Sequence alignment for CL0502

PF01740

SUT22_ARATH/540-662YPMANKTAGL....LTLRIS---SPLLCF-ANANF-IRDRILN--SV--------QE--IEGEENEQ.............
RSBRD_BACSU/161-267APIMPITDGI....GILPLV---GE.IDT-HRART-ILESVLE--QC--------SA--LK...................
S26A2_HUMAN/569-715YKNLQIKPGI....KIFRFV---AP.LYY-INKEC-FKSALYK--QT--------VN--PILIKVAWKKAAK........
O45016_CAEEL/553-725YETANDIPGI....KIFRFD---SP.IYF-GNSEM-FVRKIHQ--AC--------GL--NPLIVRGELETENKKKDARK.
SULP3_CAEEL/546-696KRDLERIQGN...VCIFRMD---AP.LIF-TSSDR-FTMSVWQ--CV--------KK--W.ERCKSESFVTIE.......
D6EY97_STRLI/11-115HLRVRHHRGH....TVLEFR---GE.IDI-ASAAE-IAPYLDR--ET--------GR--PG...................
O04001_SPOST/529-651YKDAQRIPGF....LILATE---AP.INF-ANSNY-LNERIKR--WI--------EE--ESSAQT...............
SUT32_ARATH/505-623YPQAITRSSL....LILHID---GP.IYF-ANSTY-LRDRIGR--WI--------DE--EEDKLR...............
Q55814_SYNY3/440-540QILRAANGRI....FMFHLS---GP.MSF-GAAKS-IARRLAI--VE--------NY--.....................
RSBV_BACSU/4-107NVDVKQNEND....IQVNIA---GE.IDV-YSAPV-LREKLVP--LA--------EQ--G....................
O69205_ACTPA/8-112AVVTVASDVVR.GVPVLRVA---GE.IDA-NVADE-VRRALLP--WL--------DG--L....................
P73609_SYNY3/4-107NIESEIINNA....AKLTLI---GE.LDG-GTAPL-FKEKIEE--VA--------QA--E....................
SP2AA_LYSSH/4-107QLEMVTRETV.....VIRLF---GE.LDH-HAVEQ-IRAKISA--AI--------FQ--GT...................
O84431_CHLTR/3-107NFQKEEQGQT....GILHLQ---GK.LDG-VSSPA-VQESISE--SL--------SN--G....................
P71568_MYCTU/15-120AIAVRTQDSV....VILTAD---GA.LDS-SSSAL-LRDSLTR--AT--------LE--QP...................
S26A1_RAT/529-685AAEFEGLLPPP.EVRVFRFT---GP.LYY-ANKDF-FLRSLYS--LT--------GL--DAGYSATRKDRGTE.......
P73607_SYNY3/2-105DIQINQQEDI....TVVTLS---GE.VDA-NTAPK-IHEVILP--LA--------EP--G....................
SP2AA_BACME/4-109SIELEFKQDV....LLVRLT---GE.LDH-HTAEE-LRSKITE--AI--------EK--ES...................
YVDB_BACSU/421-528VLAKREDPSV....SMYAIE---GP.LFF-GSIDS-LESSLLE--HV--------QK--KP...................
RSBV_LISMO/4-109SIEIKERDTD...HIDIFVA---GE.IDA-YTAPK-VKEALEV--YQ--------VK--EG...................
Q46665_ECOLX/332-437PVVVDVPDDV....LVLRVI---GP.LFF-AAAEG-LFTDLES--RL--------EG--K....................
S26A4_HUMAN/536-725YKNIEEPQGV....KILRFS---SP.IFY-GNVDG-FKKCIKS--TV--------GF--DAIRVYNKRLKALRKIQKLIK
RSBV_BACLI/4-107AVDTKKNDHV....IEVKVA---GE.IDV-HTAPA-LRDELMP--LA--------EE--G....................
O83261_TREPA/17-124KMNLQKIDDLE.GGVVVFLN---GY.IDT-YNSSF-FQKRIAK--VI--------DA--G....................
Y1364_MYCTU/550-649FVSLVESGRI.......VVR---GD.VDS-TTAAT-LDRQIAV--ES--------RS--GI...................
O67306_AQUAE/448-564NAEKRGLPECP.QIMFIRPN---MS.IYF-GNAQY-VYDYIMN--KV--------ED--ALFN.................
Q9Z6Z7_CHLPN/2-106NLSAKEYGDI....IVIYLQ---GS.LDA-VSVPS-VQEYLEQ--FI--------QK--K....................
SUT31_ARATH/514-633YPSSRTVPGI....LILEID---AP.IYF-ANASY-LRERIIR--WI--------DE--EEERVK...............
Q9Z6P5_CHLPN/441-545KAEVPQNTEI......YEIN---GP.FFF-GIADR-LKNLLND--IE--------KP--P....................
O17951_CAEEL/537-690YQETIFYKGI....CIFKFD---AP.LLF-HNVEC-FKKCIEK--VY--------DE--WKKSSEFNFVKEPNA......
RSFB_MYCTU/6-111SITVTVADHNG..VAVLSIG---GE.IDL-ITAAA-LEEAIGE--VV--------AD--N....................
SP2AA_BACLI/4-109GIDIHVKESV....LCIRLT---GE.LDH-HTAET-LRKQVSG--HL--------EQ--TD...................
Q55415_SYNY3/433-538RWLDEGNGRV....LLFQLS---GP.MIF-GVAKA-IAREHNA--IQ--------EC--.....................
SULH1_SCHPO/592-725NPNLTVRDPPA.GVLIFRLQ---ES.FTY-PNAGH-VNSMLTS--KA--------KT--VTRRGNANIYKKA........
O07728_MYCTU/29-135RAVTECTGSA....VVVHVG---GD.IDA-SNEVA-WQRLVSK--SA--------AI--AI...................
P72770_SYNY3/438-545HPENLVISGV....LIYRIN---GP.ILY-FNINN-IESDLFN--HL--------AQ--QQE..................
Q9Z841_CHLPN/3-107DIQKEEHGST....TIFHLH---GK.LDG-ISSPE-VQENISQ--SL--------AA--G....................
O07488_YEREN/391-488TSVLEGTSRT......YTVT---GQ.VFF-ASADR-FTSHFDF--RE--------AI--E....................
SUT33_ARATH/498-617YKEAQRIPGF....LVLSIE---SP.VNF-ANSNY-LTERTSR--WI--------EE--CEEEEA...............
P73474_SYNY3/396-498DRVLTEDENH....RIYNVS---GQ.IFF-VSKEE-FLEAFDF--DE--------LV--D....................
SP2AA_GEOSE/4-109AIDLEVKQDE....LIVRLS---GE.LDH-HTAEN-CMNKCRM--CL--------EK--RA...................
S26A3_HUMAN/526-716YYDMYEPEGV....KIFRCP---SP.IYF-ANIGF-FRRKLID--AV--------GF--SPLRILRKRNKALRKIRKLQK
SUT41_ARATH/519-638YPEAYTYNGI....VIVRID---SP.IYF-ANISY-IKDRLRE--YE--------VA--VDKYTN...............
O84770_CHLTR/2-106EWIAREYKNI....FIVSLK---GD.MDA-VTVPA-LEEFLTK--SI--------AK--GR...................
RSFA_MYCTU/18-124KATIQHHDSA....VIIHAR---GE.IDA-ANEHT-WQDLVTK--AA--------AA--TT...................
RSBRB_BACSU/147-272EMNAKQQLNAQ.REMILELS---SP.VIT-LSKST-ALLPLVG--DI--------DT--ERAKFILE.............
SUT1_STYHA/538-656YPKAAQIPGM....LIIRVD---SA.IYF-SNSNY-IKERILR--WL--------ID--EGAQRT...............
G2TL00_BACCO/4-109AIDLEVKKDV....LCIRLQ---GE.LDH-HTAES-LRASVTK--AI--------EE--NG...................
Y1739_MYCTU/443-553YPQAKRVPGL....VVYRYD---AP.LCF-ANAED-FRRRALT--VV--------DQ--DPGQVE...............
I6X4W0_MYCTU/31-137RATTDGSGAA....LLIHAG---GE.IDG-RNEHL-WRQLVTE--AA--------AG--VT...................
SP2AA_PAEPO/4-109QIEMEHHRGV....LIVRLS---GE.LDH-HTSDM-VRMQMDE--AI--------QR--RQ...................
SULX_YEAST/572-707SLDVEGTEEIE.GCMIVRIP---EP.LTF-TNSED-LKQRLDR--IE--------RY--GSSKIHP..............
SUT21_ARATH/548-668YPMTVKTPGV....LIFRVK---SA.LLC-FANAS-SIEERIM--GW--------VD--EEEEEEN..............
O83249_TREPA/5-107NIAKDVRPGC....VLLTVT---GA.VSS-YTYGE-FESRVHG--AL--------KE--.....................
PHOT_BACSU/148-254TPIVPIRNGI....SALPLV---GN.LTE-ERFNS-IVCTLTN--IL--------ST--SK...................
RSBS_BACSU/5-111KIPILKLYNC....LLVSIQ---WE.LDD-QTALT-FQEDLLN--KI--------YE--TG...................
O33206_MYCTU/385-486RKAKVTQDDT....GTYRID---GP.LSF-LSVDG-VFGSLRD--GR--------E.--.....................
RSBRA_BACSU/151-261APLIPVFENI....TVMPLV---GT.IDT-ERAKR-IMENLLN--GV--------VK--HR...................
SUT11_ARATH/518-636YPDAAQIPGI....LIIRVD---SA.IYF-SNSNY-VRERASR--WV--------RE--EQENAK...............
Y1081_THENE/1-106MFPYKIVEDV....VILMPN---KE.LNI-ENAHL-FKKWVFD--EF--------LN--KG...................
SUT3_STYHA/511-631YPMAVTTPGI....LVIRIS---SG.SLC-FANAG-FVRERIL--KW--------VE--DEEQDNI..............
SULH3_SCHPO/533-653STAVESAPRI....LVVRIP---EP.LFF-ANVSQ-LEDRLNR--LE--------KY--GHPRMHP..............
YG35_YEAST/657-777YVQTKFLDGIGEQIYVLKLQ---NL.LFF-GTIIS-IEEKIER--LL--------QI--SNKDA................
O33361_MYCTU/29-135QIRAYLHHLA....TVVTIR---GE.IDA-ANVEQ-ISEHVRR--FS--------LG--T....................
O83551_TREPA/4-108ELKVRQSGGI....CVVDIS---GD.MDL-YHSYK-LKDLVLK--LF--------DR--G....................
P73108_SYNY3/3-107SFNPQIVTRD.....VFYPQ---GT.LSA-AVTQA-FQADLAS--WL--------AT--TS...................
RSBRC_BACSU/163-272ELSAPVIVLFH.SVGLLPLI---GD.IDT-VRAKL-IMENTLH--QC--------AK--KK...................
Q40008_HORVU/530-648YPEATKVPGV....MIVRVD---SA.IYF-TNSNY-VKERILR--WL--------RD--EEEQQQ...............

PF13466

Q310Z9_DESAG/492-572----------------LQLA---GD-ITI.ERSAQ.LQEAFQE..AL........SR..Y.-------------------
B5HV30_9ACTN/31-112----------------LVLA---GP-VTR.DEVTE.LGDEVRA..LLR.....TTGA..G.-------------------
A9BX84_DELAS/2-83----------------LQLP---RE-LTY.RQARS.CLVQLRP..QV........QAFDG.-------------------
Q0K681_CUPNH/47-125----------------LSLG---TS-LTN.QNAAA.VLRDGLA..RL........AQ..G.-------------------
B5H529_STRPR/9-95----------------MHIT---GR-ITP.ADVPR.LCEELRH..LLRDDGTGGGA...P.-------------------
Q0RDC2_FRAAA/24-104----------------VRLV---GR-VDV.RTVGT.LRSLLHA..AI........DN..G.-------------------
D1AD83_THECD/187-267----------------LALS---GE-LDA.ARHAV.FGEALSQ..ALA......RAN..G.-------------------
D2SCD5_GEOOG/29-109----------------ITAA---GE-LDR.AVAHR.LSDALDA..LA........LT..G.-------------------
A1VK31_POLNA/2-82----------------LKLP---AV-LTH.AVASG.FFHTVAK..EVL......SLP..K.-------------------
A8ZVX1_DESOH/4-85----------------IVLH---GD-CLV.NRAEE.LHQLFCH..LL........KQ..S.-------------------
Q3SFW3_THIDA/281-359----------------VRLS---GE-ITP.ADDSA.LQQLSAH..AA........NH..N.-------------------
B9TGW9_RICCO/228-309----------------LSVS---GV-LDF.ETTVQ.LLAQGRE..WIE......SAA..P.-------------------
A1W422_ACISJ/2-83----------------LVLP---AE-LTH.RHAGA.TLRMLLQ..GL........KA..QD-------------------
A1U461_MARHV/15-95----------------LCVT---GD-VDA.DTVLA.LRKQGEQ..EIR......QAD..G.-------------------
Q21UA2_RHOFT/4-85----------------LVLP---QE-LTQ.RQATV.CLRALVQ..DLA......SLP..G.-------------------
B1Y2Z1_LEPCP/2-84----------------LSLP---ER-LTHVETPPT.LRSLFAEMDAL........PA..G.-------------------
Q8EEQ5_SHEON/14-91----------------VNLT---EE-LTI.YSVME.FRDALVG..HL........QP..G.-------------------
D2S5L7_GEOOG/30-110----------------VDLA---GH-LDR.RTVHL.LHDAIST..LL.......LTD..G.-------------------
A7MNS4_CROS8/14-91----------------LRLN---GT-LDR.ETLTP.LWEQRQ...SI........TD..G.-------------------
B9JTP2_AGRVS/23-100----------------LKLA---SV-LDL.NEASQ.LKDKLLS...M........RG..G.-------------------
B8DPA7_DESVM/571-651----------------LVLS---GE-VTI.ERGAD.LREALLD..VL........GS..F.-------------------
C6C1P3_DESAD/15-93----------------MNIS---GR-LDA.EGAGE.VWDKARA..AV........AA..G.-------------------
E3I167_RHOVT/14-94----------------LELE---GD-LRP.RDASA.LHEALLV..AL........SG..E.-------------------
E3IYM7_FRASU/24-104----------------IELA---GE-LDA.PGRRC.LRDQIAE..LL........GR..G.-------------------
C1D624_LARHH/5-83----------------LALP---SA-VTF.DEVSG.LLRNWLP..AV........RA..A.-------------------
A4YXB4_BRASO/320-399----------------LSLS---GP-ADA.RHVDR.AIPVFRS..AV........AV..R.-------------------
D1C014_XYLCX/37-113----------------IVLS---GE-IDA.DIGAE.LSEMSAE..AE........AT..G.-------------------
C6WD00_ACTMD/919-1001----------------LHLG---GD-LDL.DGVRA.LREFLLG..RVD......VAD..R.-------------------
E3J1T6_FRASU/56-136----------------LSID---GD-IDA.SVLPA.LVGTLAK..VA........HH..G.-------------------
C6WQ84_ACTMD/60-139----------------LHVA---GE-IDQ.LSAPV.LRGALDL..AL........KH..R.-------------------
Q2SPQ4_HAHCH/13-91----------------IKLP---GA-FSI.SSVEK.VYEQVNN..AP........AT..Q.-------------------
D2SFP4_GEOOG/531-612----------------VRAT---GA-VDM.LGAEQ.MRIRLLE..ASH......GGT..G.-------------------
D2B5R7_STRRD/72-150----------------LKVS---GD-IDR.TTRRL.WEEALDG..LV........TQ..G.-------------------
B8DLB2_DESVM/179-259----------------VRIR---GT-VNS.PAEPV.LRHVFEE..AL........LT..G.-------------------
D0KYU0_HALNC/26-108----------------VRVQ---GD-LLR.SSIES.LSDLSLP..MPD.....GQTP..G.-------------------
D5X3Z8_THIK1/566-644----------------LHLS---GE-I.L.GSSSD.FLNPLEQ..AA........KT..H.-------------------
B9J943_AGRRK/10-87----------------VSLA---AV-LDL.NEASA.LRGKLMG..L.........RG..S.-------------------
B1W2W2_STRGG/20-107----------------LTVT---GR-VSR.AVVAD.LCVELER..ALADPGGAAPAP..G.-------------------
A1SBD9_SHEAM/6-85----------------VELG---SE-LTI.RNIQP.IYSQLAD..LL........HQ..G.-------------------
A0LC67_MAGMM/14-94----------------ISLV---GS-FSH.AIFKE.FKNAYLP..LT........PG..P.-------------------
A4YMN9_BRASO/16-97----------------VVVR---GA-LTS.DTQTA.FKQQVEP..VL........SN..PS-------------------
C7LTF6_DESBD/15-91----------------IKLS---GN-LTL.DHSRD.IHAELLA..RL........PQ..A.-------------------
B1LTK1_METRJ/26-107----------------LALD---GR-WTA.DQAPT.VEAAAAR..IA........AA..GR-------------------
Q0RZA3_RHOJR/48-126----------------LRVS---GD-LDM.VTAPI.LAACLDE..VV........LR..G.-------------------
C5BID3_TERTT/281-360----------------LTLT---GA-MGS.DFSRN.LMAEVVD..HA........RP..H.-------------------
Q2SBJ1_HAHCH/18-100----------------LSIS---GI-VDL.SNVAD.LLAEGEK..AV........QA..AD-------------------
B5HHQ5_STRPR/28-107----------------LVFS---GV-LDA.HALPE.LEERLLD.PRL.......RQA..G.-------------------
Q1QXI2_CHRSD/17-99----------------LKLS---GD-VRL.TLCAT.LDQQAQR..VA.......DSP..G.-------------------
Q12BT3_POLSJ/427-501----------------LALR---GR-ATW.MHCDA.FYETARA..VL........EE..G.-------------------
C9R4W7_AGGAD/20-98----------------LRLK---GE-LSQ.NTLLP.LWQQRAS..FLL.....ARKT..E.-------------------
D9T369_MICAI/189-267----------------VALA---GE-LDP.SNHRD.FAAALER..ADP.....RPVA..G.-------------------
Q31HM4_THICR/6-86----------------IELP---EN-LTI.HHIEE.EFGNLKI..AF........QS..D.-------------------
Q31GZ5_THICR/18-93----------------IKLS---GQ-INM.DAVAS.FYAQGIK..SL........VN..P.-------------------
A7H922_ANADF/18-92----------------IRLS---GV-FDH.ASAAE.LAQRLQQ..E.........AA..T.-------------------
Q21SV7_RHOFT/514-592----------------VELS---GE-VLG.DAAEA.LDKLQAG..LY........DA..K.-------------------
A3N1T8_ACTP2/20-99----------------VKLS---GE-LTR.DTLLP.LWKQRAS..FL.......SPK..G.-------------------
B2FP86_STRMK/2-73----------------....---..-LDR.AAVIA.LWPQLQ...AL........PA..K.-------------------
F9ZTS0_ACICS/20-97----------------LRLS---GD-WRL.DALDEALRSEELR..SL........AV..D.-------------------
Q2IMF1_ANADE/97-172----------------ISLD---GV-LDV.PTARR.LAAQLAA..A.........AP..G.-------------------
Q3J3N5_RHOS4/5-82----------------LDLP---AR-LDH.QGARQ.LYAALLS..M.........PP..G.-------------------
Q3J659_RHOS4/7-80----------------LTLS---GT-LRL.QDAPG.LIERLAA..AL........AA..G.-------------------
Q6DAF4_PECAS/14-89----------------LALT---GD-LDR.ETLLP.FWQQRES..LL........A...G.-------------------
Q87LF2_VIBPA/15-93----------------LTLT---GA-LDR.DSVPS.LWAFAQQ..WK........PS..Q.-------------------

PF11964

L0GYF4_9GAMM/12-118-------------ILAFRLS...GK......LHDQDYRT.FVP--VI..........-----------------------
W8EVU9_9BACT/23-129-------------LLYIEWQ...PL......VSAAPAREMLQQ--LLTAIDTR....-----------------------
D5V1Z3_ARCNC/21-125-------------.LTIKAV...GT......LTHEDYET.ITP--LI..........-----------------------
Q11VP6_CYTH3/12-119-------------MVGFKAT...NE......VTQEDFTNKVIP--TV..........-----------------------
A5FC98_FLAJ1/11-118-------------IVAFRAL...AE......VTKDDFLTAVVP--AV..........-----------------------
Q28QM9_JANSC/19-126-------------VYAFRVT...GH......IDDDASEA.LAK--FM..........-----------------------
Q093V8_STIAD/17-124-------------LVKVTFR...GQ......MDIQEQQA.SYA--CV......EE.I-----------------------
E0TIJ6_PARBH/12-118-------------VLAARFA...GR......LAREDIER.FAN--WL..........-----------------------
Q3SKE6_THIDA/10-113-------------LIAVTVM...GQ......FTLADYRE.FEE--AV..........-----------------------
Q3ID73_PSEHT/20-125-------------FLTLKAV...GT......LTHKDYKI.ITP--MI..........-----------------------
B2HRZ3_MYCMM/12-119-------------VAAFVCH...GH......VTKDDYETVVIP--DI..........-----------------------
J7Q7E4_METSZ/12-118-------------VVAIVCK...GR......VTKADYDAVLAP--AV..........-----------------------
E8X7D9_GRATM/13-120-------------.FGFKVI...GE......LTTSDIAA.ICQ--QIDFAIDERR.K-----------------------
Q3J4W4_RHOS4/41-148-------------ILTFELG...GH......VGRPEIRR.MAE--TV..........-----------------------
F0SJ20_RUBBR/12-119-------------ILEMEID...GG......ITAEEFDSAL.E--QA..........-----------------------
D5SV07_PLAL2/13-118-------------LLIVRVT...GK......LDAAAYEQ.FVP--MV..........-----------------------
A4XX57_PSEMY/12-120-------------.IDVDFT...GK......LDSEAMRV.A..--.L..........-----------------------
A0LIB8_SYNFM/14-120-------------LMHVRIS...GI......MEPADQES.L.Q--TV..........-----------------------
I4C386_DESTA/12-119-------------ILAVRAI...NK......LTEEDYENVLIP--KL..........-----------------------
I4AGM8_FLELS/70-181-------------ILALEWR...GD......ITDEQYKEVMNK--LLELSYLY....-----------------------
M4SAG0_9SPHN/140-247-------------ICAFEVD...GR......ITADELDG.LYT--HI..........-----------------------
F0SJC2_RUBBR/13-118-------------VIEVQLS...GK......LTKEAYHE.FVP--FT..........-----------------------
M9R3U0_9RHOB/11-120-------------RVDIELS...AI......LDSDMMAA.G..--.L..........-----------------------
A9WJT9_CHLAA/12-112-------------LIWVVMEEHLHL......AEAERYYHEMWR--LL..........-----------------------
W8EZJ6_9BACT/24-132-------------LLRVTWR...GQ......YDAKSART.GCE--HILAHICHTR.C-----------------------
Q8EB52_SHEON/21-126-------------FVAFKAI...GT......LTHQDYEV.MVP--VL..........-----------------------
L0K3H2_9EURY/13-119-------------.IGYEAT...DE......LSEDEYAE.ILA--DV..........-----------------------
B1MER2_MYCA9/12-121-------------VVGFRVS...GR......LTGNELRE.FTS--TI..........-----------------------
F9ZWL7_METMM/13-118-------------LLVVQVS...GT......LVKADYQQ.FVP--EF..........-----------------------
X5E4J9_9BACT/13-117-------------VIHLQFTRDYLT......TDIPDIRSKMNE--LFDDIPYRQMCI-----------------------
E4TNT7_MARTH/14-124-------------IITVTFT...GE......KSTDENFQQYLD--EL..........-----------------------
Q8TPB5_METAC/12-119-------------VVAAVAN...GK......ITGEDYEKVLIP--AI..........-----------------------
A3QHM0_SHELP/21-124-------------.LAFKAV...GK......LTHEDYEQ.MTP--LL..........-----------------------
B0JM20_MICAN/12-118-------------ILYMQPT...SA......LAAEDFIK.IAE--AV..........-----------------------
Q7UVW9_RHOBA/74-179-------------VIEVEIN...GT......LSKQDCSA.LLP--TV..........-----------------------
A4FCH9_SACEN/137-244-------------VVVVEVQ...QP......LRVQDFDA.LAV--TV..........-----------------------
A0LXE0_GRAFK/12-118-------------IYSFEIS...GG......ISESEMHD.FIE--LL..........-----------------------
E1RHG3_METP4/12-115-------------FIGIEAS...GE......ISENDISE.ITP--QL..........-----------------------
G2J2P9_PSEUL/12-113-------------..DVALF...NE......FTLEDFKE.LEV--AL..........-----------------------
A5G4W5_GEOUR/116-227-------------VWVVRIT...GA......LRKEEMDA.I.Q--AVGI.......K-----------------------
A3CYB3_METMJ/12-120-------------VLGFRFD...GK......LSESDYATVLIP--EL..........-----------------------
Q5V739_HALMA/20-132-------------LIAIRV....GK......GTRTGYQELYSL--LV..........-----------------------
I4C4Z7_DESTA/12-119-------------VIALKAT...GK......LTDADYKDMLIP--KV..........-----------------------
M4NFH5_9GAMM/12-119-------------TLGFRAH...GQ......VTAEDYENIVVP--DV..........-----------------------
A1S706_SHEAM/12-119-------------TIALEAS...GM......IEADDYSRVLIP--AL..........-----------------------
M4V983_9DELT/11-119-------------VVALRVT...QT......LDADDYQE.IIE--EI..........-----------------------
D4ZLE1_SHEVD/12-119-------------TVAIKAS...GV......VTGDDYDKRLLP--AI..........-----------------------
B2HE07_MYCMM/27-133-------------ILHVRPE...TA......LDKEDFVK.LAE--VV..........-----------------------
J7L4H1_NOCAA/12-117-------------VLGYEVE...DT......IPHDDFEE.ILD--EV..........-----------------------
F2LY86_HIPMA/12-118-------------VLKFKLS...GL......ITAEDYENTLIP--AI..........-----------------------
F0SJ19_RUBBR/12-119-------------IVELDID...GE......ITPENFDETL.T--TL..........-----------------------
Q3JB38_NITOC/148-256-------------VFAFEIN...GM......ISAEEMPG.VIK--EF..........-----------------------
W8EXL7_9BACT/35-135-------------..........DE......LTFRALFNHMVQ--AL..........-----------------------
H8MXZ5_CORCM/21-129-------------ILWIKVR...GA......FSETDVRE.LVD--LFHELEA.....-----------------------
E1RH74_METP4/11-116-------------...FLIR...GK......LTDEDYRKTLIP--VL..........-----------------------
K9XV53_STAC7/12-117-------------VIGIKVD...GK......ITKNDFTE.LVH--KL..........-----------------------
A5FDC3_FLAJ1/11-118-------------AAAFKTV...GE......ITAYDYKTVIIP--SI..........-----------------------
G8RQ72_MYCRN/12-121-------------VAGIRVS...GK......VTGDEISA.FKP--EM..........-----------------------
Q07X46_SHEFN/12-116-------------VISLFVS...GR......LSAQDYRTRLQP--AI..........-----------------------
A9GPE4_SORC5/20-127-------------ILRFAIE...GD......ISEEIARS.LCA--VF......RR.V-----------------------
G2KMS5_MICAA/17-122-------------VICIRVD...KP......ISGEGYKTQFLP--LV..........-----------------------
Q6MQZ1_BDEBA/34-138-------------.IEILVD...GD......ISKDSVVP.LLN--LI..........-----------------------
E3FV03_STIAD/12-119-------------IVDFILD...GY......IRVEEMQRFVEE--LRVATRSLTGRE-----------------------
D2QV97_SPILD/12-116-------------.LALLVA...DF......ITVDDYYN.LRP--LL..........-----------------------
Q7NXU0_CHRVO/12-113-------------..DVALF...NE......FTLADFQL.LEQ--AL..........-----------------------
D5ER41_CORAD/12-118-------------IVGVSAT...GK......VTAQDYERVLIP--LI..........-----------------------
A1SV34_PSYIN/12-119-------------ILIVEPV...DK......LEKKDFKQ.VAL--LV..........-----------------------
B3QUM5_CHLT3/13-124-------------LVRIDFS...GK......LDVKDIIRSLKN--LIENPDYQ....-----------------------
G0J0D1_CYCMS/13-117-------------.ITAEMS...GK......ITKKGIEK.IHP--LI..........-----------------------
A0M0N9_GRAFK/12-117-------------IIATRAS...GD......LTEMDIEK.VHP--LI..........-----------------------
Q1CW14_MYXXD/23-128-------------.LVAEFN...GL......ITLEEVKE.VVT--LYQQ.TA.....-----------------------
Q6AK92_DESPS/134-240-------------LLTVKLI...GQ......LEPSVYEN.FSK--EL..........-----------------------
V5WKN4_9SPIO/39-142-------------IIRIFYP...AE......IRDNEMQSLLDS--RLEEIKRE....-----------------------
A6Q9H2_SULNB/14-120-------------..VLEPH...GA......LSKKDFDN.AAK--VI..........-----------------------
F8GCM7_NITSI/10-113-------------LVIVAII...GE......FTLADYNE.FEQ--QV..........-----------------------
C4ZLU4_THASP/10-113-------------LVSLVVF...GE......FTLADYKE.FED--VV..........-----------------------
Q6AK92_DESPS/12-119-------------TIGFKMT...GK......ITKDDYEKVVNP--AI..........-----------------------
F0M0B1_VIBFN/20-125-------------FVVIKAV...GT......LTHQDYEI.MTP--ML..........-----------------------
A6WZX1_OCHA4/19-126-------------VFAFAIE...GH......LDDASLEN.LYG--LL..........-----------------------
E3FKU0_STIAD/13-119-------------ILEVVYP...PQ......PSQQDVDEYLSR--VREIIEGL.G.E-----------------------
Q0AQY4_MARMM/16-124-------------.....IS...GQ......VTTDLLMATFAR--AR..........-----------------------
Q6LKJ4_PHOPR/20-124-------------.MEIKAI...GT......LTHADYEK.ITP--II..........-----------------------
D5BJF0_ZUNPS/25-118-------------IIDLKIA...KK......ITSDRLLF....--............-----------------------
C7P248_HALMD/57-169-------------VVAIRV....GD......CSPAGFRDLYRL--LS..........-----------------------
A1S9K0_SHEAM/21-126-------------FVVLKVT...GT......LTHEDYER.MVP--VL..........-----------------------
D3FPZ4_BACPE/12-117-------------IIEYEVD...DT......LTEEENKE.VLD--EL..........-----------------------
Q087X8_SHEFN/21-125-------------.VTLKAI...GT......LTHEDYLV.ITP--ML..........-----------------------
C0QCX2_DESAH/11-120-------------RLDIEMS...GR......LDSALMEK.A..--.L..........-----------------------
Q1LPD1_CUPMC/12-120-------------VVAVHGN...GK......LTRDDYEKVLIP--AI..........-----------------------
A3HTM6_9BACT/12-125-------------VLAIEII...DG......FTETDEKI.LQK--LF..........-----------------------
F7XLD9_METZD/12-119-------------VVGVTAS...GV......VKEEDYDKILKP--LI..........-----------------------
B1WXR6_CYAA5/19-124-------------IVEISVA...GK......ITEQDLDQIV.S--RL..........-----------------------
D0J5L7_COMT2/12-119-------------ILLLEPH...GP......LTEQDFDG.VSQ--DV..........-----------------------
H6L5W1_SAPGL/20-121-------------.GIIRVV...YD......EVITNPDD.VHA--HI......DQ.L-----------------------
B7VP41_VIBTL/20-124-------------IVVFKAK...GK......LTHDDYQA.MMP--IL..........-----------------------
K0NMI2_DESTT/11-120-------------RIDIELS...GK......LDSKEMKI.A..--.L..........-----------------------
F4CCE8_SPHS2/23-130-------------VVAYRAQ...GK......VNGEEYKEIVVQ--RI..........-----------------------
G8PHU6_PSEUV/12-120-------------VLGFEVD...GK......VDITEELN.LIS--QV..........-----------------------
A0M5Q5_GRAFK/11-116-------------VIGLIVD...RD......LTEDTLDE.IIA--GI..........-----------------------
A3CYB0_METMJ/12-120-------------VVGFRFD...GE......MTAGDYDVTLIP--AL..........-----------------------
F4AVZ8_DOKS4/11-116-------------TLGFVYE...NK......IAQDGVNQ.VKA--AI..........-----------------------
I3YWJ5_AEQSU/12-117-------------ILGILIS...GK......TTKEDYDQ.LNP--LL..........-----------------------
Q083D4_SHEFN/12-118-------------TIAVRAS...GK......LTLEDFQQ.FFP--QL..........-----------------------
B0BYZ0_ACAM1/138-242-------------IVEVIIE...GT......ITAADFDRIV.P--QM..........-----------------------
E3FWM2_STIAD/2-108-------------..RVTLH...GQ......MGLKEVRE.TVA--VA......EE.F-----------------------
D5B9R4_ZUNPS/12-117-------------VVVTVAS...GK......LNQHDLEK.IHP--LI..........-----------------------
M4SAG0_9SPHN/11-120-------------IIALSVG...GR......IEKDEMEL.AFR--LL..........-----------------------
I4AIU7_FLELS/23-135-------------.IIIKME...GD......INDEEYKEVFML--LL.DREKTQGYT-----------------------
A5GKD8_SYNPW/21-126-------------VITVFAR...GR......LSHQDYQE.FIP--QL..........-----------------------
A9GKE1_SORC5/12-119-------------LIEVTLQ...GV......VRTEEAQAYAAD--YKKALGSLYGRR-----------------------
E1V9S9_HALED/39-147-------------VVAMRVG...GR......VDANDLQR.AID--AI..........-----------------------
A8LJW8_DINSH/13-117-------------VVELTVS...GK......ITHAEFEE.VVP--KLEAELA.....-----------------------
C5BJV0_TERTT/11-120-------------RLDVALS...GK......LDTEGMIA.V..--.L..........-----------------------
S6B665_9PROT/11-113-------------.VNVGVL...GQ......FTLADFKE.LED--AV..........-----------------------
G0J0C5_CYCMS/12-117-------------VIATKAQ...EN......LTEADIQK.IHP--LI..........-----------------------
Q1CYP8_MYXXD/13-120-------------ILEVVYP...PQ......VTTADLAEYLAD--VKKAINDLAG.E-----------------------
I0JIE9_HALH3/13-116-------------.IVIDIR...EK......LTGHDARM.LDD--YI..........-----------------------
E6U1C5_BACCJ/13-120-------------IMYIKWS...GM......VEPEEVREATNR--ITELLKGFPSSG-----------------------
Q47BJ5_DECAR/11-113-------------.VNVSVF...GE......FTLADYKE.FEE--VV..........-----------------------
K9X8Y1_9CHRO/10-123-------------IITFTYE...GR......MTMDDANQ.YIS--KL......EQ.L-----------------------
Q8ED76_SHEON/12-119-------------VLTIVVS...GQ......VTHEDIETLLFP--AI..........-----------------------
A1T9B4_MYCVP/12-121-------------VTGFRVS...GH......VSGEELRD.FGS--TM..........-----------------------
J1L360_9EURY/12-120-------------VIGFLIS...GD......VTDEDYMQVFMP--AI..........-----------------------
A3QIC9_SHELP/12-116-------------VISLFAS...GR......LSTQDYCNKIVP--II..........-----------------------
G2J2S0_PSEUL/12-117-------------VVAIKLR...GT......LHDVDYRT.LEP--LV..........-----------------------
D5CNM7_SIDLE/10-114-------------LVNIAVM...GE......FTIADFKQ.FEE--HA..........-----------------------
Q093V7_STIAD/21-127-------------..KFVLR...GP......LEHAEMLA.IRA--QL......EE.L-----------------------
W8S663_9RHOB/15-124-------------LLVLEVQ...GS......MDARAMEV.A..--.L..........-----------------------
A9GPD9_SORC5/60-166-------------ILCTAIE...GD......ISDDTARA.IAA--AC......RR.L-----------------------
Q11I87_CHESB/20-127-------------AYAFEIT...GY......IETADIEN.MYG--LL..........-----------------------
C1DA99_LARHH/12-113-------------..DVAIY...NE......FTLADFKD.FEV--AL..........-----------------------
B3QXG2_CHLT3/14-123-------------.VRSVFT...GK......TTGKDLKEATTH--GL..........-----------------------
H2FUI0_OCESG/21-126-------------.LHLRIF...GD......IAYDDFRD.MEQ--RL..........-----------------------
E1QK88_DESB2/12-119-------------IVAVHVT...GA......LNLEQDKYKIFE--GV..........-----------------------
W8S5M5_9RHOB/17-125-------------VHAFRIT...GA......VTREDMAA.MGE--RM..........-----------------------
I4EWX0_MODMB/5-112-------------TVGFEAI...GK......VEDDDFEHAVEP--VL..........-----------------------
V5XBD7_MYCNE/12-121-------------VTGIRVS...GR......ISGEELRE.FQP--VM..........-----------------------
D5B9R0_ZUNPS/6-111-------------LIAAKIS...GK......LTEKDMEK.MHP--LI..........-----------------------
F5XYL0_RAMTT/15-117-------------..VIELA...GP......ATAEDFAQAIAT--VA..........-----------------------
Q1ZBL2_9GAMM/21-125-------------.LSLKGV...GK......LTHADYEI.FTP--LI..........-----------------------
A3QF38_SHELP/12-119-------------TVAVKAR...GV......LSRADYDQTLVP--AI..........-----------------------
Q3JB38_NITOC/16-125-------------VIAIHFS...GK......MTGEDIQQ.YKK--IL..........-----------------------
D6XVY9_BACIE/11-115-------------ILEVTVD...GE......FTDEEITR....--............-----------------------
Q2YCI1_NITMU/10-113-------------LISIAVF...GE......FTLADYQE.FED--KV..........-----------------------
C6Y0C1_PEDHD/12-119-------------IFGVRAS...GE......VTKDDLQQVLLP--GL..........-----------------------
B1LYM2_METRJ/12-117-------------VAEIVVD...GK......ITDEEMNAAM.T--AM..........-----------------------
Q7MEX7_VIBVY/25-130-------------ILVFKAT...GT......LTHQDYQA.IVP--VL..........-----------------------
Q12ZF4_METBU/12-119-------------VVAVRLT...GV......VKGEDYDNILVP--VI..........-----------------------
L0G526_ECHVK/12-117-------------IICTKAD...GN......LTELDMEK.IHP--LI..........-----------------------
F4C7J2_SPHS2/12-119-------------VFGVRAS...GE......VSGEDLKKVLHP--GL..........-----------------------
B0BYZ0_ACAM1/12-117-------------VVELIVE...GK......ITETDLDQVI.T--QM..........-----------------------
A6Q671_SULNB/23-127-------------.IELAMI...GK......LTHEDYKV.FVP--MI..........-----------------------
A0LXE0_GRAFK/144-249-------------IYRFVIDERTDE......AGVEALYEIFEN--EE..........-----------------------
W8EUS5_9BACT/21-126-------------.LYVEWK...GQ......HDAESART.GGE--LVLEYLRQRP.C-----------------------
H6L5S2_SAPGL/58-159-------------..........SK....KSLTVKDIDESLLL--LEEQAKIQ....-----------------------
G8R3P5_OWEHD/12-122-------------ILGFEVD...GR......VSEAAFINMMQE--LI..........-----------------------
W0RC97_9BACT/11-121-------------LIRIRIH...DT......ITPRDLRALADA--VLEAEARVLP.M-----------------------
C6C2B1_DESAD/11-117-------------VLGLRIN...GK......INEEDMEK.MLS--VC..........-----------------------
H6L5W0_SAPGL/30-131-------------..YFEQK...LK......MSLEQAQD.YYE--SL......CK.M-----------------------
D9QNG3_BRESC/27-134-------------LLIFEVD...AR......IHTADMAW.MGA--TV..........-----------------------
G2KMS4_MICAA/16-122-------------.LFVHLH...DT......ISVDDYIQFFDT--PV..........-----------------------
H6L0F3_SAPGL/30-131-------------..........SM......PLTKEVMQENFE--LVQKISLDLG..-----------------------
A0LXC2_GRAFK/12-117-------------LLATVID...GK......LSEEEIEL.LHA--KI..........-----------------------
Q2RZR2_SALRD/34-139-------------LVGITLS...DT......LTEDDYEA.FTS--AL..........-----------------------
G2KMS2_MICAA/25-131-------------.FCVRYT...GI......INAQDYKDVCVD--IG..........-----------------------
G0L8K0_ZOBGA/13-125-------------.LALEVI...DG......FTETDEKL.ALK--FF..........-----------------------
Q82UI4_NITEU/10-112-------------LIVVAVI...GE......FTLDDFRQ.FED--QV..........-----------------------
I1YHY0_METFJ/11-119-------------RLDIALQ...GK......LDAMQMRT.A..--.L..........-----------------------
C6X1D7_FLAB3/12-118-------------VAAFRAS...GE......ITKEDFEKLVMP--HV..........-----------------------
I4ANF2_FLELS/25-134-------------TIVLEWF...GH......VSHEEFVE.ACD--FLLELLIKYK.S-----------------------
V5WM94_9SPIO/3-107-------------IISVYYT...AK......MTDADHKELLEA--RLADIRRVG...-----------------------
X2HCK2_9NEIS/13-113-------------...VVLY...NE......FTLEDFYQ.LEN--AL..........-----------------------
S6ATB1_PSERE/11-120-------------RVDVDFA...GK......LDSNEMRT.G..--.L..........-----------------------
E6WYT5_NITSE/23-127-------------.VEIRMQ...GK......LHHRDYQV.MIP--VM..........-----------------------
D5BJR6_ZUNPS/18-118-------------FIYKEIYEIDGP......MAKTIVSERLQL--QN..........-----------------------
C7RNF8_ACCPU/11-113-------------.VDVTVY...AE......FTLADYQE.FEN--AV..........-----------------------
A8ZX31_DESOH/24-127-------------IFYVTLN...GDADDEMGIEIDRMINRMVE--DI..........-----------------------
H0PYZ6_9RHOO/10-113-------------LVTVAVF...GE......FTLPDYKE.FEE--LV..........-----------------------
F0JGN8_DESDE/12-119-------------MVAVRAT...DK......LTDADYRDVWIP--AL..........-----------------------
A9GPD8_SORC5/37-144-------------VLFVAIV...GD......ISEPIARA.ITA--AC......QR.V-----------------------
G2KMS3_MICAA/30-137-------------.FCARYD...GV......MNVPEYTEIFIK--QS..........-----------------------
Q31FZ2_THICR/21-125-------------.LSMKVQ...GK......LTHDDYSQ.MTP--MI..........-----------------------
A9GPE2_SORC5/23-130-------------LLVIATD...GD......VLEDNARA.LVD--AF......QR.L-----------------------
X5E3H4_9BACT/12-117-------------LIALEVE...GK......LTKEDYNK.ITP--LI..........-----------------------
M1NQM0_9CORY/12-118-------------IVTAAYS...GS......IGTEEMEH.LRS--TV..........-----------------------
A0M0L9_GRAFK/12-115-------------YMVAQ.....NR......LDATDYDN.LIS--QL..........-----------------------
A6Q807_SULNB/11-120-------------RLDLEFQ...GK......ITTEDMQE.I..--.L..........-----------------------
C6BYE1_DESAD/13-119-------------.LAVTAT...GK......VSGEDYTEVWIP--AL..........-----------------------
Q73Z58_MYCPA/13-121-------------.TGVRVS...GR......LSGQELRE.VRP--TL..........-----------------------
K9RD27_9CYAN/12-117-------------VIGVLIK...GN......VNPKDFELVTNF--I...........-----------------------
D9SJ90_GALCS/11-114-------------.VNAAVL...GE......FTLADFKV.FEE--QS..........-----------------------
W6RYK2_9CLOT/10-116-------------YIEVKIE...GE......ITTNEIEAMKQE--GISKINSLTKLT-----------------------
H8N2H1_CORCM/12-120-------------IIEIIYP...SE......VTPKDVTEYVEQ--LKKDITARGGTE-----------------------
I0KHL1_9BACT/11-115-------------RLALRVA...DF......ITPEVYFE.LRP--LL..........-----------------------
A6VRW9_MARMS/21-125-------------.LNMKTS...GH......PSEMDFEK.ITP--QL..........-----------------------
C7R9R1_KANKD/12-118-------------LVILEPD...GA......LTDNDFRL.AAQ--LI..........-----------------------
A4FCH9_SACEN/14-119-------------..GVKAS...GK......VTKEEYEAVVEP--LI..........-----------------------
Q6LS91_PHOPR/11-120-------------RIDMSFG...GK......LDSEEMKA.L..--.L..........-----------------------
G8QLC0_DECSP/10-113-------------LVSVAVF...GE......FTLADYKE.FEE--LV..........-----------------------
M4S571_9SPHN/11-120-------------VAAYRLS...GI......LDDGDYDR.MIA--DI..........-----------------------
A9B5K6_HERA2/29-133-------------IIVIKIRPGIQE.......TVEDAEENL..--............-----------------------
A4VJY0_PSEU5/11-120-------------RIDIDFS...GK......LDSQAMRA.A..--.L..........-----------------------
I3Z121_BELBD/12-117-------------VIATKAI...EK......LATSDYNI.LLP--IL..........-----------------------
A9ENE2_SORC5/23-130-------------ILRVEVH...GE......VTEDRARA.VLG--AI......QR.V-----------------------
E4TRL3_MARTH/24-128-------------...ITFH...GS......LKSEEYRAAMLS--NY..........-----------------------
A1SAI8_SHEAM/12-116-------------VISLFAS...GR......ITAQDYRTHLQP--AI..........-----------------------
K9SIP1_9CYAN/14-118-------------.VEVLVD...GK......VTNADINSIL.P--QM..........-----------------------
I5B5J2_9DELT/12-119-------------AIAYRIE...GK......ITEKEMKT.VLA--IF..........-----------------------

PF01740

SUT22_ARATH/540-662.................EVLK......................................ENGLQVVILDMSCV..MGVDT
RSBRD_BACSU/161-267..............................................................LSYLFLDISGV..PIVDT
S26A2_HUMAN/569-715............RKIKEKVV.TLGGIQDE......................MSVQLSHDPLELHTIVIDCSAI..QFLDT
O45016_CAEEL/553-725......EKEEEDAEIPKETE.KETKLEVTTHQAKV.........LDEKHAEPEPNPADQYERLTHIIIDCSTI..IYVDL
SULP3_CAEEL/546-696...........QMNSDRSAD.IFDSKLKSA....................RRRWKRDQKSENRCKLVIDCDGF..PYVDY
D6EY97_STRLI/11-115...............................................................ARVVLDLDGI..EFFDC
O04001_SPOST/529-651..........................................................KQTELRFVILDLSAV..PAIDT
SUT32_ARATH/505-623...................T.S....................................GDISLQYIVLDMSAV..GNIDT
Q55814_SYNY3/440-540...............................................................DVLILDLATV..PRLGV
RSBV_BACSU/4-107...............................................................ADLRICLKDV..SYMDS
O69205_ACTPA/8-112..............................................................RGPGVLDLTGV..RFMAS
P73609_SYNY3/4-107..............................................................ISKLVLMMDQL..EYMSS
SP2AA_LYSSH/4-107..............................................................VTTIIWNLEGL..SFMDS
O84431_CHLTR/3-107..............................................................MKNIILDCGDL..DYISS
P71568_MYCTU/15-120...............................................................SAVIVNVTEL..QVAEE
S26A1_RAT/529-685...........VGVSNRSLV.DRKDLGSVS....................SGDGLVVPLAFGFHTVVIDCAPL..LFLDV
P73607_SYNY3/2-105...............................................................SKILLDMTAV..PYMSS
SP2AA_BACME/4-109..............................................................ISHLILNLQHL..TFMDS
YVDB_BACSU/421-528...............................................................KTLILLMNKV..HYMDT
RSBV_LISMO/4-109...............................................................IVLRIDLTEV..SYMDS
Q46665_ECOLX/332-437...............................................................RIVILKWDAV..PVLDA
S26A4_HUMAN/536-725SGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTK.EIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAI..SFLDV
RSBV_BACLI/4-107...............................................................KDLKVSLKDV..SYMDS
O83261_TREPA/17-124..............................................................YTRIVFNCASL..NYVSS
Y1364_MYCTU/550-649...............................................................APVTIDLSAV..THLGS
O67306_AQUAE/448-564...........................................................GRPLKFVLIDMEAV..NYVDA
Q9Z6Z7_CHLPN/2-106..............................................................HLKIALNFTDV..SYISS
SUT31_ARATH/514-633...................Q.S....................................GESSLQYIILDMSAV..GNIDT
Q9Z6P5_CHLPN/441-545...............................................................KIFILCMTRV..PTIDA
O17951_CAEEL/537-690...........GKGSKFTFE.GMHRIAPITE..................IPLHPGINRDPILPRHFVIDCSGF..TFIDL
RSFB_MYCTU/6-111..............................................................PTALVIDLSAV..EFLGS
SP2AA_BACLI/4-109..............................................................IRHIVMNLADL..SFMDS
Q55415_SYNY3/433-538...............................................................AAIVFDLSDV..PHLGV
SULH1_SCHPO/592-725.............SDRPWND.PAPRKKK.......................NAPEVEDTRPLLRAIILDFSAV..NHIDT
O07728_MYCTU/29-135.............................................................APGPFVIDIRDL..DFMGS
P72770_SYNY3/438-545.............................................................PVELVIFEMGTS..PGIDT
Q9Z841_CHLPN/3-107..............................................................SKNIILDCAHL..DYMSS
O07488_YEREN/391-488................................................................NVVIDVSHA..HFWDI
SUT33_ARATH/498-617...................Q.E....................................KHSSLQFLILEMSAV..SGVDT
P73474_SYNY3/396-498................................................................RVTIDLTHA..HLWDQ
SP2AA_GEOSE/4-109..............................................................IRHIVLNLGQL..TFMDS
S26A3_HUMAN/526-716QGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAV..SFLDV
SUT41_ARATH/519-638...................R.G...................................LEVDRINFVILEMSPV..THIDS
O84770_CHLTR/2-106...............................................................VNVLLNMEKV..FYMSS
RSFA_MYCTU/18-124.............................................................APEPLVVNLNGL..DFMGC
RSBRB_BACSU/147-272..................NT.LQ.................................ACAKRRVEHLLIDLSGV..VVVDT
SUT1_STYHA/538-656...................E.S....................................ELPEIQHLITEMSPV..PDIDT
G2TL00_BACCO/4-109..............................................................IRHLVLNLEQL..SFMDS
Y1739_MYCTU/443-553...................W.F....................................VLNAESNVEVDLTAL..DALD.
I6X4W0_MYCTU/31-137.............................................................APGPLIVDVTGL..DFMGC
SP2AA_PAEPO/4-109..............................................................CEHIVLSLKNL..QFMDS
SULX_YEAST/572-707..................GR.KS.................................LRSKDSIKYVIFDLGGM..TSIDS
SUT21_ARATH/548-668...................T.KS..................................NAKRKILFVVLDMSSL..INVDT
O83249_TREPA/5-107...............................................................NHVVLDLSGV..TAMSS
PHOT_BACSU/148-254.............................................................D.DYLIIDLSGL..AQVNE
RSBS_BACSU/5-111..............................................................ANGVVIDLTSV..DMIDS
O33206_MYCTU/385-486................................................................DVSLDLQHV..TYLDT
RSBRA_BACSU/151-261..............................................................SQVVLIDITGV..PVVDT
SUT11_ARATH/518-636...................E.Y....................................GMPAIRFVIIEMSPV..TDIDT
Y1081_THENE/1-106..............................................................YNKILLVLSDV..ESIDS
SUT3_STYHA/511-631...................E.E...................................AAKGRVQAIIIDMTDL..TNVDT
SULH3_SCHPO/533-653..................GE.TP.................................YRRIEDIEVVVFDMVGV..SSIDS
YG35_YEAST/657-777..........................................................TKRRIKYLILDFKNINADNIDY
O33361_MYCTU/29-135...............................................................NPMVLDLSEL..SHFSG
O83551_TREPA/4-108..............................................................PRCIVIDLEAV..EYIDS
P73108_SYNY3/3-107..............................................................SPVMVIDFSQV..DFLDS
RSBRC_BACSU/163-272..............................................................VTQLYIDLSGV..AVIDT
Q40008_HORVU/530-648...................E.Q....................................KLSKTEFLIVELSPV..TDIDT

PF13466

Q310Z9_DESAG/492-572-------------------------------------------------------------..EVLRIDSQQL--ESADL
B5HV30_9ACTN/31-112-------------------------------------------------------------...VVVCDVAGL--GPPGL
A9BX84_DELAS/2-83-------------------------------------------------------------..AQVRVDASGV--EVFDS
Q0K681_CUPNH/47-125-------------------------------------------------------------...EVQVDCTGL--AQVDS
B5H529_STRPR/9-95-------------------------------------------------------------..CEVFCDVGGL--AQVNL
Q0RDC2_FRAAA/24-104-------------------------------------------------------------.SGPLRVDVAGL--ELGDH
D1AD83_THECD/187-267-------------------------------------------------------------..SPVHVDMAEL--KFIDV
D2SCD5_GEOOG/29-109-------------------------------------------------------------.HRTWTVDTSGI--TFCDA
A1VK31_POLNA/2-82-------------------------------------------------------------...EVVVDASAL--SQFDS
A8ZVX1_DESOH/4-85-------------------------------------------------------------.DDQVAVDMSAV--GRCDV
Q3SFW3_THIDA/281-359-------------------------------------------------------------...EVLVDLSEV--ARVDY
B9TGW9_RICCO/228-309-------------------------------------------------------------..AQFTIDLSRV--EYSSS
A1W422_ACISJ/2-83-------------------------------------------------------------.ESLVVVDAGAL--TAFDS
A1U461_MARHV/15-95-------------------------------------------------------------...TLEVDLSGL--GTAHS
Q21UA2_RHOFT/4-85-------------------------------------------------------------..PEAVVDASPL--NRFDS
B1Y2Z1_LEPCP/2-84-------------------------------------------------------------..TSVVIDGHQL--GRFDS
Q8EEQ5_SHEON/14-91-------------------------------------------------------------..VDISVDLSQV--TEVDT
D2S5L7_GEOOG/30-110-------------------------------------------------------------..DTWVVDASHV--TACDP
A7MNS4_CROS8/14-91-------------------------------------------------------------...LQRIDLSGL--ERVDT
B9JTP2_AGRVS/23-100-------------------------------------------------------------...AIEIDASGV--ERMGA
B8DPA7_DESVM/571-651-------------------------------------------------------------..ATVRIDLSGV--TAADL
C6C1P3_DESAD/15-93-------------------------------------------------------------...CLVVECSGI--EYLDG
E3I167_RHOVT/14-94-------------------------------------------------------------..DEILVDARRV--TSLDV
E3IYM7_FRASU/24-104-------------------------------------------------------------.GATVTVDVGGL--RRVDI
C1D624_LARHH/5-83-------------------------------------------------------------...DCRLDWAAV--RRVDS
A4YXB4_BRASO/320-399-------------------------------------------------------------..KHVRLDFSNV--CAIDA
D1C014_XYLCX/37-113-------------------------------------------------------------..LPVEIDAHHI--TFMDS
C6WD00_ACTMD/919-1001-------------------------------------------------------------..RPVELDLSGL--GYLSS
E3J1T6_FRASU/56-136-------------------------------------------------------------.RGDVRVDLGRL--RRVDV
C6WQ84_ACTMD/60-139-------------------------------------------------------------.PPVLVVDLGEV--RLLAV
Q2SPQ4_HAHCH/13-91-------------------------------------------------------------...RIKFDGAEV--EVMDA
D2SFP4_GEOOG/531-612-------------------------------------------------------------...RVELDLTEV--TLFSS
D2B5R7_STRRD/72-150-------------------------------------------------------------..DDMHIDLAGL--TFVDV
B8DLB2_DESVM/179-259-------------------------------------------------------------.APTVVLDFEPS--VSVNG
D0KYU0_HALNC/26-108-------------------------------------------------------------..TRLEIALGSV--GRIDT
D5X3Z8_THIK1/566-644-------------------------------------------------------------..EQMSISLRQL--RRIDF
B9J943_AGRRK/10-87-------------------------------------------------------------...NVAIDASSV--ERIGA
B1W2W2_STRGG/20-107-------------------------------------------------------------..AAVDCDVGGV--TRPDL
A1SBD9_SHEAM/6-85-------------------------------------------------------------..RPVTLNAARL--IKADT
A0LC67_MAGMM/14-94-------------------------------------------------------------.SFRYCIDLSQV--KSLDS
A4YMN9_BRASO/16-97-------------------------------------------------------------.VSKIKLDFSGL--QSIEA
C7LTF6_DESBD/15-91-------------------------------------------------------------..SAITLDLADS--EKSDL
B1LTK1_METRJ/26-107-------------------------------------------------------------.AGPVAVDLSGI--ERLDT
Q0RZA3_RHOJR/48-126-------------------------------------------------------------..RCAVVDLLPA--GFVGC
C5BID3_TERTT/281-360-------------------------------------------------------------..KPLQLDLSGL--EYMDN
Q2SBJ1_HAHCH/18-100-------------------------------------------------------------ATSPLRIDVSLV--ENAQS
B5HHQ5_STRPR/28-107-------------------------------------------------------------...DRVLDMSGL--ERIEL
Q1QXI2_CHRSD/17-99-------------------------------------------------------------.LAAVMIDLREA--TNVDS
Q12BT3_POLSJ/427-501-------------------------------------------------------------..RPLVLDLSGC--DYLDS
C9R4W7_AGGAD/20-98-------------------------------------------------------------.TLDVHWDLSQV--NRIDS
D9T369_MICAI/189-267-------------------------------------------------------------...RVVFDAAEL--RFVDH
Q31HM4_THICR/6-86-------------------------------------------------------------.AETYKLVAGNV--ESIDT
Q31GZ5_THICR/18-93-------------------------------------------------------------...IEVIDCSNV--KEADS
A7H922_ANADF/18-92-------------------------------------------------------------...EVVLDFSLV--REFAD
Q21SV7_RHOFT/514-592-------------------------------------------------------------...HLVISCSRL--IRVDF
A3N1T8_ACTP2/20-99-------------------------------------------------------------.NQHIYWDLKDL--ERVDS
B2FP86_STRMK/2-73-------------------------------------------------------------...LARLDLAEV--ERVDS
F9ZTS0_ACICS/20-97-------------------------------------------------------------...RVRL..DDV--DAADS
Q2IMF1_ANADE/97-172-------------------------------------------------------------..SLVRIDLTHV--RELHD
Q3J3N5_RHOS4/5-82-------------------------------------------------------------...DTCLAAGQV--SFVGG
Q3J659_RHOS4/7-80-------------------------------------------------------------...DVEIDASGV--LAVDA
Q6DAF4_PECAS/14-89-------------------------------------------------------------...KTTLDVSGL--NRVDS
Q87LF2_VIBPA/15-93-------------------------------------------------------------..KELECSLEEI--ERVDS

PF11964

L0GYF4_9GAMM/12-118---------------------------------------------------------------ENAI.A....--.AAPG
W8EVU9_9BACT/23-129---------------------------------------------------------------..........--.....
D5V1Z3_ARCNC/21-125---------------------------------------------------------------DSAL.E....--.GVTN
Q11VP6_CYTH3/12-119---------------------------------------------------------------KELV.E....--.K..T
A5FC98_FLAJ1/11-118---------------------------------------------------------------EHLV.K....--.Q..T
Q28QM9_JANSC/19-126---------------------------------------------------------------LAAFDR....--...HE
Q093V8_STIAD/17-124---------------------------------------------------------------RAR.......--....Q
E0TIJ6_PARBH/12-118---------------------------------------------------------------ESEM.R....--.E..R
Q3SKE6_THIDA/10-113---------------------------------------------------------------AHGIAF....--....E
Q3ID73_PSEHT/20-125---------------------------------------------------------------DSAL.S....--.KVDH
B2HRZ3_MYCMM/12-119---------------------------------------------------------------EKRL.L....--.N..H
J7Q7E4_METSZ/12-118---------------------------------------------------------------RDAL.E....--.K..H
E8X7D9_GRATM/13-120---------------------------------------------------------------PIGI.L....--.AD..
Q3J4W4_RHOS4/41-148---------------------------------------------------------------LAAFDR....--....F
F0SJ20_RUBBR/12-119---------------------------------------------------------------NAAI.E....--.Q..H
D5SV07_PLAL2/13-118---------------------------------------------------------------EKMV.A....--.EH.G
A4XX57_PSEMY/12-120---------------------------------------------------------------DELIQA....--.AEGI
A0LIB8_SYNFM/14-120---------------------------------------------------------------AASL.I....--.AQGL
I4C386_DESTA/12-119---------------------------------------------------------------EALI.Q....--.TH.G
I4AGM8_FLELS/70-181---------------------------------------------------------------..........--.....
M4SAG0_9SPHN/140-247---------------------------------------------------------------FEVSQP....--....D
F0SJC2_RUBBR/13-118---------------------------------------------------------------EEKI.K....--.EH.G
M9R3U0_9RHOB/11-120---------------------------------------------------------------DELFEA....--.SQDI
A9WJT9_CHLAA/12-112---------------------------------------------------------------..........--.DQCP
W8EZJ6_9BACT/24-132---------------------------------------------------------------SLML......--....N
Q8EB52_SHEON/21-126---------------------------------------------------------------EAAL.A....--.GVKD
L0K3H2_9EURY/13-119---------------------------------------------------------------EAAIDE....--....Y
B1MER2_MYCA9/12-121---------------------------------------------------------------KEAL.N....--....G
F9ZWL7_METMM/13-118---------------------------------------------------------------ERLV.S....--.QH.G
X5E4J9_9BACT/13-117---------------------------------------------------------------HISKTAKVEN--RETRE
E4TNT7_MARTH/14-124---------------------------------------------------------------QSCYDD....--....R
Q8TPB5_METAC/12-119---------------------------------------------------------------EDKI.R....--.T..Q
A3QHM0_SHELP/21-124---------------------------------------------------------------ESAL.A....--.GIKT
B0JM20_MICAN/12-118---------------------------------------------------------------DPHI.E....--.A..T
Q7UVW9_RHOBA/74-179---------------------------------------------------------------KERI.V....--.R..F
A4FCH9_SACEN/137-244---------------------------------------------------------------DTWL.E....--.R..Q
A0LXE0_GRAFK/12-118---------------------------------------------------------------ETKANT....--.....
E1RHG3_METP4/12-115---------------------------------------------------------------DELIER....--....Y
G2J2P9_PSEUL/12-113---------------------------------------------------------------MKRIAE....--....H
A5G4W5_GEOUR/116-227---------------------------------------------------------------AAGL.R....--.AQNP
A3CYB3_METMJ/12-120---------------------------------------------------------------ERAI.E....--.E..H
Q5V739_HALMA/20-132---------------------------------------------------------------.........E--KSDKH
I4C4Z7_DESTA/12-119---------------------------------------------------------------EEII.K....--.QS.R
M4NFH5_9GAMM/12-119---------------------------------------------------------------EAAF.A....--.L..N
A1S706_SHEAM/12-119---------------------------------------------------------------EQAL.K....--.D..H
M4V983_9DELT/11-119---------------------------------------------------------------EFRLVT....--....H
D4ZLE1_SHEVD/12-119---------------------------------------------------------------EGRL.K....--.D..H
B2HE07_MYCMM/27-133---------------------------------------------------------------DPHI.E....--.A..T
J7L4H1_NOCAA/12-117---------------------------------------------------------------REVIRR....--....Y
F2LY86_HIPMA/12-118---------------------------------------------------------------KEKL.K....--.K..H
F0SJ19_RUBBR/12-119---------------------------------------------------------------RAII.G....--.E..H
Q3JB38_NITOC/148-256---------------------------------------------------------------EGFLER....--....H
W8EXL7_9BACT/35-135---------------------------------------------------------------..........--..RRH
H8MXZ5_CORCM/21-129---------------------------------------------------------------.GP.......--....D
E1RH74_METP4/11-116---------------------------------------------------------------EKALEE....--....H
K9XV53_STAC7/12-117---------------------------------------------------------------ETAINN....--....Y
A5FDC3_FLAJ1/11-118---------------------------------------------------------------TALM.K....--.R..I
G8RQ72_MYCRN/12-121---------------------------------------------------------------QKLL.D....--....A
Q07X46_SHEFN/12-116---------------------------------------------------------------KSYRKD....--....W
A9GPE4_SORC5/20-127---------------------------------------------------------------SES.......--....G
G2KMS5_MICAA/17-122---------------------------------------------------------------QKMAAD....--....H
Q6MQZ1_BDEBA/34-138---------------------------------------------------------------QKRIDD....--....W
E3FV03_STIAD/12-119---------------------------------------------------------------IKIKADLRTF--KPASP
D2QV97_SPILD/12-116---------------------------------------------------------------DTAL.H....--.S..A
Q7NXU0_CHRVO/12-113---------------------------------------------------------------LKRLDE....--....R
D5ER41_CORAD/12-118---------------------------------------------------------------EEKL.K....--.R..H
A1SV34_PSYIN/12-119---------------------------------------------------------------NPYL.E....--.K..H
B3QUM5_CHLT3/13-124---------------------------------------------------------------..........--.....
G0J0D1_CYCMS/13-117---------------------------------------------------------------HHII.D....--.K..G
A0M0N9_GRAFK/12-117---------------------------------------------------------------HAIL.D....--.K..G
Q1CW14_MYXXD/23-128---------------------------------------------------------------.TD.......--....H
Q6AK92_DESPS/134-240---------------------------------------------------------------DSYF.A....--.S..A
V5WKN4_9SPIO/39-142---------------------------------------------------------------..........--.....
A6Q9H2_SULNB/14-120---------------------------------------------------------------DPFILE....--.S..D
F8GCM7_NITSI/10-113---------------------------------------------------------------LYQSHF....--....E
C4ZLU4_THASP/10-113---------------------------------------------------------------NYRVQF....--....S
Q6AK92_DESPS/12-119---------------------------------------------------------------ECGL.I....--.E..N
F0M0B1_VIBFN/20-125---------------------------------------------------------------EAAL.V....--.KVNE
A6WZX1_OCHA4/19-126---------------------------------------------------------------DAAYET....--....H
E3FKU0_STIAD/13-119---------------------------------------------------------------WSALVDQSQL--RVMSA
Q0AQY4_MARMM/16-124---------------------------------------------------------------......AHEG--WSDHY
Q6LKJ4_PHOPR/20-124---------------------------------------------------------------DEAL.E....--.GVTV
D5BJF0_ZUNPS/25-118---------------------------------------------------------------..........--..QKA
C7P248_HALMD/57-169---------------------------------------------------------------.........A--TTDAH
A1S9K0_SHEAM/21-126---------------------------------------------------------------EGAI.A....--.GVSD
D3FPZ4_BACPE/12-117---------------------------------------------------------------KTVINQ....--....Y
Q087X8_SHEFN/21-125---------------------------------------------------------------EGAL.S....--.QVDQ
C0QCX2_DESAH/11-120---------------------------------------------------------------DELVDK....--.SEGI
Q1LPD1_CUPMC/12-120---------------------------------------------------------------DAVL.T....--.G..R
A3HTM6_9BACT/12-125---------------------------------------------------------------ESKKEQ....--...GF
F7XLD9_METZD/12-119---------------------------------------------------------------EDKI.Q....--.K..H
B1WXR6_CYAA5/19-124---------------------------------------------------------------KTDI.E....--.K..H
D0J5L7_COMT2/12-119---------------------------------------------------------------DEFL.A....--.E..H
H6L5W1_SAPGL/20-121---------------------------------------------------------------RQTF......--....G
B7VP41_VIBTL/20-124---------------------------------------------------------------NTTL.E....--.ELDS
K0NMI2_DESTT/11-120---------------------------------------------------------------DELEEK....--.SKII
F4CCE8_SPHS2/23-130---------------------------------------------------------------AEVA.K....--.A..Y
G8PHU6_PSEUV/12-120---------------------------------------------------------------EEVLDK....--....H
A0M5Q5_GRAFK/11-116---------------------------------------------------------------KLKLEI....--....H
A3CYB0_METMJ/12-120---------------------------------------------------------------EDAK.R....--.S..H
F4AVZ8_DOKS4/11-116---------------------------------------------------------------EKKLES....--....H
I3YWJ5_AEQSU/12-117---------------------------------------------------------------EKHKME....--....H
Q083D4_SHEFN/12-118---------------------------------------------------------------ETQI.K....--.RL.G
B0BYZ0_ACAM1/138-242---------------------------------------------------------------KADL.A....--.K..H
E3FWM2_STIAD/2-108---------------------------------------------------------------KKG.......--....K
D5B9R4_ZUNPS/12-117---------------------------------------------------------------HSIL.E....--.K..G
M4SAG0_9SPHN/11-120---------------------------------------------------------------DEAFAR....--.DGKV
I4AIU7_FLELS/23-135---------------------------------------------------------------KVLFNQENVG--NVSSK
A5GKD8_SYNPW/21-126---------------------------------------------------------------EAAI.A....--.EQTG
A9GKE1_SORC5/12-119---------------------------------------------------------------IRVLVDFRGF--SIASE
E1V9S9_HALED/39-147---------------------------------------------------------------ESAKKA....--....H
A8LJW8_DINSH/13-117---------------------------------------------------------------..........--....R
C5BJV0_TERTT/11-120---------------------------------------------------------------DALLDN....--.AEGM
S6B665_9PROT/11-113---------------------------------------------------------------MYKIKF....--....E
G0J0C5_CYCMS/12-117---------------------------------------------------------------HNIV.Y....--.H..G
Q1CYP8_MYXXD/13-120---------------------------------------------------------------WSALVDQSQL--RVMPS
I0JIE9_HALH3/13-116---------------------------------------------------------------QGYFDD....--....D
E6U1C5_BACCJ/13-120---------------------------------------------------------------FDVLVEMVDV--TVMKQ
Q47BJ5_DECAR/11-113---------------------------------------------------------------NFKVKF....--....E
K9X8Y1_9CHRO/10-123---------------------------------------------------------------ITQ.......--....K
Q8ED76_SHEON/12-119---------------------------------------------------------------EAKL.Q....--.D..H
A1T9B4_MYCVP/12-121---------------------------------------------------------------ETML.A....--....G
J1L360_9EURY/12-120---------------------------------------------------------------DLAI.E....--.R..Y
A3QIC9_SHELP/12-116---------------------------------------------------------------EEYQQA....--....S
G2J2S0_PSEUL/12-117---------------------------------------------------------------EAAL.R....--.DG.K
D5CNM7_SIDLE/10-114---------------------------------------------------------------LYKLKA....--....P
Q093V7_STIAD/21-127---------------------------------------------------------------RNR.......--....Q
W8S663_9RHOB/15-124---------------------------------------------------------------TLLVDE....--.MEGL
A9GPD9_SORC5/60-166---------------------------------------------------------------SES.......--....G
Q11I87_CHESB/20-127---------------------------------------------------------------EGAYQL....--....H
C1DA99_LARHH/12-113---------------------------------------------------------------LDYKMR....--....K
B3QXG2_CHLT3/14-123---------------------------------------------------------------.........A--LGKKH
H2FUI0_OCESG/21-126---------------------------------------------------------------EQEL.A....--.AMDQ
E1QK88_DESB2/12-119---------------------------------------------------------------AQASHQ....--....T
W8S5M5_9RHOB/17-125---------------------------------------------------------------NTLFDA....--.VPKD
I4EWX0_MODMB/5-112---------------------------------------------------------------RGEI.A....--.A..G
V5XBD7_MYCNE/12-121---------------------------------------------------------------EDLG.K....--....S
D5B9R0_ZUNPS/6-111---------------------------------------------------------------HNII.E....--.K..G
F5XYL0_RAMTT/15-117---------------------------------------------------------------.....AFTRH--GGDRR
Q1ZBL2_9GAMM/21-125---------------------------------------------------------------DSAL.A....--.SVKE
A3QF38_SHELP/12-119---------------------------------------------------------------ETKL.Q....--.D..H
Q3JB38_NITOC/16-125---------------------------------------------------------------EGKLEK....--....H
D6XVY9_BACIE/11-115---------------------------------------------------------------...LEAHFKE--MKAGH
Q2YCI1_NITMU/10-113---------------------------------------------------------------LRKAGR....--....E
C6Y0C1_PEDHD/12-119---------------------------------------------------------------EKQS.E....--.Q..Y
B1LYM2_METRJ/12-117---------------------------------------------------------------KADL.D....--.K..G
Q7MEX7_VIBVY/25-130---------------------------------------------------------------EAAL.A....--.GINR
Q12ZF4_METBU/12-119---------------------------------------------------------------EDKV.K....--.E..Y
L0G526_ECHVK/12-117---------------------------------------------------------------HNIL.K....--.T..G
F4C7J2_SPHS2/12-119---------------------------------------------------------------QKLA.A....--.S..F
B0BYZ0_ACAM1/12-117---------------------------------------------------------------KLDI.S....--.R..H
A6Q671_SULNB/23-127---------------------------------------------------------------DKAL.K....--.EAKG
A0LXE0_GRAFK/144-249---------------------------------------------------------------..........--....K
W8EUS5_9BACT/21-126---------------------------------------------------------------YKML......--....N
H6L5S2_SAPGL/58-159---------------------------------------------------------------..........--....G
G8R3P5_OWEHD/12-122---------------------------------------------------------------.........P--KMESP
W0RC97_9BACT/11-121---------------------------------------------------------------PNRLTDMTDV--TGVEV
C6C2B1_DESAD/11-117---------------------------------------------------------------KAKMKD....--....E
H6L5W0_SAPGL/30-131---------------------------------------------------------------AEAQ......--....G
D9QNG3_BRESC/27-134---------------------------------------------------------------SQAMEA....--....F
G2KMS4_MICAA/16-122---------------------------------------------------------------........RA--IQQKN
H6L0F3_SAPGL/30-131---------------------------------------------------------------..........--.....
A0LXC2_GRAFK/12-117---------------------------------------------------------------HEIL.E....--.T..N
Q2RZR2_SALRD/34-139---------------------------------------------------------------EDQFAA....--.HITT
G2KMS2_MICAA/25-131---------------------------------------------------------------NAIIEK....--....H
G0L8K0_ZOBGA/13-125---------------------------------------------------------------QEKIDE....--...GY
Q82UI4_NITEU/10-112---------------------------------------------------------------LYQFHF....--....N
I1YHY0_METFJ/11-119---------------------------------------------------------------DELVMQ....--.SAGI
C6X1D7_FLAB3/12-118---------------------------------------------------------------AAKV.N....--.T..F
I4ANF2_FLELS/25-134---------------------------------------------------------------SKMIANNLKS--EVVSS
V5WM94_9SPIO/3-107---------------------------------------------------------------..........--.....
X2HCK2_9NEIS/13-113---------------------------------------------------------------LKAIEH....--....I
S6ATB1_PSERE/11-120---------------------------------------------------------------AELASQ....--.SEGI
E6WYT5_NITSE/23-127---------------------------------------------------------------EHAI.E....--.AARD
D5BJR6_ZUNPS/18-118---------------------------------------------------------------..........--....E
C7RNF8_ACCPU/11-113---------------------------------------------------------------NYAIQF....--....E
A8ZX31_DESOH/24-127---------------------------------------------------------------..........--....D
H0PYZ6_9RHOO/10-113---------------------------------------------------------------NYKVKF....--....E
F0JGN8_DESDE/12-119---------------------------------------------------------------EKAI.G....--.DG.G
A9GPD8_SORC5/37-144---------------------------------------------------------------RDS.......--....G
G2KMS3_MICAA/30-137---------------------------------------------------------------DAAIAK....--....Y
Q31FZ2_THICR/21-125---------------------------------------------------------------DSAL.K....--.GVKD
A9GPE2_SORC5/23-130---------------------------------------------------------------TDS.......--....G
X5E3H4_9BACT/12-117---------------------------------------------------------------DKAV.K....--.DFG.
M1NQM0_9CORY/12-118---------------------------------------------------------------QQVI.D....--.R..E
A0M0L9_GRAFK/12-115---------------------------------------------------------------KNHI.Q....--.S..N
A6Q807_SULNB/11-120---------------------------------------------------------------DEFITL....--.SKEI
C6BYE1_DESAD/13-119---------------------------------------------------------------QKTI.T....--.EH.G
Q73Z58_MYCPA/13-121---------------------------------------------------------------EKSL.K....--....S
K9RD27_9CYAN/12-117---------------------------------------------------------------..........--.RGVE
D9SJ90_GALCS/11-114---------------------------------------------------------------LYKLQS....--....P
W6RYK2_9CLOT/10-116---------------------------------------------------------------NCLVDATKLE--GVDGK
H8N2H1_CORCM/12-120---------------------------------------------------------------WSALVDQSRL--RVMPA
I0KHL1_9BACT/11-115---------------------------------------------------------------DTTL.H....--.S..A
A6VRW9_MARMS/21-125---------------------------------------------------------------EAAI.Y....--.SIHS
C7R9R1_KANKD/12-118---------------------------------------------------------------DPVI.E....--.K..A
A4FCH9_SACEN/14-119---------------------------------------------------------------DAAR.R....--.E..N
Q6LS91_PHOPR/11-120---------------------------------------------------------------DEFVDK....--.TKDV
G8QLC0_DECSP/10-113---------------------------------------------------------------NFKVKF....--....E
M4S571_9SPHN/11-120---------------------------------------------------------------EARL.D....--.R..H
A9B5K6_HERA2/29-133---------------------------------------------------------------..........--.....
A4VJY0_PSEU5/11-120---------------------------------------------------------------DDLLFK....--.SEGI
I3Z121_BELBD/12-117---------------------------------------------------------------TNRL.G....--.N..Y
A9ENE2_SORC5/23-130---------------------------------------------------------------SES.......--....G
E4TRL3_MARTH/24-128---------------------------------------------------------------DLCQQPHIKN--WLQNN
A1SAI8_SHEAM/12-116---------------------------------------------------------------KSYRED....--....W
K9SIP1_9CYAN/14-118---------------------------------------------------------------EKFI.A....--.Q..Q
I5B5J2_9DELT/12-119---------------------------------------------------------------RKKIKK....--....N

PF01740

SUT22_ARATH/540-662---SGVFALEELHQELA.S------------------NDI----------------------------------------
RSBRD_BACSU/161-267---MVAYQIFKVIDSTK.L------------------LGI----------------------------------------
S26A2_HUMAN/569-715---AGIHTLKEVRRDYE.A------------------IGI----------------------------------------
O45016_CAEEL/553-725---MGQGALKDVYNDYK.T------------------IGI----------------------------------------
SULP3_CAEEL/546-696---LGLSTLKSVYVDLQ.A------------------AGI----------------------------------------
D6EY97_STRLI/11-115---SGLRLLYRARSQVL.D------------------GGG----------------------------------------
O04001_SPOST/529-651---SGVAFLIDIKKSIE.K------------------RGL----------------------------------------
SUT32_ARATH/505-623---SGISMLEELNKILG.R------------------REL----------------------------------------
Q55814_SYNY3/440-540---TALLAIETMLKDAL.A------------------KQR----------------------------------------
RSBV_BACSU/4-107---TGLGVFVGTFKMVK.K------------------QGG----------------------------------------
O69205_ACTPA/8-112---TGLSLLVEAARRGR..------------------..A----------------------------------------
P73609_SYNY3/4-107---AGLRILVFAKQKMG..------------------SGV----------------------------------------
SP2AA_LYSSH/4-107---SGVGLVLGRMRELE.A------------------VAG----------------------------------------
O84431_CHLTR/3-107---AGIRVLLQSYHQVG.K------------------NAG----------------------------------------
P71568_MYCTU/15-120---SAWSVFISARWQADFR------------------ADV----------------------------------------
S26A1_RAT/529-685---AGMATLKDLRKNYR.A------------------LDI----------------------------------------
P73607_SYNY3/2-105---AGLRLLLYLYRQTT.A------------------NSA----------------------------------------
SP2AA_BACME/4-109---SGLGVILGRYKQVH.N------------------NGG----------------------------------------
YVDB_BACSU/421-528---SAEAVLGNIMNRIK.R------------------HNG----------------------------------------
RSBV_LISMO/4-109---TGLGVFVGAFKSLR.Q------------------RQS----------------------------------------
Q46665_ECOLX/332-437---GGLDAFQRFVKRLP..------------------EGC----------------------------------------
S26A4_HUMAN/536-725---VGVRSLRVIVKEFQ.R------------------IDV----------------------------------------
RSBV_BACLI/4-107---TGLGVFVGIYKAVN.R------------------TGG----------------------------------------
O83261_TREPA/17-124---TGIGSFTAFLKTVK.P------------------KGG----------------------------------------
Y1364_MYCTU/550-649---AGVGALAAACDRAR.K------------------QGT----------------------------------------
O67306_AQUAE/448-564---TGAETIVRLVKDIK.Q------------------KGV----------------------------------------
Q9Z6Z7_CHLPN/2-106---AGIRLLLSNFKLVQ.S------------------LGG----------------------------------------
SUT31_ARATH/514-633---SGISMMVEIKKVID.R------------------RAL----------------------------------------
Q9Z6P5_CHLPN/441-545---SAMHALEEFFLECD.R------------------QGT----------------------------------------
O17951_CAEEL/537-690---MGVSALKEVFSDLR.K------------------KRV----------------------------------------
RSFB_MYCTU/6-111---VGLKILAATSEKIG..------------------QSV----------------------------------------
SP2AA_BACLI/4-109---SGLGVVLGRYKEIK.Q------------------LGG----------------------------------------
Q55415_SYNY3/433-538---TASLALENAIEEAA.E------------------KGR----------------------------------------
SULH1_SCHPO/592-725---TGVQALVDTRKELE..------------------...----------------------------------------
O07728_MYCTU/29-135---CAYAVLAQESVRCR.R------------------RGV----------------------------------------
P72770_SYNY3/438-545---PAARWFKTLSQSLN.Q------------------QGI----------------------------------------
Q9Z841_CHLPN/3-107---AGIRVLLQSYHQVG.Q------------------HSG----------------------------------------
O07488_YEREN/391-488---TSVSALDKVVIKFR.R------------------EGA----------------------------------------
SUT33_ARATH/498-617---NGVSFFKELKKTTA.K------------------KDI----------------------------------------
P73474_SYNY3/396-498---GAVGTVEQIMTKFR.R------------------NGI----------------------------------------
SP2AA_GEOSE/4-109---SGLGVILGRYKQIK.N------------------VGG----------------------------------------
S26A3_HUMAN/526-716---SSVRGLKSILQEFI.R------------------IKV----------------------------------------
SUT41_ARATH/519-638---SAVEALKELYQEYK.T------------------RDI----------------------------------------
O84770_CHLTR/2-106---AGLRTLLSLAKLTQ.N------------------HNG----------------------------------------
RSFA_MYCTU/18-124---CAVAVLAHEAERCR.R------------------RGV----------------------------------------
RSBRB_BACSU/147-272---MVAHQIFKLIEALN.L------------------IGV----------------------------------------
SUT1_STYHA/538-656---SGIHAFEELYKTLQ.K------------------REV----------------------------------------
G2TL00_BACCO/4-109---SGLGVILGRYKQIK.Q------------------KNG----------------------------------------
Y1739_MYCTU/443-553---.......QLRTELL.R------------------RGI----------------------------------------
I6X4W0_MYCTU/31-137---CAFAALADEAQRCR.C------------------RGI----------------------------------------
SP2AA_PAEPO/4-109---SGLGVILGRYKLIN.Q------------------KGG----------------------------------------
SULX_YEAST/572-707---SAAQVLEEIITSYK.R------------------RNV----------------------------------------
SUT21_ARATH/548-668---SGITALLELHNKLI.K------------------TGV----------------------------------------
O83249_TREPA/5-107---SGLGVLISAYDEGL.K------------------YQR----------------------------------------
PHOT_BACSU/148-254---QTADQIFKLSHLLK.L------------------TGT----------------------------------------
RSBS_BACSU/5-111---FIAKVLGDVITMSK.L------------------MGA----------------------------------------
O33206_MYCTU/385-486---SGARALLYFIDHSE.K------------------DGV----------------------------------------
RSBRA_BACSU/151-261---MVAHHIIQASEAVR.L------------------VGA----------------------------------------
SUT11_ARATH/518-636---SGIHSIEELLKSLE.K------------------QEI----------------------------------------
Y1081_THENE/1-106---FSLGVIVNILKSVS.S------------------VGG----------------------------------------
SUT3_STYHA/511-631---SGILALEELHKKLL.S------------------RGV----------------------------------------
SULH3_SCHPO/533-653---SALFAFQRILKEYV.E------------------HQV----------------------------------------
YG35_YEAST/657-777---SAAEGFNRIKRFTE.T------------------KRI----------------------------------------
O33361_MYCTU/29-135---AGISLLCILDEDCR.A------------------AGV----------------------------------------
O83551_TREPA/4-108---SGIGVLIYLCSTVK.K------------------LKI----------------------------------------
P73108_SYNY3/3-107---AILVVLVNTYKELQ.S------------------QNR----------------------------------------
RSBRC_BACSU/163-272---MVAHQLFSLIEALR.L------------------IGV----------------------------------------
Q40008_HORVU/530-648---SGIHALEELLKALE.K------------------RKI----------------------------------------

PF13466

Q310Z9_DESAG/492-572---TLVQLLCAAAAQAK-E.-----------------RGG----------------------------------------
B5HV30_9ACTN/31-112---GAVDLLARLQLAAR-R.-----------------AGG----------------------------------------
A9BX84_DELAS/2-83---AALAVLLACRRTAK-A.-----------------ADK----------------------------------------
Q0K681_CUPNH/47-125---SAVAVLLAWNRAAA-A.-----------------RNQ----------------------------------------
B5H529_STRPR/9-95---AAVDALARLHLTAR-R.-----------------HGS----------------------------------------
Q0RDC2_FRAAA/24-104---AALGVLLGGARRAR-A.-----------------AGR----------------------------------------
D1AD83_THECD/187-267---GALAMLARAA.DAR-P.-----------------RGG----------------------------------------
D2SCD5_GEOOG/29-109---EGLRVLAAGEALAD-S.-----------------RGC----------------------------------------
A1VK31_POLNA/2-82---SALAILLECRRQAM-A.-----------------AGK----------------------------------------
A8ZVX1_DESOH/4-85---SFFQVICSAARSFA-Q.-----------------RDK----------------------------------------
Q3SFW3_THIDA/281-359---GSVSQFISVLMQCL-G.-----------------SGK----------------------------------------
B9TGW9_RICCO/228-309---AGLALLLEWLRIAE-V.-----------------KQK----------------------------------------
A1W422_ACISJ/2-83---SALAVLLECRRAAV-F.-----------------ENR----------------------------------------
A1U461_MARHV/15-95---VVLSMLLCWQRLAL-S.-----------------RHC----------------------------------------
Q21UA2_RHOFT/4-85---SALAVLLEFRRAAL-A.-----------------QGK----------------------------------------
B1Y2Z1_LEPCP/2-84---SALGLLLSCRRHAQ-T.-----------------HGR----------------------------------------
Q8EEQ5_SHEON/14-91---AGLQWLLALKGL..-N.-----------------VVQ----------------------------------------
D2S5L7_GEOOG/30-110---AGIRGLGTAYRRAL-R.-----------------HDR----------------------------------------
A7MNS4_CROS8/14-91---AGLALLVHLVALTQ-A.-----------------GGR----------------------------------------
B9JTP2_AGRVS/23-100---LCAQVLVSGAKTWE-E.-----------------DQK----------------------------------------
B8DPA7_DESVM/571-651---TLVQLLQSAAVTAR-A.-----------------RGV----------------------------------------
C6C1P3_DESAD/15-93---GGASLFMMMKAGCR-D.-----------------RGS----------------------------------------
E3I167_RHOVT/14-94---SILQVLIAADIAGE-K.-----------------LGR----------------------------------------
E3IYM7_FRASU/24-104---PGLAALLRADLLLR-R.-----------------VRG----------------------------------------
C1D624_LARHH/5-83---AALALALELSREAG-Q.-----------------HGH----------------------------------------
A4YXB4_BRASO/320-399---RFLGLLLMLRKQLD-S.-----------------QGC----------------------------------------
D1C014_XYLCX/37-113---SGVAFLARLATRM.-..-----------------.PQ----------------------------------------
C6WD00_ACTMD/919-1001---SGVALLLEAAEVAA-G.-----------------RGR----------------------------------------
E3J1T6_FRASU/56-136---GGLRALVASAGNLH-R.-----------------DGR----------------------------------------
C6WQ84_ACTMD/60-139---AGLAALTAAYLRAG-G.-----------------RTR----------------------------------------
Q2SPQ4_HAHCH/13-91---AALQLLLAVQKRQL-S.-----------------HGG----------------------------------------
D2SFP4_GEOOG/531-612---AAVRVVLAMARIAG-E.-----------------EGW----------------------------------------
D2B5R7_STRRD/72-150---RGTWLLAQAAHSL.-P.-----------------TGK----------------------------------------
B8DLB2_DESVM/179-259---AGIAVLAELVRHAR-G.-----------------LGR----------------------------------------
D0KYU0_HALNC/26-108---AGVAFLLGWQAEAA-A.-----------------QSV----------------------------------------
D5X3Z8_THIK1/566-644---SSAGALLNWAMMQH-D.-----------------QGK----------------------------------------
B9J943_AGRRK/10-87---LCIQVIMAAAKTWD-E.-----------------DKL----------------------------------------
B1W2W2_STRGG/20-107---TLVEAVARLALVAR-R.-----------------SGR----------------------------------------
A1SBD9_SHEAM/6-85---AGLQLLLCLQSHCE-N.-----------------SSI----------------------------------------
A0LC67_MAGMM/14-94---SVLGMFLMLRAHAG-E.-----------------AEA----------------------------------------
A4YMN9_BRASO/16-97---ASSGMLMFLSATAK-S.-----------------KNK----------------------------------------
C7LTF6_DESBD/15-91---SFVQILCSLLK...-D.-----------------EDK----------------------------------------
B1LTK1_METRJ/26-107---LGAWVLERTRAEIE-Q.-----------------AGS----------------------------------------
Q0RZA3_RHOJR/48-126---AALAVLADAGTRLR-E.-----------------QRS----------------------------------------
C5BID3_TERTT/281-360---SFIAFLLLMDCRLQ-K.-----------------YHS----------------------------------------
Q2SBJ1_HAHCH/18-100---VLISLLLRLVAAAE-A.-----------------KGL----------------------------------------
B5HHQ5_STRPR/28-107---ACAYGLLRAVTVAP-E.-----------------A.A----------------------------------------
Q1QXI2_CHRSD/17-99---TALGFLAKVAMAVE-GR-----------------LEQ----------------------------------------
Q12BT3_POLSJ/427-501---TCLGTVHELVG...-..-----------------.RG----------------------------------------
C9R4W7_AGGAD/20-98---AGFALLCDFLNERK-Q.-----------------L..----------------------------------------
D9T369_MICAI/189-267---R...SLLHLRDHAR-R.-----------------HDA----------------------------------------
Q31HM4_THICR/6-86---SGLQALLALIKSAM-A.-----------------NQK----------------------------------------
Q31GZ5_THICR/18-93---SCLALLLYFQSLI.-..-----------------.DH----------------------------------------
A7H922_ANADF/18-92---LGVAALAHGLAGG.-..-----------------.RQ----------------------------------------
Q21SV7_RHOFT/514-592---SAAGSILNWVALRE-S.-----------------EGC----------------------------------------
A3N1T8_ACTP2/20-99---AGFTLLAELLNYYQ-K.-----------------Q.T----------------------------------------
B2FP86_STRMK/2-73---AGLALLAELAARAR-K.-----------------AGH----------------------------------------
F9ZTS0_ACICS/20-97---ATLALLLDWQERAL-Q.-----------------RKR----------------------------------------
Q2IMF1_ANADE/97-172---FGLAVLAQALS...-A.-----------------RGI----------------------------------------
Q3J3N5_RHOS4/5-82---LALQLLLAAAAKWR-A.-----------------EGH----------------------------------------
Q3J659_RHOS4/7-80---AAVQVLVSAARTAG-A.-----------------TGR----------------------------------------
Q6DAF4_PECAS/14-89---AGLALLMHVYQQP.-S.-----------------SGG----------------------------------------
Q87LF2_VIBPA/15-93---AGMVMLIHLLEHAK-K.-----------------QNC----------------------------------------

PF11964

L0GYF4_9GAMM/12-118....PVRLLVELI.DF..HG...WDPKA...AW....DDF.............K.LGI....RH.......YADFE....
W8EVU9_9BACT/23-129...HAVRWLVNL............................................................HGMP....
D5V1Z3_ARCNC/21-125...PKIRAICDCT.EL..EG...WELKA...AW....DDL.............K.IGL....KH.......GNQFE....
Q11VP6_CYTH3/12-119...DTLNYMLVLDTSV..KD...FTAGA...WF....KDA.............V.LGV....KN.......LTKWN....
A5FC98_FLAJ1/11-118...NEINFLLVLDTDI..KN...FTAGA...WL....QDA.............L.LGL....KH.......LGKWN....
Q28QM9_JANSC/19-126...EKVDMLLDL...........TAFTGSDWDSMLDGDVI.............K.SRF....RS.......LSEVR....
Q093V8_STIAD/17-124...ETLYLLGDLRLSTGFSPQA...............RRS...............MGENPHP..........VQYK....
E0TIJ6_PARBH/12-118...VDAGLLVVME.EL..EGYERWQAA.....L....SDL.............K.ADL....RY.......NDRFA....
Q3SKE6_THIDA/10-113...GKVNLLFDL......RDMLSYSVDV...AW....EEL.............K.FSR....EH.......KNDFG....
Q3ID73_PSEHT/20-125...PIVKVLIDGS.QL..EG...WGIRA...AW....DDL.............K.LGL....KH.......GKNFK....
B2HRZ3_MYCMM/12-119...DKVRIYYEIGSDF..GG...FDPGA...MW....EDT.............K.LGF....SH.......FLRWE....
J7Q7E4_METSZ/12-118...DKIRIYYEIAPDF..SG...FDPGA...MW....EDF.............R.VGM....EH.......LTRWE....
E8X7D9_GRATM/13-120.......LTGMLGS.....G...W..GA...RW....DEM.............R.FLQ....RH.......TAHIS....
Q3J4W4_RHOS4/41-148...ESVDMLVVLPEFTGL.T...PAAAL...DL....EGL.............K.AGF....RS.......LGKVR....
F0SJ20_RUBBR/12-119...GSIRMLEVI.RSI..E....TPPIPWSKFW....DNF.............K.FEF....EH.......LSDIT....
D5SV07_PLAL2/13-118....KLRLLFEMH.DF..HG...WTMGA...LW....QDI.............K.FDF....KH.......GKDIE....
A4XX57_PSEMY/12-120...EHGKMFYRVGS.........FEWPT....L....GAV.............G.VELKRIPQLLRL....IRQFD....
A0LIB8_SYNFM/14-120...K.VRLLATL.DDF..EG...WRKGA...DW....GDI.............A.FFM....TH.......GNDVA....
I4C386_DESTA/12-119....SARFLFFMDKDF..GG...WTSGG...FW....DYA.............K.FGT....KH.......QNDFD....
I4AGM8_FLELS/70-181...DTSGLLVDA.........................................MELGYVSMFARAWLMLDWMPRMQ....
M4SAG0_9SPHN/140-247...SPLKILVRMKRYDGF.A...PAILA...DP....KIV.............E.RKL....SL.......LHRVS....
F0SJC2_RUBBR/13-118....KIRLLVVLH.DF..HG...WDAGA...MW....EDI.............K.FDL....HH.......FRDIE....
M9R3U0_9RHOB/11-120...SNGVMMYKIPS.........FSMPT....G....GAL.............A.AEMMRLPKLFSL....IKHFS....
A9WJT9_CHLAA/12-112...KPTDLLVDG.........................RRI...............SGADRGARQRTEAIVHHKHLG....
W8EZJ6_9BACT/24-132...DSSEVYGDW...........................................WKAGEWVGQVFAFELGKRGIR....
Q8EB52_SHEON/21-126...PDIYALVDVT.EL..DG...WELQA...AW....DDL.............K.LGV....KH.......IRHFE....
L0K3H2_9EURY/13-119...GSAKLLLDLSGVSDS.Y...AEFDA...YE....EDF.............G.FYL....RH.......GEDMD....
B1MER2_MYCA9/12-121...DELRIVEVIASDY..EG...FGPGG...LA....EDL.............K.LGLGMLFQH.......HSAFK....
F9ZWL7_METMM/13-118....TLRLLFDMT.DF..HG...WELSA...AW....EDF.............K.FGI....DH.......FADIE....
X5E4J9_9BACT/13-117...QSNQLLKEF.............................................................EIS....
E4TNT7_MARTH/14-124...QQIAITFDAN........................KAV...............IPK.............LSHQR....
Q8TPB5_METAC/12-119...GKIRMLYQLGPNF..TG...FTYNA...MW....DDA.............K.VGI....WH.......LTAFE....
A3QHM0_SHELP/21-124...PEIVALIDIT.EL..DG...LSLHA...AW....DDL.............K.LGL....KH.......GKEFK....
B0JM20_MICAN/12-118...GGLAGVIIEVPKF..TG...WESFG..ALV....AHF.............R.LIR....DH.......HKYVS....
Q7UVW9_RHOBA/74-179...GSVRILVHLR.DF..RG...WNLRA...FD....PNP.............G.LGL....QG.......DEEVE....
A4FCH9_SACEN/137-244...GDLHGLVVHAREF..PG...WQNFP..SLL....RHM.............K.FVR....DH.......HRRIG....
A0LXE0_GRAFK/12-118...KKIKILGIY.........................KDFPGFENFKAFNETLK.LKA....KA.......FNAIE....
E1RHG3_METP4/12-115...GKISWLFVI......KTGRYETVRA...FY....EDI.............S.WLL....RN.......LKHFD....
G2J2P9_PSEUL/12-113...GKPDIFLDL......SELKDFTIDM...AV....EEL.............R.FVR....AH.......DKELG....
A5G4W5_GEOUR/116-227...EDVKLLVMVGEDF..CG...WVGGE...VW....NDM.............T.FFV....HY.......GDRIA....
A3CYB3_METMJ/12-120...QNVRILLKIE.GF..RS...WRPGE...GW....DAF.............K.QWP.....G.......MEQVD....
Q5V739_HALMA/20-132...GYIHVYEEV....................................PNWTFRAFLTHLHGVVPDLRYGPEFDID....
I4C4Z7_DESTA/12-119....KAKMLLYLPGDF..AG...WEAHA...AW....DDA.............I.FGL....RH.......RNDFE....
M4NFH5_9GAMM/12-119...RKLRLLYVTADDF..TG...FDPGA...MW....DDA.............K.LSL....RH.......FSGWD....
A1S706_SHEAM/12-119...ASVRIWYEIADGC..RG...VSLLS...LW....QDV.............L.LGL....FH.......LDDFR....
M4V983_9DELT/11-119...QKVSIYADLLDLNHVTAQAVAKRIA...........................YSIAKIGE........WHRFP....
D4ZLE1_SHEVD/12-119...ASIKLWYEFDEGF..KG...ITVET...LW....DDA.............M.LGF....FH.......LTDFS....
B2HE07_MYCMM/27-133...GDLAGLILNAPSF..PG...WDSFG..AMV....NHF.............R.FIR....DH.......QKHVK....
J7L4H1_NOCAA/12-117...GAARLLVRI......HGRPSTETPT...LE....ERL.............R.FAK....EH.......LHDIE....
F2LY86_HIPMA/12-118...RKIRILYHVTKEF..KS...YQLKA...VI....DDA.............K.AGL....MF.......FNAWE....
F0SJ19_RUBBR/12-119...GKIRLLKHV.RSI..Q....FPPIPMSRMW....DDF.............K.FVH....EH.......LGDIT....
Q3JB38_NITOC/148-256...DKVRLLNRMRHFGGI.D...PAVFM...QG....GLV.............S.MKL....AA.......MQKVE....
W8EXL7_9BACT/35-135...GWYRILIDQ...................................RQMRAFSTAEQQWIVQEWLPRAVTEGGYR....
H8MXZ5_CORCM/21-129...KPLYLVADLSTSEGLSVAP...............RKY...............LAKHLSP..........TWFR....
E1RH74_METP4/11-116...ERINIMFKT.........................ENFEGRTAHAAWDDFINWPK..............IAAVN....
K9XV53_STAC7/12-117...GQIRILVEF......IQMQGLEASA...FW....EDL.............R.FSL....TH.......FKDIS....
A5FDC3_FLAJ1/11-118...NEINFLFLIDNKV..EN...FNTSA...WL....EDT.............L.IGL....RN.......LGKWN....
G8RQ72_MYCRN/12-121...DEVRIVEVIAPDY..DG...FGHGG...LV....EDL.............K.QGFGVLIKH.......HSAFK....
Q07X46_SHEFN/12-116...NQVCLYIEA.........................DVL...............LEGWEFGSLTGSGEVQLPAFD....
A9GPE4_SORC5/20-127...REVFVLADARRVGTLTAAA...............RSA...............MAEELRG..........VRFG....
G2KMS5_MICAA/17-122...GEIRMVLLF.........................EKF.............LGWEEEAAMADLASTLFLARHLK....
Q6MQZ1_BDEBA/34-138...GEVSVLEEV.........................RDI.............GKVELAAFWKDLRFGIKNLKKIP....
E3FV03_STIAD/12-119...EAANMIRDV......................................................QEFGLRSGVK....
D2QV97_SPILD/12-116...PFPRLYWEME.YF..RG...WQPEE...LW....RDL.............Q.FDL....TV.......TADFA....
Q7NXU0_CHRVO/12-113...DKPDMLLDL......TELKDFTLDM...AM....EEV.............K.FMR....AH.......EEKLG....
D5ER41_CORAD/12-118...KKLSCLYQLGPDF..EG...FEPAA...LW....NDA.............S.IGM....RH.......PFSWT....
A1SV34_PSYIN/12-119...AVLNGILIDAESF..PG...WENFA..GLV....SHL.............R.FIN....QY.......EKKVK....
B3QUM5_CHLT3/13-124...KGTSLLFDF................................................SEAYIDADYYELDRLRNYIS
G0J0D1_CYCMS/13-117...NKVDFYFELE.NL..RR...YKLEG...LW....EGL.............K.VDT....AH.......LSDYG....
A0M0N9_GRAFK/12-117...LNVRWYFEME.NF..TG...WDFPG...LW....EDL.............K.MDT....AH.......AKDYE....
Q1CW14_MYXXD/23-128...GQYYLIADIGRSQ.LEAAG...............RRY...............MSEKASS..........DWYH....
Q6AK92_DESPS/134-240...EPVHLLLDLR.DF..NG...WQGLA..GVI....EHL.............H.LVI....QH.......RHVPK....
V5WKN4_9SPIO/39-142...GEVNLLTVIENGGKTNHVKNSIQRQ...........................FSKSAGPHVHKSAVVGASGMI....
A6Q9H2_SULNB/14-120...GKLNGIIIYTKSF..PG...WEDFA..ALS....RHI.............T.FVK....NH.......HQKIR....
F8GCM7_NITSI/10-113...GKANLLFDW......RDMLDYTVDV...AW....EEI.............K.FMR....DH.......GSEFN....
C4ZLU4_THASP/10-113...GPVDLLFDL......RQMAGFTLDV...AW....EEI.............K.FSR....QH.......AGDFR....
Q6AK92_DESPS/12-119...NRLKMLCQMGPEF..DG...YTSGA...AW....DDT.............Q.LGL....KH.......WKGFE....
F0M0B1_VIBFN/20-125...PKVKVLFDAT.AL..HG...WELRA...AW....DDF.............K.LGL....KY.......GSDFD....
A6WZX1_OCHA4/19-126...EEIDLLIRLTGYEGF.D...WTAAF...SE....SML.............S.MRS....KS.......LKKLR....
E3FKU0_STIAD/13-119...TMVAVMAKL......................................................NAFAQLKGMK....
Q0AQY4_MARMM/16-124...DFMTILTRA...................................SLSAMPGPAMTELQTRMAKADPVKSGPRR....
Q6LKJ4_PHOPR/20-124...PIVNVYIDGT.EF..DG...WQLQA...AW....DDL.............K.IGL....KH.......GKKFD....
D5BJF0_ZUNPS/25-118...KEYPVFCDL....................................................................
C7P248_HALMD/57-169...DTVHLYEET....................................VDWTARSALSNCYGILPDLRRGSSFDIG....
A1S9K0_SHEAM/21-126...PDIYMLVDAT.EL..DG...WEARA...MW....DDL.............K.LGI....RH.......GRHFE....
D3FPZ4_BACPE/12-117...GKIKILVRL......NEMAGVELSA...ID....DRL.............A.FTK....EH.......LSDIE....
Q087X8_SHEFN/21-125...PKVSLFLDAT.EL..DG...WDLRA...AW....DDL.............K.LGL....KH.......KSEFE....
C0QCX2_DESAH/11-120...EKGRMLYDIVD.........YNLPS....F....GAI.............G.IELSRFPSMFAL....MKKFD....
Q1LPD1_CUPMC/12-120...EKVRLYYELGPDFTITS...MEPGA...LW....DDF.............K.LGV....SH.......YLKWE....
A3HTM6_9BACT/12-125...DPINILIKLDELKIS.K...SSIKT...FF....EDI.............I.YTL....RN.......YKLMG....
F7XLD9_METZD/12-119...EKICFLYHLDENF..DK...FTREA...LL....EDA.............K.VGK....EY.......FTSFE....
B1WXR6_CYAA5/19-124...DKLRILEEI.RSF..DG...IDPIA...LW....KDV.............R.FGF....GY.......INNFT....
D0J5L7_COMT2/12-119...PKLHGVMIQSKDF..PG...WENWA..GFS....AHM.............G.FVR....DH.......RHQVE....
H6L5W1_SAPGL/20-121...EGLWLLSDLRQMKKTNQEV...............RSA...............LSSGKIV............AV....
B7VP41_VIBTL/20-124...SKLKMLVDIS.TL..TG...WELRA...AW....DDF.............K.LGL....EL.......NSKID....
K0NMI2_DESTT/11-120...ENGKMLYDVID.........FHIPS....I....GAI.............V.IEFSRLPSMFGL....IKKFS....
F4CCE8_SPHS2/23-130...PQINFIVLLETGF..ED...YSLQA...LL....EYI.............K.VSF....EH.......FSKWN....
G8PHU6_PSEUV/12-120...AKVSVLVIL.........................NEK.............AHWGIEAGYEDLKWAMTHAKSFH....
A0M5Q5_GRAFK/11-116...EKVNVYIEL......EKGRHITFSA...LM....KGI.............K.FKY....SN.......SEHFD....
A3CYB0_METMJ/12-120...PVLRILFHIV.SF..HG...WKPHG...YW....EKL.............K.DWP.....G.......MEKVD....
F4AVZ8_DOKS4/11-116...DKINIYLED.........................DDV.............DEIEIRAFIDHTFFDISYAKRIN....
I3YWJ5_AEQSU/12-117...GTIKFYVEIDELQ.......YTAKA...MW....EDF.............K.DGL....HY.......WRDIK....
Q083D4_SHEFN/12-118....KISLLFEFD.NF..SG...WDLDA...AI....DDI.............K.FGM....KH.......LSDFE....
B0BYZ0_ACAM1/138-242...GKVKVLEEI.RSF..EG...MDPMA...LW....KDL.............Q.QAY.....M.......VKDIT....
E3FWM2_STIAD/2-108...GRIYLLVDASHGSGYSHEA...............RRA...............IGEEPRL..........SPYT....
D5B9R4_ZUNPS/12-117...LKIRWYLEMN.DF..QG...WHIEG...LW....KDF.............S.KDV....GH.......EKEYE....
M4SAG0_9SPHN/11-120...H...IFVEVLD.........LQSIA....P....DAL.............L.FDLRHVLHYLAR....LRQFG....
I4AIU7_FLELS/23-135...SRAWLVLKF....................................................IPMLQKQLGTNF....
A5GKD8_SYNPW/21-126...DRLRLVFDAR.EL..VG...WEPQA...AV....DDL.............R.LGL....RH.......GRHVE....
A9GKE1_SORC5/12-119...EATELLRDI......................................................AATSTAMGVI....
E1V9S9_HALED/39-147...PRISLYAEI.........................DDI..........RWMTFTAFLRDLGYGLTQIGDMDRYY....
A8LJW8_DINSH/13-117...GPLSLVEVI.........................DSF.............EGFDARTLWDGLKFDLAHWSEFR....
C5BJV0_TERTT/11-120...ENGGVLFDVVD.........YHLPS....F....GAI.............A.IELWRLPQVLRL....LRRFS....
S6B665_9PROT/11-113...GRVNLLIDL......RDMARFTVDV...AW....EEI.............K.FTR....EH.......RFDLW....
G0J0C5_CYCMS/12-117...QKVRWYFEMQ.DF..TG...WDMKG...LW....ADL.............K.MDL....SH.......ANDYE....
Q1CYP8_MYXXD/13-120...DVVTAMASL......................................................NAFAQLHGMK....
I0JIE9_HALH3/13-116...QNFKVLAFVPELNG......STLEG...FW....EGT.............K.VNL....KR.......WRQFS....
E6U1C5_BACCJ/13-120...DTREELVKH......................................................QEWLKEAGMK....
Q47BJ5_DECAR/11-113...GPVDLYFDL......SQMAGLTLDV...AW....EEV.............K.FSR....AH.......ANDFK....
K9X8Y1_9CHRO/10-123...EPFAILAIAHEDNSKNREKGVNSTI.........GKW...............IKHNK............PQLT....
Q8ED76_SHEON/12-119...ASIRLWYEFSADF..IG...ITVGA...LW....DDA.............L.LSV....FH.......FSDFS....
A1T9B4_MYCVP/12-121...DEIRLVEVVSDDY..QG...FGPGG...LV....EDL.............K.MGLGTLVRH.......HSGFR....
J1L360_9EURY/12-120...GTVRVLVDIV.DF..KG...EDFGA...MA....DDL.............I.QDI.....K.......VSSVE....
A3QIC9_SHELP/12-116...GKVCLYIEA.........................DVL...............LEGWESQSLSGVGELQLPRFD....
G2J2S0_PSEUL/12-117....KARLYAQFD.DF..HG...WDLHA...VW....DDM.............K.FGT....RH.......YADFE....
D5CNM7_SIDLE/10-114...GKINLLFDL......RGMLAYTPDV...AW....EEI.............KFFRR....EH.......NHDFN....
Q093V7_STIAD/21-127...GPLYLLGDVRQSTGYSLES...............RQA...............IGAEKER..........VPYT....
W8S663_9RHOB/15-124...HHGACLMRAEG.........VAWPS....L....GAI.............G.VEIRHWVQMMAM....VEKLD....
A9GPD9_SORC5/60-166...RAVLVLSDARRTGTISASA...............RKV...............MAEELRG..........VRFD....
Q11I87_CHESB/20-127...DQIDVIVIIHDYEGIDWGGAWKEQA...YL....QKV......................KA.......LKHIR....
C1DA99_LARHH/12-113...GQPNVLLDL......SEVMDFTIDM...AI....EEL.............R.FVR....AH.......QHDFG....
B3QXG2_CHLT3/14-123...QTNHYLVDI................................................RQVEITASKVEILRLPKTQY
H2FUI0_OCESG/21-126...PRILALVDLT.GF..SG...WEARA...FW....EEI.............R.FTQ....QH.......GDDFS....
E1QK88_DESB2/12-119...GKFRILLDFDEDI..KG...MTMTE...AI....EMA.............S.FVI....EQ.......QGQLE....
W8S5M5_9RHOB/17-125...QKIDMLLVFETERSA.E...PGANW...SV....DAM.............K.AQA....KA.......VTSVR....
I4EWX0_MODMB/5-112...RKIRLLYLLGAEM..GE...YEGDT...LT....EEM.............Q.FAV....RH.......PSAYE....
V5XBD7_MYCNE/12-121...AEIRIVEVIDQDY..DG...FGPGG...LT....EDL.............K.MGFGALLHH.......HSAFK....
D5B9R0_ZUNPS/6-111...HKVDFYFEME.DF..KG...YTLKG...FW....EDL.............K.IDS....AH.......LGDYG....
F5XYL0_RAMTT/15-117...ALANLLAVE.........................................GQLAFTQHFQMGHQVARQLGHLE....
Q1ZBL2_9GAMM/21-125...PKVDVLIDGT.EL..EG...WELRA...AW....DDF.............K.LGL....KH.......NNEFN....
A3QF38_SHELP/12-119...STIKLWYEFSEEF..EG...VSVET...LW....DDA.............K.LGF....FH.......LTDFS....
Q3JB38_NITOC/16-125...GQLSFLIDF......TGLSDMNANA...FV....EGT.............K.ADLEFL.GH.......IDRFS....
D6XVY9_BACIE/11-115...SQVKMLLVI.........................DNI.............H.VTLKGLIEDLKFDMKYWNDFD....
Q2YCI1_NITMU/10-113...GKVNVLFDW......RDMLSYTIDV...AW....EDI.............K.FVR....EH.......GSEFN....
C6Y0C1_PEDHD/12-119...KEIYYLLVLETDV..QN...FTAGA...WI....QDL.............I.AGI....KH.......LTEWK....
B1LYM2_METRJ/12-117...GKIKLLEDI.RAF..EG...MEPAA...FF....KDP.............R.FGF....SM.......MKSVS....
Q7MEX7_VIBVY/25-130...QQMNMLADIS.EF..SG...WEPRA...AW....DDF.............Q.LGL....KI.......GFNVN....
Q12ZF4_METBU/12-119...GKIRVLYQLGPDY..EK...FSRKA...ML....EDM.............E.LGV....KN.......ITSFD....
L0G526_ECHVK/12-117...KKVRWYFEME.NF..TG...WSIEG...LW....ADA.............K.MDL....SH.......AKDYE....
F4C7J2_SPHS2/12-119...GEIYYLLILNTSV..QN...FDSSA...WL....QDM.............L.AGI....KY.......FNKWK....
B0BYZ0_ACAM1/12-117...GKLKLLEEI.RSF..EG...IDPIA...LW....KDA.............Q.FGL....SH.......VNDFS....
A6Q671_SULNB/23-127...LEVDLLVDMR.KF..KG...WEMLA...AW....DDF.............K.FGI....KH.......RNKFD....
A0LXE0_GRAFK/144-249...EEIKLLAIL.........................KNF............KAYKDINVLLSGIKADFSALNKVT....
W8EUS5_9BACT/21-126...DNSQVSSEWEKGARWVGTEYYRLLA...........................................QQGMR....
H6L5S2_SAPGL/58-159...QALLVLVNLHQMPSLPIEV...............RKH...............LRSKEVSQF.......HENSK....
G8R3P5_OWEHD/12-122...GNIKLYVEIPRYEGTDWEVVWHSLK...........................FAIGKLKTY.......FSKVD....
W0RC97_9BACT/11-121...GFAEFLAFT...................................................ERRLGMVLPNPIK....
C6C2B1_DESAD/11-117...ERIAVYVEVEEIGG......ISFNA...LI....EDL.............K.FAL....PN.......LKRFS....
H6L5W0_SAPGL/30-131...KNIFIYIDVSTIGGISADA...............RKY...............F....AKAV.......NPRSR....
D9QNG3_BRESC/27-134...DRIDILLLIRRFEGATPGALFEPTA...LK....AEA......................AS.......ILGVR....
G2KMS4_MICAA/16-122...GWYNLLVYY.....................................DRDFKGWSEQAAALSFKCITDIGSTAR....
H6L0F3_SAPGL/30-131...RPLKVFAESSKMQRLNRCA...............REY...............MRSEEAKSYDQYVV...........
A0LXC2_GRAFK/12-117...NKLRWYFEMN.DF..DG...WSAKG...FW....EDL.............K.MDS....KH.......ASDYE....
Q2RZR2_SALRD/34-139...RVLLVMEDVDD.........WAPEE...RW....EDL.............A.FDVRHLSDV...........D....
G2KMS2_MICAA/25-131...GQLRMLIEY......................................VDFLGWEDDAAELNLKTIFYQAPFAT....
G0L8K0_ZOBGA/13-125...DHVNVLVKLDELKIS.H...SEVKA...LV....EDA.............K.WTL....GN.......YGQIG....
Q82UI4_NITEU/10-112...GEANLLLDL......RDMVSYSVDV...AW....KEI.............R.FMR....EH.......GSKIN....
I1YHY0_METFJ/11-119...EHGLMLYDIVS.........FHLPS....L....SAI.............G.VELSRLPAMLKL....VKQFD....
C6X1D7_FLAB3/12-118...KELNYLLLLDTDL..DK...FTAGA...WM....QDA.............F.LGL....QN.......LTKWN....
I4ANF2_FLELS/25-134...KNQDWLDKV.....................................................WFSKAYKHGYR....
V5WM94_9SPIO/3-107...DTVNLLTVIEEGFESNAVRSKNERN...........................FSKEVNPYVRKSAVVGATGMM....
X2HCK2_9NEIS/13-113...HLPNLLLDL......SQMKDFTIDM...AL....EHL.............R.FLR....QH.......AHDFG....
S6ATB1_PSERE/11-120...AHGRMLYRVGS.........FEMPT....L....GAM.............A.VEVSQLPQLFKV....VRRFD....
E6WYT5_NITSE/23-127...KELDILVDMR.QF..EG...WSFEA...AL....DDM.............K.FGL....KL.......RNAFK....
D5BJR6_ZUNPS/18-118...NSYPIFCDL.........................................RGVTTAQKQARDYLAIEGGNLTK....
C7RNF8_ACCPU/11-113...GPVDLFFDL......REMADFTLDV...AW....EDI.............V.FAR....AH.......ASDFS....
A8ZX31_DESOH/24-127...GEIDLLIDL........................................NRAGKTSSRSRKFFKAFTETGKCR....
H0PYZ6_9RHOO/10-113...GSVNLLIDL......REMAGFTLDV...AW....EEI.............K.FSR....QH.......AHDFG....
F0JGN8_DESDE/12-119....KADALLFMDADF..KG...WEFKA...MW....DDA.............K.FGL....AH.......RKDFR....
A9GPD8_SORC5/37-144...RDVLVLADARGNGALPPPA...............RKA...............FAEGLSS..........ARLD....
G2KMS3_MICAA/30-137...GTIRLLIEF.....................................GPNFAGWDDEAAELNFKTVLRQCPHVR....
Q31FZ2_THICR/21-125...PKVKALVDLT.EM..EG...WELRA...AW....DDF.............K.MGL....SY.......GGEFE....
A9GPE2_SORC5/23-130...REVLVLADARRCGAVAPAA...............RKV...............YLDGLRS..........ARLD....
X5E3H4_9BACT/12-117....KVKLYIQLN.YV..DG...ISPKA...FW....EDV.............K.TYL....KH.......FNHMK....
M1NQM0_9CORY/12-118...GSVRLLTEFG.DIEPGR...IEPKA...WI....EDL.............R.MT.....GI.......LGDIE....
A0M0L9_GRAFK/12-115...HKVYWYIEME.NF..EG...WTASA...YW....EGI.............E.LKL....PN.......EERVK....
A6Q807_SULNB/11-120...EHGKILYTIYD.........FDFPS....M....DAI.............M.VKLSRLPELFGL....LKRFD....
C6BYE1_DESAD/13-119....KCRALLYMDENF..KG...WDLKA...MW....EDT.............K.FGF....AH.......RNDFE....
Q73Z58_MYCPA/13-121...GEIRIVEVIDSDY..QG...FGPGG...LV....EDL.............K.LGLGAVLPH.......HSAFR....
K9RD27_9CYAN/12-117...ENYEFLRIYVEIEGIEG...FSLET...II....KEF.............E.FTL....SQ.......FHRFE....
D9SJ90_GALCS/11-114...GALNLLFDL......RGMLDYSVDV...AW....EEI.............KFFSR....QH.......NHDFS....
W6RYK2_9CLOT/10-116VDDDEIERLKEL.........................................................FISSKVN....
H8N2H1_CORCM/12-120...SVVGEMARL......................................................NAYAQQRGMK....
I0KHL1_9BACT/11-115...AESRLYWEME.YF..RG...WQPDE...LW....RDL.............Q.FDL....TV.......PADFT....
A6VRW9_MARMS/21-125...PYAGLLVDIS.EF..EG...WSMKS...AW....TEF.............L.LSQ....RL.......GGEFD....
C7R9R1_KANKD/12-118...GSLAGIIIRTRSF..PG...WNSFA..ALV....SHL.............R.FVR....EH.......HKSVK....
A4FCH9_SACEN/14-119...RRIRLLYQVAPDF..QG...LAPAA...VW....EDT.............K.VGL....SS.......LKLFD....
Q6LS91_PHOPR/11-120...ENGTMLYTIHE.........FDFPT....L....SAI.............G.VELTRLPELFRH....TRKFK....
G8QLC0_DECSP/10-113...GPVNLFFDL......RQMADVTLDT...AL....EEI.............R.FSK....AH.......ANDFE....
M4S571_9SPHN/11-120...DKISILADLA.DF..RD...MTFQA...GL....KDM.............R.YSLSKL.FQ.......LNRFS....
A9B5K6_HERA2/29-133...AAVDMLANGIRRPRLLDL................REA...............LPISREVRRFYMQPATRNSAT....
A4VJY0_PSEU5/11-120...SHGRMLYRIGD.........FDLPT....L....GAV.............G.VELSRLPQLLRF....IRRFD....
I3Z121_BELBD/12-117...NKLRWYFEME.NF..KG...WELKA...FW....QDA.............K.FDL....KH.......ANDFE....
A9ENE2_SORC5/23-130...RDVLVLADARHMGPVSAQA...............RKA...............VTEEMRG..........ARVD....
E4TRL3_MARTH/24-128...TDAGVLSLD..............................................DQKWVSENLIPKAAQEVE....
A1SAI8_SHEAM/12-116...GQVCLYIEA.........................DVL...............LEGWEQASLSGAGEVQLPPFD....
K9SIP1_9CYAN/14-118...GTVKMIEIV.KDF..SG...FELSM...LG....KAI.............K.FDI....DH.......LKDFS....
I5B5J2_9DELT/12-119...EKLIIYQEV......VSIGGVEFNAMIEKWKFFLAFG...............................LSHFS....

PF01740

SUT22_ARATH/540-662---------RLV--------I-AS-PR------WR-VL-HK.........LKRAKL----------------------D.
RSBRD_BACSU/161-267---------ETI--------I-SG-IR------PE-IA-QT.........VVKLGL----------------------D.
S26A2_HUMAN/569-715---------QVL--------L-AQ-CN------PT-VR-DS.........LTNGEY----------------------C.
O45016_CAEEL/553-725---------SVL--------F-AN-TN------EH-VR-QN.........FETSQF----------------------F.
SULP3_CAEEL/546-696---------QCF--------F-VV-QK------SD-LK-KL.........FRATDF----------------------Y.
D6EY97_STRLI/11-115---------QVR--------L-VC-TH------AM-TL-RM.........LRITGL----------------------A.
O04001_SPOST/529-651---------ELV--------L-VN-PT------GE-GH-GKNTASERGTQAFQVGI----------------------A.
SUT32_ARATH/505-623---------KLV--------I-AN-PG------AE-VM-KK.........LSKSTF----------------------I.
Q55814_SYNY3/440-540---------EVF--------L-VG-AK------GQ-VQ-AR.........LQRLPV----------------------L.
RSBV_BACSU/4-107---------SLK--------L-EN-LS------ER-LI-RL.........FDITGL----------------------K.
O69205_ACTPA/8-112---------RLV--------L-AT-AQ------RG-VL-RP.........LQLTGM----------------------S.
P73609_SYNY3/4-107---------EIF--------L-VG-TQ------EM-VN-DT.........IEQTGL----------------------H.
SP2AA_LYSSH/4-107---------RTI--------L-LN-PS------PT-MR-KV.........FQFSGL----------------------G.
O84431_CHLTR/3-107---------KIA--------L-TS-VS------KT-VE-QT.........LYVTGF----------------------L.
P71568_MYCTU/15-120---------PVL--------L-VC-GH------RA-GR-AA.........VTRTGV----------------------A.
S26A1_RAT/529-685---------TLL--------L-AC-CS------PS-VR-DT.........LRKGGF----------------------L.
P73607_SYNY3/2-105---------QLV--------L-VG-LS------EE-LI-DT.........MAVTGF----------------------L.
SP2AA_BACME/4-109---------EMV--------V-CA-IS------PA-IE-RL.........FNMSGL----------------------F.
YVDB_BACSU/421-528---------KLM--------I-VG-LQ------SQ-PK-EL.........LHKTGL----------------------F.
RSBV_LISMO/4-109---------ELV--------L-FG-LS------DR-LF-RL.........FEITGL----------------------S.
Q46665_ECOLX/332-437---------ELR--------V-CN-VE------FQ-PL-RT.........MARAGI----------------------Q.
S26A4_HUMAN/536-725---------NVY--------F-AS-LQ------DY-VI-EK.........LEQCGF----------------------F.
RSBV_BACLI/4-107---------SLV--------L-EN-LS------ER-LI-RL.........FDITGL----------------------K.
O83261_TREPA/17-124---------DIV--------L-LD-IQ------PR-VY-EV.........FQLLGF----------------------S.
Y1364_MYCTU/550-649---------ECV--------L-VA-PP------GS-PA-HH........VLSLVQL----------------------P.
O67306_AQUAE/448-564---------EVA--------F-AN-IG------CD-VY-PI.........LENAGF----------------------D.
Q9Z6Z7_CHLPN/2-106---------KMC--------L-CC-VK------ES-VT-EV.........MRIAGL----------------------D.
SUT31_ARATH/514-633---------KLV--------L-SN-PK------GE-VV-KK.........LTRSKF----------------------IG
Q9Z6P5_CHLPN/441-545---------LLL--------L-AG-VK------KT-PL-AD.........LKRYHL----------------------D.
O17951_CAEEL/537-690---------QVY--------F-AS-TK------VP-VR-EM.........FEKCSF----------------------F.
RSFB_MYCTU/6-111---------KFG--------V-VA-RG------SV-TR-RP.........IHLMGL----------------------D.
SP2AA_BACLI/4-109---------EMI--------V-CA-IS------PA-VK-RL.........FDMSGL----------------------F.
Q55415_SYNY3/433-538---------AVY--------I-VG-AT------GQ-TK-RR.........LEKLQV----------------------F.
SULH1_SCHPO/592-725---------...--------.-IY-AG------DE-VE-FH.........FTDINN----------------------D.
O07728_MYCTU/29-135---------NMR--------L-VS-NQ------PI-VA-RT.........IAACGL----------------------R.
P72770_SYNY3/438-545---------TLK--------L-VN-AS------GF-VR-DR.........LRAEGL----------------------E.
Q9Z841_CHLPN/3-107---------KIV--------L-TT-VP------KT-IE-QT.........LYVTGF----------------------L.
O07488_YEREN/391-488---------GVE--------I-RG-MN------EA-TR-TI.........VDRFGV----------------------H.
SUT33_ARATH/498-617---------ELV--------F-VN-PL------SE-VV-EK.........LQRADE----------------------Q.
P73474_SYNY3/396-498---------DVE--------L-VG-LN------GA-SA-TL.........WQKLIK----------------------E.
SP2AA_GEOSE/4-109---------QMV--------V-CA-VS------PA-VK-RL.........FDMSGL----------------------F.
S26A3_HUMAN/526-716---------DVY--------I-VG-TD------DD-FI-EK.........LNRYEF----------------------F.
SUT41_ARATH/519-638---------QLA--------I-SN-PN------KD-VH-LT.........IARSGM----------------------V.
O84770_CHLTR/2-106---------KLC--------I-CC-LR------DE-VA-DI.........IRIAGL----------------------D.
RSFA_MYCTU/18-124---------DVR--------L-VS-RD------RA-VA-RI.........IHACGY----------------------G.
RSBRB_BACSU/147-272---------RST--------L-SG-IR------PE-IA-QT.........AVQLGI----------------------D.
SUT1_STYHA/538-656---------QLI--------L-AN-PG------PV-VI-EK.........LHASKL----------------------T.
G2TL00_BACCO/4-109---------EMI--------V-CA-IS------PA-VK-RL.........FELSGL----------------------F.
Y1739_MYCTU/443-553---------VFA--------M-AR-VK------QD-LR-ES.........LRAASL----------------------L.
I6X4W0_MYCTU/31-137---------DLR--------L-VS-HQ------PI-VA-RI.........AEAGGL----------------------S.
SP2AA_PAEPO/4-109---------EMA--------V-CD-VN------PP-VH-RL.........LDMSGL----------------------F.
SULX_YEAST/572-707---------FIY--------L-VN-VS------IN-DK-VRR.......RLFKAGV----------------------A.
SUT21_ARATH/548-668---------ELV--------I-VN-PK------WQ-VI-HK.........LNQAKF----------------------V.
O83249_TREPA/5-107---------RLC--------I-LN-PS------ES-VR-RA.........IELTGF----------------------S.
PHOT_BACSU/148-254---------ELI--------I-TG-IK------PE-LA-MK.........MNKLDA----------------------N.
RSBS_BACSU/5-111---------KVV--------L-TG-IQ------PA-VA-VT........LIELGIA----------------------L.
O33206_MYCTU/385-486---------AVS--------I-KR-IP------PR-LE-S...........QLTAL----------------------A.
RSBRA_BACSU/151-261---------KCL--------L-AG-IR------PE-IA-QT.........IVNLGI----------------------D.
SUT11_ARATH/518-636---------QLI--------L-AN-PG------PV-VI-EK.........LYASKF----------------------V.
Y1081_THENE/1-106---------FFA--------L-VS-PN------ER-VE-RV.........LSITNL----------------------D.
SUT3_STYHA/511-631---------ELA--------M-VN-PR------WE-VI-HK.........LKVANF----------------------V.
SULH3_SCHPO/533-653---------EVH--------L-VS-LD------PQ-VL-HI.........FEKHGL----------------------L.
YG35_YEAST/657-777---------KLI--------I-SS-IK------ER-DR-IYN.......AFNNVGL----------------------L.
O33361_MYCTU/29-135---------QWA--------L-VA-SP------AV-VE-QLG......GRCDQGEH----------------------E.
O83551_TREPA/4-108---------HFF--------I-SG-VH------GS-VK-KV.........IELTRL----------------------L.
P73108_SYNY3/3-107---------TLL--------L-SG-VS------PE-LK-II.........FELTQL----------------------N.
RSBRC_BACSU/163-272---------SST--------L-SG-IR------PE-IA-QT.........AVQLGL----------------------S.
Q40008_HORVU/530-648---------QLI--------L-AN-PG------PA-VI-QK.........LRSAKF----------------------T.

PF13466

Q310Z9_DESAG/492-572---------RLE--------S.EG.LP------SAGLM.QT---------LVLAGF----------------------D-
B5HV30_9ACTN/31-112---------RIR--------L.RD.PD------PA.LH.AL---------LDLVGL----------------------R-
A9BX84_DELAS/2-83---------QLV--------V.VG.LP------QG.LQ.SM---------AALYGV----------------------D-
Q0K681_CUPNH/47-125---------ALS--------L.RG.VP------PQ.LS.QL---------ASLYGV----------------------D-
B5H529_STRPR/9-95---------RLR--------L.RN.AG------PD.LL.TL---------LDLVGL----------------------P-
Q0RDC2_FRAAA/24-104---------SMV--------L.VD.VP------SA.LG.RM---------FAADRL----------------------G-
D1AD83_THECD/187-267---------PLV--------L.DR.MP------AP.VR.SM---------VEMIGL----------------------D-
D2SCD5_GEOOG/29-109---------TLQ--------L.VG.PA------PF.TA.RL---------LRVVGM----------------------G-
A1VK31_POLNA/2-82---------VFS--------V.QG.AP------GR.LL.QL---------AEVYGV----------------------S-
A8ZVX1_DESOH/4-85---------HLA--------L.DA.PP------PAAFS.RQ---------LEKSGM----------------------A-
Q3SFW3_THIDA/281-359---------SIT--------L.RG.HN------AL.IH.EL---------FRVMGI----------------------D-
B9TGW9_RICCO/228-309---------QVA--------L.TG.MP------AH.MQ.AL---------VRVGGL----------------------E-
A1W422_ACISJ/2-83---------GFV--------V.KA.LP------PA.LS.SL---------AGLYGV----------------------Q-
A1U461_MARHV/15-95---------HLS--------F.TG.AS------ER.LR.SL---------AALSNL----------------------Q-
Q21UA2_RHOFT/4-85---------RFS--------T.QG.LP------KR.LA.DL---------AALYGV----------------------V-
B1Y2Z1_LEPCP/2-84---------GFS--------T.QA.LP------QR.LV.RL---------ASLYGL----------------------S-
Q8EEQ5_SHEON/14-91---------RVE--------F.CH.HS------KA.VI.DA---------LELSGL----------------------S-
D2S5L7_GEOOG/30-110---------RLG--------L.TG.AP------PF.LH.QE---------LIRLRL----------------------D-
A7MNS4_CROS8/14-91---------GVT--------L.EG.MS------EN.LT.TL---------AKLYNL----------------------P-
B9JTP2_AGRVS/23-100---------TFS--------I.KK.AS------DA.FT.KT---------IQLLGL----------------------N-
B8DPA7_DESVM/571-651---------DLA--------A.TGLVS------EA.VA.EA---------ARRTGL----------------------D-
C6C1P3_DESAD/15-93---------SLV--------I.NG.LR------PE.FA.SF---------LELFDL----------------------D-
E3I167_RHOVT/14-94---------TIT--------L.LRVPE------GA.VE.AS---------FARAGL----------------------A-
E3IYM7_FRASU/24-104---------SLE--------I.RS.AT------PA.FL.EL---------VTATGL----------------------T-
C1D624_LARHH/5-83---------SLQ--------H.LH.LP------VE.VE.SL---------IDLYGL----------------------Q-
A4YXB4_BRASO/320-399---------TAT--------F.AG.VS------PQ.LA.RI---------FHFGGL----------------------E-
D1C014_XYLCX/37-113---------KVR--------I.LR.AP------PT.VR.FL---------LDVTRI----------------------G-
C6WD00_ACTMD/919-1001---------GVG--------VVVT.EG------SA.PA.RI---------MAVSGL----------------------H-
E3J1T6_FRASU/56-136---------GLV--------L.HA.VA------PW.LL.GL---------LIVTGW----------------------D-
C6WQ84_ACTMD/60-139---------LLV--------V.AG..H------RA.VL.RP---------LRIAAL----------------------D-
Q2SPQ4_HAHCH/13-91---------GID--------W.LE.AS------DY.MK.QV---------VRLLSL----------------------Q-
D2SFP4_GEOOG/531-612---------RLV--------V.HA.PE------GG.VTRHV---------LEISGL----------------------G-
D2B5R7_STRRD/72-150---------KVF--------L.HH.AP------YC.LR.SV---------LALIGP----------------------D-
B8DLB2_DESVM/179-259---------AVR--------I.SG.VS------PN.LS.TV---------FDVVGI----------------------A-
D0KYU0_HALNC/26-108---------TVR--------Y.TH.PP------KA.MR.AM---------MRVYDL----------------------D-
D5X3Z8_THIK1/566-644---------TLQ--------F.TG.VH------RL.IA.GL---------FSILGL----------------------H-
B9J943_AGRRK/10-87---------SFT--------F.SK.VS------DA.FQ.KT---------LQMIGI----------------------D-
B1W2W2_STRGG/20-107---------TLR--------L.RR.VP------PE.LR.SL---------LDLVGL----------------------A-
A1SBD9_SHEAM/6-85---------PLN--------W.KG.IT------TE.LV.AQ---------FKQMGM----------------------Q-
A0LC67_MAGMM/14-94---------DIT--------L.RN.PT------NL.VL.RM---------LLAARF----------------------D-
A4YMN9_BRASO/16-97---------SLG--------V.SN.AN------QQ.VL.AV---------MHKANL----------------------G-
C7LTF6_DESBD/15-91---------RIS--------F.VN.LP------TH.LL.EN---------AASLGA----------------------D-
B1LTK1_METRJ/26-107---------ALT--------Y.LG.AR------PE.HR.IL---------LGEVRL----------------------R-
Q0RZA3_RHOJR/48-126---------RLT--------V.AA..F------GP.LR.HI---------LDDAGI----------------------D-
C5BID3_TERTT/281-360---------RLE--------I.IA.VS------DA.LA.KT---------FQQQGV----------------------A-
Q2SBJ1_HAHCH/18-100---------NVS--------V.SG.LT------GK.MF.DI---------ARVSGV----------------------E-
B5HHQ5_STRPR/28-107---------VIT--------V.RG.AR------RG.VV.RT---------LRQAGL----------------------D-
Q1QXI2_CHRSD/17-99---------PPT--------I.VA.EH------PD.VR.RM---------LDVMGF----------------------S-
Q12BT3_POLSJ/427-501---------RVV--------L.AG.VT------PV.VR.AL---------FEELSM----------------------D-
C9R4W7_AGGAD/20-98---------...--------L.QN.PP------SQ.LL.TL---------ADLFGL----------------------S-
D9T369_MICAI/189-267---------VAV--------L.RT.PS------RA.PA.RL---------VDLLGL----------------------S-
Q31HM4_THICR/6-86---------KIQ--------W.DS.PT------DT.LK.MG---------AEKLGL----------------------T-
Q31GZ5_THICR/18-93---------PLK--------V.LS.LP------DD.LK.VL---------VNLYNL----------------------D-
A7H922_ANADF/18-92---------RLL--------M.RG.LR------QH.QL.RI---------FRYFGV----------------------D-
Q21SV7_RHOFT/514-592---------SVQ--------F.RD.VP------RL.VA.AF---------FNVIGI----------------------N-
A3N1T8_ACTP2/20-99---------PNC--------L.IH.VP------EV.VK.TL---------ADLFDL----------------------.-
B2FP86_STRMK/2-73---------PLV--------I.TG.AP------AG.YN.EL---------SAAYRL----------------------S-
F9ZTS0_ACICS/20-97---------PLV--------L.TG.LG------PG.LR.EL---------VHLYGL----------------------E-
Q2IMF1_ANADE/97-172---------RAS--------F.RG.LG------QH.QL.RL---------LRYLGL----------------------D-
Q3J3N5_RHOS4/5-82---------QFT--------C.QP.MS------PA.FT.DD---------VTRLGV----------------------D-
Q3J659_RHOS4/7-80---------RLV--------L.AQ.DH------PA.LT.DA---------FA....----------------------.-
Q6DAF4_PECAS/14-89---------EIA--------I.VG.AS------DR.LK.TL---------IALYNL----------------------.-
Q87LF2_VIBPA/15-93---------HIM--------L.SF.VP------AQ.LR.TL---------FQLSNV----------------------.-

PF11964

L0GYF4_9GAMM/12-118.........RMA........L-IG-DK...DW.EAWM.GQL---------AKPF.T...R.............A....TV
W8EVU9_9BACT/23-129.........ALS........L-SD-QHWLEQHYLPQLVRLP---------LQYMALILTSHRQHEDLLDVTAHFPPPFEV
D5V1Z3_ARCNC/21-125.........KIA........I-IT-GK...SW.IKIG.SKI---------TSWF.I...Q.............G....EV
Q11VP6_CYTH3/12-119.........RAA........I-VS-DE...KG.VKTF.TDV---------FSVL.V...P.............G....EF
A5FC98_FLAJ1/11-118.........RAA........I-VT-DS...ED.IISF.TNG---------FSYV.V...P.............G....EF
Q28QM9_JANSC/19-126.........RYA........V-IG-AP...DR.AAKM.IEF---------MDKIIP.................V....EA
Q093V8_STIAD/17-124.........AMA........F-FG-AS...FT.MRTIFNML---------GRAQLL.................M....GR
E0TIJ6_PARBH/12-118.........KIA........I-VG-NA...RW.EEAV.TKA---------AEPF.A...E.............A....EL
Q3SKE6_THIDA/10-113.........RIA........I-LT-GD...EW.VAWS.MWV---------NRMF.M...S.............A....DI
Q3ID73_PSEHT/20-125.........KVA........V-YG-NK...EW.QATL.AKV---------AGWF.V...A.............G....KV
B2HRZ3_MYCMM/12-119.........RFA........V-VT-DI...EW.IKQT.VKF---------VGFL.M...P.............G....EL
J7Q7E4_METSZ/12-118.........RVA........L-VT-DA...EW.IKHT.MQF---------FSFM.M...P.............G....EM
E8X7D9_GRATM/13-120.........RMA........V-VS-DN...RW.EEVAEMIV---------VATAVL...Q.............A....ET
Q3J4W4_RHOS4/41-148.........RYA........V-VE-PP...KI.AALM.IET---------SDW.FM...P.............V....QA
F0SJ20_RUBBR/12-119.........HAA........V-VA-DQ...GW.IHSL.SKL---------INPM.F...K.............M....EI
D5SV07_PLAL2/13-118.........KLA........I-VG-ES...KW.EEGM.AAF---------CKPF.T...G.............A....SI
A4XX57_PSEMY/12-120.........RVA........V-VA-DQ...QW.LRTA.SEV---------EGALIP...G.............L....TI
A0LIB8_SYNFM/14-120.........RMA........I-VG-DE...RW.KDQI.FAF---------VGKGLR...D.............T....EV
I4C386_DESTA/12-119.........KVA........A-VG-GP...KW.LEQW.MKF---------KSYF.V...R.............A....QI
I4AGM8_FLELS/70-181.........QQEIESAKLAIL-RT-DAPMHKVGIDYVVSYL---------QQVLPY......................DC
M4SAG0_9SPHN/140-247.........RYA........I-VG-GP...DW.LATL.VKL---------FDP.LF...R.............I....EL
F0SJC2_RUBBR/13-118.........RLA........I-VG-ES...RW.EKGM.ASF---------CRPF.T...T.............A....NV
M9R3U0_9RHOB/11-120.........RCA........V-LT-DI...GW.LQTA.ARI---------EGALIP...G.............L....EI
A9WJT9_CHLAA/12-112.........RIA........F-IV-SE..............---------..............HHLLIFAPLVRFVSGI
W8EZJ6_9BACT/24-132.........AVA........W-IN-AM...DWPSRHSVAST---------LPHVQG.................L....EV
Q8EB52_SHEON/21-126.........RIA........V-VG-KT...TF.QEVM.AKL---------ANGL.T...P.............A....KV
L0K3H2_9EURY/13-119.........CYA........V-VG-DD...SV.LEWG.TEL---------SDR.VT...E.............T....DI
B1MER2_MYCA9/12-121.........KIA........V-VT-DK...EW.VAHT.LHA---------LAWM.V...P.............G....EI
F9ZWL7_METMM/13-118.........RLA........M-VG-DR...QW.QHGM.AIF---------CKPF.T...N.............A....MV
X5E4J9_9BACT/13-117.........HVA........F-IG-GSAANRMIAKVMLKTG---------ALKI........................KG
E4TNT7_MARTH/14-124.........KQA........L-WL-SQ...HWKLMENYCLG---------TAYVIP...SAAIRAVLKMIFSFQNQPVPY
Q8TPB5_METAC/12-119.........KIA........V-VS-DV...DW.IIDA.VKV---------FKFA.I...P.............C....PV
A3QHM0_SHELP/21-124.........RVA........I-IG-QG...EL.QEWA.TRV---------ANWF.T...P.............G....EF
B0JM20_MICAN/12-118.........KVA........V-VT-DS...TL.VKLI.ESL---------ASHF.V...A.............A....EV
Q7UVW9_RHOBA/74-179.........QVA........I-VG-DR...RW.EHGM.SLF---------CRRF.R...T.............V....GL
A4FCH9_SACEN/137-244.........RVA........L-AA-DS...KL.AELV.PHL---------AKHF.V...Q.............A....EV
A0LXE0_GRAFK/12-118.........KYA........I-LT-DK...SW.LEAL.LPI---------GNAFTP...N.............L....PI
E1RHG3_METP4/12-115.........RMA........I-VG-ET...KA.EELL.VKA---------DGLLF.......................GE
G2J2P9_PSEUL/12-113.........RVA........I-VV-ED...VW.IKLA.AHI---------AGLM.S...H.............T....KV
A5G4W5_GEOUR/116-227.........KIA........I-VG-DP...KW.ETRM.LMF---------TGAGFR...R.............A....PV
A3CYB3_METMJ/12-120.........RIA........V-VG-GE...RW.REWM.NHL---------PGLF.VGFDG.............V....DV
Q5V739_HALMA/20-132.........RYA........A-VG-DT...RW.........---------........AKLLFDWWYAIRPIWPVAPNEM
I4C4Z7_DESTA/12-119.........KLA........V-VG-GA...KW.IEWA.TKI---------ASHF.M...K.............G....EV
M4NFH5_9GAMM/12-119.........RVA........L-VT-DV...VW.LRGT.AMA---------FSFA.I...P.............A....QF
A1S706_SHEAM/12-119.........RIA........I-LT-NR...PA.FRRM.GEL---------IGLF.M...P.............C....PV
M4V983_9DELT/11-119.........RVA........L-LT-EK...SW.MSAM.SKI---------SSALIP...R.............V....QI
D4ZLE1_SHEVD/12-119.........RVV........I-IT-DS...DW.ITGM.AKA---------MAYM.I...P.............C....PV
B2HE07_MYCMM/27-133.........KIA........V-VT-DS...HL.GDVA.EHL---------TSHF.V...S.............A....EV
J7L4H1_NOCAA/12-117.........RYA........V-VG-DD...RI.IRFL.TTL---------ADAFVD.................M....DL
F2LY86_HIPMA/12-118.........KIA........V-VS-DV...EW.IING.VKA---------FSFI.I...P.............A....KV
F0SJ19_RUBBR/12-119.........HVA........S-VT-DV...SG.VESM.VKL---------LNPM.F...K.............A....EM
Q3JB38_NITOC/148-256.........RYA........I-VG-AP...GW.MRKI.IKS---------INPAFT...D.............M....DM
W8EXL7_9BACT/35-135.........FGA........I-VV-SEDVFTRLATAYVTTS---------VQGLPL......................VY
H8MXZ5_CORCM/21-129.........AVC........F-FG-AK...RT.HREVLRAL---------VAVVNF.................T....SG
E1RH74_METP4/11-116.........ETA........V-VF-DE...KW.DEFMSWLF---------KSYAFISHIY...................M
K9XV53_STAC7/12-117.........RYA........I-VG-EQ...TW.LQAW.TNL---------VKPFIP.................C....EV
A5FDC3_FLAJ1/11-118.........RTA........V-VT-EC...EK.AISF.TNS---------FRYI.V...S.............G....EF
G8RQ72_MYCRN/12-121.........RVA........V-VA-DK...EW.VRHT.VHA---------VGWM.M...P.............Y....EL
Q07X46_SHEFN/12-116.........ALV........F-VG-GP...DW.VGNSVRLM---------GPFMQG......................EV
A9GPE4_SORC5/20-127.........GVA........V-FG-AS...FS.VRVVTTLA---------SRSVQF.................F....TG
G2KMS5_MICAA/17-122.........KLA........I-VN-LP...........EKM---------VQYVGMRQ...............AALKTDL
Q6MQZ1_BDEBA/34-138.........KAA........I-VT-DI...HW.VKNVSNFF---------DPIVGT......................DI
E3FV03_STIAD/12-119.........RVA........E-LV-ESQIVALQLNRLARES---------GTDK........................IL
D2QV97_SPILD/12-116.........RIV........L-VG-TA...GT.LALI.TPV---------MQTI.F...R.............A....ER
Q7NXU0_CHRVO/12-113.........RVA........I-VV-GD...VW.IRLA.THI---------AGLL.S...H.............T....HV
D5ER41_CORAD/12-118.........RIA........C-VT-DV...DW.IFNT.TKA---------FGFL.S...A.............G....HM
A1SV34_PSYIN/12-119.........RIA........A-VT-DI...GI.LSIL.PKI---------VKHF.V...S.............A....EV
B3QUM5_CHLT3/13-124AICDFLGECKCA........F-VT-HNNPSKVVIKLLSIMC---------EA.....................YHLGFHA
G0J0D1_CYCMS/13-117.........KTE........F-EG-NK...KW.QEWA.AKA---------MDLF.T...D.............S....EV
A0M0N9_GRAFK/12-117.........KIA........M-VG-NK...KW.QDWI.TKF---------MKPF.T...N.............A....EV
Q1CW14_MYXXD/23-128.........AIL........Y-VG-AD...IV.MQTFVKAI---------ALALLF.................T....GK
Q6AK92_DESPS/134-240.........KIA........I-VG-NK...KW.QKLA.ERI---------FSKF.I...S.............A....EV
V5WKN4_9SPIO/39-142.........KVA........L-AG-VK..............---------.......................MVTGRKI
A6Q9H2_SULNB/14-120.........RLA........F-VT-DT...SV.IEFS.KMI---------AAPF.V...D.............A....EI
F8GCM7_NITSI/10-113.........KVA........I-VT-DD...EW.QAWG.AWV---------SNLF.T...N.............A....NV
C4ZLU4_THASP/10-113.........RIA........V-LT-ED...QW.LTWS.AWV---------SQLF.V...T.............A....EV
Q6AK92_DESPS/12-119.........RLA........I-VS-DV...PW.VKTL.LRA---------MAFT.L...P.............C....PV
F0M0B1_VIBFN/20-125.........KIA........L-YG-KP...GW.QELA.AKI---------GSWF.I...S.............G....DI
A6WZX1_OCHA4/19-126.........HYA........I-VG-GP...LW.IQAS.ITL---------MQP.FL...S.............I....EL
E3FKU0_STIAD/13-119.........RSAR.......V-VS-TA...ASGLQAWRMTK---------QAMLNI......................PA
Q0AQY4_MARMM/16-124.........RAA........I-VC-NDELSHAMLAFWEATA---------GQRLTT......................EE
Q6LKJ4_PHOPR/20-124.........KVA........L-YG-NQ...HW.QEVM.SKI---------GSWF.V...S.............G....EV
D5BJF0_ZUNPS/25-118..........SA........V-VD-STSMARRYFAAQGTTL---------MSAIAIYAGSPVAISHAEFYMRTLMHKIPT
C7P248_HALMD/57-169.........RYA........A-VG-DS...VW.........---------........ARGLFDCWRAIAPVWPVSPDEM
A1S9K0_SHEAM/21-126.........KIA........V-FG-RP...GW.QEWM.TKL---------ADWF.T...P.............A....DA
D3FPZ4_BACPE/12-117.........KYA........I-VS-DG...NL.TEYI.SKL---------ADKMTE.................M....DM
Q087X8_SHEFN/21-125.........RVA........I-LG-NK...DW.QEWA.AKI---------GSWF.I...A.............G....EI
C0QCX2_DESAH/11-120.........RVA........V-LT-DE...AW.LKMA.SEI---------EGALYP...G.............L....EI
Q1LPD1_CUPMC/12-120.........SVV........V-VT-DH...DW.VRHS.INV---------FRFL.V...P.............G....QI
A3HTM6_9BACT/12-125.........HIA........I-VA-HS...KI.LKAL.VPI---------DNLFFE...R.............ASKGREE
F7XLD9_METZD/12-119.........KIA........V-VS-DK...DW.LLNT.VEI---------FKFV.I...P.............A....SV
B1WXR6_CYAA5/19-124.........HAA........V-VA-DA...KW.MRTF.AEA---------VGSI.L...S.............A....EV
D0J5L7_COMT2/12-119.........QIA........L-VT-DS...HL.AGMA.EFV---------GRHI.T...H.............A....EV
H6L5W1_SAPGL/20-121.........GAA........V-IM-GN...GL.SKIIGNLF---------LK.....................F....SK
B7VP41_VIBTL/20-124.........KIA........I-YG-DK...SW.QEFA.SKV---------GSWF.V...S.............G....EI
K0NMI2_DESTT/11-120.........KAA........V-LT-DK...NW.IKNV.SEL---------EGALIP...G.............L....EI
F4CCE8_SPHS2/23-130.........RMA........I-VS-DQ...QW.VRKI.YDI---------LSPL.V...H.............G....EI
G8PHU6_PSEUV/12-120.........RIA........I-VS-DRKIWEW.LVAMDSPF---------AAMLGI......................GE
A0M5Q5_GRAFK/11-116.........KIA........I-VT-DS...NW.FQNA.VNV---------SDIFLD.................V....DV
A3CYB0_METMJ/12-120.........RIA........I-VG-GE...KW.EEWM.NHL---------PGLF.TGFTG.............I....DV
F4AVZ8_DOKS4/11-116.........RLV........I-VS-NR...SW.IRRV.VRL---------KDLLMT.................S....DV
I3YWJ5_AEQSU/12-117.........FVA........L-VT-DK...GW.LEKT.MEV---------FGAIIP...G.............M....KV
Q083D4_SHEFN/12-118.........RIA........M-VG-DK...SW.EHWM.ALI---------AKPFLI...S.............S....EV
B0BYZ0_ACAM1/138-242.........HVA........L-VA-DA...QW.MRTV.AEA---------VSAI.F...P.............A....EI
E3FWM2_STIAD/2-108.........AIV........L-FG-AS...TT.MRAISALM---------IRALAL.................L....GR
D5B9R4_ZUNPS/12-117.........KIA........L-VG-EK...KW.RKWA.AQF---------MKPF.C...N.............A....EI
M4SAG0_9SPHN/11-120.........RIA........I-VT-DQ...SW.VRIA.SRI---------ESALLP...Y.............V....SY
I4AIU7_FLELS/23-135.........EVA........V-VK-SS...TTFQRITAQVL---------LKSIMA.................INNKFRI
A5GKD8_SYNPW/21-126.........RVA........L-IT-EA...RW.LTLL.SSV---------VGLL.M...P.............G....EL
A9GKE1_SORC5/12-119.........RAA........E-LV-QSDLAALQASRIAREA---------GTAQ........................LV
E1V9S9_HALED/39-147.........RAA........T-VS-DK...HW.IRHLVRIE---------NHVFRS.................M....EM
A8LJW8_DINSH/13-117.........RVA........V-VS-DL...TW.FSPFTRLA---------DRLTHL......................QI
C5BJV0_TERTT/11-120.........HAA........V-LA-DQ...TW.LQAM.SHW---------SADLVP...G.............L....TI
S6B665_9PROT/11-113.........KIA........V-VT-DS...QW.ITWS.TWL---------TSLF.T...P.............A....ET
G0J0C5_CYCMS/12-117.........KIA........M-VG-EK...KW.QDWI.TRF---------MKPF.T...N.............A....DI
Q1CYP8_MYXXD/13-120.........RSAR.......V-VS-DA...PSGLQAWRMTK---------RAMLSI......................PT
I0JIE9_HALH3/13-116.........KFA........V-VT-ER...AL.IELG.TQA---------ADY.LP...G.............L....KA
E6U1C5_BACCJ/13-120.........RAA........V-VV-EGAVAKMQLKRTAKQS---------NHS.........................EE
Q47BJ5_DECAR/11-113.........RVA........V-VT-DS...QW.VTWS.AWI---------SQTF.V...N.............A....DV
K9X8Y1_9CHRO/10-123.........KFC........F-GY-AT...VT.TSTVFALY---------KPMTKL.................I....GT
Q8ED76_SHEON/12-119.........RVV........M-IA-DM...QI.LGAM.VNT---------LAFM.L...P.............C....PV
A1T9B4_MYCVP/12-121.........RVA........V-VA-DK...DW.IRHA.MHA---------LGWM.V...P.............G....EL
J1L360_9EURY/12-120.........REA........I-VG-GE...EW.ETRL.LSV---------QPAF.FLFSS.............T....DV
A3QIC9_SHELP/12-116.........ALV........L-VG-GP...DW.FGNAVRLM---------GPFMQG......................EV
G2J2S0_PSEUL/12-117.........RIA........V-VG-DE...TW.QEWM.VKL---------VRPF.T...L.............A....SL
D5CNM7_SIDLE/10-114.........RIA........V-VT-DN...QW.LTWQ.AWL---------SRLF.V...D.............A....DI
Q093V7_STIAD/21-127.........AVA........F-FG-AS...FT.MKTVSNMI---------LRANSI.................L....GR
W8S663_9RHOB/15-124.........KVA........V-LT-DE...TW.VRAI.AAV---------ESALIP...N.............L....VI
A9GPD9_SORC5/60-166.........AIA........V-FG-AS...FA.VRVVSTLA---------AKSVQI.................L....TR
Q11I87_CHESB/20-127.........RYA........V-VG-GP...TW.VQAM.MGI---------VKPFLS.................V....EM
C1DA99_LARHH/12-113.........RVA........V-VV-KD...GW.MKLA.THI---------ADLL.A...N.............T....ET
B3QXG2_CHLT3/14-123TAEGLDMKSRIA........L-LQ-PDSAKSRKAAHFYETA---------S......................LNRGWNV
H2FUI0_OCESG/21-126.........RLA........I-VG-CN...LK.EKIM.ATL---------VDWFML...G.............S....QV
E1QK88_DESB2/12-119.........KVA........L-VG-RP...EW.ASSF.ADY---------LGLA.T...N.............V....KF
W8S5M5_9RHOB/17-125.........NYV........V-AN-AP...GD.AGSI.VET---------VGK.AL...P.............V....EA
I4EWX0_MODMB/5-112.........RVA........V-VS-DE...DW.LRPA.LRV---------LSVL.V...P.............G....QL
V5XBD7_MYCNE/12-121.........RIA........V-VS-DK...DW.VRHT.MHA---------IGWM.V...P.............G....EL
D5B9R0_ZUNPS/6-111.........KMA........F-VG-NK...KW.QELA.AKA---------TDFF.I...K.............S....EV
F5XYL0_RAMTT/15-117.........RMAS.......V-VP-ED.....KITRTSEKV---------AQSLGM......................TL
Q1ZBL2_9GAMM/21-125.........KIA........I-YG-NK...NW.QEIA.AKV---------GSWF.L...S.............G....EV
A3QF38_SHELP/12-119.........RVA........I-IT-DS...EW.VANT.AKV---------MAYM.A...P.............C....PV
Q3JB38_NITOC/16-125.........RCA........F-VS-DK...EW.PQAL.IDF---------IGPVLP...T.............L....EM
D6XVY9_BACIE/11-115.........KIA........V-VS-DK...KS.VEIV.TRL---------SSVLPK.................L....EM
Q2YCI1_NITMU/10-113.........RIA........I-IT-EN...QW.RAWA.AWV---------SNLF.V...D.............A....DI
C6Y0C1_PEDHD/12-119.........KIA........I-VT-DQ...QA.VEKF.TDI---------FSYI.S...P.............G....EA
B1LYM2_METRJ/12-117.........HVA........L-VT-DA...PW.LKAL.AET---------FNFV.S...P.............T....QI
Q7MEX7_VIBVY/25-130.........KVA........V-YG-DK...NW.QELA.AKV---------GSWF.I...S.............G....EM
Q12ZF4_METBU/12-119.........RIA........V-VS-DV...EW.MNHA.MEL---------FKYM.I...P.............G....QV
L0G526_ECHVK/12-117.........KIA........M-VG-EK...KW.QDWI.TQF---------MKPF.T...N.............A....EI
F4C7J2_SPHS2/12-119.........KMA........I-VT-DE...EN.VRTF.TDM---------ASYI.M...P.............G....IA
B0BYZ0_ACAM1/12-117.........HVA........V-VA-EA...EW.VRTI.AAA---------SDNL.L...S.............A....QV
A6Q671_SULNB/23-127.........KMA........I-VG-NK...KW.EEQS.TAM---------MSHM.M...K.............G....KS
A0LXE0_GRAFK/144-249.........KYA........I-LT-DE...KW.VANI.AEL---------EGKIFK...K.............I....AV
W8EUS5_9BACT/21-126.........SVA........W-VC-PA...HWPARKS.MEM---------AMWFVT...Q.............P....TV
H6L5S2_SAPGL/58-159.........ATA........L-VI-SN...SL.SRLLGNLL---------LT.....................LVTGQVI
G8R3P5_OWEHD/12-122.........KIA........L-VT-DK...DW.LRFL.ATA---------EYKLIP...A.............I....DE
W0RC97_9BACT/11-121.........SAL........V-VA-SR..VQLGIARMFQTL---------NDHPQV......................TV
C6C2B1_DESAD/11-117.........KKA........V-VS-DI...KW.HEPL.IKV---------GDKLFP...S.............I....EV
H6L5W0_SAPGL/30-131.........ACA........L-LV-GS...GI.SRILGNFL---------VG.....................F....NK
D9QNG3_BRESC/27-134.........RYV........V-VG-AP...AW.AEAA.ITL---------GGWLSP.................V....ES
G2KMS4_MICAA/16-122.........RLA........Y-VS-PPDQRILLMKMMRPII---------KA..........................ET
H6L0F3_SAPGL/30-131.........GSA........L-LT-PN...QL.SKMLGNFI---------IGL....................RKQARPI
A0LXC2_GRAFK/12-117.........KIA........M-VG-DS...EW.QDWM.TQL---------MKPF.T...N.............A....DI
Q2RZR2_SALRD/34-139.........KVA........I-VS-DD...PW.ERWL.EKT---------E.ALFP...M.............S....TI
G2KMS2_MICAA/25-131.........RLA........Y-IN-PT...ERAVMKSRLIL---------PPKILG......................VM
G0L8K0_ZOBGA/13-125.........NIA........V-VA-NS...NI.LKAL.VSL---------DALFFE...R.............LRKGYEE
Q82UI4_NITEU/10-112.........RVA........V-VT-DS...QW.QVWS.AWV---------SNLF.T...D.............A....DV
I1YHY0_METFJ/11-119.........RVA........V-LT-DK...QW.IKTV.SEL---------EGALFP...G.............L....TI
C6X1D7_FLAB3/12-118.........RAA........I-VT-DK...NA.VKKF.TDA---------FSVV.M...P.............G....EF
I4ANF2_FLELS/25-134.........TSA........I-VT-SK...SIFNQVTVKQI---------VDKM...................DKEKYKV
V5WM94_9SPIO/3-107.........KVT........V-AS-LK..............---------.......................MFSKREI
X2HCK2_9NEIS/13-113.........RTA........I-VV-DD...IW.IRIG.IRL---------ANLL.T...L.............Q....RL
S6ATB1_PSERE/11-120.........RMA........V-VA-DK...GW.VRKA.SEL---------EGALIP...G.............L....EI
E6WYT5_NITSE/23-127.........KMA........I-VG-DK...KW.EELS.IEL---------FKHF.S...K.............G....EI
D5BJR6_ZUNPS/18-118.........ALA........L-LV-ED...ELAMKVARLYV---------KA.....................SEPPYPT
C7RNF8_ACCPU/11-113.........RIA........V-LT-HS...QW.VAWS.AWL---------SQIF.V...R.............A....EM
A8ZX31_DESOH/24-127.........KVA.........-..-.....LFGMHPVSMVI---------ASFVMG.................VSRNNDM
H0PYZ6_9RHOO/10-113.........RIA........V-LT-ED...QW.MTWS.AWV---------SQLF.V...D.............A....EV
F0JGN8_DESDE/12-119.........RLA........V-VG-GP...DW.VRWG.VRL---------GELL.M...D.............C....EV
A9GPD8_SORC5/37-144.........AVA........V-FG-AS...FS.IRVIGTLV---------FKSMNL.................L....AQ
G2KMS3_MICAA/30-137.........KLV........Y-IN-PS...KRTLAKAHMLL---------PADLKN......................NM
Q31FZ2_THICR/21-125.........KIA........I-IG-HK...KW.QDFI.AKV---------GSWF.I...S.............G....NI
A9GPE2_SORC5/23-130.........GIA........V-FG-AS...FS.IRVMATLI---------VKSINL.................L....TK
X5E3H4_9BACT/12-117.........KIA........V-VG-KS...RW.DKLW.SEL---------AAPF.I...S.............G....EV
M1NQM0_9CORY/12-118.........KMA........V-VA-GA...AW.LQKW.TEL---------AGGL.I...P.............G....EV
A0M0L9_GRAFK/12-115.........KVA........L-VG-NT...KW.QEQF.TEV---------LIPF.T...R.............A....HI
A6Q807_SULNB/11-120.........RMA........I-LT-NK...TW.LQKI.AQF---------EGFLVP...G.............L....EI
C6BYE1_DESAD/13-119.........KLA........V-VG-GP...SW.VEWG.TKV---------AGAM.V...S.............G....EV
Q73Z58_MYCPA/13-121.........RIA........V-VS-DK...EW.VAHT.LHA---------LAWM.V...P.............G....EL
K9RD27_9CYAN/12-117.........KEA........I-VI-DT...KL.IESL.ENM---------KDLLVA...G.............V....KV
D9SJ90_GALCS/11-114.........KIA........V-IT-DD...QW.LTWN.AWL---------SRLF.V...D.............A....DI
W6RYK2_9CLOT/10-116.........KGA........L-VV-DGLISKMKAQVYLRKI---------KEK.........................EI
H8N2H1_CORCM/12-120.........RSAR.......V-VS-DP...GSGLQAWRMTK---------NAGLTI......................PA
I0KHL1_9BACT/11-115.........RIA........L-VG-TP...DN.IALI.TPV---------MQTI.F...R.............A....EL
A6VRW9_MARMS/21-125.........RIA........I-YG-KS...PW.QNRL.IRV---------ISWF.I...S.............A....DI
C7R9R1_KANKD/12-118.........RIA........F-VT-DS...PV.GSFA.QAI---------GNHF.I...S.............A....QI
A4FCH9_SACEN/14-119.........GCA........V-VT-DI...GW.IREL.SRL---------GSFL.V...S.............C....PT
Q6LS91_PHOPR/11-120.........KVA........V-LA-EQ...QW.IRKI.SEL---------EGMLFP...G.............L....DI
G8QLC0_DECSP/10-113.........RIA........V-IT-ES...QW.VTWS.AWL---------SRAF.V...D.............A....SI
M4S571_9SPHN/11-120.........REA........V-IT-DK...EW.IRMA.IRL---------LDPVIP...F.............M....AI
A9B5K6_HERA2/29-133.........IVA........L-LV-DS...TL.SRVIANLI---------IGL....................TGNSQAV
A4VJY0_PSEU5/11-120.........RCA........V-IA-GK...EW.LRKA.SEV---------EGALIP...G.............L....TI
I3Z121_BELBD/12-117.........KIA........M-VG-EK...KW.QEWM.AIF---------MRPF.T...N.............A....EI
A9ENE2_SORC5/23-130.........AVA........I-IG-AS...FS.MRVIMALL---------AKGVHM.................L....TG
E4TRL3_MARTH/24-128.........KIAV.......V-VS-KDVFRKFAAKNILDKQ---------KGKL........................NF
A1SAI8_SHEAM/12-116.........ALV........F-VG-GP...DW.VGNAIRLL---------GPFVAG......................EI
K9SIP1_9CYAN/14-118.........HCA........V-VT-DS...GW.IGPF.ARA---------ISPF.L...N.............I....QL
I5B5J2_9DELT/12-119.........RIA........V-VT-HK...KW.IHKLVDLE---------GKLFKS.................I....EM

PF01740

SUT22_ARATH/540-662EKIK.......TENIYMTVGEA
RSBRD_BACSU/161-267FSN.........VKTEQSLAKA
S26A2_HUMAN/569-715KKEE.......ENLLFYSVYEA
O45016_CAEEL/553-725EEVP.......RGRMFVSVSDA
SULP3_CAEEL/546-696EVVD.......ESKVFNKVGDA
D6EY97_STRLI/11-115RLL..........PPWPTLDEA
O04001_SPOST/529-651CIL..........TTGEAVASL
SUT32_ARATH/505-623ESIG.......KERIYLTVAEA
Q55814_SYNY3/440-540A............QLSPHHRLE
RSBV_BACSU/4-107DII..........DISAKSEGG
O69205_ACTPA/8-112ALL..........PTHPTVDLA
P73609_SYNY3/4-107HSF..........HLVESYDFH
SP2AA_LYSSH/4-107PWM...........MDATEEQA
O84431_CHLTR/3-107SYF..........KVFDSVNEA
P71568_MYCTU/15-120RFM..........PVYPTEKAA
S26A1_RAT/529-685GEDQG....TAEELLFPSVHSA
P73607_SYNY3/2-105DFF..........TTRPTLAEG
SP2AA_BACME/4-109KII..........RFEPNEANA
YVDB_BACSU/421-528HKIG.......KQHFFDHHDEI
RSBV_LISMO/4-109DII..........EIKNVEGEM
Q46665_ECOLX/332-437PIPG.......RLAFFPNRRAA
S26A4_HUMAN/536-725DDNI......RKDTFFLTVHDA
RSBV_BACLI/4-107DII..........DISGKSEGG
O83261_TREPA/17-124QFF..........NIRDSIADA
Y1364_MYCTU/550-649.............VVGADTEDI
O67306_AQUAE/448-564EVVN.......QDLVFNAKGEA
Q9Z6Z7_CHLPN/2-106QLI..........LLCQSEQEC
SUT31_ARATH/514-633DHLG.......KEWMFLTVGEA
Q9Z6P5_CHLPN/441-545ELIG.......VDHIFSNIKSA
O17951_CAEEL/537-690DFVS.......KENFYPTLRDA
RSFB_MYCTU/6-111KTF..........RLFSTLHDA
SP2AA_BACLI/4-109KII..........RLEQSEQRA
Q55415_SYNY3/433-538RFVP.......ESNCYDDRSEA
SULH1_SCHPO/592-725.............WIKRTLVAA
O07728_MYCTU/29-135RLI..........PLYATVETA
P72770_SYNY3/438-545GEV..........GTFRRLDTV
Q9Z841_CHLPN/3-107SYF..........KIFNTVDEA
O07488_YEREN/391-488DKP.............EEVEKL
SUT33_ARATH/498-617KEFM......RPEFLFLTVAEA
P73474_SYNY3/396-498PEL..........KLINSSAEN
SP2AA_GEOSE/4-109KII..........RVEADEQFA
S26A3_HUMAN/526-716DGEV......KSSIFFLTIHDA
SUT41_ARATH/519-638ELVG.......KEWFFVRVHDA
O84770_CHLTR/2-106KVI..........TIRKAEQES
RSFA_MYCTU/18-124DVL..........PVHPTTESA
RSBRB_BACSU/147-272FSN.........ITIKTNLAQA
SUT1_STYHA/538-656ELIG.......EDKIFLTVADA
G2TL00_BACCO/4-109KII..........RLDESEQYA
Y1739_MYCTU/443-553DKIG.......EDHIFMTLPTA
I6X4W0_MYCTU/31-137RVL..........PIYPTVDTA
SP2AA_PAEPO/4-109KIM..........PIYDNEVNA
SULX_YEAST/572-707ASVERAQANNNENNTSNTFSDA
SUT21_ARATH/548-668DRIG........GKVYLTIGEA
O83249_TREPA/5-107EMF..........TVIKSLDEL
PHOT_BACSU/148-254FSS.........LKTYSNVKDA
RSBS_BACSU/5-111EEI..........ETALDLEQG
O33206_MYCTU/385-486DNEQ.......RDKLRTVLESA
RSBRA_BACSU/151-261LSQVI.....TKNTLQKGIQTA
SUT11_ARATH/518-636EEIG.......EKNIFLTVGDA
Y1081_THENE/1-106RIV..........KIYDTISEA
SUT3_STYHA/511-631DKIG.......KERVFLTVAEA
SULH3_SCHPO/533-653DLI..........GGYDHVQDS
YG35_YEAST/657-777NDV..........ELFADLNSA
O33361_MYCTU/29-135SMF..........PMARSVHKA
O83551_TREPA/4-108NYF..........PIAESVDEA
P73108_SYNY3/3-107RVF..........PIYSNPEVA
RSBRC_BACSU/163-272FEG.........ISLRSTLASA
Q40008_HORVU/530-648DLIG.......DDKIFLSVGDA

PF13466

Q310Z9_DESAG/492-572----------------------
B5HV30_9ACTN/31-112----------------------
A9BX84_DELAS/2-83----------------------
Q0K681_CUPNH/47-125----------------------
B5H529_STRPR/9-95----------------------
Q0RDC2_FRAAA/24-104----------------------
D1AD83_THECD/187-267----------------------
D2SCD5_GEOOG/29-109----------------------
A1VK31_POLNA/2-82----------------------
A8ZVX1_DESOH/4-85----------------------
Q3SFW3_THIDA/281-359----------------------
B9TGW9_RICCO/228-309----------------------
A1W422_ACISJ/2-83----------------------
A1U461_MARHV/15-95----------------------
Q21UA2_RHOFT/4-85----------------------
B1Y2Z1_LEPCP/2-84----------------------
Q8EEQ5_SHEON/14-91----------------------
D2S5L7_GEOOG/30-110----------------------
A7MNS4_CROS8/14-91----------------------
B9JTP2_AGRVS/23-100----------------------
B8DPA7_DESVM/571-651----------------------
C6C1P3_DESAD/15-93----------------------
E3I167_RHOVT/14-94----------------------
E3IYM7_FRASU/24-104----------------------
C1D624_LARHH/5-83----------------------
A4YXB4_BRASO/320-399----------------------
D1C014_XYLCX/37-113----------------------
C6WD00_ACTMD/919-1001----------------------
E3J1T6_FRASU/56-136----------------------
C6WQ84_ACTMD/60-139----------------------
Q2SPQ4_HAHCH/13-91----------------------
D2SFP4_GEOOG/531-612----------------------
D2B5R7_STRRD/72-150----------------------
B8DLB2_DESVM/179-259----------------------
D0KYU0_HALNC/26-108----------------------
D5X3Z8_THIK1/566-644----------------------
B9J943_AGRRK/10-87----------------------
B1W2W2_STRGG/20-107----------------------
A1SBD9_SHEAM/6-85----------------------
A0LC67_MAGMM/14-94----------------------
A4YMN9_BRASO/16-97----------------------
C7LTF6_DESBD/15-91----------------------
B1LTK1_METRJ/26-107----------------------
Q0RZA3_RHOJR/48-126----------------------
C5BID3_TERTT/281-360----------------------
Q2SBJ1_HAHCH/18-100----------------------
B5HHQ5_STRPR/28-107----------------------
Q1QXI2_CHRSD/17-99----------------------
Q12BT3_POLSJ/427-501----------------------
C9R4W7_AGGAD/20-98----------------------
D9T369_MICAI/189-267----------------------
Q31HM4_THICR/6-86----------------------
Q31GZ5_THICR/18-93----------------------
A7H922_ANADF/18-92----------------------
Q21SV7_RHOFT/514-592----------------------
A3N1T8_ACTP2/20-99----------------------
B2FP86_STRMK/2-73----------------------
F9ZTS0_ACICS/20-97----------------------
Q2IMF1_ANADE/97-172----------------------
Q3J3N5_RHOS4/5-82----------------------
Q3J659_RHOS4/7-80----------------------
Q6DAF4_PECAS/14-89----------------------
Q87LF2_VIBPA/15-93----------------------

PF11964

L0GYF4_9GAMM/12-118RHF..DAA....EADAAWAWIR
W8EVU9_9BACT/23-129QVF....D....DLTTALEWL.
D5V1Z3_ARCNC/21-125KNF....E....NELEAFEWLN
Q11VP6_CYTH3/12-119KVF..EHK....DQQKAIDWVS
A5FC98_FLAJ1/11-118HGF..KKE....AFNKALNWVE
Q28QM9_JANSC/19-126KAF..DAN....QKDAAWAFV.
Q093V8_STIAD/17-124KTA..STA.FTDTEQEAREWLA
E0TIJ6_PARBH/12-118RNF..DAE....EQGTALAWLR
Q3SKE6_THIDA/10-113RLF....D....ELEAAQAWVT
Q3ID73_PSEHT/20-125AYF....E....NATTAIEWLK
B2HRZ3_MYCMM/12-119RTF..TPT....QAEEARAWVS
J7Q7E4_METSZ/12-118KAF..STA....QADQARDWI.
E8X7D9_GRATM/13-120LYF..HSS....EMIQAWRWAK
Q3J4W4_RHOS4/41-148RTF..PLT....QRDAAEAWVA
F0SJ20_RUBBR/12-119KAF..NLA....EIDQAREWLK
D5SV07_PLAL2/13-118KYF..DIS....KLEEAKAWIV
A4XX57_PSEMY/12-120KAF..DSI....HEAQAEAWLQ
A0LIB8_SYNFM/14-120EFF..PLS....SEGEAERWVR
I4C386_DESTA/12-119KTF..PVE....SLEEAWTWIK
I4AGM8_FLELS/70-181RFY....V....NKENAINWI.
M4SAG0_9SPHN/140-247RHF..PLD....SEDAARAWLS
F0SJC2_RUBBR/13-118KYF..EKE....QLDEARQWIT
M9R3U0_9RHOB/11-120KCF..DMA....DEAKAEAWLA
A9WJT9_CHLAA/12-112GLF....A....TEQEALRFLG
W8EZJ6_9BACT/24-132WIF..DFD....EQDAAYAWL.
Q8EB52_SHEON/21-126KFF....V....DKLDAITWLK
L0K3H2_9EURY/13-119EFF..DAE....DLDDAWEYVE
B1MER2_MYCA9/12-121SLF..GLD....ELDRAKVWAA
F9ZWL7_METMM/13-118RYF..DHA....DADEAWSWLS
X5E4J9_9BACT/13-117DFF....K....TVDEGVNWLM
E4TNT7_MARTH/14-124KIF....S....NSEEAESWIE
Q8TPB5_METAC/12-119KTF..RNK....EFAEAKAWIS
A3QHM0_SHELP/21-124KFF....E....DKRDALDWL.
B0JM20_MICAN/12-118RQF..PWG....ETEVATQWI.
Q7UVW9_RHOBA/74-179EYF..EPD....ELNVARAWIQ
A4FCH9_SACEN/137-244NRF..GYD....DLDEAIAWAA
A0LXE0_GRAFK/12-118KSF..KLN....ERAEAIEWLD
E1RHG3_METP4/12-115KYF..DIS....AIDEAWKYIE
G2J2P9_PSEUL/12-113QYF....D....TAEAAQAWLA
A5G4W5_GEOUR/116-227KYF..AEN....RLAEARAWLE
A3CYB3_METMJ/12-120RYF..PET....RLRDAWGWLR
Q5V739_HALMA/20-132RYF..DIK....KRERALDWLR
I4C4Z7_DESTA/12-119RTF..SEA....QLKEALEWVR
M4NFH5_9GAMM/12-119RLF..HGA....DIEEATRWIT
A1S706_SHEAM/12-119CVF..SLD....EVQIAKIWLC
M4V983_9DELT/11-119KTF..DRA....SKDEALRWA.
D4ZLE1_SHEVD/12-119RVF..DKS....SSHLAEQWIA
B2HE07_MYCMM/27-133RHF..PAG....QVEQAQQWI.
J7L4H1_NOCAA/12-117RFF..ELD....QEDAAWAWVR
F2LY86_HIPMA/12-118KVF..SNN....EIGNARKWL.
F0SJ19_RUBBR/12-119KHF..KSA....ELEAAREWLQ
Q3JB38_NITOC/148-256RTF..SKD....KEQDAWEWLE
W8EXL7_9BACT/35-135RTF....T....EEAAAVAWLR
H8MXZ5_CORCM/21-129TRV..EAE.FVDSEARARAWLE
E1RH74_METP4/11-116KFF..KED....RIDEAWEWLR
K9XV53_STAC7/12-117KYF..KSN....ELEEAWHWLE
A5FDC3_FLAJ1/11-118RCY..KKE....SFQEALNWVQ
G8RQ72_MYCRN/12-121EVF..GLD....DLERAKQWAA
Q07X46_SHEFN/12-116AWF..PLE....RKQEAITWIA
A9GPE4_SORC5/20-127EVY..PMA.FFDTEDEACAWLL
G2KMS5_MICAA/17-122RIF..NTD....QFQDALAWA.
Q6MQZ1_BDEBA/34-138EVF..TRK....ELDQARAWLA
E3FV03_STIAD/12-119RRF....W....EEASARQWL.
D2QV97_SPILD/12-116RSF..SPD....KKPLAWDWFN
Q7NXU0_CHRVO/12-113QYF....D....MIEEAQAWLA
D5ER41_CORAD/12-118RVF..RNA....ELEAATKWI.
A1SV34_PSYIN/12-119RHF..SYK....ERELALSWLQ
B3QUM5_CHLT3/13-124QIF....E....EQAAALKWLQ
G0J0D1_CYCMS/13-117KFF..DLQ....EKQKAKEWIG
A0M0N9_GRAFK/12-117KYF..DLE....EKEIAKKWIK
Q1CW14_MYXXD/23-128STF..ETV.FVKTQDEARAWVA
Q6AK92_DESPS/134-240QYF..EET....RADSAQTWIQ
V5WKN4_9SPIO/39-142QAF....E....SEEDAMKWLS
A6Q9H2_SULNB/14-120KVF..DYD....DFEEAKSWIK
F8GCM7_NITSI/10-113VVF....H....NYEEAEEWAS
C4ZLU4_THASP/10-113KVF....D....DEDEARAWLA
Q6AK92_DESPS/12-119KIF..ELD....EYLQARLWLS
F0M0B1_VIBFN/20-125RFF....E....DEAQALAWLA
A6WZX1_OCHA4/19-126RAF..EAD....EENEAWEWLS
E3FKU0_STIAD/13-119RTF....E....TRDEALAWLK
Q0AQY4_MARMM/16-124RVF....E....TERDARAWLA
Q6LKJ4_PHOPR/20-124RYF....D....DPLEALAWLR
D5BJF0_ZUNPS/25-118AFF....T....QKYQALKFLK
C7P248_HALMD/57-169RYF..GPG....EREAARTWVR
A1S9K0_SHEAM/21-126RFF....V....DRQDALEWLG
D3FPZ4_BACPE/12-117RHF..AKD....EEKIARSWIR
Q087X8_SHEFN/21-125KYF....E....DEDDALKWLR
C0QCX2_DESAH/11-120KAF..ARD....QKKAAEAWFS
Q1LPD1_CUPMC/12-120RTF..PMS....QSREAREWI.
A3HTM6_9BACT/12-125RYF..DIS....KLDDAFEFVT
F7XLD9_METZD/12-119KTF..SNE....ELADAKAWVS
B1WXR6_CYAA5/19-124KAF..ETS....EIETARMWLS
D0J5L7_COMT2/12-119RHF..PFT....EDAMAMQWLH
H6L5W1_SAPGL/20-121PKI..TTR.IFTDEEKAIEWLK
B7VP41_VIBTL/20-124KSF....E....DHDSAIEWL.
K0NMI2_DESTT/11-120KAF..SKE....EKKDAEAWLN
F4CCE8_SPHS2/23-130RTY..RLE....DRQRASEWVS
G8PHU6_PSEUV/12-120KHF..DMA....NLDKAWEWVK
A0M5Q5_GRAFK/11-116RTY..DLK....DRLEAIQWIS
A3CYB0_METMJ/12-120RYF..TEG....HLDTAIGWLR
F4AVZ8_DOKS4/11-116KAY..SSK....KRVDALCWVM
I3YWJ5_AEQSU/12-117KGF..DLN....ERQEALNWLK
Q083D4_SHEFN/12-118RYF..NRE....NLQQAWDWLR
B0BYZ0_ACAM1/138-242KAF..ERS....QIELARVWLA
E3FWM2_STIAD/2-108MPQ..GTMVFKDTEEEARAWVA
D5B9R4_ZUNPS/12-117KYF..DPD....EKQEAKIWIE
M4SAG0_9SPHN/11-120EVY..PVT....QRDRALAWVK
I4AIU7_FLELS/23-135GYF....E....DRNTAKEWLA
A5GKD8_SYNPW/21-126RHF....E....DRASADAWIR
A9GKE1_SORC5/12-119RVF....K....DEAAARSWL.
E1V9S9_HALED/39-147RTF..RVR....DKRAALDWV.
A8LJW8_DINSH/13-117REF..KRD....QLEEARAWAR
C5BJV0_TERTT/11-120KTF..KRS....EKAAARLWLE
S6B665_9PROT/11-113RVF....D....DYNLASDWVA
G0J0C5_CYCMS/12-117RYF..DLE....EKQKAKEWIN
Q1CYP8_MYXXD/13-120RTF....E....TRGEALQWLR
I0JIE9_HALH3/13-116QDY..KPN....QLEEAWNWL.
E6U1C5_BACCJ/13-120YHF....N....SYDEAFHFLK
Q47BJ5_DECAR/11-113EVF....D....NADEAKAWLA
K9X8Y1_9CHRO/10-123KMMGCPCD.VFVSVEEAIAWLE
Q8ED76_SHEON/12-119KVF..GEN....ERQLAKVWLD
A1T9B4_MYCVP/12-121KLF..GIA....ELDEAKAWAA
J1L360_9EURY/12-120RFF..RPE....HRQEAWRWIE
A3QIC9_SHELP/12-116AWY..ALE....DKPQAIEWIT
G2J2S0_PSEUL/12-117RYF..PSE....ETPAAWAWIH
D5CNM7_SIDLE/10-114RVF....N....DYSEAQIWAQ
Q093V7_STIAD/21-127STG..TQAVFMDTEEEARAWLA
W8S663_9RHOB/15-124RAF..APD....QEERARAWLA
A9GPD9_SORC5/60-166QSY..PVE.FFETEGEARAWL.
Q11I87_CHESB/20-127KHF..ELE....QAEAAWEWLG
C1DA99_LARHH/12-113AHF....E....DGDAARAWLH
B3QXG2_CHLT3/14-123KIF....K....NQDDALAWLS
H2FUI0_OCESG/21-126QYF....E....SRSEAEAWLD
E1QK88_DESB2/12-119KYF..QHG....LLPQALEWLR
W8S5M5_9RHOB/17-125KSF..DTE....E..AALAWLK
I4EWX0_MODMB/5-112RGY..PVA....QLPRAKEWLA
V5XBD7_MYCNE/12-121AVF..GGN....ELDRAAEWAA
D5B9R0_ZUNPS/6-111KFF..DIS....EKQQAQNWIK
F5XYL0_RAMTT/15-117RVF....T....RLDQAQAWLR
Q1ZBL2_9GAMM/21-125KYF....E....NLTNATLWLK
A3QF38_SHELP/12-119KVF..ARQ....AADEALRWLG
Q3JB38_NITOC/16-125KVF..TPE....QSDEAMNWVS
D6XVY9_BACIE/11-115KHF..TLS....KVTDATSWLK
Q2YCI1_NITMU/10-113RVF....R....DYAAAKTWLE
C6Y0C1_PEDHD/12-119KGY..KLS....ELPIAIGWLS
B1LYM2_METRJ/12-117KVF..ERA....RIDEARSWLA
Q7MEX7_VIBVY/25-130KSF....S....DYDSAITWLA
Q12ZF4_METBU/12-119KTY..NNE....ELSEAKAWIS
L0G526_ECHVK/12-117RYF..DRN....EKESARQWIG
F4C7J2_SPHS2/12-119KGF..SHA....EVGAAVAWLS
B0BYZ0_ACAM1/12-117KAF..APS....QLEAARTWLL
A6Q671_SULNB/23-127KFF....L....KRGEALTWLM
A0LXE0_GRAFK/144-249KAF..PLD....QEHRAMDWLK
W8EUS5_9BACT/21-126LLF....D....DVAAAYAWL.
H6L5S2_SAPGL/58-159KLF....A....TEEKAIDWLK
G8R3P5_OWEHD/12-122KSF..EFS....DKEEALEWIR
W0RC97_9BACT/11-121EIF....H....ELGDALSWLA
C6C2B1_DESAD/11-117RHY..NQD....QRAEALKWVQ
H6L5W0_SAPGL/30-131PPI..PTR.LFSNKEKALQWLA
D9QNG3_BRESC/27-134QTF..DAA....EEIQARAWID
G2KMS4_MICAA/16-122RYF..NLE....DLDDAIAWMQ
H6L0F3_SAPGL/30-131KVF....T....NEVAALDWLK
A0LXC2_GRAFK/12-117KFF..EIE....EKERAKKWIQ
Q2RZR2_SALRD/34-139QTY..DAA....DQEEALDWIR
G2KMS2_MICAA/25-131RVY..AAG....ELEEAVRWIK
G0L8K0_ZOBGA/13-125RYF..DIS....QLDEALQFIA
Q82UI4_NITEU/10-112VVF....S....DYDEAYGWA.
I1YHY0_METFJ/11-119KAF..ERH....QQDQAEAWL.
C6X1D7_FLAB3/12-118RGF..GKE....DLASAIYWC.
I4ANF2_FLELS/25-134QFF....T....NLQDAIEWIK
V5WM94_9SPIO/3-107QEF....D....NETSATAWLR
X2HCK2_9NEIS/13-113RYF....S....DTATAQKWLE
S6ATB1_PSERE/11-120KAF..GSA....QSAEAEAWLQ
E6WYT5_NITSE/23-127RFF....S....DYNEALEWLR
D5BJR6_ZUNPS/18-118QIF....T....DKDEALSFLQ
C7RNF8_ACCPU/11-113RIF....D....DEVEARSWLA
A8ZX31_DESOH/24-127KFF....K....TREDAMKWLR
H0PYZ6_9RHOO/10-113LVF....H....DEAEARAWLE
F0JGN8_DESDE/12-119KLY..PPE....KLDQALEWIV
A9GPD8_SORC5/37-144RSH..AIA.FFDTEGEARAWLL
G2KMS3_MICAA/30-137RMF..EAG....QIAEAVEWMN
Q31FZ2_THICR/21-125KRF....E....SEEEAINWLS
A9GPE2_SORC5/23-130RLP..VLV.FFETEAEARAWLL
X5E3H4_9BACT/12-117KYY..EFT....DIDEARDWVK
M1NQM0_9CORY/12-118ETF..DAG....QRDEARDWLR
A0M0L9_GRAFK/12-115KCF..SPE....EKDLAKEWME
A6Q807_SULNB/11-120KAF..DLD....EIVEAEAWLS
C6BYE1_DESAD/13-119KTY..PAE....ELETALKWTA
Q73Z58_MYCPA/13-121AVF..GLG....ELERAKQWAA
K9RD27_9CYAN/12-117KCF..PFE....DRCQARCWI.
D9SJ90_GALCS/11-114RVF....T....NYEEAIAWVH
W6RYK2_9CLOT/10-116KVF....T....DFKDAIAFC.
H8N2H1_CORCM/12-120KTF....E....TRSEALSWLE
I0KHL1_9BACT/11-115RSF..SPD....QKEAAWQWF.
A6VRW9_MARMS/21-125KVF....K....RKKEATDWVM
C7R9R1_KANKD/12-118RHF..TFD....EFEAARRWI.
A4FCH9_SACEN/14-119RVF..GND....ELGEATDWLS
Q6LS91_PHOPR/11-120KGF..PPN....DTENAEAWLT
G8QLC0_DECSP/10-113RVF....S....DEAEAKAWLA
M4S571_9SPHN/11-120KTF..EPG....EAEAAMAWVS
A9B5K6_HERA2/29-133QVF....S....DEQAARQWLR
A4VJY0_PSEU5/11-120KAF..DLH....QEAEALAWLE
I3Z121_BELBD/12-117KYF..DSE....ERDTALAWIK
A9ENE2_SORC5/23-130QPY..PQQ.FFDTEGEAHAWLL
E4TRL3_MARTH/24-128QYF....N....NLEDAKAWLK
A1SAI8_SHEAM/12-116AWF..PLQ....DKAKAIAWIQ
K9SIP1_9CYAN/14-118KMF..KME....QKQEALDWLK
I5B5J2_9DELT/12-119RGF..SKE....EKDQAIEFLS

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window