....L---ITLVLTV.......VL..SIV
C7PAF8_CHIPD/260-410K.L.......I.......L..I.......FM.IIVH..LLALGYSGTRT.A....Y---VMLPVGL.......LL..FFL
C7QQR9_CYAP0/223-379N.I.......P.......I..T.......WL.MMGL..TVTFILIKSTG.A....Y---LYLVCGI.......VI..LFG
C7X6F7_9PORP/176-315T.V.......V.......L..F.......FL.ICFF..VSYIFVCKTRS.L....L---FFLPYWIY.....QIY.....
C7XAP2_9PORP/173-335E.K.......F.......I..F.......LG.MLS....IGLLSGRSKFYG....F---YALSVFM.......AL..YFS
D6Z4J1_DESAT/222-373G.I.......P.......M..A.......FI.VAVL..VITTILCKSAN.A....W---VALALGC.......GG..YFV
C8RXJ1_9RHOB/237-386R.P.......R.......L..L.......AA.ALYL..MAVLILCKSAG.P....L---VYALGLA.......PL..LLL
C8S377_9RHOB/228-382M.I.......L.......P..L........S.VATL..VLSYIVTQARF.V....P---ISIGFSL.......LM..SLI
C8S4A7_9RHOB/262-400D.L...............L...........A.VGLI..LTGILVSWNFG.A...VI---VAMVLTL.......VF..PFL
C8XKU9_NAKMY/249-387R.V.......L.......S..W.......VQ.VGLI..VSAIPMSISRS.A....M---LTTAVVL.......LL..MLF
C9BIG3_ENTFC/192-327R.L.......L.......S..L.......PA.LILA..GATIWVCQSKA.A....L---YALVIFI.......IL..EIL
C9LAR6_RUMHA/190-337R.S.......V.......L..Q.......IA.LSCI....ICALAEIKI.F....F---VMFVIGV.......FL..IFL
C9RMK5_FIBSS/201-340T.Y...............................LF..ALSILCSSSST.G....F---LMLGILL.......VY..HLC
C9RPA9_FIBSS/198-362G.L.......K.......L..L.......FA.GMCC.......MSGSRT.L....F---LGFIAVI.......FC..EFI
C9YZ01_STRSW/187-328R.G.......S.......A..A.......LV.IVPS..LVLLALTHTRT.A....T---LGMLIGL.......VL..AIG
D0D9U9_9RHOB/235-384T.F.......G.......T..V.......AA.ALYL..TLILVLSKSLG.A....L---IFAVGAIP.....MVV..FSS
D0TPJ6_9BACE/219-370P.L.......F.......V..Y.......LL.MFFI..VVCIFLCGIRT.P....I---GAMFLTV.......FF..YLL
D0WWB0_VIBAL/216-372R.L.......A.......M..L.......GM.TVVI.....VVLSFSGG.A....Y---VNFALIC......AFV..FSL
D0XH47_VIBHA/210-366R.L.......V.......L.............LLLS..FGIVILSFSGG.A....Y---VNFVLLL.......GF..VFV
D1A7L1_THECD/209-365R.I.......A.......G..C.......VI.LIAS..LWPVVYSLNRG.L....W---GALILIG.......VF..GLI
D1CAK4_SPHTD/221-370R.A.......F.......W..A.......AL.AIVG..LIGI..SLSRT.A....F---VVGVLLF.......PA..SHM
D1JLT7_9BACE/213-361K.V.......F.......F..A.......FI.MICG..IYGIGISGTRA.A....V---AVPIGAI.......LM..YVL
D1JYE9_9BACE/223-402Q.K.......W.......Y..I.......LL.ILLF..IPLFISSGSAS.V....W---ITLLLTI......CAT..FIV
D1N0G8_9BACT/45-185K.V.......V.......A..G.......IA.AAGL..IAALALTGSRT.G....M---AVLVMEM.......VF..FCC
D1NJF5_CLOTM/190-344K.I.......K.......N..Y.......IY.IAIY..IIALMLTGKRT.L....L---FVSFLVI.......GL..AIK
D1R6C1_9CHLA/199-373R.W.......LKTVYHKCA..I.......FVQFVIF..AIFVILSGSRI.A....L---AALLVPF.......MI..KLK
D1RNU0_SEROD/222-365K.F.......I.......F...............LI..TLGIVCSTSKT.A....I---IMALLYI.......MF..LMS
E8S3V1_MICSL/258-413R.T.......A.......G..V.......AI.ALAA..IFPIVYSLNRG.L....W---IGLGIAA.......AY..VAL
F0QC36_ACIAP/216-356R.A.......L.......L..A.......CA.G..L..LAGVWMSGTRG.A....M---LAGIVAV.......MG..YLL
E8YFQ6_9BURK/286-435R.I..................V.......LG.CVGI...PALLLTSARS.T....W---GGFTIAL.......IY..SFT
E3JCL8_FRASU/238-384R.I.......W.......Q..I.......T....LF..LAAILSTVSGT.G....I---LLIGFAS.......VL..LAV
D1Y952_PROAA/204-371R.V.......V.......S..G.......IL.ATGA..LVAVILTGSRA.G....L---ACATLFV.......LG..CAI
D2A6W3_SHIF2/192-313K.C..............................LII..VLAILLTESRG.V....L---LFTTLSL.......LL..ASF
D2B3Z9_STRRD/220-371R.L.......A.......V..A.......PL.IALA..AVPIVYSLNRG.L....W---IGLGIAT.......AY..LFL
E6VE03_RHOPX/196-345M.M.......R.......N..G.......VA.FGII..SLAIFLAFSRA.A....W---GMLAGAS......LLT..VAL
D2NP44_ROTMD/210-343R.L.......V.......A..I.......AI.TA.....GMLWLTGSRT.S....L---AAYAFAV.......L...WLY
D2PZ04_KRIFD/223-379R.I.......A.......G..W.......PV.LVVA..AVPVVYSLNRG.L....W---AVLVVGA.......LY..AVV
D2QHE2_SPILD/202-373K.L.......L.......C..F.......FA.GVLN..IAVLVLTQTRS.G....I---LAFILAT.......IL..FMY
D3ACB3_9CLOT/181-336N.P.......V.......Y..F.......IT.GVIS..LIPISFWGARG.A....L---ATGIVAV.......AL..YFL
D3HI42_STRG3/189-329A.R.......A.......G..L.......VM.LLVS..LLIFAITDSRT.T....F---LIAGVII.......LC..YFL
D3L003_9BACT/156-293K.S.......T.......C...........V.ALCS..VFALLSFNSRT.S....L---YAFIFVL......PLV..ILL
D3LLI7_MICLU/199-332K.F.......L.......V..L.......GA.GSVL.....TFLTGSRT.S....M---AALFCAV.......AW..ILV
D3Q950_STANL/236-391K.Y.......A.......A..V.......AI.LAVA..LIPTVYSMNRG.L....W---LNLAVAG.......VF..VAV
D3T7L1_THEIA/246-395K.M.......V.......N..I.......LL.YLTI...AEIILATSST.G....Y---IGLLFFI.......SS..YTI
D4BMR8_BIFBR/200-373K.I.......G.......I..L.......IP.IFAA..GAIAMGSGTRI.I....L---DTVVATF.......IW..LIA
D4CF67_9CLOT/193-340N.F.......F.......L..A.......LC.CLPL.....FLMGYKRS.A....I---LALFSSA.......AV..AVI
D4E8R1_SEROD/192-333Y...............................IILI..LVAIVFSTSKT.A....I---IMALLYI.......MY..LMM
P72910_SYNY3/223-371R.F.......F.......L..I.......IS.YG.....IALFFTGSRA.S....L---LIIGIFI.......LL..FVA
EXOQ_RHIME/181-340M.G.......A.......A..G.......GA.GLLA..AYCLLTSQSAT.S....V---LTTAAVI.......GL..CLG
Q03KL2_STRTD/193-334W.Y.......L.......D..V.......FV.VIVN..YLIYLLCGSRV.S....I---LLLLFAV.......FL..RIL
Q03WC5_LEUMM/225-384K.W.......F.......N..W.......AF.IGSI..LMFLVLARTTT.G....L---ITLVVAA.......VL..WFL
Q04DW5_OENOB/200-344D.Y.......L.......F...........I.LLNL..FYCFFVNQGRV.G....L---IIFLSFL.......LI..YYV
Q07GI2_ROSDO/280-429P.R.......P.......Y..L.......LY.AGYL..FIILFLSKTFG.A....F---LIAFALL.......PV..AVF
Q07I04_RHOP5/195-344A.M.......R.......N..G.......IA.FGII..TLAIFLAFSRA.A....W---GTFAGGAM.....LMT..ALM
Q07Z92_SHEFN/181-323K.K.......I.......Y..L.......FG.LLSL..IILGLLTQSRS.P....A---LFTFIIL......CGY..LIY
Q09E62_STIAD/262-421R.L.......V.......S..V.......GG.IFLG..IVCLYLCQVRA.SAMMLL---VCMLAIV.......AV..LAL
Q0F0M6_9PROT/213-366R.M.......L.......A..V.......PA.FIAT..AILVVYSQSAA.A....L---LLLLIILS....AKAY..FLL
Q0FVI2_9RHOB/235-384T.L.......R.......T..L.......LC.ALYL..LLVLVASKSLG.A....L---LLASAAL.......PC..LLF
Q0K590_CUPNH/190-329R.A.......A.......L..I..........TVIA..VPLLFLLGARS.E....F---MAFLVVA.......AM..LMV
Q0RQN9_FRAAA/191-339RPV.......V.......L..A.......LA.VLPI..LVGGLLCVSKI.F....L---LCGLPLA.......LW..QAA
Q116W3_TRIEI/310-456R.M.......G.......G..L.......FG.MAVV..FINAAISGQRI.A....L---ALVPTTT.......II..LLI
Q11WP4_CYTH3/217-372M.F.......W.......F..I.......IC.LGAF..ASNLAVSGSRG.TY.GNV---FVLFASL.......LC..SLL
Q13C35_RHOPS/193-342A.V.......R.......N..A.......IA.FGII..ALAIFLAFSRA.A....W---GTLAGAS.......VL..MIA
Q13ZP0_BURXL/293-441I.V.......L.......G..C.......VG.IP......VLLLTSARS.T....W---GGFAIAL.......AY..SFL
Q1AYI9_RUBXD/56-206K.A.......A.......G..L.......VL.TILV..LAAGFATLTRA.T....Y---MEILMTL.......FA..AWL
Q1DDI4_MYXXD/252-411R.V.......L.......S..V.......GG.ILVG..LFGIYLSQVRA.T....A---VMLVVCL.......VA..LAA
Q1ILV2_KORVE/234-378K...............................ISVL..GVALVLTLSTS.G....W---VAFFVAF.......AL..TML
Q1YYW0_PHOPR/196-339Y.I.......L.......A..I.......LP.LALN..FAIIIALDGRG.I....A---VSSITAI.......LL..WAW
Q1ZNU5_PHOAS/174-338K.I.......I.......G..L.......LS.IVFS..IAVLLKAKSLD.A....T---VTSFGSI.......FA..CFC
Q1ZRU2_PHOAS/204-332K.F.......K.......F..L.......SV.G..C..LLAIILTFSTT.G....L---VLFLISY.......GL..FVF
Q21E31_SACD2/194-335R.C.......A.......G..I.......FG.AFVM.....CMLCQSRA.G....W---AIFFAIV.......PI..MIV
Q28JD9_JANSC/245-398R.S.......L.......Y..L.......MM.GAWI..LLTLALSNSFG.G....L---VTALLFM.......PI..VLI
Q2BHJ7_9GAMM/226-360Y.L.......L.......A..C.......VC.A.....FFIVVTTASST.T....L---LALLSAP.......FF..MSL
Q2BJE6_9GAMM/185-324K.R.......I.......F..I.......TL.FVIN..MSALLLSDSRV.G....A---GAFFIAL.......II..SKI
Q2G3B0_NOVAD/227-366R.K.......L.......G..I.......VG.SVCG......FFSLSSG.A....F---LALLIGL.......GI..LVT
Q2J607_FRASC/297-440R.M..............................IMF..VLAILSTVSGT.G....L---LLLACAG.......VL..LAV
Q2SZV7_BURTA/211-393R.V.......I.......G..V.......IG.LLAC..GFVGLASLNRF.F....W---PAAGATL.......VV..AFY
Q2T8A3_BURTA/218-368R.L.......A.......L..A.......AL.LSIA..AVGIWATTNKT.T....L---VALALVV.......AL..HCM
Q31EZ8_THICR/228-358G.V.......F.......T..G.......IV.LINN..FFILVLSTSAT.A....Y---IGIFILF.......GL..ILF
Q323H8_SHIBS/204-353K.F.......A.......F..L.......F...VGF..VIMVVLTYNRN.G....M---LAFAVTS.......LF..IMI
Q3B1S6_PELLD/212-351K.I.......Y.......F..A.......CT.IMVG..LMAAIIAGSRG.P....V---LSLLVLL.......PL..LAY
Q3B349_PELLD/225-374K.I.......F.......F..LP....SSLL.LALL..IGTFLMYQSMG.A....I---FYFAMSL.......LI..L.Y
Q3MDE5_ANAVT/319-465R.F.......I.......S..L.......GS.MATV..FINAVVSGQRI.A....L---TLVPVCF.......VI..LLL
Q3SHZ0_THIDA/269-434R.R.......Y.......F..V.......IA.LCYF...LLLLASAQRQ.E....T---VAAIVAA.......TA..AVG
Q47Z28_COLP3/217-358R.N.......T.......G..L.......LG.SFVM.....SLLSQSRA.G....W---VIYIALT.......PL..CFL
Q489C9_COLP3/205-331E.K...............................CA..LASVVLSFSLT.G....M---AGVLVYI.......VL..KLN
Q48BJ9_PSE14/208-357R.L.......M.......M..I.......LL.SAVA..LYAIVLTTSKA.P....A---AAFALTL.......IL..LLL
Q48GU3_PSE14/246-383R.R.......L.......G..L.......TV.AALG..AIGLLLTGSRG.A....L---LSLIAVM.......LL..MAR
Q4BV80_CROWT/224-377N.I.......P.......I..T.......FF.VAAL..TVTFILIKSTG.A....Y---IYLAYGL.......MV..LFS
Q4BWG3_CROWT/286-429K.G.......L.......G..F.......VT.IIAV..LVATLISGQRT.A....L---LLVPIIY.......LV..LLL
Q4K0H9_STRPN/184-332Y.Q.......V.......D..S.......LV.LWFD..LFLLLVSNTRT.I....Y---IILVVFW.......IV..VHS
Q4K0J9_STRPN/274-404Q.V...............................LL..LASFVLSVSKA.A....F---LSMLVYI.......II..YTW
Q4K1F3_STRPN/210-359R............................LV.LFSI..VAAFVLTFSRS.A....I---ISTLVGI........V..FFQ
Q4K1K2_STRPN/189-336K.S.......L.......I..L.......IA.ISCI....ICALAEIKI.F....F---VIFIFSI.......IL..IFI
Q4K1M0_STRPN/192-329T.Q.......V.......T..I.......LA.FLLQ....VLVLSKSRI.A....I---IALIIYI.......VF..VVM
Q4K247_STRPN/183-329K.I.......A.......F..L.......LQ.ILTV..LNCLYADVFLS.K....V---IAIFMII.......YA..LSF
Q4K368_STRPN/165-325R.V.......L.......N..L.......VY.KTLI..AISIFLPQSRI.V....W---IAFGVIL.......IL..SFI
Q4VKA1_ECOLX/188-325R.A.......L.......F..L.......IM....P..MITLISSGSRT.A....W---LSLGMTL.......LL..TVV
Q5LE47_BACFN/193-320E.K.......S.......C................L..LVLIILTFSRA.A....L---ISIPLGW.......LY..MYC
Q5LV52_SILPO/257-406R.E.......R.......W..A.......GA.LIYM..LLVLNACKSLA.A....L---GYGLALT.......PV..VLF
Q5P6V0_AROAE/255-405W.G.......A.......M..L.......VS.TLLL..ALVLINTLGST.G....W---AAAGIGGT.....AIV..LWL
Q608R5_METCA/228-368K.P.......A.......L..W.......LS.LTTA...GGLFITLAKG.S....W---LASFIGA.......GL..VAV
Q64W31_BACFR/208-352R.L.......K.......N..I.......VL.IVLT..ILAMLFAFSTT.F....F---ILSIFYL.......VI..LFL
Q6AGK0_LEIXX/192-346P.Q.......L.......A..A.......FS.IALA..ALCLLFAHSPV.I...AA---VSVVVSL.......AT..LAL
Q6HMT7_BACHK/204-392K.F.......Y.......Y..W.......IP.TVLA..MYASIMVGTKV.G....Y---GAIVVTL.......GV..ALL
Q6LNR9_PHOPR/191-336K.I.......K.......Y..G.......LC.SIFS..LIVVVLSQSKA.A....Y---LSLIVCY.......FC..FLI
Q72TC9_LEPIC/257-406W.V.......L.......F..F.......MV.LLVF..GAVFFLIGARG.G....I---FSFLTFCIF...TVFI..FFF
Q7NDJ8_GLOVI/213-360R.F.......W.......P..I.......AL.LGA....AALAISQSKF.S....I---VSILLVL.......LY..LFW
Q7NF12_GLOVI/242-388S.L.......A.......L..L.......GG.S.....LFLLLLSGSRA.V....L---LAMPLVL.......LL.RYAV
Q7NII4_GLOVI/245-399R.W.......L.......V..L.......MA...VL..VIPYTGTKTLG.G....L---GMAAVFL.......AV..LLL
Q7NJN7_GLOVI/229-378P.F.......L.......L..........GG.AGL....LALLLTGTRS.A....L---LCLAIVA.......AL..RFV
Q7UF14_RHOBA/228-394R.W.......I.......G..S.......IL.LTVL..LLGVASSLSRG.P....I---VTLILTG.......GL..ALA
Q858F4_BPE15/191-337K.G...............A..V.......IW.MLIV..LITGFLSMSRT.P....V---AFLIAIL.......AL..YKI
Q8GM97_STRTR/177-346I.F.......F.......Q..Y.......IA.VVVT..IAAILFTQSRS.S....W---IATIVTV.......FL..YWI
Q8KN07_9ACTO/187-328R.R.......S.......A..A.......LV.IVPS..LALLALTHTRT.A....T---IGLLAGL.......VV..AIG
Q8KQ17_PSEAI/199-335S.R.......L.......V..M.......LL.LAIQ..WCISFALAGRG.L....W---LGFAVAH.......LA..LCW
Q8PRB5_XANAC/237-377R.........A.......L..L.......TC.LGLL...VGVWMSGTRG.A....M---LAGIVGV.......LG..YLV
Q8YT85_NOSS1/260-405R.L.......P.......A..S.......AA.GY.....LAFLLTTVRT.L....W---AGWLIAF.......LT..FLT
Q92U08_RHIME/208-361R.F.......A.......G..I.......VI.VALS..FVFLVNTGGKT.S....T---AMLPAIL.......LL..ALI
Q9ALX1_STRAG/186-328E.................N..I.......FI.TLFL..VFCAYLTGARI.F....L---ICMIILL.......GY..LLL
Q9RJJ8_STRCO/187-328R.R.......S.......A..A.......LV.IVPS..LLLLVLTHTRT.A....T---LGLLVGL.......TL..AIG

PF04932

A4CI06_ROBBH/191-347-----------------RARKI-ASTPE................................................FLGI
A3GY30_VIBCL/171-330-----------------VNVRK-IKFKQ................................................TLVF
Q4UYH3_XANC8/219-372-----------------QLLGG-RKVIA................................................VAAL
A4TX99_9PROT/241-386-----------------IGRLV-RLRQT................................................LALL
A3DIW4_CLOTH/315-453-----------------LLNKR-LLPFI................................................ILGG
Q89PW4_BRAJA/213-357-----------------TSMWS-VICMR................................................LYAV
A5LYT8_STRPN/187-326-----------------YKLRK-LFWKR................................................GRKI
Q7UXE7_RHOBA/267-417-----------------IYVPR-RVRIV................................................ALAG
A2TSG4_9FLAO/201-377-----------------YFIID-GVRSG................................................ALVQ
B1Z898_METPB/188-338-----------------GRFAP-RAAAL................................................ALAA
Q7UWZ2_RHOBA/233-380-----------------YVRPR-RGLIG................................................LPVL
A0PZ10_CLONN/222-380-----------------LYLKQ-HSKSI................................................YKKI
Q7UPJ9_RHOBA/331-474-----------------DFVWA-NAFGR................................................RVVN
Q97ER0_CLOAB/210-348-----------------IRSKN-AKSVV................................................RFGI
A4AI36_9ACTN/211-357-----------------LYALR-RVPSG................................................RRRY
A7VGX9_9CLOT/231-488-----------------AGIRN-RVKTYDDRMVIGQNSTCDPFLGWLIGYAGIVLGYTVMAFLTTGTGKGYDKLTGLAKL
A0K2I1_ARTS2/235-362-----------------SWSPA-VRRRA................................................GLAA
Q1ZI48_9GAMM/245-403-----------------FKWRK-YIFLV................................................PFLI
A4XML1_CALS8/220-429-----------------LLPRE-KRISF................................................VFNL
Q2BFT2_9BACI/241-418-----------------LTKEW-KRARN................................................IVIG
Q0G5C8_9RHIZ/213-362-----------------LSGRI-LGGRI................................................LPVI
A3EK85_VIBCL/216-360-----------------LILLF-YKTKP................................................KSLY
Q7NQD3_CHRVO/200-367-----------------WHWRS-RDENS................................................RRMM
Q7MVK6_PORGI/277-409-----------------VRAFF-LSQKK................................................KLLF
Q5FQI9_GLUOX/196-353-----------------LYRPM-RPAAL................................................AAAA
A3XRK0_LEEBM/177-345-----------------ADVRK-LRSKK................................................VLKL
RFC_SALMU/185-325-----------------SNRKM-LFCGI................................................TLFV
Q98C91_RHILO/186-337-----------------LAMTK-LLSRR................................................YRRV
Q12C32_POLSJ/166-320-----------------WELPK-RYRAA................................................VVLL
Q0SYF1_SHIF8/194-338-----------------MFKQW-KL...................................................LLVG
Q9X4C1_ECOLX/176-341-----------------KFKKP-FLVFT................................................IFLL
A0ZHE8_NODSP/234-386-----------------LLVYW-WTVQM................................................PPFW
Q7V9G4_PROMA/203-353-----------------TATWF-WVLPL................................................MALS
Q6ABG2_PROAC/212-358-----------------AVRRW-RWVLP................................................GVVM
Q609Q8_METCA/225-373-----------------VYLLL-ARSSR................................................FSSG
A4ISY3_GEOTN/200-391-----------------LMPKT-FFKNV................................................IRPH
Q7UKM5_RHOBA/239-382-----------------DRLAN-RRGLA................................................MGLC
Q2T0U3_BURTA/206-363-----------------FAQTR-RDPAA................................................RRAR
Q01XB1_SOLUE/184-329-----------------MRQKR-WLLLA................................................PLPV
A0Z5U1_9GAMM/194-332-----------------LYRGK-RLVSS................................................LSAG
A4AAF7_9GAMM/171-307-----------------GSHRS-ALRNV................................................WYAA
Q9X5H1_HELPX/195-362-----------------FILYA-KKSLR................................................PLGY
Q6ASB4_DESPS/185-338-----------------LLVQT-LSWKK................................................MFVG
Q4JZ62_STRPN/213-343-----------------LFSKT-SGVKR................................................YVSS
Q11T24_CYTH3/244-416-----------------WRYKI-RWSYI................................................GIAA
Q6MI87_BDEBA/207-358-----------------LHKTE-TNQGR................................................IFKF
Q8AA03_BACTN/192-346-----------------IHFKW-ITKAK................................................SYLQ
Q1J334_DEIGD/252-413-----------------FRPGR-RWWKP................................................LALA
A5UWM4_ROSS1/288-436-----------------LHRSQ-HRQAV................................................RWSA
Q4K127_STRPN/198-353-----------------IYWYD-KKVSK................................................LGKE
A6GZ05_FLAPJ/236-385-----------------ILFFV-TQRAA................................................KIKL
A5G2R8_ACICJ/202-340-----------------NSRNR-LTSFL................................................LFGI
Q5NZI1_AROAE/256-398-----------------RNFGA-GFATR................................................MVGA
A7Z9C6_BACA2/261-409-----------------ILLPS-LLKKL................................................ALYA
Q9RZA8_DEIRA/165-323-----------------FGGQR-RRVWV................................................MLPA
Q89SN4_BRAJA/265-409-----------------VPLEL-GRSRK................................................WLVL
Q9ZIT0_ECOLX/196-350-----------------MDSYI-NKRIN................................................YKLY
A4ND37_HAEIF/179-336-----------------LYKED-INKKL................................................IITL
O06944_SYNY3/232-381-----------------IGIGL-LRQLP................................................WRWW
A5UY10_ROSS1/144-293-----------------VRLQR-YAQDS................................................DARI
Q9AQJ1_STRAG/174-309-----------------LLNTI-VIKRQ................................................TIRF
Q65SG0_MANSM/195-350-----------------LNASA-YFKAV................................................YLFF
Q832Q1_ENTFA/206-388-----------------FTIWF-FQKNT................................................SKAV
Q83VQ8_9PROT/239-380-----------------FMERK-Y....................................................IPVL
Q97EP1_CLOAB/208-365-----------------YIYIM-GRKQT................................................IYKK
A7BD98_9ACTO/223-370-----------------LVVQR-RVPVH................................................LRLR
Q220X5_RHOFD/200-337-----------------RSERK-VVTGF................................................WFGV
Q04RV1_LEPBJ/208-370-----------------VLGIV-RKELP................................................SAKI
A6F4Q1_9ALTE/139-270-----------------LYRNR-VWFLL................................................FGAA
Q09DA3_STIAD/195-349-----------------GVLRQ-RRPGS................................................GRRP
B9LD61_CHLSY/273-406-----------------VRYRQ-LWRHM................................................LAVS
A4B946_9GAMM/214-357-----------------YFRWS-LFKPK................................................ILVS
Q8RNK4_KLEPN/160-294-----------------LHVFT-RRNLL................................................IAAA
Q72XI7_BACC1/178-330-----------------IQQKA-GIKGK................................................IKAL
Q2BRH4_9GAMM/186-340-----------------WQKLN-LKTLC................................................ILLA
A6D015_9VIBR/218-369-----------------YLYRH-STRKR................................................FRGW
Q1MQ48_LAWIP/199-337-----------------CIWTK-FSLLK................................................VIVP
P74814_9SPHN/322-468-----------------LWGLR-RWIKE................................................RGGL
Q2N6C0_ERYLH/230-383-----------------AVWGK-IRNRA................................................AQMP
A6QBN3_SULNB/185-344-----------------IHYRI-NFRSI................................................IAAL
A6M2N6_CLOB8/242-531-----------------IFYKP-LIKRW................................................KGIL

PF13425

C6IFG7_9BACE/266-414.................LS..R.NRK...........---------------------------------------..AC
A0LW89_ACIC1/221-359.................SW..Q.ARQ...........---------------------------------------..KV
A0YRC8_LYNSP/311-457L.....T.G......QVTN..L.KRF...........---------------------------------------..LP
A0YY08_LYNSP/334-480A.....T.S.......HIP..Q.LKR...........---------------------------------------..LV
A0ZBK6_NODSP/316-462.................AT..G.QIRN..........---------------------------------------LKRF
A1BHF5_CHLPD/216-365.................ST..R.MKS...........---------------------------------------..SV
A1KBI4_AZOSB/182-311.................QR..R.LV............---------------------------------------..GA
A1VT05_POLNA/222-357.................RR..Q.SSV...........---------------------------------------..VI
A1WA83_ACISJ/201-342.................VA..Q.GVK...........---------------------------------------..FI
A1YVC7_LACJH/222-358.................TS..K.SSN...........---------------------------------------..IY
A1YZN9_PSEAI/186-321.................LS..S.KNK...........---------------------------------------..GL
A1ZS85_9BACT/258-408.................MS..K.NFK...........---------------------------------------..IV
A2CCT3_PROM3/195-349......V.M.......RLK..G.RSK...........---------------------------------------..KF
A2SDP8_METPP/225-368.................LR..T.VLR...........---------------------------------------..LG
A2WDK3_9BURK/260-410................QSS..N.RVR...........---------------------------------------..MR
A3F4D2_LACLC/174-305.................SS..K.KTKKQVSN...FEK---------------------------------------RSIT
A3HV81_9BACT/249-392.................VF..G.LYK...........---------------------------------------..L.
A3IMI1_9CHRO/286-429.................TQ..K.KNK...........---------------------------------------..NF
A3IUA7_9CHRO/225-379.................AK....KFRH..........---------------------------------------.SLP
A3K8X9_9RHOB/235-384.................VR..M.QVR...........---------------------------------------..VA
A3KU19_PSEAI/248-385.................RKVPY.TGR...........---------------------------------------..LL
A3P2Q6_BURP0/171-296.................Y...................---------------------------------------...L
A3SPZ3_9RHOB/245-394................SER..A.MVR...........---------------------------------------..VA
A3V694_9RHOB/192-341G.....A.Q.......RQ.......IFGGRD..IRGL---------------------------------------LGRL
A3W1Y4_9RHOB/173-312......N.R.......IMG..G.RWT...........---------------------------------------..LF
A3WFB0_9SPHN/222-363D.....W.L......TERF..Y.NLT...........---------------------------------------..WR
A3XD73_9RHOB/304-453.................AS..P.RWQ...........---------------------------------------..IR
A3Y9Z7_9GAMM/195-353V....TN.FS.....KAY.......VGN........K---------------------------------------RVSL
A3ZP84_9PLAN/227-386......C.L.......AYR..G.EWR...........---------------------------------------..RT
A4AEK4_9ACTN/190-334.................LA..W.PVPH..........---------------------------------------.STG
A4EDX8_9RHOB/194-345L.....G.M......RSMS......APA.........---------------------------------------RSLV
A4EWL1_9RHOB/245-394.................GS..Y.RLQ...........---------------------------------------....
A4F0R9_9RHOB/216-356Q.....S.A......TRRL......KN..........---------------------------------------QWNT
A4TXA3_9PROT/212-353.................LS..G.RGGTM.........---------------------------------------ARNL
A4XMK9_CALS8/198-350G.....S.W.......SFA..K.K.KIE........I---------------------------------------FKKL
A4YQ66_BRASO/187-322.................TL..N.PFS...........---------------------------------------.PGK
A4YX51_BRASO/206-352.................RH..G.HMR...........---------------------------------------..LF
A5CP65_CLAM3/221-356F.....L.R......DAIS..L.RVR...........---------------------------------------..AT
A5EAQ5_BRASB/235-388.................TQ..P.RLQ...........---------------------------------------..AK
A5FL57_FLAJ1/219-339......R.N.......KLY..Q.LAK...........---------------------------------------..IY
A5FL58_FLAJ1/161-315.................Y...K.KDKL..........---------------------------------------NTKM
A5G2F5_ACICJ/218-369V.....E.A......PDFG..M.RAR...........---------------------------------------..LG
A5GEM1_GEOUR/220-381QNS.KQQ.LLS...QTSGF..I.NRR...........---------------------------------------..YL
A5GQB5_SYNR3/178-326Q....QG.I......GLG...Q.VCK...........---------------------------------------..RG
A5PAQ9_9SPHN/298-451.................VW..A.LRRWRQGK...DSI---------------------------------------FGPA
A5V8X2_SPHWW/271-405.................LR..G.RYM...........---------------------------------------..LA
A5ZV75_9FIRM/172-330......S.........GKI..K.LWK...........---------------------------------------..KL
A6BIH2_9FIRM/191-358.................YT..K.PSK...........---------------------------------------..KT
A6CBU1_9PLAN/250-380.................PK..Y.GKK...........---------------------------------------..AA
A6DE00_9PROT/193-358VRI.FND.FLN...RFSI......KKH..........---------------------------------------YVKY
A6DFC8_9BACT/220-366.................T...F.KRKDSG.......P---------------------------------------LKTF
A6DMP1_9BACT/236-371.................KF..K.ASK...........---------------------------------------..RY
A6DZI5_9RHOB/235-384.................LP..T.RMQ...........---------------------------------------..I.
A6E8K4_9SPHI/180-325.................FY..Y.GSS...........---------------------------------------..AL
A6ETG3_9BACT/167-314......I.........IAK..Q.HFL...........---------------------------------------..KH
A6F673_9GAMM/263-423LIM.FDG.IKH..KDEKFK..F.KFE...........---------------------------------------..VV
A6FK24_9RHOB/260-408.................SR.....KT...........---------------------------------------..QL
A6L5V9_BACV8/222-366.................SV..N.IFRY..........---------------------------------------KVFY
A6L7F9_BACV8/212-352N....IY.L......GQKM..T.RKR...........---------------------------------------..LG
A6LGX1_PARD8/196-333.................VE..Y.KERQ..........---------------------------------------YKSV
A6N385_ARTOX/264-390.................WT..K.VGK...........---------------------------------------.YAG
A6UIW2_SINMW/253-393K.....R.L.......ADA..I.GPR...........---------------------------------------.PLW
A6WE97_KINRD/230-374.................LL..G.RLG...........---------------------------------------..RS
D7HGD2_VIBCL/212-351.................P......IR...........---------------------------------------..YI
A7AHI1_9PORP/175-336N.....I.N.......HFK..L.NIK...........---------------------------------------..TI
A7B4B5_RUMGN/180-334T....KI.RR.....DDAK..K.RKKEYEMA...SWF---------------------------------------SGL.
A7B9B7_9ACTO/214-354......Q.R.......LRA..G.AWRT..........---------------------------------------.VLG
A7BWS2_9GAMM/221-377LA...SL.VG.....LVK.....KPIM..........---------------------------------------.RYF
A7GLQ7_BACCN/204-397F....SF.I......EYMM..N.RKKEGKG.....FP---------------------------------------QLV.
A7IL98_XANP2/205-360AR..LLK.YP....ERIK.......TFLR......RT---------------------------------------ALWS
A7JJ42_FRANO/186-334K....PL.FS.....FSLR..K.GKI...........---------------------------------------..FY
A7JMT4_FRANO/187-383V....II.KH.....YSL.......NDEKE.....LN---------------------------------------ILKF
A7M5X5_BACOV/176-343.................TS..F.KSI...........---------------------------------------..RY
A7NGA7_ROSCS/365-564LLLILALRRAQQ.QNQERA..R.LWR...........---------------------------------------..RL
A7V9S7_BACUN/180-319F.....N.F......KGMS.IK.KIR...........---------------------------------------..LL
A7VV00_9CLOT/206-361Y.....D.W.......IAH..N.SRK...........---------------------------------------..KT
A8GC50_SERP5/204-356.................LR..V.DRKL..........---------------------------------------.ERV
A8LUD1_DINSH/214-355A.....G.I.......THR..T.KYR...........---------------------------------------..WW
A8LXZ5_SALAI/235-376.................RA..S.RRGNT.........---------------------------------------RVAA
A8RK65_9CLOT/197-346.................TE..G.RANQG.........---------------------------------------YAMR
A8RKN0_9CLOT/193-357......Y.R.......QY.......KAGRISG.RFLC---------------------------------------CIGA
A8RSJ4_9CLOT/221-350.................KS..I.RYT...........---------------------------------------..VF
A8SGY7_9FIRM/208-357R.....N.S......GEM...G.KIK...........---------------------------------------.QGM
A8U9G8_9LACT/218-351D....KI.NL.....RELK..W.TKR...........---------------------------------------..TT
A8UCK5_9LACT/210-361.................DN..F.KKK...........---------------------------------------..PY
A8YA87_MICAE/331-478L.....T.G.......QIA..N.LKR...........---------------------------------------.FLP
A9A0Y0_DESOH/253-403.................CL..K.NWK...........---------------------------------------.AMA
A9CEI7_AGRT5/239-386................SSF..S.NRKI..........---------------------------------------.TLT
A9E2E9_9RHOB/245-394................PAR..W.QIR...........---------------------------------------..LA
A9EBQ8_9FLAO/78-235.................RS..T.G.............---------------------------------------..KF
A9ETU3_SORC5/228-355.................KK..Y.GIR...........---------------------------------------..GA
A9GB69_9RHOB/245-394.................AS..Y.RMQ...........---------------------------------------..MR
A9GIB7_SORC5/278-406.................RR..S.G.T...........---------------------------------------..LG
B0CE59_ACAM1/222-374.................TW..S.RSS...........---------------------------------------..IA
B0CEF6_ACAM1/212-353................RTK..I.RIK...........---------------------------------------..FR
B0JPJ8_MICAN/292-437.................AT..S.KHKQ..........---------------------------------------.KLP
B0KB87_THEP3/245-390Y....NF.L......HSIR..G.GRKYQ........Q---------------------------------------NLYY
B0M993_9FIRM/208-351......D.Y.......LFA....NKRYLF.......T---------------------------------------KITL
B0M9A4_9FIRM/196-348................IKY..V.KSK...........---------------------------------------..NY
B0N359_9FIRM/240-375.................IN..F.KIN...........---------------------------------------..IG
B0T732_CAUSK/201-343.................VR..Y.LGRNGA.......K---------------------------------------VLVA
B0TYH5_FRAP2/172-367I....AL.K......YFS......FKNNK......LC---------------------------------------IKRL
B0ULV1_METS4/257-396.................FS.AT.RARA..........---------------------------------------.LGM
B0V6K1_ACIBY/174-325YFM.INS.FNL...KKGI.......SIKI......SF---------------------------------------FKKM
B0VGS8_CLOAI/260-411K.....G.Y......NLMK..Q.FIR...........---------------------------------------..MF
B1C0Q0_9FIRM/182-328CT...VI.MR....SQDSK..L.KIK...........---------------------------------------..RI
B1FZC5_9BURK/272-424................KSN..N.KVR...........---------------------------------------..LR
B1R2U0_CLOBU/208-343.................CN..S.KFKK..........---------------------------------------.FVY
B1RNR5_CLOPF/189-330.................YK..N.KKK...........---------------------------------------..LI
B1WSH8_CYAA5/286-429.................TE..K.RNK...........---------------------------------------..NL
B1X0A2_CYAA5/338-485.................LT..G.KFAD..........---------------------------------------IKRF
B1Y725_LEPCP/205-349.................WH..W.RQH...........---------------------------------------..LR
B1ZT82_OPITP/197-358SM...PR.AG.....IGFG..P.GFK...........---------------------------------------..AL
B2AHI9_CUPTR/221-375CT...LM.FG.....RSV...A.KRR...........---------------------------------------..VL
B2ILP9_STRPS/194-329......N.........EIN..S.NNK...........---------------------------------------..WL
B2J995_NOSP7/327-473......L.T.......GQI..G.NLK...........---------------------------------------..RF
B2JKN4_BURP8/242-388SR..PGR.VV....PGAVE..R.QQR...........---------------------------------------..MW
B3C6G3_9BACE/158-317MH..RDK.SK....WNVLW..K.RYK...........---------------------------------------..RR
B3DZJ9_METI4/232-389......A.G.......FLA..G.RMKS..........---------------------------------------TTTF
B3EF24_CHLL2/226-378.................SS..K.IKK...........---------------------------------------..PV
B3Q3Q8_RHIE6/200-358.................SA....KPM...........---------------------------------------..LG
B3QV51_CHLT3/220-371.................LN..K.RYG...........---------------------------------------..VF
B3W8Q4_LACCB/236-408VKVVIYFWGDRYSLNLNRA..M.NIR...........---------------------------------------..RA
B3WWQ6_SHIDY/179-312......C.........GMK..V.DVR...........---------------------------------------..LK
B3ZZ03_BACCE/196-346.................AK..K.NVK...........---------------------------------------..FF
E0UAN3_CYAP2/223-375.................AK..W.LRT...........---------------------------------------.NLP
B4D1K5_9BACT/198-355.................IA..L.RRPAQM......RG---------------------------------------AVIF
B4SDC8_PELPB/170-319......S.F.......KYK..N.PYR...........---------------------------------------..QF
B4SFN3_PELPB/228-374.................LS..N.RIK...........---------------------------------------..KI
B4VS49_9CYAN/220-377FL..KQT.SI....IQSY.....FQR...........---------------------------------------..FT
B4VUT2_9CYAN/289-432.................LT..D.RHK...........---------------------------------------..GW
B5CP97_9FIRM/225-366D....AL.R......SKL.......RTL.........---------------------------------------NKKY
B5GZE0_STRCL/202-343SL...LL.TS.....GPAR..R.FFA...........---------------------------------------..WT
B5L3Q0_SHIDY/193-354.................VG..N.KISL..........---------------------------------------SKIF
B5L3W7_SHIBO/182-338.................NE..P.KGKSI.........---------------------------------------FIAY
B5QM83_LACRH/213-382VKVVVYFWGDRHSLNLNK.......KMN........F---------------------------------------RRVA
B5VX91_SPIMA/313-459L.....T.G.......QIA..N.LKR...........---------------------------------------..FI
B5VYV0_SPIMA/317-463......A.T.......SHI..S.RWK...........---------------------------------------..RL
B5Y6R2_COPPD/204-356.................VE..S.LVW...........---------------------------------------..AC
B6B6U9_9RHOB/187-338.................FL..L.GRT...........---------------------------------------..GW
B6B8S8_9RHOB/245-394......A.........PLR..W.QLR...........---------------------------------------..AA
B6JES5_OLICO/169-318L....MY.L......TATT..R.KRRVK.........---------------------------------------IVML
B6VUA4_9BACE/257-407.................LS..K.SWK...........---------------------------------------..IG
B6VYZ2_9BACE/224-375.................YC..K.RTS...........---------------------------------------...Y
B7AH28_9BACE/205-353.................RN....KIKF..........---------------------------------------.STI
B7BDU4_9PORP/175-316S.....T.F......SEIE..I.SKK...........---------------------------------------..IV
B7J3X6_ACIF2/185-346.................FR..G.QWR...........---------------------------------------..YW
B7K071_CYAP8/337-484L.....T.G.......QI...A.NLK...........---------------------------------------..RF
B7K694_CYAP8/286-429......L.........TEK..H.QPK...........---------------------------------------..LP
B7RNS7_9RHOB/202-356................ARR..Q.GIA...........---------------------------------------.RLV
B8CL34_SHEPW/174-319.................RF..Y.KKT...........---------------------------------------..FF
B8CL64_SHEPW/214-355.................IR..Y.YRS...........---------------------------------------..PW
B8FWJ7_DESHD/228-369W.....A.F.......FYH..H.RSK...........---------------------------------------.EVM
B8G9F2_CHLAD/225-362S.....L.T......RTGN..K.SWR...........---------------------------------------..VP
B8HEF1_ARTCA/210-341......A.........LAT..G.RKR...........---------------------------------------.FWS
B8HLI8_CYAP4/219-378.................LR..Q.GKI...........---------------------------------------..PQ
B8HNC8_CYAP4/218-375......Q.L.......DFS..K.GAKKY.........---------------------------------------FVRF
B9D396_WOLRE/190-376CL...YI.LG.....GETK..R.KFK...........---------------------------------------..LF
B9JKY3_AGRRK/181-340.................SP..K.QRK...........---------------------------------------..KL
B9XD26_9BACT/204-347.................WL..M.RTR...........---------------------------------------..MY
B9YBP1_9FIRM/190-362DY..FTN.GKV...GRISQ..K.NRI...........---------------------------------------..LT
D7E0N9_NOSA0/308-454L.....T.G.......PL...V.NLK...........---------------------------------------..KV
C0C2D1_9CLOT/195-372CG...AV.IV....KLSWY..E.LLK...........---------------------------------------..KA
C0CGX9_9FIRM/216-373A....RN.S......NNRK..N.IFK...........---------------------------------------.NIL
C0QGY0_DESAH/188-336K....NL.PT.....TLFS..N.LIR...........---------------------------------------..YT
C0VIY2_9GAMM/185-331.................HK..G.KSLV..........---------------------------------------.LNS
C0WW30_LACFE/203-350.................HS..L.GSKK..........---------------------------------------.IKF
C0ZT43_RHOE4/202-356................QVK..I.RFI...........---------------------------------------..GL
C1A313_RHOE4/214-369.................YK..Y.RSI...........---------------------------------------..LM
C1AWF5_RHOOB/210-389YE...AK.RS.....FQA...R.QRRTGF......WF---------------------------------------GPVV
C1AY50_RHOOB/263-416.................YA..R.GFR...........---------------------------------------..SG
C1F0J2_BACC3/223-353.................KS..N.QLR...........---------------------------------------..NF
D5UK63_CELFN/214-352.................RS..Q.APAH..........---------------------------------------.VRL
D7B6S8_NOCDD/245-400.................VA..L.RRG...........---------------------------------------..RV
D5SX75_PLAL2/208-338.................FW..G.GFK...........---------------------------------------..MA
C2EPL4_9LACO/200-348.................KN..K.FSKNK........V---------------------------------------LNYL
C2H8B0_ENTFC/192-326.................PK..S.LMRV..........---------------------------------------.IRA
C2JZS3_LACRH/195-345................KKL..V.SPR...........---------------------------------------..SF
C2MCR4_9PORP/284-433C....KL.L......DWVK..V.TRRQ..........---------------------------------------PYLM
C2NRN1_BACCE/206-352P.....K.I......RKAA..N.KHK...........---------------------------------------..LL
C2PN12_BACCE/193-346K.....N.I.......GLK..N.KAKVV........R---------------------------------------NMTY
C2Q801_BACCE/208-396F.....S.F......IQYM..I.HRKQEGKG...STH---------------------------------------LVNT
C2U9X7_BACCE/204-397F....SF.I......EYMI..N.RKKEG........K---------------------------------------GFTH
C2V7V1_BACCE/208-389FL...FI.EY....IIHRK..K.EGKGFT.......Y---------------------------------------LVNT
C2ZKF6_BACCE/208-401F.....S.F......IEYM..I.HRKKEG.......N---------------------------------------GFTY
C3GAX2_BACTU/276-404.................RS..K.YRP...........---------------------------------------..LG
C3PKS4_CORA7/215-355.................QA..L.RRGA..........---------------------------------------.MRA
C3Q1B3_9BACE/197-337.................KQ..N.VWK...........---------------------------------------..VL
C3R6E0_9BACE/193-346YS...FC.TK....SKYQY..K.KFRR..........---------------------------------------.ILN
C3WCW0_FUSMR/165-294......K.D.......KFL..Y.KLR...........---------------------------------------..YF
C4RGH6_9ACTO/357-512................RLA..L.RGRVVV.......L---------------------------------------VGLA
C5BIC6_TERTT/235-383.................FG..K.R.K...........---------------------------------------..WL
C5E895_BIFLI/204-349.................ML..R.ESKIG........Q---------------------------------------RVRF
C5RCC2_WEIPA/221-380................AAP..K.KQK...........---------------------------------------.ISL
D9RUY4_PREMB/174-313.................RL..Y.RSK...........---------------------------------------..IM
C6IJ43_9BACE/203-357ST...GI.FR.....LVI.......KGRY.......I---------------------------------------RLYS
C6M735_NEISI/182-343.................YR..N.NGL...........---------------------------------------.FTL
C6NU22_9GAMM/224-372.................KW..R.GIR...........---------------------------------------..LS
C6R555_9MICC/204-343.................IA..N.RLKT..........---------------------------------------.FGR
C6RIN3_9PROT/199-385CL...YI.LG.....GEAK..R.KFK...........---------------------------------------..LF
C6W3M0_DYAFD/200-366FHF.KFS.DLT..SGIANA..F...KF..........---------------------------------------RNMV
C6XK30_HIRBI/203-344.................I.......K...........---------------------------------------..HG
C6XVP4_PEDHD/210-354......L.S.......LI.....KIKGR........L---------------------------------------ANMI
C6Z207_9BACE/221-375.................HY....KKK...........---------------------------------------..SY
C7G9J0_9FIRM/181-318E.....K.L.......VKN..K.KVKFI.........---------------------------------------YALS
C7MGH4_BRAFD/211-348L.....L.P.......GVS..R.RFR...........---------------------------------------.VIA
C7PAF8_CHIPD/260-410.................VN..L.HNR...........---------------------------------------..NT
C7QQR9_CYAP0/223-379.................AR....QFRS..........---------------------------------------.VLP
C7X6F7_9PORP/176-315.................LF..C.GKR...........---------------------------------------..IF
C7XAP2_9PORP/173-335N.....I.K.......NFK..L.NLK...........---------------------------------------..NS
D6Z4J1_DESAT/222-373.................YR..K.PGL...........---------------------------------------..HF
C8RXJ1_9RHOB/237-386.................AP....RRL...........---------------------------------------..QV
C8S377_9RHOB/228-382.................VF..H.GFRFNIATR.PFFY---------------------------------------GLLA
C8S4A7_9RHOB/262-400.................RW..P.HLS...........---------------------------------------..LH
C8XKU9_NAKMY/249-387................VWK..W.RLR...........---------------------------------------.YNV
C9BIG3_ENTFC/192-327.................PK..K.VFRN..........---------------------------------------THL.
C9LAR6_RUMHA/190-337.................LR..K.KNRRQK.......I---------------------------------------RVTI
C9RMK5_FIBSS/201-340.................KI..G.MSK...........---------------------------------------..WY
C9RPA9_FIBSS/198-362RA..IYC.DFF...KNGVK..V.RRK...........---------------------------------------.MLL
C9YZ01_STRSW/187-328S.....L.F.......LTS..T.AAR...........---------------------------------------..RF
D0D9U9_9RHOB/235-384.................RQ..M.QIK...........---------------------------------------..VA
D0TPJ6_9BACE/219-370.................ML..R.RIK...........---------------------------------------..PM
D0WWB0_VIBAL/216-372I....AL.K......TVLT..G.KTRI..........---------------------------------------SHFF
D0XH47_VIBHA/210-366F....TF.LK.....TVLT..G.KTRI..........---------------------------------------SHFF
D1A7L1_THECD/209-365R.....L.V.......AI...G.GARV..........---------------------------------------LGWT
D1CAK4_SPHTD/221-370.................RL..Q.SVR...........---------------------------------------..GW
D1JLT7_9BACE/213-361.................IS..K.NTK...........---------------------------------------..SI
D1JYE9_9BACE/223-402.................LT..K.NLKA..........---------------------------------------.YKF
D1N0G8_9BACT/45-185.................FY..G.RRF...........---------------------------------------.LKY
D1NJF5_CLOTM/190-344................LFN..I.KSKP..........---------------------------------------.AKI
D1R6C1_9CHLA/199-373.................SL..V.SLK...........---------------------------------------..SI
D1RNU0_SEROD/222-365......R.R.......LFS..L.RFS...........---------------------------------------..LN
E8S3V1_MICSL/258-413................RLA..L.RGR...........---------------------------------------..MV
F0QC36_ACIAP/216-356T....SK.G......LVRS..A.AAR...........---------------------------------------..LF
E8YFQ6_9BURK/286-435................MLD..G.KSR...........---------------------------------------..VR
E3JCL8_FRASU/238-384.................HK..G.LRF...........---------------------------------------..TL
D1Y952_PROAA/204-371......G.S.......VMW..R.RSRVVRRAGHRRMV---------------------------------------WGGL
D2A6W3_SHIF2/192-313K.....L.H.......KLY..L.NTI...........---------------------------------------..II
D2B3Z9_STRRD/220-371.................RL..GTRAR...........---------------------------------------..VV
E6VE03_RHOPX/196-345M....FI.TA.....PTQQ..R.RLRIV.........---------------------------------------VLAA
D2NP44_ROTMD/210-343.................FS..Y.RLNL..........---------------------------------------FGKA
D2PZ04_KRIFD/223-379.................QV..I.RLRGFN.......A---------------------------------------VAWL
D2QHE2_SPILD/202-373.................FH..V.RPTEIRSA...VRS---------------------------------------LVKP
D3ACB3_9CLOT/181-336.................FS..S.KLTM..........---------------------------------------.KKI
D3HI42_STRG3/189-329.................KP..L.LLKYQ........V---------------------------------------SGSV
D3L003_9BACT/156-293.................TK..K.SWK...........---------------------------------------..YW
D3LLI7_MICLU/199-332.................SP..Y.LGR...........---------------------------------------.ALR
D3Q950_STANL/236-391......R.F.......LAC..G.RWW...........---------------------------------------..PL
D3T7L1_THEIA/246-395YNFLHGIGGERK.YRENFY..Y.IIRT..........---------------------------------------.IS.
D4BMR8_BIFBR/200-373......T.I.......NF.....HSR...........---------------------------------------...K
D4CF67_9CLOT/193-340F.....M.V......FPKQ..W.KRK...........---------------------------------------..AA
D4E8R1_SEROD/192-333......R.R.......VLS..L.RSS...........---------------------------------------..LN
P72910_SYNY3/223-371IK...LS.RQ.....SIA.......ST..........---------------------------------------RAKN
EXOQ_RHIME/181-340M....RA.IT.....ALRP..A.SRK...........---------------------------------------..LL
Q03KL2_STRTD/193-334.................IQ..M.DKKRF.........---------------------------------------LSL.
Q03WC5_LEUMM/225-384.................WS..K.RDDK..........---------------------------------------.IIL
Q04DW5_OENOB/200-344F....FL.N......MKYK..S.LFK...........---------------------------------------..II
Q07GI2_ROSDO/280-429.................LG....TRL...........---------------------------------------..QL
Q07I04_RHOP5/195-344F....VT.A......SSQ.....RARLR........I---------------------------------------VALA
Q07Z92_SHEFN/181-323H.....F.S.......VT...K...KKT.........---------------------------------------TYLF
Q09E62_STIAD/262-421.................NG..R.LLR...........---------------------------------------..MT
Q0F0M6_9PROT/213-366................AVR..Y.RVG...........---------------------------------------..LL
Q0FVI2_9RHOB/235-384......L.........SRQ..M.QIR...........---------------------------------------..IA
Q0K590_CUPNH/190-329................VRE..G.ASRT..........---------------------------------------TLIW
Q0RQN9_FRAAA/191-339.................RL..G.RPLR..........---------------------------------------.RLS
Q116W3_TRIEI/310-456......L.T.......GQL..A.NFK...........---------------------------------------..RL
Q11WP4_CYTH3/217-372.................LL..I.RHKKI........L---------------------------------------KSLL
Q13C35_RHOPS/193-342LT...FI.TA.....PTQQ..R.RLR...........---------------------------------------..IV
Q13ZP0_BURXL/293-441................MLN..G.KSR...........---------------------------------------..MR
Q1AYI9_RUBXD/56-206................LV.....RPRGTLLK...YLV---------------------------------------SLLP
Q1DDI4_MYXXD/252-411......V.L.......LVS..G...RVG.........---------------------------------------RFLA
Q1ILV2_KORVE/234-378.................YR..K.KMV...........---------------------------------------..PF
Q1YYW0_PHOPR/196-339.................FD..K.SLR...........---------------------------------------..KM
Q1ZNU5_PHOAS/174-338LY...HF.SN....LAITQ..R.AQKAT........V---------------------------------------NLLY
Q1ZRU2_PHOAS/204-332.................YK..S.QHKFR........A---------------------------------------LFKV
Q21E31_SACD2/194-335.................LG..N.LKN...........---------------------------------------..PL
Q28JD9_JANSC/245-398.................LH..V.RG............---------------------------------------..QM
Q2BHJ7_9GAMM/226-360......Y.........LVR..K.HIK...........---------------------------------------..LL
Q2BJE6_9GAMM/185-324.................N.....NVR...........---------------------------------------..WF
Q2G3B0_NOVAD/227-366D....WV.QK.....KVQF..L.NWR...........---------------------------------------..LI
Q2J607_FRASC/297-440.................HK....GARF..........---------------------------------------.ALT
Q2SZV7_BURTA/211-393.................PL..Y.RRRL..........---------------------------------------GVSV
Q2T8A3_BURTA/218-368.................LR..A.HSL...........---------------------------------------..RT
Q31EZ8_THICR/228-358.................TK..L.TLKKN........L---------------------------------------EFLV
Q323H8_SHIBS/204-353.................HT..Y.LRR...........---------------------------------------..YY
Q3B1S6_PELLD/212-351................ELF..R.NQRMTF......DY---------------------------------------LIKL
Q3B349_PELLD/225-374.................IG..I.KWK...........---------------------------------------..NA
Q3MDE5_ANAVT/319-465.................LT..G.QIRN..........---------------------------------------LKRF
Q3SHZ0_THIDA/269-434.................LL..H.GKR...........---------------------------------------..FA
Q47Z28_COLP3/217-358.................HK....HFKN..........---------------------------------------.PML
Q489C9_COLP3/205-331.................KK..I.ELK...........---------------------------------------..YM
Q48BJ9_PSE14/208-357.................RR..M.SWT...........---------------------------------------..CR
Q48GU3_PSE14/246-383.................RR......IPH.........---------------------------------------LGRL
Q4BV80_CROWT/224-377.................TK..W.LRK...........---------------------------------------..KI
Q4BWG3_CROWT/286-429................ITQ..K.RDK...........---------------------------------------..NL
Q4K0H9_STRPN/184-332G.....F.I......KYIK..K.NHR...........---------------------------------------..PV
Q4K0J9_STRPN/274-404.................VV..D.KNK...........---------------------------------------..IL
Q4K1F3_STRPN/210-359.................RK..K.LFSTTKI.....NV---------------------------------------MTLV
Q4K1K2_STRPN/189-336.................FQ..K.SETV..........---------------------------------------KKIR
Q4K1M0_STRPN/192-329......V.Q.......ITS..I.N.K...........---------------------------------------..RM
Q4K247_STRPN/183-329......N.........IKR..V.FWK...........---------------------------------------.RGI
Q4K368_STRPN/165-325L....NR.Q......GILT..Y.R.K...........---------------------------------------..LS
Q4VKA1_ECOLX/188-325L....RD.S......ASIR..L.RKK...........---------------------------------------...I
Q5LE47_BACFN/193-320......I.........GRM..S.KKI...........---------------------------------------..QI
Q5LV52_SILPO/257-406.................LR..R.KAV...........---------------------------------------..LR
Q5P6V0_AROAE/255-405SV..SAI.RG....PSAPR..L.RPR...........---------------------------------------.AIS
Q608R5_METCA/228-368.................GR..S.KYRRA.........---------------------------------------AMAT
Q64W31_BACFR/208-352.................FS..S.RKNF..........---------------------------------------ALKI
Q6AGK0_LEIXX/192-346.................YG..I.RKVPDGA....RSY---------------------------------------AQWG
Q6HMT7_BACHK/204-392F....SF.I......EYMM..N.RKKEGKG.....ST---------------------------------------HFVN
Q6LNR9_PHOPR/191-336......I.........MFF..Y.RLRG..........---------------------------------------YRLF
Q72TC9_LEPIC/257-406.................LL..I.KNKSI........S---------------------------------------RVL.
Q7NDJ8_GLOVI/213-360.................VY..Q.RFR...........---------------------------------------..VG
Q7NF12_GLOVI/242-388.................SL..G.KERGP.........---------------------------------------ALLC
Q7NII4_GLOVI/245-399.................PR..L.NAK...........---------------------------------------..TI
Q7NJN7_GLOVI/229-378.................FS..L.GKSGG.........---------------------------------------IAAV
Q7UF14_RHOBA/228-394.................WH..Y.RPA...........---------------------------------------..AW
Q858F4_BPE15/191-337.................TS..S.RGV...........---------------------------------------..AM
Q8GM97_STRTR/177-346.................KK..R.KIASQKL....QKN---------------------------------------KFLF
Q8KN07_9ACTO/187-328SM...VL.TS.....AAA...R.R.WF..........---------------------------------------.GWA
Q8KQ17_PSEAI/199-335................IGP..V.GSR...........---------------------------------------..FL
Q8PRB5_XANAC/237-377S....SR.G......LVRS..P.WAR...........---------------------------------------..LL
Q8YT85_NOSS1/260-405......S.L.......KTR..L.QLRL..........---------------------------------------.FIT
Q92U08_RHIME/208-361.................FE..K.VRFL..........---------------------------------------.RIP
Q9ALX1_STRAG/186-328EI...II.NK.....FNL...K.ITK...........---------------------------------------..KA
Q9RJJ8_STRCO/187-328SL...AL.TS.....AAAR..R.FFS...........---------------------------------------..WA

PF04932

A4CI06_ROBBH/191-347I....A---------IIV--LA--VVFVF...................................................
A3GY30_VIBCL/171-330T....L---------ISF--LL--VSVSY...................................................
Q4UYH3_XANC8/219-372G....A---------VLA--AG--VVAVA...................................................
A4TX99_9PROT/241-386L....V---------LIG--LA--GAAVL...................................................
A3DIW4_CLOTH/315-453V....M---------MIP--FL--PQYVY...................................................
Q89PW4_BRAJA/213-357L....P---------FVM--CL--LAGAL...................................................
A5LYT8_STRPN/187-326S....V---------VTF--IA--SVVML...................................................
Q7UXE7_RHOBA/267-417V....V---------VFS--GA--MAMGL...................................................
A2TSG4_9FLAO/201-377RLKYPL---------LPI--IG--ILIAG...................................................
B1Z898_METPB/188-338L....I---------LGL--AF--ALAPV...................................................
Q7UWZ2_RHOBA/233-380A....V---------VIA--IS--VAILT...................................................
A0PZ10_CLONN/222-380Y....A---------THS--II--LISIF...................................................
Q7UPJ9_RHOBA/331-474A....S---------LLA--IS--AVFAA...................................................
Q97ER0_CLOAB/210-348I....S---------LMV--VL--IGITL...................................................
A4AI36_9ACTN/211-357W....Q---------FVL--IG--FVAAV...................................................
A7VGX9_9CLOT/231-488VDHRLI---------LTI--ES--IVLVI...................................................
A0K2I1_ARTS2/235-362V....A---------LVG--VV--WVMVP...................................................
Q1ZI48_9GAMM/245-403L....G---------VIF--YA--PSAVD...................................................
A4XML1_CALS8/220-429A....I---------IGA--IV--LAFLN...................................................
Q2BFT2_9BACI/241-418I.....---------LIA--VV--LVNIP...................................................
Q0G5C8_9RHIZ/213-362L....V---------LVS--VT--AIGMM...................................................
A3EK85_VIBCL/216-360L....L---------IVS--LF--IVDAL...................................................
Q7NQD3_CHRVO/200-367L....A---------MWA--AS--GTILA...................................................
Q7MVK6_PORGI/277-409T....S---------FML--II--VGGFI...................................................
Q5FQI9_GLUOX/196-353M....L---------PVL--VL--VARVF...................................................
A3XRK0_LEEBM/177-345L....A---------VGV--LG--FALLS...................................................
RFC_SALMU/185-325I....I---------IPV--LA--ISTNI...................................................
Q98C91_RHILO/186-337I....F---------VVG--AG--LIVVV...................................................
Q12C32_POLSJ/166-320P....F---------VLV--GA--LFLSS...................................................
Q0SYF1_SHIF8/194-338V....M---------VSI--IA--LSVIF...................................................
Q9X4C1_ECOLX/176-341I....Q---------FFI--VQ--ETYPT...................................................
A0ZHE8_NODSP/234-386RTWSLP---------MIL--GG--MISLL...................................................
Q7V9G4_PROMA/203-353L....F---------PVL--LS--VLPFV...................................................
Q6ABG2_PROAC/212-358A....V---------VVV--IV--VTHLH...................................................
Q609Q8_METCA/225-373L....V---------LAI--LS--SIVLV...................................................
A4ISY3_GEOTN/200-391I....L---------VSF--AV--LLTIV...................................................
Q7UKM5_RHOBA/239-382V....V---------MGI--CL--LMLAV...................................................
Q2T0U3_BURTA/206-363A....W---------VIP--VV--LGALF...................................................
Q01XB1_SOLUE/184-329L....L---------LLW--AN--PFGVG...................................................
A0Z5U1_9GAMM/194-332L....L---------LCV--VG--LWFRG...................................................
A4AAF7_9GAMM/171-307L....V---------LVL--VS--LTVLS...................................................
Q9X5H1_HELPX/195-362M....I---------VVS--LV--LSTLY...................................................
Q6ASB4_DESPS/185-338G....L---------MLA--LS--LVVLV...................................................
Q4JZ62_STRPN/213-343L....F---------ILA--TI--CCFSI...................................................
Q11T24_CYTH3/244-416L....I---------VAV--YI--FSARD...................................................
Q6MI87_BDEBA/207-358A....S---------LSV--LL--TFALF...................................................
Q8AA03_BACTN/192-346T....H---------FYT--AT--LLYIT...................................................
Q1J334_DEIGD/252-413T....F---------VLL--SL--LTFDV...................................................
A5UWM4_ROSS1/288-436L....A---------FIG--AL--IVGMT...................................................
Q4K127_STRPN/198-353R....K---------ILS--LL--NIFSL...................................................
A6GZ05_FLAPJ/236-385F....W---------MVV--FS--FVAFL...................................................
A5G2R8_ACICJ/202-340V....M---------ATA--IS--FMPAD...................................................
Q5NZI1_AROAE/256-398V....S---------ALG--VA--LAVAI...................................................
A7Z9C6_BACA2/261-409AGAGAA---------LCA--VL--FAGRI...................................................
Q9RZA8_DEIRA/165-323V....L---------VML--AA--FATTS...................................................
Q89SN4_BRAJA/265-409G....G---------SAA--AG--LVLLQ...................................................
Q9ZIT0_ECOLX/196-350C....F---------ITI--AL--LAGVF...................................................
A4ND37_HAEIF/179-336V....T---------VIT--IG--LTALI...................................................
O06944_SYNY3/232-381L....G---------LGT--LA--IAVVG...................................................
A5UY10_ROSS1/144-293P....R---------SIW--RS--LVVAG...................................................
Q9AQJ1_STRAG/174-309F....L---------YLV--PI--LILLL...................................................
Q65SG0_MANSM/195-350A....C---------VIA--LF--IFNLS...................................................
Q832Q1_ENTFA/206-388I....K---------KVV--QA--VLVSF...................................................
Q83VQ8_9PROT/239-380L....V---------LPV--IG--LAIPE...................................................
Q97EP1_CLOAB/208-365I....C---------VII--LA--FFVLI...................................................
A7BD98_9ACTO/223-370V....V---------GMF--AG--IGVLT...................................................
Q220X5_RHOFD/200-337I....A---------LGL--LA--LMPGS...................................................
Q04RV1_LEPBJ/208-370L....L---------FAS--GI--LMLLL...................................................
A6F4Q1_9ALTE/139-270V....L---------CGI--LI--LIFYP...................................................
Q09DA3_STIAD/195-349S....R---------SAW--GG--GLAVL...................................................
B9LD61_CHLSY/273-406I....L---------GAV--LL--FGLGY...................................................
A4B946_9GAMM/214-357F....S---------IIL--AM--LWVIL...................................................
Q8RNK4_KLEPN/160-294L....A---------VLV--AL--LLVMT...................................................
Q72XI7_BACC1/178-330I....G---------ILV--TL--VISLY...................................................
Q2BRH4_9GAMM/186-340L....F---------IIA--CG--LIYSL...................................................
A6D015_9VIBR/218-369T....F---------ASL--AG--VALGL...................................................
Q1MQ48_LAWIP/199-337P....M---------LLL--VV--LSMFG...................................................
P74814_9SPHN/322-468V....G---------IST--TM--MYPAF...................................................
Q2N6C0_ERYLH/230-383K....W---------MSL--GA--AVGAI...................................................
A6QBN3_SULNB/185-344V....L---------IVV--IF--TGAYT...................................................
A6M2N6_CLOB8/242-531I....G---------VIT--LI--ILFVGANFASKGSLFKRIPSLASDAFSIFKDTSDLDYTNYTPVKDIKYIDSTTEVV

PF13425

C6IFG7_9BACE/266-414I----T........GISV..LA..LLFLF---------------------------------------------------
A0LW89_ACIC1/221-359I----AL......IIAPI..AG..VGMKL---------------------------------------------------
A0YRC8_LYNSP/311-457I----A.........AGL..GL..VLGIA---------------------------------------------------
A0YY08_LYNSP/334-480I----............I..LL..GIVLF---------------------------------------------------
A0ZBK6_NODSP/316-462I----P.........MGL.GLA..LILGI---------------------------------------------------
A1BHF5_CHLPD/216-365L----V.........MVM..LL..LPHLY---------------------------------------------------
A1KBI4_AZOSB/182-311G----V.........VAA..GT..VVLVL---------------------------------------------------
A1VT05_POLNA/222-357F----S.........ALF..LT..VVVIT---------------------------------------------------
A1WA83_ACISJ/201-342I----A..........II..LF..AVFLF---------------------------------------------------
A1YVC7_LACJH/222-358L----LIVK...TTIIPI..IL..VVGMI---------------------------------------------------
A1YZN9_PSEAI/186-321P----I.........LAL..II..VAAGS---------------------------------------------------
A1ZS85_9BACT/258-408V----L.........GII..IG..IGAFS---------------------------------------------------
A2CCT3_PROM3/195-349F----AISL...TITAGM..VS..LIGLW---------------------------------------------------
A2SDP8_METPP/225-368A----..........VAL..VG..GLAVL---------------------------------------------------
A2WDK3_9BURK/260-410I----L.........ISG..VV..LVGLC---------------------------------------------------
A3F4D2_LACLC/174-305V----L.........PLL..LL..IISYS---------------------------------------------------
A3HV81_9BACT/249-392I----A.........AGF..LS..LIAFA---------------------------------------------------
A3IMI1_9CHRO/286-429L----I.........KLA..II..FILTA---------------------------------------------------
A3IUA7_9CHRO/225-379L----L.........ILI..VT..VSLYL---------------------------------------------------
A3K8X9_9RHOB/235-384I----L.........IGL..LA..LAYPL---------------------------------------------------
A3KU19_PSEAI/248-385L----L........GVGL..VV..VLVLS---------------------------------------------------
A3P2Q6_BURP0/171-296I----V.........PAV..LV..VVPTF---------------------------------------------------
A3SPZ3_9RHOB/245-394L----L.........MAA..VA..VVYPV---------------------------------------------------
A3V694_9RHOB/192-341F----A.........VIA..LA..LSLAA---------------------------------------------------
A3W1Y4_9RHOB/173-312L----I.........LSV..IL..YVALD---------------------------------------------------
A3WFB0_9SPHN/222-363L----F.........LS...FA..GLAYV---------------------------------------------------
A3XD73_9RHOB/304-453V----A..........IV..LA..SIAIT---------------------------------------------------
A3Y9Z7_9GAMM/195-353F----I.........VFI..VF..LSFIF---------------------------------------------------
A3ZP84_9PLAN/227-386I----F.........AGG.MLA..AILVV---------------------------------------------------
A4AEK4_9ACTN/190-334I----A.........LIL..LV..PVTYA---------------------------------------------------
A4EDX8_9RHOB/194-345L----I.........IAL.PFA..VIGLL---------------------------------------------------
A4EWL1_9RHOB/245-394I----K.........VAV.LLA..TIAIT---------------------------------------------------
A4F0R9_9RHOB/216-356L----L.........TGS..VV..FYIVA---------------------------------------------------
A4TXA3_9PROT/212-353V----M.........LAA..LI..AGTYQ---------------------------------------------------
A4XMK9_CALS8/198-350I----L.........VDS..IL..LFTTL---------------------------------------------------
A4YQ66_BRASO/187-322I----A.........AAI..LL..PCAVV---------------------------------------------------
A4YX51_BRASO/206-352V----V.........AVV..LG..LIVIA---------------------------------------------------
A5CP65_CLAM3/221-356V----T.........AGV..VV..VAAAV---------------------------------------------------
A5EAQ5_BRASB/235-388L----..........AVI..LV..ALALT---------------------------------------------------
A5FL57_FLAJ1/219-339L----A...............G..AILLF---------------------------------------------------
A5FL58_FLAJ1/161-315I----F..........FP..LI..ILFMG---------------------------------------------------
A5G2F5_ACICJ/218-369L----LT......TGGAA..FG..AVLLA---------------------------------------------------
A5GEM1_GEOUR/220-381L----I.........SSI..IL..TFALV---------------------------------------------------
A5GQB5_SYNR3/178-326F----L.........LLG..FG..AAALA---------------------------------------------------
A5PAQ9_9SPHN/298-451I----T.........LAY..PV..ILTTF---------------------------------------------------
A5V8X2_SPHWW/271-405L----L.........MPL..AG..VIVIT---------------------------------------------------
A5ZV75_9FIRM/172-330I----I.........IVG..LV..VSAYI---------------------------------------------------
A6BIH2_9FIRM/191-358I----G.........IC...IA..IGLIL---------------------------------------------------
A6CBU1_9PLAN/250-380I----A.........CAV..VG..MAGVT---------------------------------------------------
A6DE00_9PROT/193-358I----I.........LLL..LI..IYFLI---------------------------------------------------
A6DFC8_9BACT/220-366F----I.........LFI..VL..IFSTL---------------------------------------------------
A6DMP1_9BACT/236-371S----V.........WGA..LV..LLMLV---------------------------------------------------
A6DZI5_9RHOB/235-384R----I.........AGV..MA..VVAIC---------------------------------------------------
A6E8K4_9SPHI/180-325F----S.........LSL..VT..IICIG---------------------------------------------------
A6ETG3_9BACT/167-314L----F.........LLV..FP..LLLLV---------------------------------------------------
A6F673_9GAMM/263-423V----L.........LIS..ML..VFSLS---------------------------------------------------
A6FK24_9RHOB/260-408L----M.........VAC..LA..LFVLL---------------------------------------------------
A6L5V9_BACV8/222-366R----I.........VGV..FL..VSCLF---------------------------------------------------
A6L7F9_BACV8/212-352I----Y........HVII..FV..LIVYS---------------------------------------------------
A6LGX1_PARD8/196-333L----I.........IAV..LT..ILASG---------------------------------------------------
A6N385_ARTOX/264-390I----L.........VGL..GL..GGYLF---------------------------------------------------
A6UIW2_SINMW/253-393L----M.........TVT..LS..ALALC---------------------------------------------------
A6WE97_KINRD/230-374L----V.........VLV.LAG..FTAVT---------------------------------------------------
D7HGD2_VIBCL/212-351I----F..........SA..LG..LIIIL---------------------------------------------------
A7AHI1_9PORP/175-336I----L.........LII...T..LILIL---------------------------------------------------
A7B4B5_RUMGN/180-334L----A........SAGT..IC..AAGIL---------------------------------------------------
A7B9B7_9ACTO/214-354I----V.........AAI.VVG..VIAWL---------------------------------------------------
A7BWS2_9GAMM/221-377V----I.........CSL..LV..GIIIL---------------------------------------------------
A7GLQ7_BACCN/204-397.----NT.......IVAL..VV..LAGLG---------------------------------------------------
A7IL98_XANP2/205-360F----L.........ALL..LP..PVLML---------------------------------------------------
A7JJ42_FRANO/186-334I----I.........SAL.CLM..IIGLY---------------------------------------------------
A7JMT4_FRANO/187-383F----S.........IIS..IC..IISLS---------------------------------------------------
A7M5X5_BACOV/176-343L----L.........MGI..VV..FVFYS---------------------------------------------------
A7NGA7_ROSCS/365-564L----IGE.....VVVAL..AL..AGFLA---------------------------------------------------
A7V9S7_BACUN/180-319L----I.........SLI..FL..IGIVS---------------------------------------------------
A7VV00_9CLOT/206-361V----IYS....CICAAL..LL..FCVMM---------------------------------------------------
A8GC50_SERP5/204-356I----W.........GGA..TV..TVFFV---------------------------------------------------
A8LUD1_DINSH/214-355L----L.........IAI..LA..PCYLL---------------------------------------------------
A8LXZ5_SALAI/235-376S----I.........VGV..VL..VGGVA---------------------------------------------------
A8RK65_9CLOT/197-346F----L.........GTM..LF..FFLIF---------------------------------------------------
A8RKN0_9CLOT/193-357I----L.........TAA..LV..IGLWL---------------------------------------------------
A8RSJ4_9CLOT/221-350I----L..........AI..LA..IGYFY---------------------------------------------------
A8SGY7_9FIRM/208-357I----V.........CLG..TG..ICFLG---------------------------------------------------
A8U9G8_9LACT/218-351I----Y.........LLL..II..AVVFF---------------------------------------------------
A8UCK5_9LACT/210-361V----N.........IFV..LS..LILLL---------------------------------------------------
A8YA87_MICAE/331-478I----IF.......SVAL..LL..AVGFS---------------------------------------------------
A9A0Y0_DESOH/253-403F----F.........ACI..LV..LFFLF---------------------------------------------------
A9CEI7_AGRT5/239-386L----V.........YGC..IGTLIGSMV---------------------------------------------------
A9E2E9_9RHOB/245-394V----V.........FAA..VA..VIYPM---------------------------------------------------
A9EBQ8_9FLAO/78-235I----Y.........MSV..IL..GIGMM---------------------------------------------------
A9ETU3_SORC5/228-355I----F..........GA..IC..AAPLM---------------------------------------------------
A9GB69_9RHOB/245-394L----A.........L.A..LG..VVAIV---------------------------------------------------
A9GIB7_SORC5/278-406V----I.........AAC..FV..GPPML---------------------------------------------------
B0CE59_ACAM1/222-374I----W.........LLA..LL..MAGYL---------------------------------------------------
B0CEF6_ACAM1/212-353I----L.........AII..LL..LIITT---------------------------------------------------
B0JPJ8_MICAN/292-437L----K.........LGI..LG..LISLL---------------------------------------------------
B0KB87_THEP3/245-390I----IRT....VGIITG..LS..IIYIF---------------------------------------------------
B0M993_9FIRM/208-351L----V.........MSS..LG..AAKLI---------------------------------------------------
B0M9A4_9FIRM/196-348Y----F.........TYF..LG..IIGTA---------------------------------------------------
B0N359_9FIRM/240-375F----T...........I..VI..AIAAI---------------------------------------------------
B0T732_CAUSK/201-343L----V.........AAP..FV..LAPLA---------------------------------------------------
B0TYH5_FRAP2/172-367V----T.........ILT..CC..IVIIS---------------------------------------------------
B0ULV1_METS4/257-396L----A.........GAA..AA..VAAAA---------------------------------------------------
B0V6K1_ACIBY/174-325L----A.........TLV..VG..ISAIL---------------------------------------------------
B0VGS8_CLOAI/260-411V----I.........MAF.LIY..IVQVF---------------------------------------------------
B1C0Q0_9FIRM/182-328F----K.........ISI..FV..VIAVL---------------------------------------------------
B1FZC5_9BURK/272-424I----V.........ASA..VL..LAGLC---------------------------------------------------
B1R2U0_CLOBU/208-343I----F.........CGM..FI..ILKLG---------------------------------------------------
B1RNR5_CLOPF/189-330V----Y.........LPI.LLL..VLNLF---------------------------------------------------
B1WSH8_CYAA5/286-429L----I........KLAI..IF..IITV.---------------------------------------------------
B1X0A2_CYAA5/338-485I----P.........VGI..GL..SVVLF---------------------------------------------------
B1Y725_LEPCP/205-349L----LR.......WLVV..LA..YVALD---------------------------------------------------
B1ZT82_OPITP/197-358I----T.........LAA..VG..VVVSF---------------------------------------------------
B2AHI9_CUPTR/221-375V----W.........VGV..AV..LIGAV---------------------------------------------------
B2ILP9_STRPS/194-329I----G...........I..FC..PIIPF---------------------------------------------------
B2J995_NOSP7/327-473I----P.........IGI..GL..AIVLG---------------------------------------------------
B2JKN4_BURP8/242-388I----I.........AAC..AG..VLGTL---------------------------------------------------
B3C6G3_9BACE/158-317F----I.........LWG..VS..ALFIL---------------------------------------------------
B3DZJ9_METI4/232-389I----F........YLLL..AC..SIAAL---------------------------------------------------
B3EF24_CHLL2/226-378L----L.........IVM..VA..IPHLY---------------------------------------------------
B3Q3Q8_RHIE6/200-358L----F.........AG...LF..MAAAV---------------------------------------------------
B3QV51_CHLT3/220-371V----A.........MLS..VS..MIALF---------------------------------------------------
B3W8Q4_LACCB/236-408L----V.........LLV.TVA..LCGFF---------------------------------------------------
B3WWQ6_SHIDY/179-312I----V.........SLI..FM..AIPTI---------------------------------------------------
B3ZZ03_BACCE/196-346L----VKV....PFYIVL..LV..ISFYA---------------------------------------------------
E0UAN3_CYAP2/223-375L----L.........LLM..AG..ICYYL---------------------------------------------------
B4D1K5_9BACT/198-355L----L.........LGL..IA..GVGLT---------------------------------------------------
B4SDC8_PELPB/170-319L----I........ISAI..LY..ATINM---------------------------------------------------
B4SFN3_PELPB/228-374I----L.........VLI..LL..LPPHL---------------------------------------------------
B4VS49_9CYAN/220-377V----P.........IIL..SF..IAAYT---------------------------------------------------
B4VUT2_9CYAN/289-432L----P.........IKL.GIG..VLLAI---------------------------------------------------
B5CP97_9FIRM/225-366F----L.........LLI..PP..VILLA---------------------------------------------------
B5GZE0_STRCL/202-343V----V.........CAA..VA..AVGFA---------------------------------------------------
B5L3Q0_SHIDY/193-354I----FT.......ICLA..LL..VFILF---------------------------------------------------
B5L3W7_SHIBO/182-338I----S.........LAF..LF..LIILL---------------------------------------------------
B5QM83_LACRH/213-382V----I.........LLT..VV..LCGFF---------------------------------------------------
B5VX91_SPIMA/313-459P----I.........AGG..LG..LLLSI---------------------------------------------------
B5VYV0_SPIMA/317-463L----I........SFLA..IG..LFLLT---------------------------------------------------
B5Y6R2_COPPD/204-356V----A.........AAA..AV..IGALT---------------------------------------------------
B6B6U9_9RHOB/187-338A----M.........AGC..AT..VFTLL---------------------------------------------------
B6B8S8_9RHOB/245-394L----L.........LAV..IA..VVY..---------------------------------------------------
B6JES5_OLICO/169-318V----L.........TAV.ALA..ALAIF---------------------------------------------------
B6VUA4_9BACE/257-407I----I.........SFI..LL..VGGVG---------------------------------------------------
B6VYZ2_9BACE/224-375I----V.........SSV..LV..GIVLA---------------------------------------------------
B7AH28_9BACE/205-353I----V.........LGI..SS..IIIIS---------------------------------------------------
B7BDU4_9PORP/175-316L----L.........VAG..FI..MAYLI---------------------------------------------------
B7J3X6_ACIF2/185-346A----L.........GGI.ALT..IIGMG---------------------------------------------------
B7K071_CYAP8/337-484I----P.........VAA..GL..SVVLF---------------------------------------------------
B7K694_CYAP8/286-429I----K.........LGI..IA..LITIV---------------------------------------------------
B7RNS7_9RHOB/202-356.----F........QFGI.ILG..IVVLS---------------------------------------------------
B8CL34_SHEPW/174-319I----L........TVTS..IL..VIPSL---------------------------------------------------
B8CL64_SHEPW/214-355L----Y.........FAA..SP..ALLLL---------------------------------------------------
B8FWJ7_DESHD/228-369I----K.........IGA..LF..LLTII---------------------------------------------------
B8G9F2_CHLAD/225-362L----A.........IAI..II..IVVVS---------------------------------------------------
B8HEF1_ARTCA/210-341V----L.........AAA..AG..VVIVY---------------------------------------------------
B8HLI8_CYAP4/219-378V----T.........AMA..IG..AVGLF---------------------------------------------------
B8HNC8_CYAP4/218-375L----I.........PSI..FI..TIFVA---------------------------------------------------
B9D396_WOLRE/190-376A----V.........IFA..VC..VAGAS---------------------------------------------------
B9JKY3_AGRRK/181-340F----A.........TAA..IS..GIILV---------------------------------------------------
B9XD26_9BACT/204-347V----VRR.....SMV.A..FV..VLAAL---------------------------------------------------
B9YBP1_9FIRM/190-362I----V.........LLV..IM..IFAST---------------------------------------------------
D7E0N9_NOSA0/308-454I----P........LGGA..FA..VILVI---------------------------------------------------
C0C2D1_9CLOT/195-372V----I.........LLI..GG..TVVTL---------------------------------------------------
C0CGX9_9FIRM/216-373L----I.........FGV..WA..VIMLL---------------------------------------------------
C0QGY0_DESAH/188-336Y----I.........LII..LA..TPLLI---------------------------------------------------
C0VIY2_9GAMM/185-331I----V........KITV..IC..GGLYL---------------------------------------------------
C0WW30_LACFE/203-350I----VS......TIT........GFFLT---------------------------------------------------
C0ZT43_RHOE4/202-356L----S.........LVS..IG..GAAYL---------------------------------------------------
C1A313_RHOE4/214-369L----F.........GAA.AAA..VPFVL---------------------------------------------------
C1AWF5_RHOOB/210-389L----V.........VGI..AV..AYGVA---------------------------------------------------
C1AY50_RHOOB/263-416F----V.........SGI.VVS..VLAVA---------------------------------------------------
C1F0J2_BACC3/223-353F----I........FTFG..LL..VILLF---------------------------------------------------
D5UK63_CELFN/214-352L----S.........LCA..LG..GGTAA---------------------------------------------------
D7B6S8_NOCDD/245-400V----L.........VGA..CA..VAGLA---------------------------------------------------
D5SX75_PLAL2/208-338I----L.........CGV..LG..VCALA---------------------------------------------------
C2EPL4_9LACO/200-348L----L.........LLL..LF..AIIMS---------------------------------------------------
C2H8B0_ENTFC/192-326P----F.........IAY..TA..TILLA---------------------------------------------------
C2JZS3_LACRH/195-345S----I.........FGF..LI..VCFLI---------------------------------------------------
C2MCR4_9PORP/284-433S----Y.........LML..AG..AILVS---------------------------------------------------
C2NRN1_BACCE/206-352S----I.........SAI..FY..IICFL---------------------------------------------------
C2PN12_BACCE/193-346L----F.........IAS..II..MLFML---------------------------------------------------
C2Q801_BACCE/208-396V----..........IAA..VV..LGGLL---------------------------------------------------
C2U9X7_BACCE/204-397I----VN......TVVAA..VI..LGALI---------------------------------------------------
C2V7V1_BACCE/208-389I----V.........VAI.VLG..GILIL---------------------------------------------------
C2ZKF6_BACCE/208-401L----VN......TVVAA..IV..LGGLI---------------------------------------------------
C3GAX2_BACTU/276-404F----V.........LMS..FL..GAVLV---------------------------------------------------
C3PKS4_CORA7/215-355V----G.........SAA..LG..LVLIA---------------------------------------------------
C3Q1B3_9BACE/197-337I----A.........LFF..LY..MIIPN---------------------------------------------------
C3R6E0_9BACE/193-346I----S.........IIA..LV..MGTLY---------------------------------------------------
C3WCW0_FUSMR/165-294I----YG.......EFFF..LL..YFSIV---------------------------------------------------
C4RGH6_9ACTO/357-512L----A.........TGL..MG..VAVLA---------------------------------------------------
C5BIC6_TERTT/235-383Y----L.........AAA..LS..VIVFL---------------------------------------------------
C5E895_BIFLI/204-349F----V........ECTI..AI..IVVLF---------------------------------------------------
C5RCC2_WEIPA/221-380F----F.........LGI..IA..VIGVA---------------------------------------------------
D9RUY4_PREMB/174-313M----VG......MYVSS..IV..IVFMA---------------------------------------------------
C6IJ43_9BACE/203-357I----L.........GGM..LI..VFTML---------------------------------------------------
C6M735_NEISI/182-343M----T.........IGV..TG..AGLSM---------------------------------------------------
C6NU22_9GAMM/224-372L----LWG.....VYAGI.GLF..VAFVA---------------------------------------------------
C6R555_9MICC/204-343I----A.........L.....G..VALYW---------------------------------------------------
C6RIN3_9PROT/199-385A----V.........IFA..VC..VAGAS---------------------------------------------------
C6W3M0_DYAFD/200-366F----L.........VLI..LV..AINYF---------------------------------------------------
C6XK30_HIRBI/203-344W----V.........IAL..LG..TALIV---------------------------------------------------
C6XVP4_PEDHD/210-354I----L.........ISF..LL..VGGIT---------------------------------------------------
C6Z207_9BACE/221-375I----V.........SAI..LG..GVALL---------------------------------------------------
C7G9J0_9FIRM/181-318I----P.........VGA..IF..SFVMM---------------------------------------------------
C7MGH4_BRAFD/211-348T----V.........VGV..AG..AVIAL---------------------------------------------------
C7PAF8_CHIPD/260-410L----I.........AAA..LF..TFGML---------------------------------------------------
C7QQR9_CYAP0/223-379V----L.........LLI..IG..LCLYL---------------------------------------------------
C7X6F7_9PORP/176-315F----A.........MSV..FC..VALVS---------------------------------------------------
C7XAP2_9PORP/173-335L----I.........III..ML..VAIIA---------------------------------------------------
D6Z4J1_DESAT/222-373I----F..........PL..LL..LVVPL---------------------------------------------------
C8RXJ1_9RHOB/237-386L----A.........AAV..LA..VLVVS---------------------------------------------------
C8S377_9RHOB/228-382L----V.........VSI..LS..TLVYF---------------------------------------------------
C8S4A7_9RHOB/262-400F----A.........LAI..VA..VMALA---------------------------------------------------
C8XKU9_NAKMY/249-387I----V.........IGS..IA..LV.TF---------------------------------------------------
C9BIG3_ENTFC/192-327.----S.........FWM.YAA..VSVLA---------------------------------------------------
C9LAR6_RUMHA/190-337I----I.........LGI..VG..LLIVA---------------------------------------------------
C9RMK5_FIBSS/201-340L----A.........IGV..LF..LIVLS---------------------------------------------------
C9RPA9_FIBSS/198-362Y----V.........IGI..LV..VVFVG---------------------------------------------------
C9YZ01_STRSW/187-328F----A.........WVV..LC..AAVAA---------------------------------------------------
D0D9U9_9RHOB/235-384I----L.........IGL..LA..IGYPV---------------------------------------------------
D0TPJ6_9BACE/219-370I----Y.........VAV..IG..FIGYI---------------------------------------------------
D0WWB0_VIBAL/216-372V----L.........LLV..FC..LLLVL---------------------------------------------------
D0XH47_VIBHA/210-366I----L.........VLV.MVL..VLFLI---------------------------------------------------
D1A7L1_THECD/209-365I----AG.......LCAG..AL..IIAAS---------------------------------------------------
D1CAK4_SPHTD/221-370F----Q.........AGV..LG..VGAVG---------------------------------------------------
D1JLT7_9BACE/213-361I----TS.......SVIL..IG..VFSFF---------------------------------------------------
D1JYE9_9BACE/223-402L----L.........GIT..FS..IGFII---------------------------------------------------
D1N0G8_9BACT/45-185G----L.........AAL..VV..LVAAF---------------------------------------------------
D1NJF5_CLOTM/190-344F----L........GSLV..AV..PIGLL---------------------------------------------------
D1R6C1_9CHLA/199-373I----IVA.....SFLGC..LS..IGIAY---------------------------------------------------
D1RNU0_SEROD/222-365I----V........TLAT..FV..LGMFF---------------------------------------------------
E8S3V1_MICSL/258-413V----LGGL...ALAVGL..IG..VLIVA---------------------------------------------------
F0QC36_ACIAP/216-356L----A.........GVV..LA..ALAAA---------------------------------------------------
E8YFQ6_9BURK/286-435L----L.........AGV..LG..LAVMA---------------------------------------------------
E3JCL8_FRASU/238-384T----A.........LAV.LVV..LVGAL---------------------------------------------------
D1Y952_PROAA/204-371V----A.........LAV..VV..IGMVI---------------------------------------------------
D2A6W3_SHIF2/192-313I----L.........GSV..LF..IIMLY---------------------------------------------------
D2B3Z9_STRRD/220-371V----F.........SAT..AC..GALVL---------------------------------------------------
E6VE03_RHOPX/196-345L----A.........LAV..LG..ATVAV---------------------------------------------------
D2NP44_ROTMD/210-343V----L..........AY..LF..YLGVN---------------------------------------------------
D2PZ04_KRIFD/223-379.----A........PVAV.VAV..VAALL---------------------------------------------------
D2QHE2_SPILD/202-373V----P.........IFI..MI..VGVIG---------------------------------------------------
D3ACB3_9CLOT/181-336I----I.........IVV..TS..ISAFG---------------------------------------------------
D3HI42_STRG3/189-329I----I.........PLV..IV..MFGLG---------------------------------------------------
D3L003_9BACT/156-293V----I.........TIA..VL..VPVFS---------------------------------------------------
D3LLI7_MICLU/199-332I----...........AL..AV..VMGWF---------------------------------------------------
D3Q950_STANL/236-391T----V.........LAV..TG..VVALA---------------------------------------------------
D3T7L1_THEIA/246-395.----IIT.....VLSTI..LL..SIYIL---------------------------------------------------
D4BMR8_BIFBR/200-373V----T.........AGF..VG..ALGLL---------------------------------------------------
D4CF67_9CLOT/193-340S----A.........LSV.LLV..AGGLI---------------------------------------------------
D4E8R1_SEROD/192-333I----V.........TMV..TL..VLSLF---------------------------------------------------
P72910_SYNY3/223-371L----T.........FAF..LL..TVPLL---------------------------------------------------
EXOQ_RHIME/181-340F----I.........AAS.VFG.GVAAVA---------------------------------------------------
Q03KL2_STRTD/193-334.----FA.......PMAV..VL..LIGCL---------------------------------------------------
Q03WC5_LEUMM/225-384I----I.........FGI..MA..IVGIA---------------------------------------------------
Q04DW5_OENOB/200-344I----L.........PIS..LI..VTSWL---------------------------------------------------
Q07GI2_ROSDO/280-429I----A.........AAC..IA..AAVLT---------------------------------------------------
Q07I04_RHOP5/195-344V----A.........AAV..LA..IVAVG---------------------------------------------------
Q07Z92_SHEFN/181-323I----L.........SFL..LF..AIALV---------------------------------------------------
Q09E62_STIAD/262-421K----L.........IAV..VG..GFAVV---------------------------------------------------
Q0F0M6_9PROT/213-366L----W.........GGT..AF..ILFII---------------------------------------------------
Q0FVI2_9RHOB/235-384L----L..............LG..LLAIA---------------------------------------------------
Q0K590_CUPNH/190-329L----P.........LGV..AG..IAYLA---------------------------------------------------
Q0RQN9_FRAAA/191-339T----V.........GGG..LA..LGG..---------------------------------------------------
Q116W3_TRIEI/310-456I----P.........IGA.GLA..VILGG---------------------------------------------------
Q11WP4_CYTH3/217-372I----I.........IIS..AC..LGLLI---------------------------------------------------
Q13C35_RHOPS/193-342V----LA......ALAAA..ML..VAAIA---------------------------------------------------
Q13ZP0_BURXL/293-441L----L.........AGV..LG..LAVMA---------------------------------------------------
Q1AYI9_RUBXD/56-206L----V.........YGV..TG..AFVAF---------------------------------------------------
Q1DDI4_MYXXD/252-411L----..........LAV..MG..TAGVA---------------------------------------------------
Q1ILV2_KORVE/234-378L----V.........AGT.LLL..VIGVG---------------------------------------------------
Q1YYW0_PHOPR/196-339I----LSVF...FHSLIA..GF..IIKLA---------------------------------------------------
Q1ZNU5_PHOAS/174-338L----..........LAM..CA..IIFVY---------------------------------------------------
Q1ZRU2_PHOAS/204-332T----I.........YFI..IG..VISFL---------------------------------------------------
Q21E31_SACD2/194-335S----W.........VAM..GV..VLPVL---------------------------------------------------
Q28JD9_JANSC/245-398I----F.........VAV..IA..VITLT---------------------------------------------------
Q2BHJ7_9GAMM/226-360F----Y.........SGL..AC..LVCLH---------------------------------------------------
Q2BJE6_9GAMM/185-324F----A.........VGV..AA..LASLL---------------------------------------------------
Q2G3B0_NOVAD/227-366I----G.........AGV..LV..ASLLH---------------------------------------------------
Q2J607_FRASC/297-440A----L.........LGV..SL..VALII---------------------------------------------------
Q2SZV7_BURTA/211-393V----A.........IAV..LG..AAALG---------------------------------------------------
Q2T8A3_BURTA/218-368V----C.........LWA..TA..LTIAL---------------------------------------------------
Q31EZ8_THICR/228-358L----I.........IAF.TLL..VFIFS---------------------------------------------------
Q323H8_SHIBS/204-353L----TLANLYYVFLIGI..LF..IAPSF---------------------------------------------------
Q3B1S6_PELLD/212-351I----WS.......IVLV..LP..AVSYL---------------------------------------------------
Q3B349_PELLD/225-374V----L.........VIV..LL..VTPYI---------------------------------------------------
Q3MDE5_ANAVT/319-465I----P.........IGA..GL..AAMLA---------------------------------------------------
Q3SHZ0_THIDA/269-434L----R.........SAV..IG..LVTVL---------------------------------------------------
Q47Z28_COLP3/217-358L----V.........LIG..LV..IPAIT---------------------------------------------------
Q489C9_COLP3/205-331I----I..........SI..LS..LIAFA---------------------------------------------------
Q48BJ9_PSE14/208-357T----L.........CIV..VA..GIGLL---------------------------------------------------
Q48GU3_PSE14/246-383L----M.........GGL..VA..GIFLL---------------------------------------------------
Q4BV80_CROWT/224-377L----L.........IIL..IV..SISIY---------------------------------------------------
Q4BWG3_CROWT/286-429L----V.........KLV..IL..FIVSI---------------------------------------------------
Q4K0H9_STRPN/184-332I----I.........TTW..LV..ISLLS---------------------------------------------------
Q4K0J9_STRPN/274-404.----...........SI..FG..IIIST---------------------------------------------------
Q4K1F3_STRPN/210-359I----FP......LIFLI..VL..VIFYL---------------------------------------------------
Q4K1K2_STRPN/189-336I----I.........STA..AG..ISLIF---------------------------------------------------
Q4K1M0_STRPN/192-329I----V..........AF..YP..TIPLI---------------------------------------------------
Q4K247_STRPN/183-329L----I.........SFL..TF..IITIL---------------------------------------------------
Q4K368_STRPN/165-325V----I.........VLI.LII..VVSLC---------------------------------------------------
Q4VKA1_ECOLX/188-325F----TLAS..IGTVCGA..LY..AIFYM---------------------------------------------------
Q5LE47_BACFN/193-320F----L.........FFL..VL..VITIA---------------------------------------------------
Q5LV52_SILPO/257-406I----A.........L.....G..IAALA---------------------------------------------------
Q5P6V0_AROAE/255-405A----W.........MAV..LL..IAATC---------------------------------------------------
Q608R5_METCA/228-368I----LG.......GMII..VG..IPALI---------------------------------------------------
Q64W31_BACFR/208-352L----L.........LFS..VL..LLFYC---------------------------------------------------
Q6AGK0_LEIXX/192-346L----A.........LFT..VA..VLVAT---------------------------------------------------
Q6HMT7_BACHK/204-392T----V.........VAA..VV..LGGLL---------------------------------------------------
Q6LNR9_PHOPR/191-336V----S.........ISM.ILF..IAIIF---------------------------------------------------
Q72TC9_LEPIC/257-406.----T........PVFISHFV..LAGIL---------------------------------------------------
Q7NDJ8_GLOVI/213-360I----V.........LGA..AV..LLPPL---------------------------------------------------
Q7NF12_GLOVI/242-388I----L.........VAA..LG..FTCLA---------------------------------------------------
Q7NII4_GLOVI/245-399I----G.........GAV..AV..ALVLG---------------------------------------------------
Q7NJN7_GLOVI/229-378L----A.........LAA..AG..SFTIL---------------------------------------------------
Q7UF14_RHOBA/228-394G----L.........SMV..VI..VLAGL---------------------------------------------------
Q858F4_BPE15/191-337K----M.........VAA..FF..VITAL---------------------------------------------------
Q8GM97_STRTR/177-346F----L.........SFV..IS..TLAIF---------------------------------------------------
Q8KN07_9ACTO/187-328V----L.........CAA..VA..AVAFG---------------------------------------------------
Q8KQ17_PSEAI/199-335I----VQ......LSAAF..VG..LALYF---------------------------------------------------
Q8PRB5_XANAC/237-377L----V.........GGI..AA..MLAAA---------------------------------------------------
Q8YT85_NOSS1/260-405I----L.........IMA..LC..VIPLT---------------------------------------------------
Q92U08_RHIME/208-361I----A.........VGG..VG..LFNLF---------------------------------------------------
Q9ALX1_STRAG/186-328V----F.........LII..IG..IILLL---------------------------------------------------
Q9RJJ8_STRCO/187-328V----L.........CAA..VA..AVAFA---------------------------------------------------

PF04932

A4CI06_ROBBH/191-347..........................................................................SNRALI
A3GY30_VIBCL/171-330.....................................................................QFSPRIQERVD
Q4UYH3_XANC8/219-372.....................................................................PQARERLQRTT
A4TX99_9PROT/241-386..........................................................................ADGDIT
A3DIW4_CLOTH/315-453.............................................................................NRI
Q89PW4_BRAJA/213-357...........................................IFYFYATGYD..........................A
A5LYT8_STRPN/187-326...........................................ALVIFGYFLP..........................Y
Q7UXE7_RHOBA/267-417............................................................................KDQM
A2TSG4_9FLAO/201-377...........................................FLLVTNSNRL...................DRSKANSY
B1Z898_METPB/188-338...........................................EGDLLHRLMP.......................EAAH
Q7UWZ2_RHOBA/233-380....................................................................VPMQLNLESITR
A0PZ10_CLONN/222-380...........................................IIILVIYKLD......................LSNNL
Q7UPJ9_RHOBA/331-474...........................................LPLAARGWFG.......................TGWI
Q97ER0_CLOAB/210-348........................................................................WIAISKYN
A4AI36_9ACTN/211-357...........................................AVISWLSRVA..........................I
A7VGX9_9CLOT/231-488..........................GSLLYGWGSRKKADCVVAQKKGLRSVKDKKQASTMGCWKVIFWSVVGILILTAF
A0K2I1_ARTS2/235-362..........................................................................GMVGTI
Q1ZI48_9GAMM/245-403...........................................RFTQGMHAED....................TDISQVT
A4XML1_CALS8/220-429..................................KVGAQLNPNGKEKLWLILLMQFAVVWAAAYAFSFVEKRLYVLKNEV
Q2BFT2_9BACI/241-418...........................................VTKGANYFKLQGLDQDVPRTETPADQTEQPSDEERRF
Q0G5C8_9RHIZ/213-362......................................................................TLGTVLSDTL
A3EK85_VIBCL/216-360....................................................................VVSNWFGLDKVR
Q7NQD3_CHRVO/200-367...........................................AQFALPLFNH..........................L
Q7MVK6_PORGI/277-409...............................................................................F
Q5FQI9_GLUOX/196-353...........................................SPGSFFHLVT......................LARQQ
A3XRK0_LEEBM/177-345.......................................................YGFVKIFPYSIEKFSEVTFAHLDKV
RFC_SALMU/185-325...........................................................................FDNYT
Q98C91_RHILO/186-337...........................................AFVALNLGLM........................DFV
Q12C32_POLSJ/166-320.........................................................................HKVRDRL
Q0SYF1_SHIF8/194-338..........................................................................THKEMT
Q9X4C1_ECOLX/176-341...........................................WVSMGKIMSE........................NAN
A0ZHE8_NODSP/234-386...........................................FLAIIFVEPV.......................RIRV
Q7V9G4_PROMA/203-353...........................................PTEIQFIARK....................IVPEGLW
Q6ABG2_PROAC/212-358......................................................................QAGLVWHRFI
Q609Q8_METCA/225-373...........................................DLVIVGSYFG......................IEEVA
A4ISY3_GEOTN/200-391...........................................YFMPDVQSRT...............YSAVYAMEKIIS
Q7UKM5_RHOBA/239-382...................................................................GLLSEGSDVGSRV
Q2T0U3_BURTA/206-363...........................................VAVNVAVRWA......................NAHYH
Q01XB1_SOLUE/184-329.............................................................................ERM
A0Z5U1_9GAMM/194-332................................................................................
A4AAF7_9GAMM/171-307...........................................................................FFPAL
Q9X5H1_HELPX/195-362...........................................MGSNALEKKG...........AIEQSRVQNQSFEEDL
Q6ASB4_DESPS/185-338...........................................QTSPKFMNQG.......................RELY
Q4JZ62_STRPN/213-343................................................................................
Q11T24_CYTH3/244-416...........................................QFYMQMKRNN.............ADSKTKKTSVEDQF
Q6MI87_BDEBA/207-358...........................................................................FGSQV
Q8AA03_BACTN/192-346...........................................VAIIIVCASV...........................
Q1J334_DEIGD/252-413...........................................RVTVGQSRNT....................ISAESLL
A5UWM4_ROSS1/288-436.............................................................................GLA
Q4K127_STRPN/198-353...........................................IFITGIFFYV...................YSVKSDFI
A6GZ05_FLAPJ/236-385...........................................IIWSYSSSQT.......................NGLI
A5G2R8_ACICJ/202-340...........................................................................WKARM
Q5NZI1_AROAE/256-398..........................................................................GLAPVF
A7Z9C6_BACA2/261-409............................................................................TNAV
Q9RZA8_DEIRA/165-323........................................................................LNVPFKPL
Q89SN4_BRAJA/265-409...........................................LVGGLVAGRI.........................VE
Q9ZIT0_ECOLX/196-350...........................................SFKDTLLMRM.......................NDLN
A4ND37_HAEIF/179-336...........................................ANPKFGIEKR...................YNAAKSDI
O06944_SYNY3/232-381...........................................IFICTNDRLL........................TSF
A5UY10_ROSS1/144-293...........................................AAGIGLIALL....................VNLPATQ
Q9AQJ1_STRAG/174-309...........................................VILRFDNLVS......................IYNRI
Q65SG0_MANSM/195-350...........................................WLQEVFILLA..............KIDWLERPIERFS
Q832Q1_ENTFA/206-388............................................FCGAIVFGGLQLIEKGYIATANSVNIEVPKVLDNKE
Q83VQ8_9PROT/239-380...........................................................................IRDRL
Q97EP1_CLOAB/208-365...........................................LILLGLSYLT.........SYTGNVNNQVLNYLIYRA
A7BD98_9ACTO/223-370...........................................AIAAFFCRHM..........................I
Q220X5_RHOFD/200-337...........................................................................WEQRM
Q04RV1_LEPBJ/208-370...........................................VLGIVLSFTQ.....................VGQKIT
A6F4Q1_9ALTE/139-270................................................................................
Q09DA3_STIAD/195-349...........................................LVLCASLGAG..................GYVAWEKLV
B9LD61_CHLSY/273-406...........................................................................ADEFI
A4B946_9GAMM/214-357...........................................................................PEEQL
Q8RNK4_KLEPN/160-294..........................................................................PVGDML
Q72XI7_BACC1/178-330...........................................VIFNVELLYT.................IIGVRMEHLF
Q2BRH4_9GAMM/186-340....................................................................ADLSHIRILGNL
A6D015_9VIBR/218-369...........................................FLGFGNTSSQ...........................
Q1MQ48_LAWIP/199-337...............................................................................I
P74814_9SPHN/322-468...........................................AVVLAVMIMV......................VPAVH
Q2N6C0_ERYLH/230-383...........................................ASFALAIGAS..................ILLGRAAAI
A6QBN3_SULNB/185-344...........................................LSDKFQTRVQ.....................AAQHDI
A6M2N6_CLOB8/242-531LPNDTLKITYESGNPVFKDSNGEVVPYALNGKVLSTNIETFKNITFAFGKLDKKSVISDSLLLNINNQPTFLFKLNDNKI

PF13425

C6IFG7_9BACE/266-414-------------------------------------------.......FVCTNIG...............DDNQYIRK
A0LW89_ACIC1/221-359-------------------------------------------.......AIP......................GLLGT
A0YRC8_LYNSP/311-457-------------------------------------------.......VIA.NP..................QIIQER
A0YY08_LYNSP/334-480-------------------------------------------.......MGG.TH..................LLFPSI
A0ZBK6_NODSP/316-462-------------------------------------------.......ALA......................TNPTI
A1BHF5_CHLPD/216-365-------------------------------------------.......IVT.RTT................GTWD...
A1KBI4_AZOSB/182-311-------------------------------------------.......AWS......................GLGQT
A1VT05_POLNA/222-357-------------------------------------------.......LMG......................IYFNE
A1WA83_ACISJ/201-342-------------------------------------------.......SFY.QIAISF.........GDVFGFDT...
A1YVC7_LACJH/222-358-------------------------------------------.......LIN......................YF...
A1YZN9_PSEAI/186-321-------------------------------------------.......VAT.ISSGI...........VEIPDSRVAN
A1ZS85_9BACT/258-408-------------------------------------------.......VLK.FTSIGQ..........GIYAINRMRT
A2CCT3_PROM3/195-349-------------------------------------------W.....FMIG......................PR.S.
A2SDP8_METPP/225-368-------------------------------------------.......VLG.DALNL............SFTLGRIGE
A2WDK3_9BURK/260-410-------------------------------------------.......VPL.LTVGPV..........ADRLGQRLQS
A3F4D2_LACLC/174-305-------------------------------------------.......LLK...........................
A3HV81_9BACT/249-392-------------------------------------------.......VYV......................IFFAS
A3IMI1_9CHRO/286-429-------------------------------------------.......IIT......................TQIGL
A3IUA7_9CHRO/225-379-------------------------------------------.......CFA.STGN..............FTTQN...
A3K8X9_9RHOB/235-384-------------------------------------------.......LKG.AALIP...........EETLLSRAAA
A3KU19_PSEAI/248-385-------------------------------------------.......YPP.L...................QERLAT
A3P2Q6_BURP0/171-296-------------------------------------------.......LIN.DF.................FMLK...
A3SPZ3_9RHOB/245-394-------------------------------------------........LR.GNGW.............VPVDAI...
A3V694_9RHOB/192-341-------------------------------------------.......VVG.F....................VDFER
A3W1Y4_9RHOB/173-312-------------------------------------------.......LAS......................NRTPI
A3WFB0_9SPHN/222-363-------------------------------------------.......VIE.FSSN.............TGFYGL...
A3XD73_9RHOB/304-453-------------------------------------------.......YPM......................LRNLD
A3Y9Z7_9GAMM/195-353-------------------------------------------.......LPI.IVSVI............ETNFKY...
A3ZP84_9PLAN/227-386-------------------------------------------.......SFS.WAVAVG..........GESVTRRLSS
A4AEK4_9ACTN/190-334-------------------------------------------T.....IAFT.DVVS..............EVAIRGQD
A4EDX8_9RHOB/194-345-------------------------------------------.......SAQ......................LLFEY
A4EWL1_9RHOB/245-394-------------------------------------------.......YPM......................LRNLG
A4F0R9_9RHOB/216-356-------------------------------------------......EIAS......................DRPAI
A4TXA3_9PROT/212-353-------------------------------------------.......TLQ.F....................VYSYS
A4XMK9_CALS8/198-350-------------------------------------------.......LDK.DFY...............KIFERIKS
A4YQ66_BRASO/187-322-------------------------------------------.......LFW......................PVISG
A4YX51_BRASO/206-352-------------------------------------------F....GDVLS.L...................DAFTRR
A5CP65_CLAM3/221-356-------------------------------------------.......APFVQ....................SVFDD
A5EAQ5_BRASB/235-388-------------------------------------------.......YPA......................MRIAG
A5FL57_FLAJ1/219-339-------------------------------------------.......VIG.S....................VLMTR
A5FL58_FLAJ1/161-315-------------------------------------------.......VIFLS....................QRYKD
A5G2F5_ACICJ/218-369-------------------------------------------.......GPA......................LHFVR
A5GEM1_GEOUR/220-381-------------------------------------------TV..CIAYMS.DGQSDNK........SIYALYNFFTD
A5GQB5_SYNR3/178-326-------------------------------------------A....KQLLR......................PSSTG
A5PAQ9_9SPHN/298-451-------------------------------------------.......LLA.T....................FFVGR
A5V8X2_SPHWW/271-405-------------------------------------------.......TLP......................ILGHD
A5ZV75_9FIRM/172-330-------------------------------------------.......LLN......................NLIDI
A6BIH2_9FIRM/191-358-------------------------------------------.......VIG.F....................NFIKR
A6CBU1_9PLAN/250-380-------------------------------------------.......VLA......................GRQGN
A6DE00_9PROT/193-358-------------------------------------------.......FIT.VH.................YWDE...
A6DFC8_9BACT/220-366-------------------------------------------.......TPL......................KLEDE
A6DMP1_9BACT/236-371-------------------------------------------.......SYP......................SLSK.
A6DZI5_9RHOB/235-384-------------------------------------------.......YPV......................LKGAG
A6E8K4_9SPHI/180-325-------------------------------------------IY...NYVLK.DN..................LGNMEN
A6ETG3_9BACT/167-314-------------------------------------------.......LVK.KEDV.............SREYER...
A6F673_9GAMM/263-423-------------------------------------------.......IFY.EKN................NQGA...
A6FK24_9RHOB/260-408-------------------------------------------.......FPF......................ARTSG
A6L5V9_BACV8/222-366-------------------------------------------.......FWK......................FYFTL
A6L7F9_BACV8/212-352-------------------------------------------......LFIG......................IDIQN
A6LGX1_PARD8/196-333-------------------------------------------S....DLLMF.I...................LDRFDI
A6N385_ARTOX/264-390-------------------------------------------.......STF......................IEQGN
A6UIW2_SINMW/253-393-------------------------------------------.......TSW......................ITGRS
A6WE97_KINRD/230-374-------------------------------------------.......VFS.S....................VLESR
D7HGD2_VIBCL/212-351-------------------------------------------P.....IILL......................NLDIL
A7AHI1_9PORP/175-336-------------------------------------------.......VVS.WKK...............VSFYFIEG
A7B4B5_RUMGN/180-334-------------------------------------------.......ILSML...................YTKGSS
A7B9B7_9ACTO/214-354-------------------------------------------.......ATP......................ASQSL
A7BWS2_9GAMM/221-377-------------------------------------------.......AFG.LVK................AMEQ...
A7GLQ7_BACCN/204-397-------------------------------------------.......VLT......................PLTPI
A7IL98_XANP2/205-360-------------------------------------------.......ALS.G....................VSLED
A7JJ42_FRANO/186-334-------------------------------------------.......VLT.IS..................TEFKYT
A7JMT4_FRANO/187-383-------------------------------------------......AVLF.T...................VYKTSN
A7M5X5_BACOV/176-343-------------------------------------------.......FIT.STQVLSDNG...NDLFLVMKTKFIQT
A7NGA7_ROSCS/365-564-------------------------------------------.......AFN.LSDAPLFQ.....QLRDVPYIGRMGR
A7V9S7_BACUN/180-319-------------------------------------------.......YIY.TTYG..............DLLIVFDR
A7VV00_9CLOT/206-361-------------------------------------------.......AVT.QSD...............LYMRLMDT
A8GC50_SERP5/204-356-------------------------------------------.......SMF......................VFNSY
A8LUD1_DINSH/214-355-------------------------------------------L.....EIIS......................DRPAH
A8LXZ5_SALAI/235-376-------------------------------------------......TVFI......................PVAQL
A8RK65_9CLOT/197-346-------------------------------------------.......VLF.M....................NLTGN
A8RKN0_9CLOT/193-357-------------------------------------------........IW.PEQGFT..........IQDKEYN...
A8RSJ4_9CLOT/221-350-------------------------------------------......GVFD......................LVLQR
A8SGY7_9FIRM/208-357-------------------------------------------.......LSQ.NEYLS...........AKWLGGIQGA
A8U9G8_9LACT/218-351-------------------------------------------.......SWD.LINE..............TIINRTVD
A8UCK5_9LACT/210-361-------------------------------------------.......YIT......................GFLSN
A8YA87_MICAE/331-478-------------------------------------------.......FLN.P...................DFIQQR
A9A0Y0_DESOH/253-403-------------------------------------------.......WLP......................EFLER
A9CEI7_AGRT5/239-386-------------------------------------------.......IFF......................GSFDL
A9E2E9_9RHOB/245-394-------------------------------------------LR...NAG.............................
A9EBQ8_9FLAO/78-235-------------------------------------------.......VIS......................MYNTE
A9ETU3_SORC5/228-355-------------------------------------------.......LLG......................GRGGG
A9GB69_9RHOB/245-394-------------------------------------------.......YPM......................LRNLG
A9GIB7_SORC5/278-406-------------------------------------------.......LLG......................GRSGE
B0CE59_ACAM1/222-374-------------------------------------------.......AIS.STGS..............LTPTY...
B0CEF6_ACAM1/212-353-------------------------------------------.......SVL......................ILTND
B0JPJ8_MICAN/292-437-------------------------------------------.......AVT.LN.................PFVQERG
B0KB87_THEP3/245-390-------------------------------------------.......VFGLAN.................VINAFTS
B0M993_9FIRM/208-351-------------------------------------------.......LSW......................IA...
B0M9A4_9FIRM/196-348-------------------------------------------.......FIA.RDQ................LTAYFGS
B0N359_9FIRM/240-375-------------------------------------------.......IVF......................PKILT
B0T732_CAUSK/201-343-------------------------------------------.......VLI......................GVETG
B0TYH5_FRAP2/172-367-------------------------------------------.......IIF.GTV...............YKFSS...
B0ULV1_METS4/257-396-------------------------------------------TLTPFGEVIG......................ERLAS
B0V6K1_ACIBY/174-325-------------------------------------------.......ILW......................EEIED
B0VGS8_CLOAI/260-411-------------------------------------------.......YPS.FLF...............QISKS...
B1C0Q0_9FIRM/182-328-------------------------------------------.......LYS.NNAF..............QIKER...
B1FZC5_9BURK/272-424-------------------------------------------.......VPL.LAVGPV..........AERMQARLST
B1R2U0_CLOBU/208-343-------------------------------------------.......LLD......................NVLIR
B1RNR5_CLOPF/189-330-------------------------------------------I....YIFPN......................QFQRN
B1WSH8_CYAA5/286-429-------------------------------------------.......IIT......................TQVGL
B1X0A2_CYAA5/338-485-------------------------------------------.......VGF.SFF...............NPDFIQER
B1Y725_LEPCP/205-349-------------------------------------------......IVMK.AP.................AYYLLAR
B1ZT82_OPITP/197-358-------------------------------------------.......LPI.FSE...............GREAF...
B2AHI9_CUPTR/221-375-------------------------------------------.......AMA......................VFSAS
B2ILP9_STRPS/194-329-------------------------------------------.......MLF.YNFE.............KIKQIFFQM
B2J995_NOSP7/327-473-------------------------------------------.......IVM......................VTNPT
B2JKN4_BURP8/242-388-------------------------------------------.......YII......................LFMPG
B3C6G3_9BACE/158-317-------------------------------------------.......MLG......................GAGAF
B3DZJ9_METI4/232-389-------------------------------------------.......LAN......................TLFSS
B3EF24_CHLL2/226-378-------------------------------------------.......VIT......................R.TTG
B3Q3Q8_RHIE6/200-358-------------------------------------------.......LLG.DSIIE............AMNSSGLRT
B3QV51_CHLT3/220-371-------------------------------------------S....SPFLA......................SFFND
B3W8Q4_LACCB/236-408-------------------------------------------.......YTN.ATIARFSKPSPSDIRQEDRLKKQDRN
B3WWQ6_SHIDY/179-312-------------------------------------------......YLLF......................VLVAN
B3ZZ03_BACCE/196-346-------------------------------------------.......MIW.FL..................EEYQYT
E0UAN3_CYAP2/223-375-------------------------------------------.......FIN.ISGQFN..........GDELVSWAAN
B4D1K5_9BACT/198-355-------------------------------------------................................TLVPI
B4SDC8_PELPB/170-319-------------------------------------------.......SPF.VLEQ.............ASSDSI...
B4SFN3_PELPB/228-374-------------------------------------------.......YIA......................TRVTG
B4VS49_9CYAN/220-377-------------------------------------------.......WFR.PA.................FDAFMMR
B4VUT2_9CYAN/289-432-------------------------------------------.......WIT......................RTLGK
B5CP97_9FIRM/225-366-------------------------------------------......FVIW.......................RMSR
B5GZE0_STRCL/202-343-------------------------------------------.......SAV.QA.................WFLRGQS
B5L3Q0_SHIDY/193-354-------------------------------------------Q....SDSIQ......................QRLNE
B5L3W7_SHIBO/182-338-------------------------------------------.......LSW.NYLSSTG........LAEKVLYRFSG
B5QM83_LACRH/213-382-------------------------------------------.......YSN......................ATIAR
B5VX91_SPIMA/313-459-------------------------------------------.......VMI......................TNPEV
B5VYV0_SPIMA/317-463-------------------------------------------.......TLV......................IFPNL
B5Y6R2_COPPD/204-356-------------------------------------------.......IPQ......................LRDRL
B6B6U9_9RHOB/187-338-------------------------------------------.......SLP......................FLLSE
B6B8S8_9RHOB/245-394-------------------------------------------........PM......................LRNTG
B6JES5_OLICO/169-318-------------------------------------------.......IML......................SFSST
B6VUA4_9BACE/257-407-------------------------------------------.......MLK.YTKIGE..........SNKLIRRMRS
B6VYZ2_9BACE/224-375-------------------------------------------.......LFC.YPMLS............KETKDT...
B7AH28_9BACE/205-353-------------------------------------------.......FFQ......................YLNEF
B7BDU4_9PORP/175-316-------------------------------------------.......SLF......................FQFPS
B7J3X6_ACIF2/185-346-------------------------------------------.......MSP......................IVQHR
B7K071_CYAP8/337-484-------------------------------------------.......VGF.S....................FINPD
B7K694_CYAP8/286-429-------------------------------------------.......IVT.QF..................GIVQEA
B7RNS7_9RHOB/202-356-------------------------------------------.......VIIAF....................GFVPL
B8CL34_SHEPW/174-319-------------------------------------------.......VTF.FLLK..............NDSLTQRV
B8CL64_SHEPW/214-355-------------------------------------------.......GLT.GHS...............VIEKVEQT
B8FWJ7_DESHD/228-369-------------------------------------------.......LFA.TA.................SGDFFYR
B8G9F2_CHLAD/225-362-------------------------------------------.......IYQ.VAP...............HLVVREGE
B8HEF1_ARTCA/210-341-------------------------------------------.......LLF.DL..................LYSGEA
B8HLI8_CYAP4/219-378-------------------------------------------S.....AVFG.WAVAVG..........GSQTLWRIMT
B8HNC8_CYAP4/218-375-------------------------------------------......RYFN.DA.................VNAFIYR
B9D396_WOLRE/190-376-------------------------------------------A.....AVLS.SPTA.............MYKFLQ...
B9JKY3_AGRRK/181-340-------------------------------------------.......VAG......................VYLGA
B9XD26_9BACT/204-347-------------------------------------------.......VMK.APVW..............YLLARMSE
B9YBP1_9FIRM/190-362-------------------------------------------V.....AVPE.I...................FEKVQD
D7E0N9_NOSA0/308-454-------------------------------------------.......AMA......................ANPTI
C0C2D1_9CLOT/195-372-------------------------------------------.......IIL.PVN...............KVATS...
C0CGX9_9FIRM/216-373-------------------------------------------Y....QYVMT......................HTDNI
C0QGY0_DESAH/188-336-------------------------------------------.......SSF......................FVFKS
C0VIY2_9GAMM/185-331-------------------------------------------.......LFN.N...................LYI...
C0WW30_LACFE/203-350-------------------------------------------.......TIW.AVFL..............YFVYFSNS
C0ZT43_RHOE4/202-356-------------------------------------------.......LFD.E....................QVGDR
C1A313_RHOE4/214-369-------------------------------------------.......LLA.P...................PSIVKP
C1AWF5_RHOOB/210-389-------------------------------------------...................................TI
C1AY50_RHOOB/263-416-------------------------------------------.......TNW.STF...............TSDDRQAG
C1F0J2_BACC3/223-353-------------------------------------------W....DYVYA......................ILDKT
D5UK63_CELFN/214-352-------------------------------------------.......LLG.SGI................AAGVAAR
D7B6S8_NOCDD/245-400-------------------------------------------.......VLL.ALAAS............PLADVVRTR
D5SX75_PLAL2/208-338-------------------------------------------.......VMG......................GRQAN
C2EPL4_9LACO/200-348-------------------------------------------.......YYD.NI..................VGLLQS
C2H8B0_ENTFC/192-326-------------------------------------------.......LPI......................SYLAA
C2JZS3_LACRH/195-345-------------------------------------------.......VLL......................PAFSI
C2MCR4_9PORP/284-433-------------------------------------------.......LVY......................TTSPH
C2NRN1_BACCE/206-352-------------------------------------------.......IIA.WL.................AFLSDSK
C2PN12_BACCE/193-346-------------------------------------------.......NYF......................GLLDN
C2Q801_BACCE/208-396-------------------------------------------.......ALT.PQT................PIAKNMS
C2U9X7_BACCE/204-397-------------------------------------------.......VLT.PHT...............PIAKN...
C2V7V1_BACCE/208-389-------------------------------------------.......TPY.TP..................IAKNMS
C2ZKF6_BACCE/208-401-------------------------------------------.......ALT.PH..................TPI...
C3GAX2_BACTU/276-404-------------------------------------------.......VIL......................SNAEK
C3PKS4_CORA7/215-355-------------------------------------------T....AWYFS.PL.................GASFFNR
C3Q1B3_9BACE/197-337-------------------------------------------V.....IVLV......................QQSGL
C3R6E0_9BACE/193-346-------------------------------------------.......VLL.NVL...............DEDRI...
C3WCW0_FUSMR/165-294-------------------------------------------.......LPS......................KLKAT
C4RGH6_9ACTO/357-512-------------------------------------------.......SPL.G....................DLLNE
C5BIC6_TERTT/235-383-------------------------------------------.......YPT......................LRAAG
C5E895_BIFLI/204-349-------------------------------------------.......FSY......................GLTGL
C5RCC2_WEIPA/221-380-------------------------------------------.......LTY.IT..................VPSVHN
D9RUY4_PREMB/174-313-------------------------------------------.......TLV......................TMFSN
C6IJ43_9BACE/203-357-------------------------------------------.......SVY.LYN...............NDPFFYKN
C6M735_NEISI/182-343-------------------------------------------.......IPK......................QYIAD
C6NU22_9GAMM/224-372-------------------------------------------P.....AIIA.G....................LRGTD
C6R555_9MICC/204-343-------------------------------------------.......LID......................ILTSD
C6RIN3_9PROT/199-385-------------------------------------------V.....AVLS.SPT................AMYK...
C6W3M0_DYAFD/200-366-------------------------------------------.........L......................ARYGN
C6XK30_HIRBI/203-344-------------------------------------------TT...PEVIT......................NIMEA
C6XVP4_PEDHD/210-354-------------------------------------------.......ILA.I....................PKQKL
C6Z207_9BACE/221-375-------------------------------------------.......FFC.YPMLP............KEVRTT...
C7G9J0_9FIRM/181-318-------------------------------------------.......ILF......................NSDND
C7MGH4_BRAFD/211-348-------------------------------------------......PVVG......................SVLES
C7PAF8_CHIPD/260-410-------------------------------------------......ALLF.GPFYS............NPTIIRFRT
C7QQR9_CYAP0/223-379-------------------------------------------.......GIA.STGN..............LSDQQIKN
C7X6F7_9PORP/176-315-------------------------------------------......FSMF.D....................ELKVV
C7XAP2_9PORP/173-335-------------------------------------------.......VAW.QKI................YFYFFQT
D6Z4J1_DESAT/222-373-------------------------------------------.......YIG......................LRISG
C8RXJ1_9RHOB/237-386-------------------------------------------.......YPL......................LRGAH
C8S377_9RHOB/228-382-------------------------------------------.......AIN......................DVHRL
C8S4A7_9RHOB/262-400-------------------------------------------.......WFT.G....................LWQVL
C8XKU9_NAKMY/249-387-------------------------------------------.......HLVNR....................GLLGT
C9BIG3_ENTFC/192-327-------------------------------------------.......LPI......................SYFAA
C9LAR6_RUMHA/190-337-------------------------------------------Y.....QVLK.IVMP..............ENLRVFQS
C9RMK5_FIBSS/201-340-------------------------------------------.......IVICY....................FLFSD
C9RPA9_FIBSS/198-362-------------------------------------------VH..NQIVVG.KV.................IGVRDSL
C9YZ01_STRSW/187-328-------------------------------------------.......VGF.GPA...............LRSWF...
D0D9U9_9RHOB/235-384-------------------------------------------........MK.GTHL..............VPEER..I
D0TPJ6_9BACE/219-370-------------------------------------------.......IIE.NI..................PELSAT
D0WWB0_VIBAL/216-372-------------------------------------------......MYLG......................TLLLD
D0XH47_VIBHA/210-366-------------------------------------------.......YVG.T....................ILIE.
D1A7L1_THECD/209-365-------------------------------------------......PLPG......................MVQSR
D1CAK4_SPHTD/221-370-------------------------------------------.......LLY......................TIVSR
D1JLT7_9BACE/213-361-------------------------------------------.......YFT.NIGNG............NQYIRKMRS
D1JYE9_9BACE/223-402-------------------------------------------.......AIG......................YGIGN
D1N0G8_9BACT/45-185-------------------------------------------.......ALS......................GMLGR
D1NJF5_CLOTM/190-344-------------------------------------------.......VLG.FIPQ..............AQIVIKRI
D1R6C1_9CHLA/199-373-------------------------------------------......LVVN.TE..................GLRSDG
D1RNU0_SEROD/222-365-------------------------------------------.......YVT.TTN................YDVYQAL
E8S3V1_MICSL/258-413-------------------------------------------.......TPL.G...................RTFDER
F0QC36_ACIAP/216-356-------------------------------------------.......SVG......................IVVAS
E8YFQ6_9BURK/286-435-------------------------------------------.......APL.MMIDQV..........ADPVVRRFST
E3JCL8_FRASU/238-384-------------------------------------------.......SLT......................PAAKI
D1Y952_PROAA/204-371-------------------------------------------.......VVP......................GLRRM
D2A6W3_SHIF2/192-313-------------------------------------------.......MVG......................SR...
D2B3Z9_STRRD/220-371-------------------------------------------.......FLS......................PLQAM
E6VE03_RHOPX/196-345-------------------------------------------.......LLS.FD.................RIDA...
D2NP44_ROTMD/210-343-------------------------------------------.......YLE......................DNFAR
D2PZ04_KRIFD/223-379-------------------------------------------.......SPL.P...................TMIGER
D2QHE2_SPILD/202-373-------------------------------------------.......VVY......................FFQRY
D3ACB3_9CLOT/181-336-------------------------------------------.......IAS......................NLQSI
D3HI42_STRG3/189-329-------------------------------------------L.....GLPY.F...................YNGDST
D3L003_9BACT/156-293-------------------------------------------.......SFF.DLLE..............YANRR...
D3LLI7_MICLU/199-332-------------------------------------------.......VSW.A...................EENLAD
D3Q950_STANL/236-391-------------------------------------------A.....VLVT......................PLGQI
D3T7L1_THEIA/246-395-------------------------------------------.......VFG.......................LDNL
D4BMR8_BIFBR/200-373-------------------------------------------.......GAG......................GLSAI
D4CF67_9CLOT/193-340-------------------------------------------YL...WLIFS......................GLLET
D4E8R1_SEROD/192-333-------------------------------------------......FYVT......................TTNYS
P72910_SYNY3/223-371-------------------------------------------......QFLL......................LRINL
EXOQ_RHIME/181-340-------------------------------------------.......MIY.A...................GGVDL.
Q03KL2_STRTD/193-334-------------------------------------------.......MFS.LILP.............SSTIYTTSL
Q03WC5_LEUMM/225-384-------------------------------------------.......LGY.FFVQ..............PIHDIFYN
Q04DW5_OENOB/200-344-------------------------------------------.......AVK.......................LFEY
Q07GI2_ROSDO/280-429-------------------------------------------.......YPT......................LRASE
Q07I04_RHOP5/195-344-------------------------------------------.......ILL......................SFDSI
Q07Z92_SHEFN/181-323-------------------------------------------......VSPM......................FLFSD
Q09E62_STIAD/262-421-------------------------------------------.......GFG.WA..................STMGGD
Q0F0M6_9PROT/213-366-------------------------------------------.......MLP......................GIVQR
Q0FVI2_9RHOB/235-384-------------------------------------------.......YPV......................MKGAN
Q0K590_CUPNH/190-329-------------------------------------------................................ISFQI
Q0RQN9_FRAAA/191-339-------------------------------------------.......VLG.GELGL...........ARWNGSW...
Q116W3_TRIEI/310-456-------------------------------------------.......LIV......................SNPVI
Q11WP4_CYTH3/217-372-------------------------------------------Y.....KVVF......................ARQIE
Q13C35_RHOPS/193-342-------------------------------------------.......VLL.SIDQ.............IDELFR...
Q13ZP0_BURXL/293-441-------------------------------------------.......APL.MMIDQV..........AEPVIQRFST
Q1AYI9_RUBXD/56-206-------------------------------------------.......ALP......................SWITV
Q1DDI4_MYXXD/252-411-------------------------------------------.......TFG.WAVAVG..........GDAVMSRWST
Q1ILV2_KORVE/234-378-------------------------------------------.......YVV......................SDQVN
Q1YYW0_PHOPR/196-339-------------------------------------------.......LLS......................PLPEY
Q1ZNU5_PHOAS/174-338-------------------------------------------......IIFG.TPE................FNHFMVE
Q1ZRU2_PHOAS/204-332-------------------------------------------......YAPY.F....................GYFDK
Q21E31_SACD2/194-335-------------------------------------------.......VLL.GEP...............VYNWVMDS
Q28JD9_JANSC/245-398-------------------------------------------.......YPV......................LRSAD
Q2BHJ7_9GAMM/226-360-------------------------------------------......MVMS.AP.................VWHLLSR
Q2BJE6_9GAMM/185-324-------------------------------------------VK...SKALS......................IFLMD
Q2G3B0_NOVAD/227-366-------------------------------------------.......LLS......................QR.GL
Q2J607_FRASC/297-440-------------------------------------------.......SFT......................PASSI
Q2SZV7_BURTA/211-393-------------------------------------------.......LLE.FS.................ARERDPS
Q2T8A3_BURTA/218-368-------------------------------------------.......PIA......................GWIAT
Q31EZ8_THICR/228-358-------------------------------------------.......APY......................IA..E
Q323H8_SHIBS/204-353-------------------------------------------.......ILY.......................FGGD
Q3B1S6_PELLD/212-351-------------------------------------------.......LIH.IH.................EFEGFNR
Q3B349_PELLD/225-374-------------------------------------------.......YIF......................SRSTG
Q3MDE5_ANAVT/319-465-------------------------------------------......IAMA.SNPA..............VVEERFNS
Q3SHZ0_THIDA/269-434-------------------------------------------.......AVG.GGA................WLLIKDN
Q47Z28_COLP3/217-358-------------------------------------------.......LLG.EP.................LFSW...
Q489C9_COLP3/205-331-------------------------------------------.......YIF.NELII............NYLSERVGN
Q48BJ9_PSE14/208-357-------------------------------------------.......LPT.L....................GLIVS
Q48GU3_PSE14/246-383-------------------------------------------.......AFY.PP.................LQDRLMG
Q4BV80_CROWT/224-377-------------------------------------------.......LFL.GATGQV..........SGTKGDQ...
Q4BWG3_CROWT/286-429-------------------------------------------.......IIS......................TQIGL
Q4K0H9_STRPN/184-332-------------------------------------------.......IIF......................FFKHI
Q4K0J9_STRPN/274-404-------------------------------------------.......VLG......................LYFYN
Q4K1F3_STRPN/210-359-------------------------------------------.......YPE.NVIIN............MLYSSYSST
Q4K1K2_STRPN/189-336-------------------------------------------.......LIA......................YKLIE
Q4K1M0_STRPN/192-329-------------------------------------------.......LLY.NWEK..............IKHIFFQM
Q4K247_STRPN/183-329-------------------------------------------.......LLF.IDI................QGYLIRY
Q4K368_STRPN/165-325-------------------------------------------.......LYF.DVFAFI..........SNYISLRFSS
Q4VKA1_ECOLX/188-325-------------------------------------------......GSIS......................G....
Q5LE47_BACFN/193-320-------------------------------------------.......VMP......................TLISN
Q5LV52_SILPO/257-406-------------------------------------------.......IAY......................PALRN
Q5P6V0_AROAE/255-405-------------------------------------------......TWVW.KASPA...........APQAAKV...
Q608R5_METCA/228-368-------------------------------------------.......AFL......................D...Y
Q64W31_BACFR/208-352-------------------------------------------.......LYK.QE.................LDAV...
Q6AGK0_LEIXX/192-346-------------------------------------------.......YFS.......................RTRV
Q6HMT7_BACHK/204-392-------------------------------------------.......VLT.PQT................PIAKN..
Q6LNR9_PHOPR/191-336-------------------------------------------.......VFE......................MFSND
Q72TC9_LEPIC/257-406-------------------------------------------.......FPI......................WVVWT
Q7NDJ8_GLOVI/213-360-------------------------------------------G.....YYIA.TL..................PTFSDT
Q7NF12_GLOVI/242-388-------------------------------------------.......VPP.VTNF..............LVDTT...
Q7NII4_GLOVI/245-399-------------------------------------------.......TFT.ASP...............AGQERLES
Q7NJN7_GLOVI/229-378-------------------------------------------...........SVPPVT..........EAVLGSYQGT
Q7UF14_RHOBA/228-394-------------------------------------------.......VAS......................NWDGF
Q858F4_BPE15/191-337-------------------------------------------.......AIA.SPYI..............FDYLRLSS
Q8GM97_STRTR/177-346-------------------------------------------I.....SLFF.SYL................NHFFMA.
Q8KN07_9ACTO/187-328-------------------------------------------.......SLL.QA.................WFLRGQT
Q8KQ17_PSEAI/199-335-------------------------------------------.......LLM.VALP..............TWLGIDMT
Q8PRB5_XANAC/237-377-------------------------------------------.......SYG......................IVVTS
Q8YT85_NOSS1/260-405-------------------------------------------.......QIE.QFSK..............PITTRFET
Q92U08_RHIME/208-361-------------------------------------------.......AVG.SAVF.............APLGDFISG
Q9ALX1_STRAG/186-328-------------------------------------------.......VCF.SYK...............VESIINYI
Q9RJJ8_STRCO/187-328-------------------------------------------......SALH.AW..................FLRGQS

PF04932

A4CI06_ROBBH/191-347EKFKD------------------------------------------------AV--NFDGQYEVTEYWGGR........
A3GY30_VIBCL/171-330FTIFE------------------------------------------------IS--SIASNNIHAAASS..........
Q4UYH3_XANC8/219-372LAFTD------------------------------------------------GE--QGVDQAL................
A4TX99_9PROT/241-386LARMS------------------------------------------------GE--GDLT...................
A3DIW4_CLOTH/315-453LTIFR------------------------------------------------AA--QDTST..................
Q89PW4_BRAJA/213-357IHVGD------------------------------------------------AS--VDL....................
A5LYT8_STRPN/187-326LRYFD------------------------------------------------FT--F......................
Q7UXE7_RHOBA/267-417MSMKR------------------------------------------------DK--ALSAADAAKSV............
A2TSG4_9FLAO/201-377KNILY------------------------------------------------TK--SSVQNATLAPAPVQAGLSKIA..
B1Z898_METPB/188-338ERLTQ------------------------------------------------SS--S......................
Q7UWZ2_RHOBA/233-380LEMIS------------------------------------------------AN--ADTLQK.................
A0PZ10_CLONN/222-380ISLLD------------------------------------------------KN--NISN...................
Q7UPJ9_RHOBA/331-474DALPE------------------------------------------------SV--.......................
Q97ER0_CLOAB/210-348VYFFS------------------------------------------------AS--YIKA...................
A4AI36_9ACTN/211-357VASFD------------------------------------------------AS--GDL....................
A7VGX9_9CLOT/231-488VTVVT------------------------------------------------GV--GNQWEIFTFDDEWG.........
A0K2I1_ARTS2/235-362KGLFG------------------------------------------------GQ--DPSL...................
Q1ZI48_9GAMM/245-403LDFED------------------------------------------------SQ--LDTQRIT................
A4XML1_CALS8/220-429YIISA------------------------------------------------LT--IAALGIIGFIIALNMHLIPTSIV
Q2BFT2_9BACI/241-418KETFE------------------------------------------------MS--TVELSKT................
Q0G5C8_9RHIZ/213-362DSILQ------------------------------------------------SV--MPGTTF.................
A3EK85_VIBCL/216-360QRLAE------------------------------------------------TS--LQN....................
Q7NQD3_CHRVO/200-367ISLLT------------------------------------------------HS--DVENASGVARLAANGDDMG....
Q7MVK6_PORGI/277-409NGLLS------------------------------------------------HR--FFAD...................
Q5FQI9_GLUOX/196-353LTHFG------------------------------------------------QS--PYG....................
A3XRK0_LEEBM/177-345GKLDE------------------------------------------------LD--NPEASAYNGL.............
RFC_SALMU/185-325EILIG------------------------------------------------RF--TDSSQASRGST............
Q98C91_RHILO/186-337LGLFG------------------------------------------------KD--STL....................
Q12C32_POLSJ/166-320IMMKM------------------------------------------------EV--ESHSAHAQPNTSS..........
Q0SYF1_SHIF8/194-338AKLTY------------------------------------------------KL--QQTNS..................
Q9X4C1_ECOLX/176-341YTVSS------------------------------------------------AA--QGIDFQRVGTF............
A0ZHE8_NODSP/234-386LSIFA------------------------------------------------DR--QDSSN..................
Q7V9G4_PROMA/203-353SRLTD------------------------------------------------LQ--FATDRPIE...............
Q6ABG2_PROAC/212-358GVLIH------------------------------------------------HN--DEGPSSF................
Q609Q8_METCA/225-373RRLEQ------------------------------------------------TT--VAEA...................
A4ISY3_GEOTN/200-391RHLHS------------------------------------------------DS--TNHVDGNSSDEDGGFLDEEPDDE
Q7UKM5_RHOBA/239-382VAVGT------------------------------------------------KT--GDVNELTSA..............
Q2T0U3_BURTA/206-363LGLAE------------------------------------------------SA--AERMRDAGQI.............
Q01XB1_SOLUE/184-329RSVYK------------------------------------------------PA--GDLDSN.................
A0Z5U1_9GAMM/194-332.QLFP------------------------------------------------MD--QTDKSL.................
A4AAF7_9GAMM/171-307DLITH------------------------------------------------FS--LPPSL..................
Q9X5H1_HELPX/195-362KRYAK------------------------------------------------KD--ADSSI..................
Q6ASB4_DESPS/185-338NTVTN------------------------------------------------YQ--EEISHGKFNNV............
Q4JZ62_STRPN/213-343..LWD------------------------------------------------NK--SGTGSA.................
Q11T24_CYTH3/244-416KSITN------------------------------------------------MN--TDVSN..................
Q6MI87_BDEBA/207-358YDFAR------------------------------------------------GV--ATGQNALGTREAQDGI.......
Q8AA03_BACTN/192-346.LLYQ------------------------------------------------MK--ADSA...................
Q1J334_DEIGD/252-413LNLKS------------------------------------------------IT--DSTGDEARDGSR...........
A5UWM4_ROSS1/288-436LTLRG------------------------------------------------GP--GGGSV..................
Q4K127_STRPN/198-353YTFIQ------------------------------------------------EH--NINS...................
A6GZ05_FLAPJ/236-385AKRYA------------------------------------------------NE--DASGRVKSTLL............
A5G2R8_ACICJ/202-340FTILH------------------------------------------------FH--HSNSA..................
Q5NZI1_AROAE/256-398ARFAQ------------------------------------------------DA--TA.....................
A7Z9C6_BACA2/261-409LNLFS------------------------------------------------AP--QAMPGQQPLPSN...........
Q9RZA8_DEIRA/165-323DRLLN------------------------------------------------DQ--T......................
Q89SN4_BRAJA/265-409HGLID------------------------------------------------..--.......................
Q9ZIT0_ECOLX/196-350NDLVN------------------------------------------------YS--HDNTRTSV...............
A4ND37_HAEIF/179-336VSYLE------------------------------------------------KN--NRNTSL.................
O06944_SYNY3/232-381TGIMG------------------------------------------------GQ--GAGQF..................
A5UY10_ROSS1/144-293DALAS------------------------------------------------AA--LRA....................
Q9AQJ1_STRAG/174-309INLRS------------------------------------------------GS--S......................
Q65SG0_MANSM/195-350LVIFS------------------------------------------------MG--DDKSV..................
Q832Q1_ENTFA/206-388NEILG------------------------------------------------NK--KITTKRPDVEGKDDIS.......
Q83VQ8_9PROT/239-380LDLTS------------------------------------------------GN--QVVAYAKLNSY............
Q97EP1_CLOAB/208-365KSIFD------------------------------------------------WN--SDGSN..................
A7BD98_9ACTO/223-370ADAFG------------------------------------------------RS--PDM....................
Q220X5_RHOFD/200-337NTIGS------------------------------------------------YE--QDHSA..................
Q04RV1_LEPBJ/208-370DPLFG------------------------------------------------KE--KHTD...................
A6F4Q1_9ALTE/139-270EFILS------------------------------------------------RG--L......................
Q09DA3_STIAD/195-349AEAST------------------------------------------------AR--SVETLR.................
B9LD61_CHLSY/273-406NRVLS------------------------------------------------GV--QFRDQAQ................
A4B946_9GAMM/214-357GRFQN------------------------------------------------MG--EDQTS..................
Q8RNK4_KLEPN/160-294LARFE------------------------------------------------EL--GTQS...................
Q72XI7_BACC1/178-330SYILG------------------------------------------------KG--ANEGSI.................
Q2BRH4_9GAMM/186-340NALSS------------------------------------------------SG--PISMTAIQQI.............
A6D015_9VIBR/218-369.NLIE------------------------------------------------QK--ASFT...................
Q1MQ48_LAWIP/199-337ARLSW------------------------------------------------ET--MLN....................
P74814_9SPHN/322-468NRVLG------------------------------------------------GG--ATQASN.................
Q2N6C0_ERYLH/230-383ERLIV------------------------------------------------AD--EIG....................
A6QBN3_SULNB/185-344TKIEK------------------------------------------------GQ--FTSSW..................
A6M2N6_CLOB8/242-531FHLID------------------------------------------------MS--TKNYIDLQTPETFGFKGKEKLG.

PF13425

C6IFG7_9BACE/266-414..MRS...................AF......................RPS..QD..A.S.Y------------------
A0LW89_ACIC1/221-359..IRS...................F.F....................LHAG..QD..P.S.I------------------
A0YRC8_LYNSP/311-457..I......................................................D.S.F------------------
A0YY08_LYNSP/334-480..I..............................................SQ..RL..E.S.L------------------
A0ZBK6_NODSP/316-462..I..............................................QE..RA..N.S.F------------------
A1BHF5_CHLPD/216-365..GRNLS................DF.VA.................EKFSAN..RA..Q.S.L------------------
A1KBI4_AZOSB/182-311..L..................................................SE..R.G.L------------------
A1VT05_POLNA/222-357..VIY..........................................ALFT..DE..G.T.L------------------
A1WA83_ACISJ/201-342..IGR...................I.M...................LLFEG..DD..V.N.V------------------
A1YVC7_LACJH/222-358..L..............................................SQ..KL..N.S.N------------------
A1YZN9_PSEAI/186-321..L.............................................LDL.QHD..N.S.S------------------
A1ZS85_9BACT/258-408..A.............................................LDP..ND..P.S.L------------------
A2CCT3_PROM3/195-349.................................................TI..NL..G.S.D------------------
A2SDP8_METPP/225-368..F..............................................GS..ER..S.S.A------------------
A2WDK3_9BURK/260-410..IV............................................NLK..DD..R.S.Y------------------
A3F4D2_LACLC/174-305..LP...........................................INQY..IN..S.L.L------------------
A3HV81_9BACT/249-392DDFYFF..................V.L...................DTITF..EN..T.S.S------------------
A3IMI1_9CHRO/286-429..I..............................................DE..RV..A.N.F------------------
A3IUA7_9CHRO/225-379..AEPVL................SA.IS.................SNISED..RA..G.S.L------------------
A3K8X9_9RHOB/235-384..I..............................................DP.DRA..A.S.L------------------
A3KU19_PSEAI/248-385..I..............................................FS.PQN..A.S.T------------------
A3P2Q6_BURP0/171-296..LSYL.................MA.TL..................NGQGE..TT..G.S.F------------------
A3SPZ3_9RHOB/245-394..LAQ.....................A....................EAFNPDRA..Q.S.L------------------
A3V694_9RHOB/192-341..L..............................................GI..TD..S.T.S------------------
A3W1Y4_9RHOB/173-312.TIII.....................E....................TMTF..NS..G.T.G------------------
A3WFB0_9SPHN/222-363..LVR..........................................YASL..NS..V.S.A------------------
A3XD73_9RHOB/304-453..LFPTE...............AIL.AQA................EAISAE..RA..Q.S.L------------------
A3Y9Z7_9GAMM/195-353..IFQGLN.............LLYL.NVID..............FNFERFI.YST..P.S.I------------------
A3ZP84_9PLAN/227-386..LI...........................................DDDM..GE..V.Y.Y------------------
A4AEK4_9ACTN/190-334..A..............................................D...QL..I.T.L------------------
A4EDX8_9RHOB/194-345..LL...........................................GLLG..RD..A.T.L------------------
A4EWL1_9RHOB/245-394..LFPTE...............AIL.AQA...............EAISAD...RA..Q.S.L------------------
A4F0R9_9RHOB/216-356..IAI...................L.S....................RLAF..NS..S.T.V------------------
A4TXA3_9PROT/212-353..A..............................................NF..ED..G.S.T------------------
A4XMK9_CALS8/198-350..I...............................................P..VD..N.S.A------------------
A4YQ66_BRASO/187-322..VLA...................L.D...................DPDRG..LT..S.G.I------------------
A4YX51_BRASO/206-352..L.............................................GEF..SD..T.Q.S------------------
A5CP65_CLAM3/221-356..A..............................................GT.EAS..A.S.S------------------
A5EAQ5_BRASB/235-388..VFPTN...............MLF.DVA................SSINQD..RA..Y.S.L------------------
A5FL57_FLAJ1/219-339..YFQY..................G.S...................LEGFI..LD..S.N.L------------------
A5FL58_FLAJ1/161-315.DIQ...........................................FLNK..NK..I.E.N------------------
A5G2F5_ACICJ/218-369..VID.....................L....................IHLG..DA..A.S.L------------------
A5GEM1_GEOUR/220-381..L.............................................AGS..SY..E.G.N------------------
A5GQB5_SYNR3/178-326..I.............................................PGI..DL..S.S.D------------------
A5PAQ9_9SPHN/298-451..LRA...................L.V...................WGTKA..QS..F.S.S------------------
A5V8X2_SPHWW/271-405.................................................DA..R...L.S.T------------------
A5ZV75_9FIRM/172-330..LYWVSQKL..........AQYGM.QSRSV...........TLLINQIKS..NE..I.Y.L------------------
A6BIH2_9FIRM/191-358..YNPAILK............IFVD.NDAME............YYLSGNGY..TN..S.G.D------------------
A6CBU1_9PLAN/250-380..I..............................................DL..NS..G.T.G------------------
A6DE00_9PROT/193-358..IKFL.................YA.GL..................GIGGT..SA..H.S.S------------------
A6DFC8_9BACT/220-366..I..............................................NT..RD..L.N.Q------------------
A6DMP1_9BACT/236-371......................................................I..G.S.V------------------
A6DZI5_9RHOB/235-384..LIPVD................WI.LEQ................AAKVDP.DRA..N.S.L------------------
A6E8K4_9SPHI/180-325..IV...........................................TKNV..HN..D.A.A------------------
A6ETG3_9BACT/167-314..ITA..........................................RFE....N..P.E.K------------------
A6F673_9GAMM/263-423..VKT...................E.A...................VGIEE..MA..E.S.N------------------
A6FK24_9RHOB/260-408..LVPLT...............PIQ.NLA................ESINPA..RA..Q.S.L------------------
A6L5V9_BACV8/222-366..IYS...................T.L...................FANKM..DV..G.S.S------------------
A6L7F9_BACV8/212-352..I..............................................A...LI..S.S.N------------------
A6LGX1_PARD8/196-333..FSN...................T.T....................AMTI..TD..H.S.S------------------
A6N385_ARTOX/264-390......................................................T..A.S.H------------------
A6UIW2_SINMW/253-393..LVA...................L.V...................GRLTF..DP..M.S.Y------------------
A6WE97_KINRD/230-374..LAQQT................TE.AS.................GAGGGL..LP..Q.T.V------------------
D7HGD2_VIBCL/212-351..LN...........................................RENY..VA..L.S.G------------------
A7AHI1_9PORP/175-336..I..............................................TG..EA..E.T.D------------------
A7B4B5_RUMGN/180-334..I..............................................FL.KLD..S.I.L------------------
A7B9B7_9ACTO/214-354..L..............................................ERVAAS..S.S.T------------------
A7BWS2_9GAMM/221-377..LASL..................K.M...................EDAES.KES..Q.T.I------------------
A7GLQ7_BACCN/204-397..AKNMGIHLQIYEYKKALREEQERKEGKVVKEDPDEAKKHAQGELTDSEV..KS..L.I.Y------------------
A7IL98_XANP2/205-360..L..............................................SP..TL..M.S.M------------------
A7JJ42_FRANO/186-334..L.............................................INS..TQ..D...L------------------
A7JMT4_FRANO/187-383..IFHDRVNE.........AIKESQ.LYFSKD..........FDNKTAEEL..AL..T.S.T------------------
A7M5X5_BACOV/176-343..IPKA.................DN.FS.................PNDFEM.LNL..S.S.Y------------------
A7NGA7_ROSCS/365-564..L.............................................LEV..ET..G.T.G------------------
A7V9S7_BACUN/180-319..F..............................................ET.DEV..E.T.G------------------
A7VV00_9CLOT/206-361..L..............................................QG..KD..S.S.N------------------
A8GC50_SERP5/204-356..FVYD.................QV.KN.................TSLHDS..AY..S.S.I------------------
A8LUD1_DINSH/214-355..IAL...................L.S....................HLTF..NA..H.N.V------------------
A8LXZ5_SALAI/235-376..IG...........................................DRVG..SS..D.T.N------------------
A8RK65_9CLOT/197-346..IGSGI...............LDD.LRL................FKVNEG..MS..N.S.F------------------
A8RKN0_9CLOT/193-357..ILT...................R.I....................QEKL..AL..L.S.Q------------------
A8RSJ4_9CLOT/221-350..F..................................................SG..S.L.T------------------
A8SGY7_9FIRM/208-357..I..............................................DK.ISG..Q.S.V------------------
A8U9G8_9LACT/218-351..I.............................................LSG..ED..G.S.A------------------
A8UCK5_9LACT/210-361..MFSSLADIT........GLSTSI.RIRFDE.........VSDLLSGVVF..HG..S.D.L------------------
A8YA87_MICAE/331-478..Y..............................................DS.AVA..R.W.Q------------------
A9A0Y0_DESOH/253-403..VLL.....................I....................GFDT..GDPNA.I.F------------------
A9CEI7_AGRT5/239-386..LDGA.................IS.KR..................FLEDE..NA..S.S.N------------------
A9E2E9_9RHOB/245-394..LVPLD...............AIL.AQA...............EAISAD...RA..Q.S.L------------------
A9EBQ8_9FLAO/78-235..IFTLIENVV........NGRVFS.KISDPT.........LIAQGNVDQL..YE..D.L.G------------------
A9ETU3_SORC5/228-355..................................................E..AD..E.S.A------------------
A9GB69_9RHOB/245-394..LVPVD...............AIL.AQA................QAFSPE..RA..Q.S.L------------------
A9GIB7_SORC5/278-406.................................................E...AS..E.S.S------------------
B0CE59_ACAM1/222-374..TRQLV................AT.AS.................QITGPE..RA..A.S.L------------------
B0CEF6_ACAM1/212-353..ILYEK...............VAS.RLL................SLFLYE..DD..I.S.V------------------
B0JPJ8_MICAN/292-437..L..............................................NF..ID..R.WLY------------------
B0KB87_THEP3/245-390..LT...........................................VDKF..NT..L.S.G------------------
B0M993_9FIRM/208-351.................................................QE..RD..L.S.N------------------
B0M9A4_9FIRM/196-348..I..............................................DL..........Y------------------
B0N359_9FIRM/240-375..IIL...................A.G....................RGGQ..SL..F.D.S------------------
B0T732_CAUSK/201-343..FVA.....................W....................LHKL..VP..P.S.W------------------
B0TYH5_FRAP2/172-367..VFNYRLQT.........SLEESQ.VFFNQD..........YNNTDARKQ..YE..T.S.T------------------
B0ULV1_METS4/257-396..LG............................................DGA..QD..G.S.A------------------
B0V6K1_ACIBY/174-325..IFVK..................K.VM..................YKMDD..GG..G.V.T------------------
B0VGS8_CLOAI/260-411..FERLN................TL.EA.................LTKGDL..TA..G.G.T------------------
B1C0Q0_9FIRM/182-328..WENT.................PL.YE.................RISDET.GYQ..S.G.D------------------
B1FZC5_9BURK/272-424..IV............................................NLN..DD..Q.S.Y------------------
B1R2U0_CLOBU/208-343..F...............................................G..EE..S.L.T------------------
B1RNR5_CLOPF/189-330..FTV...................F.K....................NVEN..TD..D.S.T------------------
B1WSH8_CYAA5/286-429..V..............................................DE..RV..A.N.F------------------
B1X0A2_CYAA5/338-485..I..............................................DS.FVD..R.W.N------------------
B1Y725_LEPCP/205-349..I..............................................DL..TG..S.S.T------------------
B1ZT82_OPITP/197-358..MSRW.................ET.AA..................STTAT..GDAWS.S.I------------------
B2AHI9_CUPTR/221-375..VEST..................V.QR..................FHDAA..ED..E.D.F------------------
B2ILP9_STRPS/194-329..F..............................................SS..RS..G.S.N------------------
B2J995_NOSP7/327-473..V.............................................VQE..RT..E.S.F------------------
B2JKN4_BURP8/242-388..VAKAL...............TDF.VDT................TVMSKA..GS..S.S.G------------------
B3C6G3_9BACE/158-317..L...............................................L..KP..D.S.A------------------
B3DZJ9_METI4/232-389..IIEA.................MI.MR..................WTGAS..EL..E.G.G------------------
B3EF24_CHLL2/226-378..IWDGTN..............LSG.FVA...............EKFSAD...RA..Q.S.L------------------
B3Q3Q8_RHIE6/200-358..F..............................................NT..EN..S.S.G------------------
B3QV51_CHLT3/220-371..VIQ.....................S....................VEAG..EI..K.G.M------------------
B3W8Q4_LACCB/236-408..I..............................................SG..DD..I.S.L------------------
B3WWQ6_SHIDY/179-312..I..............................................D....D..T.S.F------------------
B3ZZ03_BACCE/196-346..FPYLH...............QLL.QIM................DTGQLT..SV..S.S.F------------------
E0UAN3_CYAP2/223-375..F..............................................NQ.DRA..S.S.L------------------
B4D1K5_9BACT/198-355..FKEGV...............AVQ.HER................FESGGG..ME..Q.G.I------------------
B4SDC8_PELPB/170-319..FSKL..................Y.NR..................FTVE...GD..S.S.L------------------
B4SFN3_PELPB/228-374..IWDGR...............NFS.NFV...............AEKFSAV..RA..Q.S.L------------------
B4VS49_9CYAN/220-377.................................................TT..SS..D.N.L------------------
B4VUT2_9CYAN/289-432..V..............................................EE..RV..I.S.F------------------
B5CP97_9FIRM/225-366.................................................ER..NI..W.T.L------------------
B5GZE0_STRCL/202-343.................................................KE..HF..S.S.L------------------
B5L3Q0_SHIDY/193-354..ITS...................L.D....................KMAS..SD..NLS.V------------------
B5L3W7_SHIBO/182-338..LID...................F.L....................SGTG..GD..N.S.S------------------
B5QM83_LACRH/213-382..FSKPTNA............DLRE.ERKFK............WRDANGGG..ND..T.S.L------------------
B5VX91_SPIMA/313-459..I..............................................QE..RV..D.S.F------------------
B5VYV0_SPIMA/317-463..A..............................................EG..RI..E.S.F------------------
B5Y6R2_COPPD/204-356..LTA...................F.T....................WAYV..QE..S.S.Q------------------
B6B6U9_9RHOB/187-338..FSLLLPQ............SVTY.NLQRL............DFLNISGN..ST..F.L.Q------------------
B6B8S8_9RHOB/245-394..LVPTE...............ALV.AQA................EAISAE..RA..H.S.L------------------
B6JES5_OLICO/169-318..ADLF.................SE.RA..................SLSQP..YD..S.G.R------------------
B6VUA4_9BACE/257-407..A.............................................FDT..ED..Q.S.M------------------
B6VYZ2_9BACE/224-375..VEGFV...............LFW.NDK...............AAAKAEM..HG..S.S.L------------------
B7AH28_9BACE/205-353..ILY.....................R....................LINV..E.......D------------------
B7BDU4_9PORP/175-316..VFH...................G.L....................QEDF...S..S.G.G------------------
B7J3X6_ACIF2/185-346..VQEGL................QN.LQV................VSKGD...YD..T.S.W------------------
B7K071_CYAP8/337-484..F.............................................VQE..RI..D.S.F------------------
B7K694_CYAP8/286-429..I......................................................A.D.F------------------
B7RNS7_9RHOB/202-356..L..............................................DALGKD..V.T.L------------------
B8CL34_SHEPW/174-319..IK............................................KET..AQ.......------------------
B8CL64_SHEPW/214-355..IYA..........................................FKNA..RA..G.S.T------------------
B8FWJ7_DESHD/228-369..LTE.....................G....................LNFS..NS..T.S.F------------------
B8G9F2_CHLAD/225-362SGL..............................................DE..SF..N.I.F------------------
B8HEF1_ARTCA/210-341..A..............................................DE..VA..S.S.G------------------
B8HLI8_CYAP4/219-378..LF...........................................SSDP..QN..V.Y.Y------------------
B8HNC8_CYAP4/218-375..A..............................................Q...TS..G.G.L------------------
B9D396_WOLRE/190-376..IGIVSE..............ANL.ENE...............SMRERLA..GL..S.F.S------------------
B9JKY3_AGRRK/181-340..VDL...................V.L....................GAFG..KD..S.T.L------------------
B9XD26_9BACT/204-347..L..............................................TG..GD......G------------------
B9YBP1_9FIRM/190-362..I..............................................LR..LK..S.S.V------------------
D7E0N9_NOSA0/308-454..V..............................................QD..RM..N.S.F------------------
C0C2D1_9CLOT/195-372..IMPEVSFQEE.....KEQDANLN.SLIDGYMV......RMEGNDKAKAG..IN..D.Y.S------------------
C0CGX9_9FIRM/216-373..LIK...................G.F...................LTRFS..AN..D.L.W------------------
C0QGY0_DESAH/188-336..F...............................................T..DD..M.S.F------------------
C0VIY2_9GAMM/185-331..LDT...................L.V...................LRYEN..SG..L.E.S------------------
C0WW30_LACFE/203-350..LNT..........................................HFMQ..LD..E.F.L------------------
C0ZT43_RHOE4/202-356..LTSQL................SS.PSK................DGLPPW..IP..E.T.I------------------
C1A313_RHOE4/214-369..L..............................................F...SS..Y.S.L------------------
C1AWF5_RHOOB/210-389..LPAFGEDVAR......AEPSATS.PSEPAATP......EPSGKLGDIDF..EG..G.N.I------------------
C1AY50_RHOOB/263-416..G..............................................VG..SE..G.E.L------------------
C1F0J2_BACC3/223-353..IFQ..........................................KMFM..KT..E.S.G------------------
D5UK63_CELFN/214-352.................................................FT..DD..E.G.S------------------
D7B6S8_NOCDD/245-400..I..............................................D...NP..H.S.D------------------
D5SX75_PLAL2/208-338..L..............................................DL..ND..S.T.G------------------
C2EPL4_9LACO/200-348..FST..........................................TDSM..YG..G.S.T------------------
C2H8B0_ENTFC/192-326..V..............................................SE..KV..N.L.F------------------
C2JZS3_LACRH/195-345..WMMTK................YD.AS.................NSLFSA..LD..R.L.S------------------
C2MCR4_9PORP/284-433..L..............................................TA...G..Y.L.E------------------
C2NRN1_BACCE/206-352..I..............................................G...MS..S.S.L------------------
C2PN12_BACCE/193-346..LIER..................F.S...................FSNTE..NV..S.S.D------------------
C2Q801_BACCE/208-396..IHLQMYEYKKS....VQEEKERK.EGKVIKEE.....EHKPGELTDSEV..KS..L.I.Y------------------
C2U9X7_BACCE/204-397..MGIHMQIYEYKK.SVQEEKDRKE.GKVIKEDPED.AKKHAKGELTDSEV..KS..L.I.Y------------------
C2V7V1_BACCE/208-389..IHLQIYKYK........NPVQEG.EVTKEEH........EQGELTDSEM..KS..L.I.Y------------------
C2ZKF6_BACCE/208-401..AKNMGIHMQIYEYKKSVQEEKDRKEGKVIKEDLDAEKKHAKGELTDSEV..KS..L.I.Y------------------
C3GAX2_BACTU/276-404..F......................................................S.S.L------------------
C3PKS4_CORA7/215-355..V..............................................S...TT..N.S.T------------------
C3Q1B3_9BACE/197-337..LGR.....................F....................NFDF..SD..S.S.S------------------
C3R6E0_9BACE/193-346..LFMI..................N.KI..................ISADS.GNT..S.F.L------------------
C3WCW0_FUSMR/165-294..V..................................................YN..K.L.L------------------
C4RGH6_9ACTO/357-512..R..............................................MA..NG..H.S.D------------------
C5BIC6_TERTT/235-383..LIPVN................QI.NAY................FTELDE..DR..G.G.S------------------
C5E895_BIFLI/204-349..S..............................................FS..DL..L.N.Q------------------
C5RCC2_WEIPA/221-380..LLN.....................T....................WIF...QK..G.G.T------------------
D9RUY4_PREMB/174-313..L........................................................S.N------------------
C6IJ43_9BACE/203-357..IRFAF...............EAF.FNW................VETGE....L..R.T.D------------------
C6M735_NEISI/182-343..FLLSMHG...........NAFLE.NISSR...........LYLFLFNLE..SD..N.S.V------------------
C6NU22_9GAMM/224-372..H..............................................LF..AD..A.S.L------------------
C6R555_9MICC/204-343..YAH.....................S....................GAFA.DRT..G.T.D------------------
C6RIN3_9PROT/199-385..FLQIGI.............VSEA.SLEN..............ESMRERI.AGA..G.F.S------------------
C6W3M0_DYAFD/200-366..ILNLLLGYW.......DIFEDRI.MNVIFTS.......TGVRLSEEAD...VD..Y.S.A------------------
C6XK30_HIRBI/203-344..AT...........................................RGDI.QNI..L.T.G------------------
C6XVP4_PEDHD/210-354..I..............................................EG.LGT..S.S.H------------------
C6Z207_9BACE/221-375..VEGIV...............LFW.DDK...............AAVKADI..HG..S.S.V------------------
C7G9J0_9FIRM/181-318..I.............................................MKT..ID..R.Y.V------------------
C7MGH4_BRAFD/211-348..A.............................................GDE..AA..G.S.A------------------
C7PAF8_CHIPD/260-410..AF............................................MGS..QD..E.S.L------------------
C7QQR9_CYAP0/223-379..IVSI..................A.TN..................IAGEE..RA..S.S.L------------------
C7X6F7_9PORP/176-315..L..............................................RI.NED..A.S.F------------------
C7XAP2_9PORP/173-335..L..............................................TS.DVD..K.D.M------------------
D6Z4J1_DESAT/222-373..MVAAG...............DVE.VLV................AKVFDE.DRT..S.S.L------------------
C8RXJ1_9RHOB/237-386..LVPLD...............AIL.GLA................DHLDAN..RA..Y.S.L------------------
C8S377_9RHOB/228-382..LEIT.................SI.FN..................FNGES..GT..A.S.I------------------
C8S4A7_9RHOB/262-400..YDL...................S.F....................GDAG..VA..K.G.V------------------
C8XKU9_NAKMY/249-387..IWA...................L.F....................TNVN..ND..P.S.I------------------
C9BIG3_ENTFC/192-327..M..............................................SD..KV..H.L.F------------------
C9LAR6_RUMHA/190-337..LEG..........................................ALFY..ED.RT.T.Y------------------
C9RMK5_FIBSS/201-340..IFLV..................N.MN..................KLSRI..SK..G.S.S------------------
C9RPA9_FIBSS/198-362..S..............................................SN.VLE..S.Q.S------------------
C9YZ01_STRSW/187-328..LRG..........................................QSQE..NF..T.S.L------------------
D0D9U9_9RHOB/235-384..LAA...................V.S....................QFDK.ERS..Y.S.L------------------
D0TPJ6_9BACE/219-370..IDSI.................FI.KD.................SRQTNV..EG..S.S.I------------------
D0WWB0_VIBAL/216-372..FIY.....................Y....................KLQH..EA..T.G.G------------------
D0XH47_VIBHA/210-366..FLY.....................Y....................KMST..EA..S.G.G------------------
D1A7L1_THECD/209-365..L..............................................D...NP..H.S.N------------------
D1CAK4_SPHTD/221-370..VEPLRA..............RFF.EGD...............LSLKVGG..IA..I.N.A------------------
D1JLT7_9BACE/213-361..AF............................................RPT..ED..A.S.Y------------------
D1JYE9_9BACE/223-402..FNKKNTN...........ENKEE.TNIEY...........LLLGKIQDT..NN..L.S.T------------------
D1N0G8_9BACT/45-185..F..............................................G...ID..R.A.L------------------
D1NJF5_CLOTM/190-344..I..............................................QY.SSD..T.T.Y------------------
D1R6C1_9CHLA/199-373..LLSYKNIEI.......MKQVWED.IDIRAEP........EIKKLETDEK..FD..Q.S.W------------------
D1RNU0_SEROD/222-365..FPK..........................................ENAI..AE..N.S.I------------------
E8S3V1_MICSL/258-413..L...............................................Q..NG..H.S.D------------------
F0QC36_ACIAP/216-356..V..............................................NF..RD..G.S.T------------------
E8YFQ6_9BURK/286-435..I.............................................QDI.GED..N.S.Y------------------
E3JCL8_FRASU/238-384..FAS...................R.A...................TETKS..SG..S.S.G------------------
D1Y952_PROAA/204-371..L..............................................N.......P.S.D------------------
D2A6W3_SHIF2/192-313.....................................................SE..D.S.D------------------
D2B3Z9_STRRD/220-371..VAQ..........................................RLD...NP..H.S.N------------------
E6VE03_RHOPX/196-345..LFRE..................R.A...................SLAQP..YD..S.G.R------------------
D2NP44_ROTMD/210-343..AG...........................................AFAD..RL..G.S.D------------------
D2PZ04_KRIFD/223-379..L...............................................A..NQ..H.S.N------------------
D2QHE2_SPILD/202-373..FTAYLILYDY.....VSSFLERN.LENVYALF.....GQKSQGTDYKAV..LD..D.S.A------------------
D3ACB3_9CLOT/181-336..A.............................................IY...ML..N....------------------
D3HI42_STRG3/189-329..I.............................................YAT..LN..H.L.F------------------
D3L003_9BACT/156-293..MLA..........................................IFDL.SSD..P.S.M------------------
D3LLI7_MICLU/199-332..LG............................................IFG...D..R.T.G------------------
D3Q950_STANL/236-391..VA...........................................ARAA..NG..H.S.D------------------
D3T7L1_THEIA/246-395..INAF..................V.SL..................TVDKF..NN..L.S.G------------------
D4BMR8_BIFBR/200-373..IINPR................LN.SLA................TNGLLA..GD..G.S.M------------------
D4CF67_9CLOT/193-340..I.............................................SNF..AN..I.D.S------------------
D4E8R1_SEROD/192-333..IYEM..................I.FP..................EENTY..AE..N.S.I------------------
P72910_SYNY3/223-371..ISN.....................R....................ADDT..AS..P.L.Q------------------
EXOQ_RHIME/181-340..IL...........................................GAFG..KD..S.T.L------------------
Q03KL2_STRTD/193-334..V..............................................AI..ID..K.L.L------------------
Q03WC5_LEUMM/225-384..F..............................................LF..NK..Q.G.T------------------
Q04DW5_OENOB/200-344..FNF..........................................TSGT..NV..A.S.Y------------------
Q07GI2_ROSDO/280-429..IFPME...............RLT.ESL................ISLNAE..RA..S.S.F------------------
Q07I04_RHOP5/195-344..ASLF.................KE.RA..................SFSQP..YD..S.G.R------------------
Q07Z92_SHEFN/181-323..VFS...................S.S....................RFSA..EG..M.T.D------------------
Q09E62_STIAD/262-421..AIVS.................RW.NT.................LFEDQA..GD..V.Y.Y------------------
Q0F0M6_9PROT/213-366..P..............................................DV..YD....S.L------------------
Q0FVI2_9RHOB/235-384..IIPED...............RIL.AAA................ASFDED..RA..R.S.L------------------
Q0K590_CUPNH/190-329..LEGN.................SR.IL..................QLLAI.KES..A.S.Y------------------
Q0RQN9_FRAAA/191-339..MLRML................IP.GAG................SNGLFA..QY..T.A.D------------------
Q116W3_TRIEI/310-456..V..............................................QE..RI..N.S.F------------------
Q11WP4_CYTH3/217-372..IIS...................Q.R....................VENA..KG..E.S.V------------------
Q13C35_RHOPS/193-342..QRA.....................S....................LSQP..YD..S.G.R------------------
Q13ZP0_BURXL/293-441..M..............................................ENLGQD..N.S.Y------------------
Q1AYI9_RUBXD/56-206..ASN.....................R....................SPLL..SD..N.T.L------------------
Q1DDI4_MYXXD/252-411..LF...........................................AASP..DE..V.Y.H------------------
Q1ILV2_KORVE/234-378..FIVN..................D.R...................VLLRL..AD..P.S.S------------------
Q1YYW0_PHOPR/196-339..LVLG..................I.SP..................DAWTN..IR..T.T.D------------------
Q1ZNU5_PHOAS/174-338..I...............................................G..KD..P.T.L------------------
Q1ZRU2_PHOAS/204-332..V..............................................KT..HG..A.S.I------------------
Q21E31_SACD2/194-335..YQQ..........................................VKES..RP..G.S.T------------------
Q28JD9_JANSC/245-398..IVPTE...............RLV.QWA................EVISDD..RA..R.S.L------------------
Q2BHJ7_9GAMM/226-360..I..............................................GA.VGG..S.T.S------------------
Q2BJE6_9GAMM/185-324..F..............................................ETLSAD..P.S.L------------------
Q2G3B0_NOVAD/227-366..IPV...................L.I....................RYTL..DP..A.T.G------------------
Q2J607_FRASC/297-440..FAA...................R.A...................TETSS..ST..S.S.G------------------
Q2SZV7_BURTA/211-393..ASAATASAS........SAARDI.TVAGQRV........YVPGELNALG..DT..L.S.S------------------
Q2T8A3_BURTA/218-368..LAST..................Q.D...................VGSSG..SL..S.S.M------------------
Q31EZ8_THICR/228-358..LI...........................................LLKL..SS..Y.S.F------------------
Q323H8_SHIBS/204-353..IQNS.................YS.SI.................DYSAFT..KL..S.T.L------------------
Q3B1S6_PELLD/212-351..I..............................................QS..GL..F.S.D------------------
Q3B349_PELLD/225-374..SWDGT...............NLT.NYI...............AEKISPA..RA..Q.S.L------------------
Q3MDE5_ANAVT/319-465..LAS..........................................RWEA...S..P.P.Q------------------
Q3SHZ0_THIDA/269-434..LVQE..................A.TK..................WGVIG..HS..A.I.Q------------------
Q47Z28_COLP3/217-358..LSNS..................Y.A...................DIKAS..RP..E.S.T------------------
Q489C9_COLP3/205-331..I...............................................S..ND..N.S.T------------------
Q48BJ9_PSE14/208-357..PDA...................Y.A...................VSSGG..SL..A.S.L------------------
Q48GU3_PSE14/246-383..L..............................................FT.SDD..A.S.T------------------
Q4BV80_CROWT/224-377..FLDL..................L.SS..................VISEQ..RL..S.S.L------------------
Q4BWG3_CROWT/286-429..V..............................................DE..RI..A.N.F------------------
Q4K0H9_STRPN/184-332..I...............................................N..NS..E.S.Y------------------
Q4K0J9_STRPN/274-404..F..............................................SQVSSY..G.S.I------------------
Q4K1F3_STRPN/210-359..L..............................................NL..TD..S.S.A------------------
Q4K1K2_STRPN/189-336..IVLPDN..............LYT.FFNV..............TKALSYE..NR..T.E.F------------------
Q4K1M0_STRPN/192-329..F..............................................NS..RT..G.S.N------------------
Q4K247_STRPN/183-329..L..............................................QY..FD..F.T.F------------------
Q4K368_STRPN/165-325..LY...........................................RYGL..AD..G.S.L------------------
Q4VKA1_ECOLX/188-325..IES.....................Q....................YRGL..NT..Y.T.A------------------
Q5LE47_BACFN/193-320..L..............................................E...SD..P.S.T------------------
Q5LV52_SILPO/257-406..IGVIPL..............DAI.LER...............AAAISAE..RA..Q.S.L------------------
Q5P6V0_AROAE/255-405..VDN...................L.L....................LKKL..DG..G.S.A------------------
Q608R5_METCA/228-368..ASVG..................R.E...................NAKDE..NQ..E.T.A------------------
Q64W31_BACFR/208-352..FDI...................V.I....................LSKF..DS..T.S.F------------------
Q6AGK0_LEIXX/192-346..I..............................................DLLNAR..A.D.F------------------
Q6HMT7_BACHK/204-392..MSIHLQMYEYK...KSVQEEKDR.KEGKVVQEE....EHKQGELTDSEM..KS..L.I.Y------------------
Q6LNR9_PHOPR/191-336..LNTVL................VA.LE.................HLQSGG..VD..S.S.T------------------
Q72TC9_LEPIC/257-406..L..................................................VG..P.V.D------------------
Q7NDJ8_GLOVI/213-360..F.............................................DDL.LVS..G.A.V------------------
Q7NF12_GLOVI/242-388..VGT...................V.E...................AANDF..RA..G.S.T------------------
Q7NII4_GLOVI/245-399..LRQTPI.............FNGQ.FDVN.............SAVHLASV..QN..N.S.F------------------
Q7NJN7_GLOVI/229-378..VQS..........................................TDNF..RK..E.S.T------------------
Q7UF14_RHOBA/228-394..LRLLESD............ANEH.KRAAV............LVVDDQQV..VY..T.G.T------------------
Q858F4_BPE15/191-337..IN...........................................QGQ...LS..D.G.M------------------
Q8GM97_STRTR/177-346..LFV.....................R....................VSGS..LD..A.G.E------------------
Q8KN07_9ACTO/187-328.................................................EE..NF..S.S.L------------------
Q8KQ17_PSEAI/199-335..L.............................................MFG..MR..S.G.L------------------
Q8PRB5_XANAC/237-377..V..............................................NF..RD..G.S.T------------------
Q8YT85_NOSS1/260-405..F..............................................SNLEDD..D.S.A------------------
Q92U08_RHIME/208-361..L..............................................G...ID..A.T.F------------------
Q9ALX1_STRAG/186-328..I..............................................HY..RF..Q.S.S------------------
Q9RJJ8_STRCO/187-328.................................................EE..NF..S.N.L------------------

PF04932

A4CI06_ROBBH/191-347.............GF--RE.L----------.IW------D--CTA---H-VI--------EA------------N.P--
A3GY30_VIBCL/171-330.............GG--RL.Q----------.LW------Y--AAV---E-AF--------KH------------N.P--
Q4UYH3_XANC8/219-372.............SG--RA.Q----------.IW------G--AAL---C-MI--------RE------------H.P--
A4TX99_9PROT/241-386.............GD--RP.N----------.LM------R--LTW---I-AI--------GD------------A.P--
A3DIW4_CLOTH/315-453.............QT--RV.K----------.IL------Q--TVE---P-MF--------KH------------Y.M--
Q89PW4_BRAJA/213-357.............TE--RT.F----------.IW------H--YAI---S-HF--------DD------------A.P--
A5LYT8_STRPN/187-326.............NG--RY.Q----------.IW------R--IVY---A-TI--------LQ------------V.K--
Q7UXE7_RHOBA/267-417.............EL--RP.L----------.LA------L--VAY---E-MF--------LD------------R.P--
A2TSG4_9FLAO/201-377.............GI--RS.L----------.YY------K--MAM---D-DF--------KR------------S.P--
B1Z898_METPB/188-338.............RA--RV.A----------.IA------Q--SFG---A-AV--------AQ------------A.P--
Q7UWZ2_RHOBA/233-380.............DG--RL.L----------.HW------Q--DGW---N-AA--------MA------------YLP--
A0PZ10_CLONN/222-380.............IT--RF.T----------.SQ------K--ISL---D-LG--------IN------------N.F--
Q7UPJ9_RHOBA/331-474.............RY--RF.Q----------.YW------D--ATW---R-LV--------EY------------S.P--
Q97ER0_CLOAB/210-348.............DN--RW.I----------.KW------Q--VAI---E-YI--------KK------------Y..--
A4AI36_9ACTN/211-357.............TY--RL.R----------.VW------R--QLW---S-LG--------EI------------H.R--
A7VGX9_9CLOT/231-488.............NY--RG.Y----------.VW------N--RLF---R-IY--------QD------------L.P--
A0K2I1_ARTS2/235-362.............KS--RT.D----------.SY------D--VVS---S-FV--------EM------------N.P--
Q1ZI48_9GAMM/245-403.............SG--RV.I----------.AW------P--LVW---Q-KI--------VE------------A.P--
A4XML1_CALS8/220-429DKIKSISFKDRNFVE--RL.V----------.FY------K--DGL---K-IF--------LK------------S.P--
Q2BFT2_9BACI/241-418.............TG--RL.F----------.IV------N--KGF---E-IF--------KD------------H.P--
Q0G5C8_9RHIZ/213-362.............TG--RT.D----------.LW------R--FTL---D-LM--------RP------------Q.Q--
A3EK85_VIBCL/216-360.............ES--RD.D----------.VV------R--DAL---H-AI--------QE------------R.P--
Q7NQD3_CHRVO/200-367.............AR--RF.A----------.EM------H--KAW---L-AF--------KA------------H.P--
Q7MVK6_PORGI/277-409.............GE--RM.Q----------.MR------D--IAM---D-AI--------NR------------H.P--
Q5FQI9_GLUOX/196-353...............--...E----------.IY------T--HAV---V-MA--------QA------------H.P--
A3XRK0_LEEBM/177-345.............VT--RL.S----------.IW------K--SSL---E-VA--------LE------------H.P--
RFC_SALMU/185-325.............QG--RI.D----------.MA------I--NSL---N-FL--------SE------------H.P--
Q98C91_RHILO/186-337.............TG--RT.Y----------.LW------E--QGW---N-AA--------QR------------S.P--
Q12C32_POLSJ/166-320.............GL--RL.H----------.FW------M--NSI---Q-MI--------AR------------H.P--
Q0SYF1_SHIF8/194-338.............SY--RYAN----------GTQ------G--SAL---D-LI--------LE------------N.P--
Q9X4C1_ECOLX/176-341.............ID--RLYY----------.LW------P--RAF---D-NF--------IH------------S.P--
A0ZHE8_NODSP/234-386.............NF--RR.N----------.VW------D--AVF---E-MI--------RD------------F.P--
Q7V9G4_PROMA/203-353.............AT--RI.F----------.QW------K--DAI---A-LF--------YQ------------K.P--
Q6ABG2_PROAC/212-358.............AV--RT.T----------.LL------A--WGL---A-LV--------ME------------Y.P--
Q609Q8_METCA/225-373.............SN--RV.D----------.LY------D--YAV---P-YV--------LD------------YLP--
A4ISY3_GEOTN/200-391EATQDEETTNRAVVS--RV.T----------.LW------K--TGW---V-MM--------KE------------N.P--
Q7UKM5_RHOBA/239-382.............TG--RT.E----------.IW------A--EAI---R-FI--------AQ------------R.P--
Q2T0U3_BURTA/206-363.............AP--RL.A----------.LW------K--YGL---T-MF--------RE------------H.P--
Q01XB1_SOLUE/184-329.............QF--RV.V----------.CR------R--AGW---A-IV--------KQ------------H.P--
A0Z5U1_9GAMM/194-332.............GL--RE.A----------.LF------E--QGV---N-AF--------LA------------T.P--
A4AAF7_9GAMM/171-307.............LE--RR.R----------.IY------A--ELL---L-QL--------WE------------S.P--
Q9X5H1_HELPX/195-362.............GW--RL.E----------.RW------K--EAL---T-VL--------RL------------R.P--
Q6ASB4_DESPS/185-338.............SL--RI.A----------.WQ------I--NSL---K-LI--------AE------------A.P--
Q4JZ62_STRPN/213-343.............TI--RF.D----------.DY------K--AGF---L-AW--------QK------------S.P--
Q11T24_CYTH3/244-416.............ME--RL.N----------.RW------S--SAI---R-MI--------KD------------K.P--
Q6MI87_BDEBA/207-358.............AS--RW.E----------.EV------E--RGS---Q-IF--------LQ------------Q.P--
Q8AA03_BACTN/192-346.............NG--RL.F----------.IW------K--TTC---K-VI--------AN------------K.P--
Q1J334_DEIGD/252-413.............RW--RL.N----------.WW------N--DIV---N-YT--------VH------------G.P--
A5UWM4_ROSS1/288-436.............DA--RL.L----------.LW------R--EAL---V-YL--------RQ------------N.P--
Q4K127_STRPN/198-353.............MA--RT.D----------.LW------K--GVE---S-TY--------NF------------A.P--
A6GZ05_FLAPJ/236-385.............SG--RE.E----------.II------G--SEF---D-MF--------LA------------N.P--
A5G2R8_ACICJ/202-340.............NE--RM.T----------.VW------R--DAF---G-IA--------LH------------N.P--
Q5NZI1_AROAE/256-398.............DA--RW.P----------.IL------D--ATL---E-AA--------SA------------FFP--
A7Z9C6_BACA2/261-409.............LA--RA.N----------.LL------K--NAF---H-YV--------ID------------S..--
Q9RZA8_DEIRA/165-323.............SG--RE.Y----------.VW------Q--DAV---S-GW--------ET------------S.P--
Q89SN4_BRAJA/265-409.............PQ--RI.A----------.AY------Q--ASL---G-II--------AD------------H.Q--
Q9ZIT0_ECOLX/196-350.............GA--RL.A----------.MY------E--VGL---K-TY--------S.------------..P--
A4ND37_HAEIF/179-336.............GA--RF.D----------.MW------E--NAL---I-AI--------KE------------A.P--
O06944_SYNY3/232-381.............AY--RL.I----------.NF------E--IGW---R-MG--------SA------------H.P--
A5UY10_ROSS1/144-293.............AD--RL.A----------.VY------R--NSF---F-LA--------LD------------F.P--
Q9AQJ1_STRAG/174-309.............ES--RF.S----------.LY------K--DTV---H-SV--------IT------------DSL--
Q65SG0_MANSM/195-350.............GY--RT.E----------.IY------T--TFL---D-NF--------KI------------..L--
Q832Q1_ENTFA/206-388.............NS--RF.A----------.LW------Q--SAI---D-LM--------KL------------N.P--
Q83VQ8_9PROT/239-380.............AW--RK.Y----------.LW------D--SAL---H-WM--------QV------------SKY--
Q97EP1_CLOAB/208-365.............LL--RK.Y----------.YW------I--SFI---N-LF--------RR------------N.F--
A7BD98_9ACTO/223-370.............SG--RS.V----------.IW------H--AVA---P-LV--------RQ------------R.P--
Q220X5_RHOFD/200-337.............MG--RI.E----------.AW------K--MTI---N-LA--------NR------------H..--
Q04RV1_LEPBJ/208-370.............SG--RT.F----------.IW------D--STF---P-LI--------RD------------N.F--
A6F4Q1_9ALTE/139-270.............SW--RP.A----------.IW------M--STL---D-SI--------GS------------A.P--
Q09DA3_STIAD/195-349.............RG--KV.E----------.LW------P--MMA---E-AA--------WA------------F.P--
B9LD61_CHLSY/273-406.............QM--RL.D----------.EY------A--NAI---A-II--------QR------------Y.P--
A4B946_9GAMM/214-357.............VQ--RM.L----------.YW------T--NGI---D-MI--------AD------------H.P--
Q8RNK4_KLEPN/160-294.............GL--RL.S----------.IW------H--HTL---S-EM--------AS------------Q.P--
Q72XI7_BACC1/178-330.............NI--RA.N----------.MI------D--MGL---D-WF--------QE------------R.P--
Q2BRH4_9GAMM/186-340.............DI--RA.E----------.YY------I--LSF---L-TF--------LQ------------N.W--
A6D015_9VIBR/218-369.............DI--RA.T----------.IY------S--QSI---D-ML--------IE------------K.P--
Q1MQ48_LAWIP/199-337.............DP--RI.E----------.LW------I--RAI---E-VG--------KE------------H.L--
P74814_9SPHN/322-468.............DG--RH.E----------.QI------R--MGL---P-KL--------AM------------R.P--
Q2N6C0_ERYLH/230-383.............GI--RQ.E----------.AL------P--TIL---D-MI--------RT------------YFP--
A6QBN3_SULNB/185-344.............GM--RV.A----------.MY------I--VAA---D-II--------KD------------H.P--
A6M2N6_CLOB8/242-531.............SS--RG.Y----------.IW------S--RSL---P-LI--------KN------------T.M--

PF13425

C6IFG7_9BACE/266-414-------------QL..RV.D..........N.R......K..KMR...E.LM........IH....K........-P..
A0LW89_ACIC1/221-359-------------QN..RL.G..........D.Y......A..AAG...Y.YI........SR............D-P..
A0YRC8_LYNSP/311-457-------------VS..RW.E..........A.S......P..PTA...F.IA........EQ....FEHSTGRQE-G..
A0YY08_LYNSP/334-480-------------VS..RW.NASP...PAEFV.T......E..QAE...W.TV........RK....H.......Q-G..
A0ZBK6_NODSP/316-462-------------VD..RV.ESAPPEQFIAQQ.F......E..ENW...R.NV........VS............P-...
A1BHF5_CHLPD/216-365-------------QF..RF.D..........N.E......A..ILI...D.KA........RQ....G........-T..
A1KBI4_AZOSB/182-311-------------SY..RL.D..........I.W......A..DAL...R.RV........LA...DC.......N-A..
A1VT05_POLNA/222-357-------------VT..RV.D..........H.W......D..SLL...N.LF........LE....N........-PSY
A1WA83_ACISJ/201-342-------------SS..RQ.L..........A.I......H..GAW...N.QF........LS....S........-P..
A1YVC7_LACJH/222-358-------------SGFSRK.R..........D.Y......I..NSF...I.AW........IN....Y........-P..
A1YZN9_PSEAI/186-321-------------NE..RS.R..........I.A......S..EGL...N.KI........ME....S........-P..
A1ZS85_9BACT/258-408-------------QV..RL.A..........N.Q......R..KLS...N.YL........AS....R........-P..
A2CCT3_PROM3/195-349-------------SH..RL.EA.......ALC.W......L..SAM...F.TG........HN....R........-F..
A2SDP8_METPP/225-368-------------YI..RY.IAP......FRV.I......A..DTM...M.SD........AW....S........-F..
A2WDK3_9BURK/260-410-------------DD..RN.K..........F.Y......A..TFA...E.TA........FT............D-...
A3F4D2_LACLC/174-305-------------SG..RL.A..........L.Y......Q..EIY...S.TF........GI............H-L..
A3HV81_9BACT/249-392-------------VG..HV.V..........E.W......L..LAL...D.SM........VG....N........-P..
A3IMI1_9CHRO/286-429-------------VQ..RW.QYAP...PHEFI.A......K..QIQ...W.LT........HD....R.......I-T..
A3IUA7_9CHRO/225-379-------------EF..RL.E..........N.E......E..LLV...Q.KA........LE....R........-P..
A3K8X9_9RHOB/235-384-------------RF..RF.M..........N.E......N..TLL...D.RA........YL....K........-P..
A3KU19_PSEAI/248-385-------------EV..RF.D..........E.Y......R..MFP...K.AV........AR....Y........-P..
A3P2Q6_BURP0/171-296-------------SD..RV.E..........N.V......A..TIA...R.VA........GD....N........-...
A3SPZ3_9RHOB/245-394-------------AY..RF.N..........N.E......T..ILL...E.RA........QE....K........-L..
A3V694_9RHOB/192-341-------------LK.ARF.D..........H.W......R..VLQ...E.RV........AG....FTL....LQ-Y..
A3W1Y4_9RHOB/173-312-------------WT..RI.A..........T.N......Q..FGW...A.SV........WT....Y........-P..
A3WFB0_9SPHN/222-363-------------YN..RV.L..........I.W......K..YGS...Q.NV........AE....N........-P..
A3XD73_9RHOB/304-453-------------GY..RF.D..........N.E......A..MML...G.RA........AE....K........-P..
A3Y9Z7_9GAMM/195-353-------------SN..RY.E..........Q.I......V..FVI...D.NI........DI....I........-P..
A3ZP84_9PLAN/227-386-------------KN..RG.H..........F.L......E..DTI..NK.QI........PQ....Y........-P..
A4AEK4_9ACTN/190-334-------------SS..RT.I..........A.W......Q..AVF...S.VP........MD....TW......H-K..
A4EDX8_9RHOB/194-345-------------TG..RT.I..........I.W......E..GVF...I.AL........GG....N........-V..
A4EWL1_9RHOB/245-394-------------GY..RF.H..........N.E......A..LML...E.RA........AE....K........-P..
A4F0R9_9RHOB/216-356-------------SI..RQ.R..........L.F......E..YGT...E.QI........GK....T........-P..
A4TXA3_9PROT/212-353-------------IG..HF.E..........A.L......Q..RNL...E.EL........GD....V........-A..
A4XMK9_CALS8/198-350-------------QA..RV.Q..........S.W......S..SAK...H.YI........GM....S........-P..
A4YQ66_BRASO/187-322-------------SG..RD.D..........L.W......Q..HSL...E.AI........AE............H-P..
A4YX51_BRASO/206-352-------------SGWARF.IS.......MFR.V......L..RGV...V.FA........TD....A.......T-F..
A5CP65_CLAM3/221-356-------------DY..RG.D..........L.Y......R..LV..............................P-...
A5EAQ5_BRASB/235-388-------------KF..RF.D..........Q.E......E..QLL...Q.HA........GE....R........-L..
A5FL57_FLAJ1/219-339-------------GG..RI.L..........Q.I......R..KV................ND....I........-T..
A5FL58_FLAJ1/161-315-------------SS..RY.T..........L.C......F..CSL...K.VI........TD....S.......H-...
A5G2F5_ACICJ/218-369-------------SN..RN.L..........I.W......P..YFE...A.AL........AR....S........-P..
A5GEM1_GEOUR/220-381-------------EY..RR.S..........H.L......I..SSA...N.II........FE............H-P..
A5GQB5_SYNR3/178-326-------------TG..RL.A..........I.A......QCYGAI...P.FS........GN....N.......R-F..
A5PAQ9_9SPHN/298-451-------------MA..RE.E..........Q.V......D..MGM...P.MI........WS....Q........-P..
A5V8X2_SPHWW/271-405-------------LY..RL.E..........L.V......T..GVP...R.AL........GH....G........-V..
A5ZV75_9FIRM/172-330-------------TN..RD.Y..........I.Y......T..ACV...E.YI........RG....R........-V..
A6BIH2_9FIRM/191-358-------------LN..RL.T..........A.V......Q..KIY...S.MF........FR....GDR....VH-S..
A6CBU1_9PLAN/250-380-------------HD..RI.L..........L.W......R..EGL...T.AL........KS....P.......D-L..
A6DE00_9PROT/193-358-------------GT..RI.N..........Q.M......L..ETF...E.VF........LK....S........-P..
A6DFC8_9BACT/220-366-------------DI..RY.K..........L.F......A..TVP...N.IV........KE....F........-P..
A6DMP1_9BACT/236-371-------------IV..RG.E..........Y.A......R..VSL...E.MF........QE....K........-P..
A6DZI5_9RHOB/235-384-------------RF..RL.D..........N.E......D..ILM...E.RA........LE....K........-P..
A6E8K4_9SPHI/180-325-------------YN..RS.G..........L.V......E..ENL...R.IY........LD....Y........-P..
A6ETG3_9BACT/167-314-------------RM..NA.T..........Y.A......D..RGY...D.RL........FE....F........-PEY
A6F673_9GAMM/263-423-------------SA..RM.E..........L.L......S..SIV...S.GL........DD....N........-V..
A6FK24_9RHOB/260-408-------------NY..RL.N..........N.E......D..ILL...A.KA........SQ....K........-P..
A6L5V9_BACV8/222-366-------------SG.MRL.E..........Q.W......G..SIL...W.AF........EQ....N........-E..
A6L7F9_BACV8/212-352-------------SA..RN.D..........V.L......N..DNL...C.FL........NY....DI.....PN-I..
A6LGX1_PARD8/196-333-------------QT..RV.D..........R.I......N..FAM...D.SF........IR....S........-P..
A6N385_ARTOX/264-390-------------.....S.D..........G.L......L..SGF...M.LG........LQ....S........-P..
A6UIW2_SINMW/253-393-------------WS..RN.L..........I.W......E..VGW...V.SV........SN............H-P..
A6WE97_KINRD/230-374-------------AY..RV.L..........V.W......E.RDFL...P.LL........RQ....A........-...
D7HGD2_VIBCL/212-351-------------IG..RF.N..........I.M......I..YKF...K.HV........GF.............-...
A7AHI1_9PORP/175-336-------------TI.ARF.V..........L.Y......T..TSI...Q.IL........ID....Y.......F-P..
A7B4B5_RUMGN/180-334-------------SQ..RL.S..........F.S......K..KGM...E.VY........GF....S........-...
A7B9B7_9ACTO/214-354-------------ED..RA.S..........N.Y......V..ETL...Y.EL........QQ....S........-P..
A7BWS2_9GAMM/221-377-------------AY..RF.E..........L.Y......I..TYG...Q.IV........LE....R........-A..
A7GLQ7_BACCN/204-397-------------SD..RD.K..........F.L......K..VYQ...R.YY........KE....A........-P..
A7IL98_XANP2/205-360-------------AD..RI.N.........NT.W......Q..QPF...E.TV........AE....L.......F-P..
A7JJ42_FRANO/186-334-------------YN..RF.T.........DL.P......A..KNI...E.YF........NA....SF.....FN-Y..
A7JMT4_FRANO/187-383-------------GL..RL.M..........Y.Y......D..SAI...K.VF........EK....Y........-PKL
A7M5X5_BACOV/176-343-------------S.................I.L......S..NLW...V.AS........QA....P.......M-R..
A7NGA7_ROSCS/365-564-------------RV..RW.L..........I.WFGDDKAG..GAA...A.LI........RS............D-P..
A7V9S7_BACUN/180-319-------------GG..RI.D..........R.L......M..IVG...S.KL........LD....Y........-P..
A7VV00_9CLOT/206-361-------------RY..RI.G..........LSF......R..ILG...D.SF........WN....Y........-W..
A8GC50_SERP5/204-356-------------FI..RV.Q..........Q.H......N..DIF...N.DV........EK....S.......S-L..
A8LUD1_DINSH/214-355-------------YW..RT.I..........I.F......D..YGM...L.NV........WA....N........-P..
A8LXZ5_SALAI/235-376-------------SD..RL.S..........L.Y......A..EVL...R.RV........GE....S........-P..
A8RK65_9CLOT/197-346-------------GG..KI.S..........I.F......T..NLI...K.QM........QP....W.......N-Y..
A8RKN0_9CLOT/193-357-------------GG.IRK.L..........I.V......D..RGG...E.KI........LY....Y........-PEY
A8RSJ4_9CLOT/221-350-------------TG..RA.E..........V.W......S.RISS...K.GI........KF....F.......H-F..
A8SGY7_9FIRM/208-357-------------NVVSRQ.N..........S.P......L..INL...K.IF........SN....Y........-P..
A8U9G8_9LACT/218-351-------------YF..RI.I......................RSW...D.YV........NM....E.......H-I..
A8UCK5_9LACT/210-361-------------SA..RF.Q..........R.Y......T..LSI...D.AF........KN....N........-V..
A8YA87_MICAE/331-478-------------NS.PPT.A..........F.I......Q..EQL...D.FA........IR....NQ......G-G..
A9A0Y0_DESOH/253-403-------------TG..RI.D.........KI.W......L..PLI..TE.RL........RD.............-PSA
A9CEI7_AGRT5/239-386-------------IF.ERL.E..........S.L......G..YGI...Q.VA........LH....N........-P..
A9E2E9_9RHOB/245-394-------------SY..RF.M..........N.E......E..QLL...S.RA........AE....K........-P..
A9EBQ8_9FLAO/78-235-------------SG..RK.N..........L.S......L..MYI...D.YL........LT............H-V..
A9ETU3_SORC5/228-355-------------NE..RT.E..........I.L......G..EGL...N.IY........RM....F........-P..
A9GB69_9RHOB/245-394-------------GF..RF.T..........N.E......A..LML...D.RA........AD....K........-P..
A9GIB7_SORC5/278-406-------------GE..RV.E..........L.L......R..EAF...E.LI........RR....T........-K..
B0CE59_ACAM1/222-374-------------NF..RL.E..........N.E......Q..ILS...A.KA........RI....R........-P..
B0CEF6_ACAM1/212-353-------------NI..RQ.E..........L.Y......N..TYF...D.SA........IS............Q-...
B0JPJ8_MICAN/292-437-------------SS..PI.D..........F.V......V..NQI...Q.WA........LR....Y.......L-Q..
B0KB87_THEP3/245-390-------------QE..RL.Q..........G.F......L..NGL...N.LF........IN....Y........-P..
B0M993_9FIRM/208-351-------------LG.SRI.P..........I.W......K..MAI...E.KI........KE....N........-P..
B0M9A4_9FIRM/196-348-------------SP..RL.I..........L.F......K..DGL...K.LM........LS............H-F..
B0N359_9FIRM/240-375-------------SN..RL.E..........L.I......I..ESI...P.VI........FN....N........-L..
B0T732_CAUSK/201-343-------------DA..RL.N..........I.W......T..FAA...D.HI........QN............H-P..
B0TYH5_FRAP2/172-367-------------GL..RL.L..........Y.Y......S..SSF...K.VL........RE....Y........-PKL
B0ULV1_METS4/257-396-------------RE..RL.E..........Q.Y......L..VLW...N.QP.........D....S........-G..
B0V6K1_ACIBY/174-325-------------GG..RN.E..........V.W......D..AI................ID....N.......S-L..
B0VGS8_CLOAI/260-411-------------LA..RL.T.........ER.G......P..RVM...S.EF........YK....S........-P..
B1C0Q0_9FIRM/182-328-------------EY..RK.E..........S.L......F..KTI...E.EA........YK....Y........-P..
B1FZC5_9BURK/272-424-------------AA..RN.E..........F.Y......A..TFA...K.TA........FT............D-...
B1R2U0_CLOBU/208-343-------------SG..RN.E..........T.W......D..KI....Q.MM........GL....Y........-P..
B1RNR5_CLOPF/189-330-------------IL..RF.Y..........K.G......F..IVF...K.SLD......FKE............K-...
B1WSH8_CYAA5/286-429-------------IQ..RW.QYAP....PYEF.I......A..KQI...Q.WL........SH....D.......R-I..
B1X0A2_CYAA5/338-485-------------AS.PPY.L..........F.I......Q..QQF...D.YA........IR....NQ......K-G..
B1Y725_LEPCP/205-349-------------SW.HRA.A..........L.I......E..AAI...D.HL........PQ............W-W..
B1ZT82_OPITP/197-358-------------VG..RI.L.........GG.F......T..QPF...Q.WA........AN....A........-P..
B2AHI9_CUPTR/221-375-------------GE..RV.G.........TM.F......L..GES...E.AY........AK............P-T..
B2ILP9_STRPS/194-329-------------AT..RF.R..........V.Y......E..ESL...K.AI........NG....M.......E-M..
B2J995_NOSP7/327-473-------------TG..RW.EA.......SPP.Q......D..FIV...Q.QF........EE....NWKN..VDG-P..
B2JKN4_BURP8/242-388-------------IE..RM.S..........W.N......T..QGM...T.NF........LE....T........-Y..
B3C6G3_9BACE/158-317-------------LG..RL.F..........L.W......K..ITC...R.AV........VN....Y........-P..
B3DZJ9_METI4/232-389-------------IF..AI.E..........R.I......E..ADL...V.RF........IE....NMD....FV-P..
B3EF24_CHLL2/226-378-------------QF..RF.D..........N.E......T..ILI...D.KA........LQ....G........-T..
B3Q3Q8_RHIE6/200-358-------------EG..RL.V..........L.S......V..YGS...M.LF........FY....R........-P..
B3QV51_CHLT3/220-371-------------TG..RD.G..........M.W......K..SIM...E.SF........YQ....G.......S-V..
B3W8Q4_LACCB/236-408-------------SS..RF.V..........L.L......S..DAM...D.IV........KS....ESA....VG-V..
B3WWQ6_SHIDY/179-312-------------ES..KF.M..........L.L......N..KFL...T.TF........QE....RNF....TE-L..
B3ZZ03_BACCE/196-346-------------NT..RT.Y..........I.W......S..SAW...S.EF........LT.....HES..LKT-W..
E0UAN3_CYAP2/223-375-------------EF..RF.K..........N.E......E..LLI...A.KA........RQ....R........-M..
B4D1K5_9BACT/198-355-------------VM..RF.A..........QDF......I..AAG...G.S.........LS....R.......A-P..
B4SDC8_PELPB/170-319-------------QENSRY.G..........V.M......E..RGF...K.QI........FQ....R........-...
B4SFN3_PELPB/228-374-------------QF..RF.D..........N.E......T..ILI...D.KA........LQ....G........-T..
B4VS49_9CYAN/220-377-------------SE..RI.L..........N.S......F..NVT...G.YF........QY....K........-Q..
B4VUT2_9CYAN/289-432-------------VD..RW.EASP....PPTF.M......L..DQF...K.WV........LS....RQ......E-G..
B5CP97_9FIRM/225-366-------------GS..RT.Y..........I.W......A..EGI...R.QI........LK....N........-P..
B5GZE0_STRCL/202-343-------------TG..RA.K..........V.W......D..ALLAEPR.TT........AE....R........-...
B5L3Q0_SHIDY/193-354-------------IA..IY.S..........N.L......Q..IAL...I.SL........SD....N........-L..
B5L3W7_SHIBO/182-338-------------NE..RF.E..........I.Y......T..SVF...S.FL........AN....NI.....DM-I..
B5QM83_LACRH/213-382-------------RS..RF.V..........L.L......T..DAT...K.II........EKGSIVN........-K..
B5VX91_SPIMA/313-459-------------VS..RW.N..........A.S......P..PTG...F.IS........DQ....FDHSSGGQQ-G..
B5VYV0_SPIMA/317-463-------------TG..RW.IASP...PPEFV.I......D..QTQ...W.TL........RN....S.......G-G..
B5Y6R2_COPPD/204-356-------------PG.GRI.Y..........Q.W......G..RAL...E.NVGILGGFKGIR............Q-L..
B6B6U9_9RHOB/187-338-------------TG..RF.V..........N.W......I..HLM...A.VF........QE....N........-W..
B6B8S8_9RHOB/245-394-------------NY..RF.E..........N.E......A..QLL...A.RA........AE....K........-P..
B6JES5_OLICO/169-318-------------YG..RF.G..........R.H......I..LGA...V.MT........LD....Y........-P..
B6VUA4_9BACE/257-407-------------MA..RF.E..........N.Q......K..ALN...A.YM........DE............M-P..
B6VYZ2_9BACE/224-375-------------GG..RT.E..........Q.L......T..YAF...Q.VI........DN....R........-L..
B7AH28_9BACE/205-353-------------ST..RF.L..........L.I......E..TII...D.TM........SNM.DIF.......T-L..
B7BDU4_9PORP/175-316-------------NG..RS.E..........I.A......L..QVF...Y.NF........LS....HSS...LSE-M..
B7J3X6_ACIF2/185-346-------------GL..RV.L..........M.A......Q..GAL...Y.MG........FQ............H-P..
B7K071_CYAP8/337-484-------------VG..RW.NNAPP..QAFIQ.E......Q..IAF...S.AE........QQ....R........-G..
B7K694_CYAP8/286-429-------------IG..RW.QYSPPQEFIAKQ.F......Q..WLF...N.YR........LE.............-...
B7RNS7_9RHOB/202-356-------------TG..RT.P..........L.W......A..LLD...I.EI........AK............H-P..
B8CL34_SHEPW/174-319-------------.....H.S..........F.W......E.ERGY...D.RI........YN....NY.....EY-L..
B8CL64_SHEPW/214-355-------------RV..RQ.E..........L.A......N..IAL...E.RW........AN....E.......A-I..
B8FWJ7_DESHD/228-369-------------QG..HM.D..........R.W......G..VAV...G.SI........SQ....S........-P..
B8G9F2_CHLAD/225-362-------------AD..RG.G..........L.W......Q..IGL...N.YF........FA....S........-P..
B8HEF1_ARTCA/210-341-------------DA..RA.N..........Q.L......D..VAF...G.LL..............N........-P..
B8HLI8_CYAP4/219-378-------------QN..RG.L..........F.L......D..TTI..RE.YL........PL....Y........-P..
B8HNC8_CYAP4/218-375-------------SS..RI.T.........GS.F......T..EIF...D.FA........RV....S.......D-...
B9D396_WOLRE/190-376-------------SG..RD.L..........I.L......K..ERL...P.LL........FA....S........-PR.
B9JKY3_AGRRK/181-340-------------TG..RT.Y..........L.W......Q..QGI...A.AA........TM............H-P..
B9XD26_9BACT/204-347-------------WH..RS.Y..........L.L......D..MAY...Q.HI........DK............W-W..
B9YBP1_9FIRM/190-362-------------GI..RT.F..........E.N......A..AVI...E.FM........KN....A.......S-F..
D7E0N9_NOSA0/308-454-------------IG..RW.NASPPHHFIVDQ.L......Q..ENW...K.SV.........D....T........-P..
C0C2D1_9CLOT/195-372-------------SG..RM.G..........I.W......I..EA......IS........KS....N........-...
C0CGX9_9FIRM/216-373-------------TG..RT.S..........I.A......E..TYF...E.WLS.....TDWK....Y........-W..
C0QGY0_DESAH/188-336-------------RF..HY.V..........V.W......L..GAW...K.MF........IG....S........-P..
C0VIY2_9GAMM/185-331-------------SD..RL.E..........N.L......F..LPL...G.GL........LA....S........-L..
C0WW30_LACFE/203-350-------------SY..RL.N..........Y.S......Q..MAL...S.LA........GS....DL......H-K..
C0ZT43_RHOE4/202-356-------------RY..RV.G..........I.W......N.NETV...P.AI........LD....S........-P..
C1A313_RHOE4/214-369-------------EE..RG.S..........G.W......S..STI...S.SL........FV............H-P..
C1AWF5_RHOOB/210-389-------------GF..RI.E..........V.A......K..AAA...EDMS........GA....N........-L..
C1AY50_RHOOB/263-416-------------LD..RL.N..........T.L......A..TSV...W.AV........RE....E........-P..
C1F0J2_BACC3/223-353-------------ID..RS.N..........F.F......M..EHL...S.YF........QD....S.......S-F..
D5UK63_CELFN/214-352-------------AG.ART.D..........A.F......R..FFA...E.TW........QD....Y........-P..
D7B6S8_NOCDD/245-400-------------DG..RA.A..........T.N......A..ASV...E.AA........HL....S........-P..
D5SX75_PLAL2/208-338-------------GE..RV.Q..........L.W......R..DGF...D.AL........KS....S.......D-I..
C2EPL4_9LACO/200-348-------------AA..RL.N..........G.I......E..YFY...G.LW........RN....S.......N-V..
C2H8B0_ENTFC/192-326-------------TG..RE.D..........I.W......H..KFY...Q.TL........GE....KS.....EQ-V..
C2JZS3_LACRH/195-345-------------SL..RF.S..........F.G......N..AIY...K.AY........GL....N........-...
C2MCR4_9PORP/284-433-------------GG.IRN.E..........L.L......Q..MSY...Q.AL........RE....I.......P-I..
C2NRN1_BACCE/206-352-------------ID..RL.S..........H.W......G..KNA...P.QI........NT....L.......E-G..
C2PN12_BACCE/193-346-------------ST..RD.I..........Q.R......E..SLL...S.II........DN....N........-A..
C2Q801_BACCE/208-396-------------SD..RD.K..........Y.L......K..VYK...Q.YY........KD....A........-P..
C2U9X7_BACCE/204-397-------------SD..RD.K..........F.L......K..TYK...Q.YY........KD....A........-P..
C2V7V1_BACCE/208-389-------------SD..RD.K..........F.L......N..VYK...Q.YY........KD....A........-P..
C2ZKF6_BACCE/208-401-------------SD..RD.K..........F.L......K..VYK...Q.YY........KD....A........-P..
C3GAX2_BACTU/276-404-------------PS..HL.K..........G.L......T..HNF...T.VI........AD....D........-P..
C3PKS4_CORA7/215-355-------------DD..RW.A..........L.Y......R..TTW...A.RT........LE....S........-P..
C3Q1B3_9BACE/197-337-------------ET..RL.T..........A.F......E..LFF................I....Y........-P..
C3R6E0_9BACE/193-346-------------SE..RL.G..........L.Y......K..DFQ...S.MP........VT....F........-...
C3WCW0_FUSMR/165-294-------------SG..RF.W..........L.F......D..YYL...N.NQ........EI....T........-...
C4RGH6_9ACTO/357-512-------------DI..RA.T..........L.S......S..GAV...E.AA........NH....S........-P..
C5BIC6_TERTT/235-383-------------LG.VRL.K..........N.E......D..ILL...D.KA........RE....R........-A..
C5E895_BIFLI/204-349-------------SN..RE.T..........L.L......E..VAL...P.TF........LK....SG......R-M..
C5RCC2_WEIPA/221-380-------------DN..RL.G..........G.T......I..ALI...R.TW........LQ............H-P..
D9RUY4_PREMB/174-313-------------FY..RA.F..........I.W......F..HFL...K.EI........AK....D........-P..
C6IJ43_9BACE/203-357-------------ST.DKL.N..........T.M......M..WVW...P.ED........VK....S........-W..
C6M735_NEISI/182-343-------------GY..RQ.E..........I.............Y...N.YF........WS....N.......P-P..
C6NU22_9GAMM/224-372-------------LI..RY.E..........E.W......A..HYS...G.IW........LN.....HG...VAT-M..
C6R555_9MICC/204-343-------------AL..RS.L..........I.D......Q..ASE...I.KV........QA....S........-G..
C6RIN3_9PROT/199-385-------------SG..RD.L..........I.L......K..ERL...P.LL........FA....S........-PR.
C6W3M0_DYAFD/200-366-------------MG..RV.S..........G.F......G..EFL...E.TL........YS....W.......D-I..
C6XK30_HIRBI/203-344-------------NG..RL.I..........I.W......S..GAF...V.EM........KD....N........-L..
C6XVP4_PEDHD/210-354-------------EN..RE.D..........R.V......M..NSL...L.IL........AN....SSI....PD-I..
C6Z207_9BACE/221-375-------------DG..RT.E..........Q.L......A..YAF...Q.AI........DN....R........-L..
C7G9J0_9FIRM/181-318-------------SG..RV.YIL.....GKYY.H......D..QGL...A.LL........PR....N.......Q-...
C7MGH4_BRAFD/211-348-------------GY..RT.D..........L.............L...V.LL........GQ....V........-R..
C7PAF8_CHIPD/260-410-------------NL..R..D..........V.N......R..HGI...Q.PY........MY....S.......H-P..
C7QQR9_CYAP0/223-379-------------GF..RL.E..........N.E......K..KLI...D.KA........LE....R........-P..
C7X6F7_9PORP/176-315-------------LT..RE.S..........L.S......I..FLL...D.GI........RE....N.......Y-F..
C7XAP2_9PORP/173-335-------------IA..RY.V..........L.Y......A..TSP...Q.IL........MD....Y.......F-P..
D6Z4J1_DESAT/222-373-------------AI..RL.L..........Q.E......D..LFS...Q.KA........LE....S........-P..
C8RXJ1_9RHOB/237-386-------------RF..RI.G..........N.E......E..QLL...A.RA........AE....R........-P..
C8S377_9RHOB/228-382-------------IS..RA.S..........Q.............Y...Q.LI........PA....E........-...
C8S4A7_9RHOB/262-400-------------SQ..RH.T..........L.F......G..LGL...E.KI........SR....N........-P..
C8XKU9_NAKMY/249-387-------------QH..RL.S..........D.T......A..TVV...Q.LF........ES....R........-P..
C9BIG3_ENTFC/192-327-------------TG..RE.E..........I.W......R..KFY...E.TL........GE....K........-...
C9LAR6_RUMHA/190-337-------------AG..RT.N..........T.I......P..FVY...H.NV........FE....N.......D-WMF
C9RMK5_FIBSS/201-340-------------DD..RL.FG.......PLA.Y......L..SAF...N.AW........EH............M-...
C9RPA9_FIBSS/198-362-------------SA..RL.H.........AR.Y......W..TSI...P.LI........TK....N.......N-S..
C9YZ01_STRSW/187-328-------------TG..RA.K..........V.W......E..ALL...A.AP........RT....TS......E-Y..
D0D9U9_9RHOB/235-384-------------EF..RF.D..........N.E......N..VLL...D.RA........YQ....K........-P..
D0TPJ6_9BACE/219-370-------------DM..RM.E..........Q.L......N..GCF...R.EI........QD....C........-L