Sequence alignment for CL0502

PF01740

SUT22_ARATH/540-662YPMANKTAGL....LTLRISSPLLCF-ANANF-I----------RDRILN--SV--------QE--IEGEENEQ......
RSBRD_BACSU/161-267APIMPITDGI....GILPLVGE.IDT-HRART-I----------LESVLE--QC--------SA--LK............
S26A2_HUMAN/569-715YKNLQIKPGI....KIFRFVAP.LYY-INKEC-F----------KSALYK--QT--------VN--PILIKVAWKKAAK.
O45016_CAEEL/553-725YETANDIPGI....KIFRFDSP.IYF-GNSEM-F----------VRKIHQ--AC--------GL--NPLIVRGELETENK
SULP3_CAEEL/546-696KRDLERIQGN...VCIFRMDAP.LIF-TSSDR-F----------TMSVWQ--CV--------KK--W.ERCKSESFVTIE
D6EY97_STRLI/11-115HLRVRHHRGH....TVLEFRGE.IDI-ASAAE-I----------APYLDR--ET--------GR--PG............
O04001_SPOST/529-651YKDAQRIPGF....LILATEAP.INF-ANSNY-L----------NERIKR--WI--------EE--ESSAQT........
SUT32_ARATH/505-623YPQAITRSSL....LILHIDGP.IYF-ANSTY-L----------RDRIGR--WI--------DE--EEDKLR........
Q55814_SYNY3/440-540QILRAANGRI....FMFHLSGP.MSF-GAAKS-I----------ARRLAI--VE--------NY--..............
RSBV_BACSU/4-107NVDVKQNEND....IQVNIAGE.IDV-YSAPV-L----------REKLVP--LA--------EQ--G.............
O69205_ACTPA/8-112AVVTVASDVVR.GVPVLRVAGE.IDA-NVADE-V----------RRALLP--WL--------DG--L.............
P73609_SYNY3/4-107NIESEIINNA....AKLTLIGE.LDG-GTAPL-F----------KEKIEE--VA--------QA--E.............
SP2AA_LYSSH/4-107QLEMVTRETV.....VIRLFGE.LDH-HAVEQ-I----------RAKISA--AI--------FQ--GT............
O84431_CHLTR/3-107NFQKEEQGQT....GILHLQGK.LDG-VSSPA-V----------QESISE--SL--------SN--G.............
P71568_MYCTU/15-120AIAVRTQDSV....VILTADGA.LDS-SSSAL-L----------RDSLTR--AT--------LE--QP............
S26A1_RAT/529-685AAEFEGLLPPP.EVRVFRFTGP.LYY-ANKDF-F----------LRSLYS--LT--------GL--DAGYSATRKDRGTE
P73607_SYNY3/2-105DIQINQQEDI....TVVTLSGE.VDA-NTAPK-I----------HEVILP--LA--------EP--G.............
SP2AA_BACME/4-109SIELEFKQDV....LLVRLTGE.LDH-HTAEE-L----------RSKITE--AI--------EK--ES............
YVDB_BACSU/421-528VLAKREDPSV....SMYAIEGP.LFF-GSIDS-L----------ESSLLE--HV--------QK--KP............
RSBV_LISMO/4-109SIEIKERDTD...HIDIFVAGE.IDA-YTAPK-V----------KEALEV--YQ--------VK--EG............
Q46665_ECOLX/332-437PVVVDVPDDV....LVLRVIGP.LFF-AAAEG-L----------FTDLES--RL--------EG--K.............
S26A4_HUMAN/536-725YKNIEEPQGV....KILRFSSP.IFY-GNVDG-F----------KKCIKS--TV--------GF--DAIRVYNKRLKALR
RSBV_BACLI/4-107AVDTKKNDHV....IEVKVAGE.IDV-HTAPA-L----------RDELMP--LA--------EE--G.............
O83261_TREPA/17-124KMNLQKIDDLE.GGVVVFLNGY.IDT-YNSSF-F----------QKRIAK--VI--------DA--G.............
Y1364_MYCTU/550-649FVSLVESGRI.......VVRGD.VDS-TTAAT-L----------DRQIAV--ES--------RS--GI............
O67306_AQUAE/448-564NAEKRGLPECP.QIMFIRPNMS.IYF-GNAQY-V----------YDYIMN--KV--------ED--ALFN..........
Q9Z6Z7_CHLPN/2-106NLSAKEYGDI....IVIYLQGS.LDA-VSVPS-V----------QEYLEQ--FI--------QK--K.............
SUT31_ARATH/514-633YPSSRTVPGI....LILEIDAP.IYF-ANASY-L----------RERIIR--WI--------DE--EEERVK........
Q9Z6P5_CHLPN/441-545KAEVPQNTEI......YEINGP.FFF-GIADR-L----------KNLLND--IE--------KP--P.............
O17951_CAEEL/537-690YQETIFYKGI....CIFKFDAP.LLF-HNVEC-F----------KKCIEK--VY--------DE--WKKSSEFNFVKEPN
RSFB_MYCTU/6-111SITVTVADHNG..VAVLSIGGE.IDL-ITAAA-L----------EEAIGE--VV--------AD--N.............
SP2AA_BACLI/4-109GIDIHVKESV....LCIRLTGE.LDH-HTAET-L----------RKQVSG--HL--------EQ--TD............
Q55415_SYNY3/433-538RWLDEGNGRV....LLFQLSGP.MIF-GVAKA-I----------AREHNA--IQ--------EC--..............
SULH1_SCHPO/592-725NPNLTVRDPPA.GVLIFRLQES.FTY-PNAGH-V----------NSMLTS--KA--------KT--VTRRGNANIYKKA.
O07728_MYCTU/29-135RAVTECTGSA....VVVHVGGD.IDA-SNEVA-W----------QRLVSK--SA--------AI--AI............
P72770_SYNY3/438-545HPENLVISGV....LIYRINGP.ILY-FNINN-I----------ESDLFN--HL--------AQ--QQE...........
Q9Z841_CHLPN/3-107DIQKEEHGST....TIFHLHGK.LDG-ISSPE-V----------QENISQ--SL--------AA--G.............
O07488_YEREN/391-488TSVLEGTSRT......YTVTGQ.VFF-ASADR-F----------TSHFDF--RE--------AI--E.............
SUT33_ARATH/498-617YKEAQRIPGF....LVLSIESP.VNF-ANSNY-L----------TERTSR--WI--------EE--CEEEEA........
P73474_SYNY3/396-498DRVLTEDENH....RIYNVSGQ.IFF-VSKEE-F----------LEAFDF--DE--------LV--D.............
SP2AA_GEOSE/4-109AIDLEVKQDE....LIVRLSGE.LDH-HTAEN-C----------MNKCRM--CL--------EK--RA............
S26A3_HUMAN/526-716YYDMYEPEGV....KIFRCPSP.IYF-ANIGF-F----------RRKLID--AV--------GF--SPLRILRKRNKALR
SUT41_ARATH/519-638YPEAYTYNGI....VIVRIDSP.IYF-ANISY-I----------KDRLRE--YE--------VA--VDKYTN........
O84770_CHLTR/2-106EWIAREYKNI....FIVSLKGD.MDA-VTVPA-L----------EEFLTK--SI--------AK--GR............
RSFA_MYCTU/18-124KATIQHHDSA....VIIHARGE.IDA-ANEHT-W----------QDLVTK--AA--------AA--TT............
RSBRB_BACSU/147-272EMNAKQQLNAQ.REMILELSSP.VIT-LSKST-A----------LLPLVG--DI--------DT--ERAKFILE......
SUT1_STYHA/538-656YPKAAQIPGM....LIIRVDSA.IYF-SNSNY-I----------KERILR--WL--------ID--EGAQRT........
G2TL00_BACCO/4-109AIDLEVKKDV....LCIRLQGE.LDH-HTAES-L----------RASVTK--AI--------EE--NG............
Y1739_MYCTU/443-553YPQAKRVPGL....VVYRYDAP.LCF-ANAED-F----------RRRALT--VV--------DQ--DPGQVE........
I6X4W0_MYCTU/31-137RATTDGSGAA....LLIHAGGE.IDG-RNEHL-W----------RQLVTE--AA--------AG--VT............
SP2AA_PAEPO/4-109QIEMEHHRGV....LIVRLSGE.LDH-HTSDM-V----------RMQMDE--AI--------QR--RQ............
SULX_YEAST/572-707SLDVEGTEEIE.GCMIVRIPEP.LTF-TNSED-L----------KQRLDR--IE--------RY--GSSKIHP.......
SUT21_ARATH/548-668YPMTVKTPGV....LIFRVKSA.LLC-FANAS-S----------IEERIM--GW--------VD--EEEEEEN.......
O83249_TREPA/5-107NIAKDVRPGC....VLLTVTGA.VSS-YTYGE-F----------ESRVHG--AL--------KE--..............
PHOT_BACSU/148-254TPIVPIRNGI....SALPLVGN.LTE-ERFNS-I----------VCTLTN--IL--------ST--SK............
RSBS_BACSU/5-111KIPILKLYNC....LLVSIQWE.LDD-QTALT-F----------QEDLLN--KI--------YE--TG............
O33206_MYCTU/385-486RKAKVTQDDT....GTYRIDGP.LSF-LSVDG-V----------FGSLRD--GR--------E.--..............
RSBRA_BACSU/151-261APLIPVFENI....TVMPLVGT.IDT-ERAKR-I----------MENLLN--GV--------VK--HR............
SUT11_ARATH/518-636YPDAAQIPGI....LIIRVDSA.IYF-SNSNY-V----------RERASR--WV--------RE--EQENAK........
Y1081_THENE/1-106MFPYKIVEDV....VILMPNKE.LNI-ENAHL-F----------KKWVFD--EF--------LN--KG............
SUT3_STYHA/511-631YPMAVTTPGI....LVIRISSG.SLC-FANAG-F----------VRERIL--KW--------VE--DEEQDNI.......
SULH3_SCHPO/533-653STAVESAPRI....LVVRIPEP.LFF-ANVSQ-L----------EDRLNR--LE--------KY--GHPRMHP.......
YG35_YEAST/657-777YVQTKFLDGIGEQIYVLKLQNL.LFF-GTIIS-I----------EEKIER--LL--------QI--SNKDA.........
O33361_MYCTU/29-135QIRAYLHHLA....TVVTIRGE.IDA-ANVEQ-I----------SEHVRR--FS--------LG--T.............
O83551_TREPA/4-108ELKVRQSGGI....CVVDISGD.MDL-YHSYK-L----------KDLVLK--LF--------DR--G.............
P73108_SYNY3/3-107SFNPQIVTRD.....VFYPQGT.LSA-AVTQA-F----------QADLAS--WL--------AT--TS............
RSBRC_BACSU/163-272ELSAPVIVLFH.SVGLLPLIGD.IDT-VRAKL-I----------MENTLH--QC--------AK--KK............
Q40008_HORVU/530-648YPEATKVPGV....MIVRVDSA.IYF-TNSNY-V----------KERILR--WL--------RD--EEEQQQ........

PF13466

Q310Z9_DESAG/492-572----------------LQLAGD-ITI.ERSAQ.L----------QEAFQE..AL........SR..Y.------------
B5HV30_9ACTN/31-112----------------LVLAGP-VTR.DEVTE.L----------GDEVRA..LLR.....TTGA..G.------------
A9BX84_DELAS/2-83----------------LQLPRE-LTY.RQARS.C----------LVQLRP..QV........QAFDG.------------
Q0K681_CUPNH/47-125----------------LSLGTS-LTN.QNAAA.V----------LRDGLA..RL........AQ..G.------------
B5H529_STRPR/9-95----------------MHITGR-ITP.ADVPR.L----------CEELRH..LLRDDGTGGGA...P.------------
Q0RDC2_FRAAA/24-104----------------VRLVGR-VDV.RTVGT.L----------RSLLHA..AI........DN..G.------------
D1AD83_THECD/187-267----------------LALSGE-LDA.ARHAV.F----------GEALSQ..ALA......RAN..G.------------
D2SCD5_GEOOG/29-109----------------ITAAGE-LDR.AVAHR.L----------SDALDA..LA........LT..G.------------
A1VK31_POLNA/2-82----------------LKLPAV-LTH.AVASG.F----------FHTVAK..EVL......SLP..K.------------
A8ZVX1_DESOH/4-85----------------IVLHGD-CLV.NRAEE.L----------HQLFCH..LL........KQ..S.------------
Q3SFW3_THIDA/281-359----------------VRLSGE-ITP.ADDSA.L----------QQLSAH..AA........NH..N.------------
B9TGW9_RICCO/228-309----------------LSVSGV-LDF.ETTVQ.L----------LAQGRE..WIE......SAA..P.------------
A1W422_ACISJ/2-83----------------LVLPAE-LTH.RHAGA.T----------LRMLLQ..GL........KA..QD------------
A1U461_MARHV/15-95----------------LCVTGD-VDA.DTVLA.L----------RKQGEQ..EIR......QAD..G.------------
Q21UA2_RHOFT/4-85----------------LVLPQE-LTQ.RQATV.C----------LRALVQ..DLA......SLP..G.------------
B1Y2Z1_LEPCP/2-84----------------LSLPER-LTHVETPPT.L----------RSLFAEMDAL........PA..G.------------
Q8EEQ5_SHEON/14-91----------------VNLTEE-LTI.YSVME.F----------RDALVG..HL........QP..G.------------
D2S5L7_GEOOG/30-110----------------VDLAGH-LDR.RTVHL.L----------HDAIST..LL.......LTD..G.------------
A7MNS4_CROS8/14-91----------------LRLNGT-LDR.ETLTP.L----------WEQRQ...SI........TD..G.------------
B9JTP2_AGRVS/23-100----------------LKLASV-LDL.NEASQ.L----------KDKLLS...M........RG..G.------------
B8DPA7_DESVM/571-651----------------LVLSGE-VTI.ERGAD.L----------REALLD..VL........GS..F.------------
C6C1P3_DESAD/15-93----------------MNISGR-LDA.EGAGE.V----------WDKARA..AV........AA..G.------------
E3I167_RHOVT/14-94----------------LELEGD-LRP.RDASA.L----------HEALLV..AL........SG..E.------------
E3IYM7_FRASU/24-104----------------IELAGE-LDA.PGRRC.L----------RDQIAE..LL........GR..G.------------
C1D624_LARHH/5-83----------------LALPSA-VTF.DEVSG.L----------LRNWLP..AV........RA..A.------------
A4YXB4_BRASO/320-399----------------LSLSGP-ADA.RHVDR.A----------IPVFRS..AV........AV..R.------------
D1C014_XYLCX/37-113----------------IVLSGE-IDA.DIGAE.L----------SEMSAE..AE........AT..G.------------
C6WD00_ACTMD/919-1001----------------LHLGGD-LDL.DGVRA.L----------REFLLG..RVD......VAD..R.------------
E3J1T6_FRASU/56-136----------------LSIDGD-IDA.SVLPA.L----------VGTLAK..VA........HH..G.------------
C6WQ84_ACTMD/60-139----------------LHVAGE-IDQ.LSAPV.L----------RGALDL..AL........KH..R.------------
Q2SPQ4_HAHCH/13-91----------------IKLPGA-FSI.SSVEK.V----------YEQVNN..AP........AT..Q.------------
D2SFP4_GEOOG/531-612----------------VRATGA-VDM.LGAEQ.M----------RIRLLE..ASH......GGT..G.------------
D2B5R7_STRRD/72-150----------------LKVSGD-IDR.TTRRL.W----------EEALDG..LV........TQ..G.------------
B8DLB2_DESVM/179-259----------------VRIRGT-VNS.PAEPV.L----------RHVFEE..AL........LT..G.------------
D0KYU0_HALNC/26-108----------------VRVQGD-LLR.SSIES.L----------SDLSLP..MPD.....GQTP..G.------------
D5X3Z8_THIK1/566-644----------------LHLSGE-I.L.GSSSD.F----------LNPLEQ..AA........KT..H.------------
B9J943_AGRRK/10-87----------------VSLAAV-LDL.NEASA.L----------RGKLMG..L.........RG..S.------------
B1W2W2_STRGG/20-107----------------LTVTGR-VSR.AVVAD.L----------CVELER..ALADPGGAAPAP..G.------------
A1SBD9_SHEAM/6-85----------------VELGSE-LTI.RNIQP.I----------YSQLAD..LL........HQ..G.------------
A0LC67_MAGMM/14-94----------------ISLVGS-FSH.AIFKE.F----------KNAYLP..LT........PG..P.------------
A4YMN9_BRASO/16-97----------------VVVRGA-LTS.DTQTA.F----------KQQVEP..VL........SN..PS------------
C7LTF6_DESBD/15-91----------------IKLSGN-LTL.DHSRD.I----------HAELLA..RL........PQ..A.------------
B1LTK1_METRJ/26-107----------------LALDGR-WTA.DQAPT.V----------EAAAAR..IA........AA..GR------------
Q0RZA3_RHOJR/48-126----------------LRVSGD-LDM.VTAPI.L----------AACLDE..VV........LR..G.------------
C5BID3_TERTT/281-360----------------LTLTGA-MGS.DFSRN.L----------MAEVVD..HA........RP..H.------------
Q2SBJ1_HAHCH/18-100----------------LSISGI-VDL.SNVAD.L----------LAEGEK..AV........QA..AD------------
B5HHQ5_STRPR/28-107----------------LVFSGV-LDA.HALPE.L----------EERLLD.PRL.......RQA..G.------------
Q1QXI2_CHRSD/17-99----------------LKLSGD-VRL.TLCAT.L----------DQQAQR..VA.......DSP..G.------------
Q12BT3_POLSJ/427-501----------------LALRGR-ATW.MHCDA.F----------YETARA..VL........EE..G.------------
C9R4W7_AGGAD/20-98----------------LRLKGE-LSQ.NTLLP.L----------WQQRAS..FLL.....ARKT..E.------------
D9T369_MICAI/189-267----------------VALAGE-LDP.SNHRD.F----------AAALER..ADP.....RPVA..G.------------
Q31HM4_THICR/6-86----------------IELPEN-LTI.HHIEE.E----------FGNLKI..AF........QS..D.------------
Q31GZ5_THICR/18-93----------------IKLSGQ-INM.DAVAS.F----------YAQGIK..SL........VN..P.------------
A7H922_ANADF/18-92----------------IRLSGV-FDH.ASAAE.L----------AQRLQQ..E.........AA..T.------------
Q21SV7_RHOFT/514-592----------------VELSGE-VLG.DAAEA.L----------DKLQAG..LY........DA..K.------------
A3N1T8_ACTP2/20-99----------------VKLSGE-LTR.DTLLP.L----------WKQRAS..FL.......SPK..G.------------
B2FP86_STRMK/2-73----------------......-LDR.AAVIA.L----------WPQLQ...AL........PA..K.------------
F9ZTS0_ACICS/20-97----------------LRLSGD-WRL.DALDEAL----------RSEELR..SL........AV..D.------------
Q2IMF1_ANADE/97-172----------------ISLDGV-LDV.PTARR.L----------AAQLAA..A.........AP..G.------------
Q3J3N5_RHOS4/5-82----------------LDLPAR-LDH.QGARQ.L----------YAALLS..M.........PP..G.------------
Q3J659_RHOS4/7-80----------------LTLSGT-LRL.QDAPG.L----------IERLAA..AL........AA..G.------------
Q6DAF4_PECAS/14-89----------------LALTGD-LDR.ETLLP.F----------WQQRES..LL........A...G.------------
Q87LF2_VIBPA/15-93----------------LTLTGA-LDR.DSVPS.L----------WAFAQQ..WK........PS..Q.------------

PF14213

G2J3X0_PSEUL/31-97-------------------SGERFRD-EQLIP-A----------LGS...------------.A----------------
C5AFW9_BURGB/238-293-------------------QAQRLLA-RVER.-.----------......------------.F----------------
R6DUG2_9CLOT/21-84-------------------QGGLIFD-AIVPK-L----------.KD...------------.G----------------
D8P9E0_9BACT/36-91-------------------EARRLLA-NLEN.-.----------......------------.V----------------
D9QF83_BRESC/26-91-------------------NGARFRN-EKLLP-L----------LLN...------------.G----------------
K8GP23_9CYAN/208-263-------------------QAKRLLN-RLSA.-.----------......------------.F----------------
D7E2C2_NOSA0/17-80-------------------GGQKLYD-QIHPC-L----------.LT...------------.G----------------
D9SDG1_GALCS/27-91-------------------SGQAFRD-KFLLP-S----------LKE...------------.A----------------
C4Z656_EUBE2/22-87-------------------YGVSIYE-EQIKG-K----------LDI...------------.S----------------
R5XRA0_9FIRM/285-340-------------------QARRVVY-RLEQ.-.----------......------------.F----------------
R6PJ48_9CLOT/285-340-------------------QARRILS-RLEE.-.----------......------------.F----------------
A3QA48_SHELP/32-98-------------------AGEVFRD-TILVD-A----------LKA...------------.N----------------
R5ZPG5_9CLOT/24-98-------------------SGENFRK-KILKP-R----------FIESAN------------KE----------------
Q73PI2_TREDE/278-333-------------------QAKRLIT-RFDK.-.----------......------------.F----------------
K9ZH15_ANACC/18-81-------------------SGQQLYN-LIHPQ-L----------.QA...------------.G----------------
H8H3V4_DEIGI/24-87-------------------DGEKVYD-RICPI-I----------.ED...------------.G----------------
H8XUH7_FLAIG/24-92-------------------SGEEFYH-SVLNE-K----------FYEVFS------------ND----------------
A0LXZ9_GRAFK/27-97-------------------SGEEFRN-NLLAP-A----------FKKALE------------EN----------------
Q8XHB8_CLOPE/17-78-------------------DAIILRD-YIEDN-L----------......------------.N----------------
Q5NEH5_FRATT/276-331-------------------QAKRLLT-RLEN.-.----------......------------.F----------------
R4K797_CLOPA/19-79-------------------DAILLKS-NLAND-.----------......------------.N----------------
A9H234_GLUDA/27-96-------------------NGTRFRE-TILRP-A----------IEAAKQ------------NG----------------
D5BER1_ZUNPS/19-78-------------------QGKSFFS-SLNEA-A----------.QG...------------.S----------------
I4C4U2_DESTA/277-332-------------------QAKRLLA-RIEK.-.----------......------------.F----------------
G0AI14_COLFT/270-325-------------------QAKRLTR-RFER.-.----------......------------.F----------------
K9ZPS4_ANACC/341-404-------------------AAKRFRD-SRIIE-R----------VQN...------------.G----------------
H6LER3_ACEWD/283-338-------------------QARRIFD-GMNL.-.----------......------------.F----------------
E6N6U4_9ARCH/18-73-------------------TANTLFD-MIEKA-Q----------......------------.D----------------
F8I7N0_SULAT/28-91-------------------QGRRLRG-LLVDH-I----------.HR...------------.Q----------------
F5YCP5_TREAZ/25-79-------------------AKAYIFK-DIKP.-.----------......------------.G----------------
A5G5Z8_GEOUR/270-325-------------------QAKRVLA-RVEK.-.----------......------------.F----------------
H6RW13_BLASD/80-135-------------------EAKRLLR-GLER.-.----------......------------.F----------------
L0D9F9_SINAD/118-173-------------------EAKQLLG-SVRT.-.----------......------------.P----------------
D8IQ15_HERSS/25-89-------------------SGEEFRA-DHLVP-A----------LEE...------------.G----------------
Q82UU3_NITEU/25-95-------------------NGEKFRE-ELLVP-A----------LSEAID------------KG----------------
B5EI93_GEOBB/335-400-------------------VGIPIRR-KLLNL-Y----------EMSG..------------.G----------------
L0DGU6_SINAD/19-82-------------------DGAVLCQ-QTHTA-L----------.AQ...------------.G----------------
W6RWL6_9CLOT/19-83-------------------QGDLIFD-EIATS-L----------DKS...------------.E----------------
B4U9L3_HYDS0/40-103-------------------TGVIVRK-MMEEL-L----------EK....------------.N----------------
K9TRC5_9CYAN/18-81-------------------DGQKIYH-KIHPQ-L----------.VA...------------.G----------------
K4IKE5_PSYTT/20-83-------------------DGQKIFD-LLERS-L----------.SD...------------.K----------------
K4L2N6_9FIRM/328-393-------------------TGERIRN-LVINL-M----------KQNP..------------.G----------------
K9UH85_9CYAN/18-81-------------------DGQQLFD-LIHPQ-L----------.QT...------------.G----------------
B4SE54_PELPB/33-96-------------------DGQKVFD-KTVPL-L----------.KA...------------.G----------------
B7XKG1_ENTBH/25-91-------------------SAEDFRE-RLLAP-S----------LKK...------------.N----------------
E6U4T1_ETHHY/18-81-------------------DGRKLRK-AIEAS-L----------.KD...------------.G----------------
A6L6I8_BACV8/31-97-------------------RGVYVRE-NSHID-D----------IDSK..------------.Y----------------
K9RV87_SYNP3/278-333-------------------QAKRLLA-NVDK.-.----------......------------.F----------------
E3H2Y7_ROTDC/336-394-------------------GGTKISN-IIGNL-V----------NDG...------------.A----------------
C7MM94_CRYCD/17-81-------------------AGRVAYN-RIVSL-P----------TWG...------------.T----------------
B1ZYW4_OPITP/20-83-------------------AAARFRL-TRIEP-Y----------VAI...------------.S----------------
F3ZTR7_9BACE/27-97-------------------SGEKFRK-NILAC-V----------FKKAIN------------EN----------------
Q5E361_VIBF1/32-98-------------------SGEVFRK-QCLVP-A----------LRE...------------.F----------------
W0PBU4_9BURK/27-91-------------------SGERFRD-EILIP-A----------LRD...------------.N----------------
Q7NLA4_GLOVI/5-68-------------------AGQVVYE-KIYPQ-L----------.QA...------------.G----------------
A7I365_CAMHC/26-89-------------------SGEKFRD-EVLEK-Y----------FKA...------------.N----------------
Q7VJH0_HELHP/18-83-------------------DGEKLHN-KIKET-Y----------.KE...------------.G----------------
D1B345_SULD5/22-85-------------------DGDKVYK-TIQKI-L----------.NE...------------.N----------------
R6I2W7_9FIRM/273-328-------------------QAKRICN-RLEK.-.----------......------------.F----------------
A1BGI6_CHLPD/273-328-------------------QAKRLVS-RFEK.-.----------......------------.F----------------
K9VZ93_9CYAN/30-93-------------------DGQKVYD-LVHPE-L----------.LA...------------.L----------------
Q97FP7_CLOAB/19-80-------------------DAVVLKY-HILKS-K----------......------------.G----------------
A1SAB7_SHEAM/362-425-------------------AAIKFRD-NKLFQ-A----------VKD...------------.G----------------
E3HBI7_ILYPC/11-75-------------------HGPEVLF-NKISE-N----------LKK...------------.K----------------
V5SDX9_9RHIZ/278-333-------------------QARRLMA-RVER.-.----------......------------.F----------------
A4XX40_PSEMY/363-426-------------------AAIKFRD-KRITP-A----------IDS...------------.G----------------
S6ABL2_9PROT/28-89-------------------TASPLRE-EVEIA-L----------AQ....------------.G----------------
K9V072_9CYAN/33-96-------------------DGKRVYE-HIAAV-F----------NA....------------.G----------------
I3Z1N7_BELBD/17-80-------------------AGHDFYL-HLKEV-L----------.KK...------------.G----------------
R6H1A0_9FIRM/21-84-------------------QGDVIFQ-EIDSS-F----------.KQ...------------.K----------------
M4VBB1_9DELT/264-319-------------------QAKRIML-GLEK.-.----------......------------.F----------------
Q8TKH8_METAC/27-90-------------------DGQKVHD-IIVDL-F----------.RK...------------.N----------------
I0K8N5_9BACT/19-82-------------------EGQEVYN-RMEKA-M----------.QA...------------.R----------------
W6RYG0_9CLOT/18-79-------------------EATLLKQ-IIYEN-L----------......------------.E----------------
H2J416_MARPK/19-82-------------------EGEKLRI-ILKKY-L----------ENT...------------.K----------------
Q3JEZ3_NITOC/23-86-------------------DGQKVFG-KVEQL-V----------.RE...------------.G----------------
D4M3H3_9FIRM/23-78-------------------HARRVLK-DAEG.-.----------......------------.Y----------------
R6G1E0_9CLOT/19-80-------------------DAILLRE-IIKNN-L----------......------------.E----------------

PF11964

L0GYF4_9GAMM/12-118ILAFRLS...GK......LHDQDYRT-.FVPV-I..........ENAI.A.....AAPG....P----------------
W8EVU9_9BACT/23-129LLYIEWQ...PL......VSAAPARE-MLQQL-LTAIDTR......................HA----------------
D5V1Z3_ARCNC/21-125.LTIKAV...GT......LTHEDYET-.ITPL-I..........DSAL.E.....GVTN...PK----------------
Q11VP6_CYTH3/12-119MVGFKAT...NE......VTQEDFTN-KVIPT-V..........KELV.E.....K..T...DT----------------
A5FC98_FLAJ1/11-118IVAFRAL...AE......VTKDDFLT-AVVPA-V..........EHLV.K.....Q..T...NE----------------
Q28QM9_JANSC/19-126VYAFRVT...GH......IDDDASEA-.LAKF-M..........LAAFDR.......HE...EK----------------
Q093V8_STIAD/17-124LVKVTFR...GQ......MDIQEQQA-.SYAC-V......EE.IRAR...........Q...ET----------------
E0TIJ6_PARBH/12-118VLAARFA...GR......LAREDIER-.FANW-L..........ESEM.R.....E..R...VD----------------
Q3SKE6_THIDA/10-113LIAVTVM...GQ......FTLADYRE-.FEEA-V..........AHGIAF........E...GK----------------
Q3ID73_PSEHT/20-125FLTLKAV...GT......LTHKDYKI-.ITPM-I..........DSAL.S.....KVDH...PI----------------
B2HRZ3_MYCMM/12-119VAAFVCH...GH......VTKDDYET-VVIPD-I..........EKRL.L.....N..H...DK----------------
J7Q7E4_METSZ/12-118VVAIVCK...GR......VTKADYDA-VLAPA-V..........RDAL.E.....K..H...DK----------------
E8X7D9_GRATM/13-120.FGFKVI...GE......LTTSDIAA-.ICQQ-IDFAIDERR.KPIGI.L.....AD.......----------------
Q3J4W4_RHOS4/41-148ILTFELG...GH......VGRPEIRR-.MAET-V..........LAAFDR........F...ES----------------
F0SJ20_RUBBR/12-119ILEMEID...GG......ITAEEFDS-AL.EQ-A..........NAAI.E.....Q..H...GS----------------
D5SV07_PLAL2/13-118LLIVRVT...GK......LDAAAYEQ-.FVPM-V..........EKMV.A.....EH.G....K----------------
A4XX57_PSEMY/12-120.IDVDFT...GK......LDSEAMRV-.A...-L..........DELIQA.....AEGI...EH----------------
A0LIB8_SYNFM/14-120LMHVRIS...GI......MEPADQES-.L.QT-V..........AASL.I.....AQGL...K.----------------
I4C386_DESTA/12-119ILAVRAI...NK......LTEEDYEN-VLIPK-L..........EALI.Q.....TH.G....S----------------
I4AGM8_FLELS/70-181ILALEWR...GD......ITDEQYKE-VMNKL-LELSYLY......................DT----------------
M4SAG0_9SPHN/140-247ICAFEVD...GR......ITADELDG-.LYTH-I..........FEVSQP........D...SP----------------
F0SJC2_RUBBR/13-118VIEVQLS...GK......LTKEAYHE-.FVPF-T..........EEKI.K.....EH.G....K----------------
M9R3U0_9RHOB/11-120RVDIELS...AI......LDSDMMAA-.G...-L..........DELFEA.....SQDI...SN----------------
A9WJT9_CHLAA/12-112LIWVVMEEHLHL......AEAERYYH-EMWRL-L.....................DQCP...KP----------------
W8EZJ6_9BACT/24-132LLRVTWR...GQ......YDAKSART-.GCEH-ILAHICHTR.CSLML..........N...DS----------------
Q8EB52_SHEON/21-126FVAFKAI...GT......LTHQDYEV-.MVPV-L..........EAAL.A.....GVKD...PD----------------
L0K3H2_9EURY/13-119.IGYEAT...DE......LSEDEYAE-.ILAD-V..........EAAIDE........Y...GS----------------
B1MER2_MYCA9/12-121VVGFRVS...GR......LTGNELRE-.FTST-I..........KEAL.N........G...DE----------------
F9ZWL7_METMM/13-118LLVVQVS...GT......LVKADYQQ-.FVPE-F..........ERLV.S.....QH.G....T----------------
X5E4J9_9BACT/13-117VIHLQFTRDYLT......TDIPDIRS-KMNEL-FDDIPYRQMCIHISKTAKVENRETRE...QS----------------
E4TNT7_MARTH/14-124IITVTFT...GE......KSTDENFQ-QYLDE-L..........QSCYDD........R...QQ----------------
Q8TPB5_METAC/12-119VVAAVAN...GK......ITGEDYEK-VLIPA-I..........EDKI.R.....T..Q...GK----------------
A3QHM0_SHELP/21-124.LAFKAV...GK......LTHEDYEQ-.MTPL-L..........ESAL.A.....GIKT...PE----------------
B0JM20_MICAN/12-118ILYMQPT...SA......LAAEDFIK-.IAEA-V..........DPHI.E.....A..T...GG----------------
Q7UVW9_RHOBA/74-179VIEVEIN...GT......LSKQDCSA-.LLPT-V..........KERI.V.....R..F...GS----------------
A4FCH9_SACEN/137-244VVVVEVQ...QP......LRVQDFDA-.LAVT-V..........DTWL.E.....R..Q...GD----------------
A0LXE0_GRAFK/12-118IYSFEIS...GG......ISESEMHD-.FIEL-L..........ETKANT............KK----------------
E1RHG3_METP4/12-115FIGIEAS...GE......ISENDISE-.ITPQ-L..........DELIER........Y...GK----------------
G2J2P9_PSEUL/12-113..DVALF...NE......FTLEDFKE-.LEVA-L..........MKRIAE........H...GK----------------
A5G4W5_GEOUR/116-227VWVVRIT...GA......LRKEEMDA-.I.QA-VGI.......KAAGL.R.....AQNP...ED----------------
A3CYB3_METMJ/12-120VLGFRFD...GK......LSESDYAT-VLIPE-L..........ERAI.E.....E..H...QN----------------
Q5V739_HALMA/20-132LIAIRV....GK......GTRTGYQE-LYSLL-V...................EKSDKH...GY----------------
I4C4Z7_DESTA/12-119VIALKAT...GK......LTDADYKD-MLIPK-V..........EEII.K.....QS.R....K----------------
M4NFH5_9GAMM/12-119TLGFRAH...GQ......VTAEDYEN-IVVPD-V..........EAAF.A.....L..N...RK----------------
A1S706_SHEAM/12-119TIALEAS...GM......IEADDYSR-VLIPA-L..........EQAL.K.....D..H...AS----------------
M4V983_9DELT/11-119VVALRVT...QT......LDADDYQE-.IIEE-I..........EFRLVT........H...QK----------------
D4ZLE1_SHEVD/12-119TVAIKAS...GV......VTGDDYDK-RLLPA-I..........EGRL.K.....D..H...AS----------------
B2HE07_MYCMM/27-133ILHVRPE...TA......LDKEDFVK-.LAEV-V..........DPHI.E.....A..T...GD----------------
J7L4H1_NOCAA/12-117VLGYEVE...DT......IPHDDFEE-.ILDE-V..........REVIRR........Y...GA----------------
F2LY86_HIPMA/12-118VLKFKLS...GL......ITAEDYEN-TLIPA-I..........KEKL.K.....K..H...RK----------------
F0SJ19_RUBBR/12-119IVELDID...GE......ITPENFDE-TL.TT-L..........RAII.G.....E..H...GK----------------
Q3JB38_NITOC/148-256VFAFEIN...GM......ISAEEMPG-.VIKE-F..........EGFLER........H...DK----------------
W8EXL7_9BACT/35-135..........DE......LTFRALFN-HMVQA-L......................RRH...GW----------------
H8MXZ5_CORCM/21-129ILWIKVR...GA......FSETDVRE-.LVDL-FHELEA......GP...........D...KP----------------
E1RH74_METP4/11-116...FLIR...GK......LTDEDYRK-TLIPV-L..........EKALEE........H...ER----------------
K9XV53_STAC7/12-117VIGIKVD...GK......ITKNDFTE-.LVHK-L..........ETAINN........Y...GQ----------------
A5FDC3_FLAJ1/11-118AAAFKTV...GE......ITAYDYKT-VIIPS-I..........TALM.K.....R..I...NE----------------
G8RQ72_MYCRN/12-121VAGIRVS...GK......VTGDEISA-.FKPE-M..........QKLL.D........A...DE----------------
Q07X46_SHEFN/12-116VISLFVS...GR......LSAQDYRT-RLQPA-I..........KSYRKD........W...NQ----------------
A9GPE4_SORC5/20-127ILRFAIE...GD......ISEEIARS-.LCAV-F......RR.VSES...........G...RE----------------
G2KMS5_MICAA/17-122VICIRVD...KP......ISGEGYKT-QFLPL-V..........QKMAAD........H...GE----------------
Q6MQZ1_BDEBA/34-138.IEILVD...GD......ISKDSVVP-.LLNL-I..........QKRIDD........W...GE----------------
E3FV03_STIAD/12-119IVDFILD...GY......IRVEEMQR-FVEEL-RVATRSLTGREIKIKADLRTFKPASP...EA----------------
D2QV97_SPILD/12-116.LALLVA...DF......ITVDDYYN-.LRPL-L..........DTAL.H.....S..A...PF----------------
Q7NXU0_CHRVO/12-113..DVALF...NE......FTLADFQL-.LEQA-L..........LKRLDE........R...DK----------------
D5ER41_CORAD/12-118IVGVSAT...GK......VTAQDYER-VLIPL-I..........EEKL.K.....R..H...KK----------------
A1SV34_PSYIN/12-119ILIVEPV...DK......LEKKDFKQ-.VALL-V..........NPYL.E.....K..H...AV----------------
B3QUM5_CHLT3/13-124LVRIDFS...GK......LDVKDIIR-SLKNL-IENPDYQ......................KG----------------
G0J0D1_CYCMS/13-117.ITAEMS...GK......ITKKGIEK-.IHPL-I..........HHII.D.....K..G...NK----------------
A0M0N9_GRAFK/12-117IIATRAS...GD......LTEMDIEK-.VHPL-I..........HAIL.D.....K..G...LN----------------
Q1CW14_MYXXD/23-128.LVAEFN...GL......ITLEEVKE-.VVTL-YQQ.TA......TD...........H...GQ----------------
Q6AK92_DESPS/134-240LLTVKLI...GQ......LEPSVYEN-.FSKE-L..........DSYF.A.....S..A...EP----------------
V5WKN4_9SPIO/39-142IIRIFYP...AE......IRDNEMQS-LLDSR-LEEIKRE......................GE----------------
A6Q9H2_SULNB/14-120..VLEPH...GA......LSKKDFDN-.AAKV-I..........DPFILE.....S..D...GK----------------
F8GCM7_NITSI/10-113LVIVAII...GE......FTLADYNE-.FEQQ-V..........LYQSHF........E...GK----------------
C4ZLU4_THASP/10-113LVSLVVF...GE......FTLADYKE-.FEDV-V..........NYRVQF........S...GP----------------
Q6AK92_DESPS/12-119TIGFKMT...GK......ITKDDYEK-VVNPA-I..........ECGL.I.....E..N...NR----------------
F0M0B1_VIBFN/20-125FVVIKAV...GT......LTHQDYEI-.MTPM-L..........EAAL.V.....KVNE...PK----------------
A6WZX1_OCHA4/19-126VFAFAIE...GH......LDDASLEN-.LYGL-L..........DAAYET........H...EE----------------
E3FKU0_STIAD/13-119ILEVVYP...PQ......PSQQDVDE-YLSRV-REIIEGL.G.EWSALVDQSQLRVMSA...TM----------------
Q0AQY4_MARMM/16-124.....IS...GQ......VTTDLLMA-TFARA-R................AHEGWSDHY...DF----------------
Q6LKJ4_PHOPR/20-124.MEIKAI...GT......LTHADYEK-.ITPI-I..........DEAL.E.....GVTV...PI----------------
D5BJF0_ZUNPS/25-118IIDLKIA...KK......ITSDRLLF-.....-.......................QKA...KE----------------
C7P248_HALMD/57-169VVAIRV....GD......CSPAGFRD-LYRLL-S...................ATTDAH...DT----------------
A1S9K0_SHEAM/21-126FVVLKVT...GT......LTHEDYER-.MVPV-L..........EGAI.A.....GVSD...PD----------------
D3FPZ4_BACPE/12-117IIEYEVD...DT......LTEEENKE-.VLDE-L..........KTVINQ........Y...GK----------------
Q087X8_SHEFN/21-125.VTLKAI...GT......LTHEDYLV-.ITPM-L..........EGAL.S.....QVDQ...PK----------------
C0QCX2_DESAH/11-120RLDIEMS...GR......LDSALMEK-.A...-L..........DELVDK.....SEGI...EK----------------
Q1LPD1_CUPMC/12-120VVAVHGN...GK......LTRDDYEK-VLIPA-I..........DAVL.T.....G..R...EK----------------
A3HTM6_9BACT/12-125VLAIEII...DG......FTETDEKI-.LQKL-F..........ESKKEQ.......GF...DP----------------
F7XLD9_METZD/12-119VVGVTAS...GV......VKEEDYDK-ILKPL-I..........EDKI.Q.....K..H...EK----------------
B1WXR6_CYAA5/19-124IVEISVA...GK......ITEQDLDQ-IV.SR-L..........KTDI.E.....K..H...DK----------------
D0J5L7_COMT2/12-119ILLLEPH...GP......LTEQDFDG-.VSQD-V..........DEFL.A.....E..H...PK----------------
H6L5W1_SAPGL/20-121.GIIRVV...YD......EVITNPDD-.VHAH-I......DQ.LRQTF..........G...EG----------------
B7VP41_VIBTL/20-124IVVFKAK...GK......LTHDDYQA-.MMPI-L..........NTTL.E.....ELDS...SK----------------
K0NMI2_DESTT/11-120RIDIELS...GK......LDSKEMKI-.A...-L..........DELEEK.....SKII...EN----------------
F4CCE8_SPHS2/23-130VVAYRAQ...GK......VNGEEYKE-IVVQR-I..........AEVA.K.....A..Y...PQ----------------
G8PHU6_PSEUV/12-120VLGFEVD...GK......VDITEELN-.LISQ-V..........EEVLDK........H...AK----------------
A0M5Q5_GRAFK/11-116VIGLIVD...RD......LTEDTLDE-.IIAG-I..........KLKLEI........H...EK----------------
A3CYB0_METMJ/12-120VVGFRFD...GE......MTAGDYDV-TLIPA-L..........EDAK.R.....S..H...PV----------------
F4AVZ8_DOKS4/11-116TLGFVYE...NK......IAQDGVNQ-.VKAA-I..........EKKLES........H...DK----------------
I3YWJ5_AEQSU/12-117ILGILIS...GK......TTKEDYDQ-.LNPL-L..........EKHKME........H...GT----------------
Q083D4_SHEFN/12-118TIAVRAS...GK......LTLEDFQQ-.FFPQ-L..........ETQI.K.....RL.G....K----------------
B0BYZ0_ACAM1/138-242IVEVIIE...GT......ITAADFDR-IV.PQ-M..........KADL.A.....K..H...GK----------------
E3FWM2_STIAD/2-108..RVTLH...GQ......MGLKEVRE-.TVAV-A......EE.FKKG...........K...GR----------------
D5B9R4_ZUNPS/12-117VVVTVAS...GK......LNQHDLEK-.IHPL-I..........HSIL.E.....K..G...LK----------------
M4SAG0_9SPHN/11-120IIALSVG...GR......IEKDEMEL-.AFRL-L..........DEAFAR.....DGKV...H.----------------
I4AIU7_FLELS/23-135.IIIKME...GD......INDEEYKE-VFMLL-L.DREKTQGYTKVLFNQENVGNVSSK...SR----------------
A5GKD8_SYNPW/21-126VITVFAR...GR......LSHQDYQE-.FIPQ-L..........EAAI.A.....EQTG...DR----------------
A9GKE1_SORC5/12-119LIEVTLQ...GV......VRTEEAQA-YAADY-KKALGSLYGRRIRVLVDFRGFSIASE...EA----------------
E1V9S9_HALED/39-147VVAMRVG...GR......VDANDLQR-.AIDA-I..........ESAKKA........H...PR----------------
A8LJW8_DINSH/13-117VVELTVS...GK......ITHAEFEE-.VVPK-LEAELA...................R...GP----------------
C5BJV0_TERTT/11-120RLDVALS...GK......LDTEGMIA-.V...-L..........DALLDN.....AEGM...EN----------------
S6B665_9PROT/11-113.VNVGVL...GQ......FTLADFKE-.LEDA-V..........MYKIKF........E...GR----------------
G0J0C5_CYCMS/12-117VIATKAQ...EN......LTEADIQK-.IHPL-I..........HNIV.Y.....H..G...QK----------------
Q1CYP8_MYXXD/13-120ILEVVYP...PQ......VTTADLAE-YLADV-KKAINDLAG.EWSALVDQSQLRVMPS...DV----------------
I0JIE9_HALH3/13-116.IVIDIR...EK......LTGHDARM-.LDDY-I..........QGYFDD........D...QN----------------
E6U1C5_BACCJ/13-120IMYIKWS...GM......VEPEEVRE-ATNRI-TELLKGFPSSGFDVLVEMVDVTVMKQ...DT----------------
Q47BJ5_DECAR/11-113.VNVSVF...GE......FTLADYKE-.FEEV-V..........NFKVKF........E...GP----------------
K9X8Y1_9CHRO/10-123IITFTYE...GR......MTMDDANQ-.YISK-L......EQ.LITQ...........K...EP----------------
Q8ED76_SHEON/12-119VLTIVVS...GQ......VTHEDIET-LLFPA-I..........EAKL.Q.....D..H...AS----------------
A1T9B4_MYCVP/12-121VTGFRVS...GH......VSGEELRD-.FGST-M..........ETML.A........G...DE----------------
J1L360_9EURY/12-120VIGFLIS...GD......VTDEDYMQ-VFMPA-I..........DLAI.E.....R..Y...GT----------------
A3QIC9_SHELP/12-116VISLFAS...GR......LSTQDYCN-KIVPI-I..........EEYQQA........S...GK----------------
G2J2S0_PSEUL/12-117VVAIKLR...GT......LHDVDYRT-.LEPL-V..........EAAL.R.....DG.K....K----------------
D5CNM7_SIDLE/10-114LVNIAVM...GE......FTIADFKQ-.FEEH-A..........LYKLKA........P...GK----------------
Q093V7_STIAD/21-127..KFVLR...GP......LEHAEMLA-.IRAQ-L......EE.LRNR...........Q...GP----------------
W8S663_9RHOB/15-124LLVLEVQ...GS......MDARAMEV-.A...-L..........TLLVDE.....MEGL...HH----------------
A9GPD9_SORC5/60-166ILCTAIE...GD......ISDDTARA-.IAAA-C......RR.LSES...........G...RA----------------
Q11I87_CHESB/20-127AYAFEIT...GY......IETADIEN-.MYGL-L..........EGAYQL........H...DQ----------------
C1DA99_LARHH/12-113..DVAIY...NE......FTLADFKD-.FEVA-L..........LDYKMR........K...GQ----------------
B3QXG2_CHLT3/14-123.VRSVFT...GK......TTGKDLKE-ATTHG-L...................ALGKKH...QT----------------
H2FUI0_OCESG/21-126.LHLRIF...GD......IAYDDFRD-.MEQR-L..........EQEL.A.....AMDQ...PR----------------
E1QK88_DESB2/12-119IVAVHVT...GA......LNLEQDKY-KIFEG-V..........AQASHQ........T...GK----------------
W8S5M5_9RHOB/17-125VHAFRIT...GA......VTREDMAA-.MGER-M..........NTLFDA.....VPKD...QK----------------
I4EWX0_9ACTN/5-112TVGFEAI...GK......VEDDDFEH-AVEPV-L..........RGEI.A.....A..G...RK----------------
V5XBD7_MYCNE/12-121VTGIRVS...GR......ISGEELRE-.FQPV-M..........EDLG.K........S...AE----------------
D5B9R0_ZUNPS/6-111LIAAKIS...GK......LTEKDMEK-.MHPL-I..........HNII.E.....K..G...HK----------------
F5XYL0_RAMTT/15-117..VIELA...GP......ATAEDFAQ-AIATV-A...............AFTRHGGDRR...AL----------------
Q1ZBL2_9GAMM/21-125.LSLKGV...GK......LTHADYEI-.FTPL-I..........DSAL.A.....SVKE...PK----------------
A3QF38_SHELP/12-119TVAVKAR...GV......LSRADYDQ-TLVPA-I..........ETKL.Q.....D..H...ST----------------
Q3JB38_NITOC/16-125VIAIHFS...GK......MTGEDIQQ-.YKKI-L..........EGKLEK........H...GQ----------------
D6XVY9_BACIE/11-115ILEVTVD...GE......FTDEEITR-.....-..............LEAHFKEMKAGH...SQ----------------
Q2YCI1_NITMU/10-113LISIAVF...GE......FTLADYQE-.FEDK-V..........LRKAGR........E...GK----------------
C6Y0C1_PEDHD/12-119IFGVRAS...GE......VTKDDLQQ-VLLPG-L..........EKQS.E.....Q..Y...KE----------------
B1LYM2_METRJ/12-117VAEIVVD...GK......ITDEEMNA-AM.TA-M..........KADL.D.....K..G...GK----------------
Q7MEX7_VIBVY/25-130ILVFKAT...GT......LTHQDYQA-.IVPV-L..........EAAL.A.....GINR...QQ----------------
Q12ZF4_METBU/12-119VVAVRLT...GV......VKGEDYDN-ILVPV-I..........EDKV.K.....E..Y...GK----------------
L0G526_ECHVK/12-117IICTKAD...GN......LTELDMEK-.IHPL-I..........HNIL.K.....T..G...KK----------------
F4C7J2_SPHS2/12-119VFGVRAS...GE......VSGEDLKK-VLHPG-L..........QKLA.A.....S..F...GE----------------
B0BYZ0_ACAM1/12-117VVELIVE...GK......ITETDLDQ-VI.TQ-M..........KLDI.S.....R..H...GK----------------
A6Q671_SULNB/23-127.IELAMI...GK......LTHEDYKV-.FVPM-I..........DKAL.K.....EAKG...LE----------------
A0LXE0_GRAFK/144-249IYRFVIDERTDE......AGVEALYE-IFENE-E........................K...EE----------------
W8EUS5_9BACT/21-126.LYVEWK...GQ......HDAESART-.GGEL-VLEYLRQRP.CYKML..........N...DN----------------
H6L5S2_SAPGL/58-159..........SK....KSLTVKDIDE-SLLLL-EEQAKIQ..................G...QA----------------
G8R3P5_OWEHD/12-122ILGFEVD...GR......VSEAAFIN-MMQEL-I...................PKMESP...GN----------------
W0RC97_9BACT/11-121LIRIRIH...DT......ITPRDLRA-LADAV-LEAEARVLP.MPNRLTDMTDVTGVEV...GF----------------
C6C2B1_DESAD/11-117VLGLRIN...GK......INEEDMEK-.MLSV-C..........KAKMKD........E...ER----------------
H6L5W0_SAPGL/30-131..YFEQK...LK......MSLEQAQD-.YYES-L......CK.MAEAQ..........G...KN----------------
D9QNG3_BRESC/27-134LLIFEVD...AR......IHTADMAW-.MGAT-V..........SQAMEA........F...DR----------------
G2KMS4_MICAA/16-122.LFVHLH...DT......ISVDDYIQ-FFDTP-V..................RAIQQKN...GW----------------
H6L0F3_SAPGL/30-131..........SM......PLTKEVMQ-ENFEL-VQKISLDLG....................RP----------------
A0LXC2_GRAFK/12-117LLATVID...GK......LSEEEIEL-.LHAK-I..........HEIL.E.....T..N...NK----------------
Q2RZR2_SALRD/34-139LVGITLS...DT......LTEDDYEA-.FTSA-L..........EDQFAA.....HITT...RV----------------
G2KMS2_MICAA/25-131.FCVRYT...GI......INAQDYKD-VCVDI-G..........NAIIEK........H...GQ----------------
G0L8K0_ZOBGA/13-125.LALEVI...DG......FTETDEKL-.ALKF-F..........QEKIDE.......GY...DH----------------
Q82UI4_NITEU/10-112LIVVAVI...GE......FTLDDFRQ-.FEDQ-V..........LYQFHF........N...GE----------------
I1YHY0_METFJ/11-119RLDIALQ...GK......LDAMQMRT-.A...-L..........DELVMQ.....SAGI...EH----------------
C6X1D7_FLAB3/12-118VAAFRAS...GE......ITKEDFEK-LVMPH-V..........AAKV.N.....T..F...KE----------------
I4ANF2_FLELS/25-134TIVLEWF...GH......VSHEEFVE-.ACDF-LLELLIKYK.SSKMIANNLKSEVVSS...KN----------------
V5WM94_9SPIO/3-107IISVYYT...AK......MTDADHKE-LLEAR-LADIRRVG.....................DT----------------
X2HCK2_9NEIS/13-113...VVLY...NE......FTLEDFYQ-.LENA-L..........LKAIEH........I...HL----------------
S6ATB1_PSERE/11-120RVDVDFA...GK......LDSNEMRT-.G...-L..........AELASQ.....SEGI...AH----------------
E6WYT5_NITSE/23-127.VEIRMQ...GK......LHHRDYQV-.MIPV-M..........EHAI.E.....AARD...KE----------------
D5BJR6_ZUNPS/18-118FIYKEIYEIDGP......MAKTIVSE-RLQLQ-N........................E...NS----------------
C7RNF8_ACCPU/11-113.VDVTVY...AE......FTLADYQE-.FENA-V..........NYAIQF........E...GP----------------
A8ZX31_DESOH/24-127IFYVTLN...GDADDEMGIEIDRMIN-RMVED-I........................D...GE----------------
H0PYZ6_9RHOO/10-113LVTVAVF...GE......FTLPDYKE-.FEEL-V..........NYKVKF........E...GS----------------
F0JGN8_DESDE/12-119MVAVRAT...DK......LTDADYRD-VWIPA-L..........EKAI.G.....DG.G....K----------------
A9GPD8_SORC5/37-144VLFVAIV...GD......ISEPIARA-.ITAA-C......QR.VRDS...........G...RD----------------
G2KMS3_MICAA/30-137.FCARYD...GV......MNVPEYTE-IFIKQ-S..........DAAIAK........Y...GT----------------
Q31FZ2_THICR/21-125.LSMKVQ...GK......LTHDDYSQ-.MTPM-I..........DSAL.K.....GVKD...PK----------------
A9GPE2_SORC5/23-130LLVIATD...GD......VLEDNARA-.LVDA-F......QR.LTDS...........G...RE----------------
X5E3H4_9BACT/12-117LIALEVE...GK......LTKEDYNK-.ITPL-I..........DKAV.K.....DFG.....K----------------
M1NQM0_9CORY/12-118IVTAAYS...GS......IGTEEMEH-.LRST-V..........QQVI.D.....R..E...GS----------------
A0M0L9_GRAFK/12-115YMVAQ.....NR......LDATDYDN-.LISQ-L..........KNHI.Q.....S..N...HK----------------
A6Q807_SULNB/11-120RLDLEFQ...GK......ITTEDMQE-.I...-L..........DEFITL.....SKEI...EH----------------
C6BYE1_DESAD/13-119.LAVTAT...GK......VSGEDYTE-VWIPA-L..........QKTI.T.....EH.G....K----------------
Q73Z58_MYCPA/13-121.TGVRVS...GR......LSGQELRE-.VRPT-L..........EKSL.K........S...GE----------------
K9RD27_9CYAN/12-117VIGVLIK...GN......VNPKDFEL-VTNFI-......................RGVE...EN----------------
D9SJ90_GALCS/11-114.VNAAVL...GE......FTLADFKV-.FEEQ-S..........LYKLQS........P...GA----------------
W6RYK2_9CLOT/10-116YIEVKIE...GE......ITTNEIEA-MKQEG-ISKINSLTKLTNCLVDATKLEGVDGKVDDDE----------------
H8N2H1_CORCM/12-120IIEIIYP...SE......VTPKDVTE-YVEQL-KKDITARGGTEWSALVDQSRLRVMPA...SV----------------
I0KHL1_9BACT/11-115RLALRVA...DF......ITPEVYFE-.LRPL-L..........DTTL.H.....S..A...AE----------------
A6VRW9_MARMS/21-125.LNMKTS...GH......PSEMDFEK-.ITPQ-L..........EAAI.Y.....SIHS...PY----------------
A4FCH9_SACEN/14-119..GVKAS...GK......VTKEEYEA-VVEPL-I..........DAAR.R.....E..N...RR----------------
Q6LS91_PHOPR/11-120RIDMSFG...GK......LDSEEMKA-.L...-L..........DEFVDK.....TKDV...EN----------------
G8QLC0_DECSP/10-113LVSVAVF...GE......FTLADYKE-.FEEL-V..........NFKVKF........E...GP----------------
M4S571_9SPHN/11-120VAAYRLS...GI......LDDGDYDR-.MIAD-I..........EARL.D.....R..H...DK----------------
A9B5K6_HERA2/29-133IIVIKIRPGIQE.......TVEDAEE-NL...-.............................AA----------------
A4VJY0_PSEU5/11-120RIDIDFS...GK......LDSQAMRA-.A...-L..........DDLLFK.....SEGI...SH----------------
I3Z121_BELBD/12-117VIATKAI...EK......LATSDYNI-.LLPI-L..........TNRL.G.....N..Y...NK----------------
A9ENE2_SORC5/23-130ILRVEVH...GE......VTEDRARA-.VLGA-I......QR.VSES...........G...RD----------------
E4TRL3_MARTH/24-128...ITFH...GS......LKSEEYRA-AMLSN-Y..........DLCQQPHIKNWLQNN...TD----------------
A1SAI8_SHEAM/12-116VISLFAS...GR......ITAQDYRT-HLQPA-I..........KSYRED........W...GQ----------------
K9SIP1_9CYAN/14-118.VEVLVD...GK......VTNADINS-IL.PQ-M..........EKFI.A.....Q..Q...GT----------------
I5B5J2_9DELT/12-119AIAYRIE...GK......ITEKEMKT-.VLAI-F..........RKKIKK........N...EK----------------

PF01740

SUT22_ARATH/540-662........................EVLK......................................ENGLQVVILDM---
RSBRD_BACSU/161-267.....................................................................LSYLFLDI---
S26A2_HUMAN/569-715...................RKIKEKVV.TLGGIQDE......................MSVQLSHDPLELHTIVIDC---
O45016_CAEEL/553-725KKDARK.......EKEEEDAEIPKETE.KETKLEVTTHQAKV.........LDEKHAEPEPNPADQYERLTHIIIDC---
SULP3_CAEEL/546-696..................QMNSDRSAD.IFDSKLKSA....................RRRWKRDQKSENRCKLVIDC---
D6EY97_STRLI/11-115......................................................................ARVVLDL---
O04001_SPOST/529-651.................................................................KQTELRFVILDL---
SUT32_ARATH/505-623..........................T.S....................................GDISLQYIVLDM---
Q55814_SYNY3/440-540......................................................................DVLILDL---
RSBV_BACSU/4-107......................................................................ADLRICL---
O69205_ACTPA/8-112.....................................................................RGPGVLDL---
P73609_SYNY3/4-107.....................................................................ISKLVLMM---
SP2AA_LYSSH/4-107.....................................................................VTTIIWNL---
O84431_CHLTR/3-107.....................................................................MKNIILDC---
P71568_MYCTU/15-120......................................................................SAVIVNV---
S26A1_RAT/529-685..................VGVSNRSLV.DRKDLGSVS....................SGDGLVVPLAFGFHTVVIDC---
P73607_SYNY3/2-105......................................................................SKILLDM---
SP2AA_BACME/4-109.....................................................................ISHLILNL---
YVDB_BACSU/421-528......................................................................KTLILLM---
RSBV_LISMO/4-109......................................................................IVLRIDL---
Q46665_ECOLX/332-437......................................................................RIVILKW---
S26A4_HUMAN/536-725KIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTK.EIEIQVDWNSELPVKVNVPKVPIHSLVLDC---
RSBV_BACLI/4-107......................................................................KDLKVSL---
O83261_TREPA/17-124.....................................................................YTRIVFNC---
Y1364_MYCTU/550-649......................................................................APVTIDL---
O67306_AQUAE/448-564..................................................................GRPLKFVLIDM---
Q9Z6Z7_CHLPN/2-106.....................................................................HLKIALNF---
SUT31_ARATH/514-633..........................Q.S....................................GESSLQYIILDM---
Q9Z6P5_CHLPN/441-545......................................................................KIFILCM---
O17951_CAEEL/537-690A.................GKGSKFTFE.GMHRIAPITE..................IPLHPGINRDPILPRHFVIDC---
RSFB_MYCTU/6-111.....................................................................PTALVIDL---
SP2AA_BACLI/4-109.....................................................................IRHIVMNL---
Q55415_SYNY3/433-538......................................................................AAIVFDL---
SULH1_SCHPO/592-725....................SDRPWND.PAPRKKK.......................NAPEVEDTRPLLRAIILDF---
O07728_MYCTU/29-135....................................................................APGPFVIDI---
P72770_SYNY3/438-545....................................................................PVELVIFEM---
Q9Z841_CHLPN/3-107.....................................................................SKNIILDC---
O07488_YEREN/391-488.......................................................................NVVIDV---
SUT33_ARATH/498-617..........................Q.E....................................KHSSLQFLILEM---
P73474_SYNY3/396-498.......................................................................RVTIDL---
SP2AA_GEOSE/4-109.....................................................................IRHIVLNL---
S26A3_HUMAN/526-716KIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDF---
SUT41_ARATH/519-638..........................R.G...................................LEVDRINFVILEM---
O84770_CHLTR/2-106......................................................................VNVLLNM---
RSFA_MYCTU/18-124....................................................................APEPLVVNL---
RSBRB_BACSU/147-272.........................NT.LQ.................................ACAKRRVEHLLIDL---
SUT1_STYHA/538-656..........................E.S....................................ELPEIQHLITEM---
G2TL00_BACCO/4-109.....................................................................IRHLVLNL---
Y1739_MYCTU/443-553..........................W.F....................................VLNAESNVEVDL---
I6X4W0_MYCTU/31-137....................................................................APGPLIVDV---
SP2AA_PAEPO/4-109.....................................................................CEHIVLSL---
SULX_YEAST/572-707.........................GR.KS.................................LRSKDSIKYVIFDL---
SUT21_ARATH/548-668..........................T.KS..................................NAKRKILFVVLDM---
O83249_TREPA/5-107......................................................................NHVVLDL---
PHOT_BACSU/148-254....................................................................D.DYLIIDL---
RSBS_BACSU/5-111.....................................................................ANGVVIDL---
O33206_MYCTU/385-486.......................................................................DVSLDL---
RSBRA_BACSU/151-261.....................................................................SQVVLIDI---
SUT11_ARATH/518-636..........................E.Y....................................GMPAIRFVIIEM---
Y1081_THENE/1-106.....................................................................YNKILLVL---
SUT3_STYHA/511-631..........................E.E...................................AAKGRVQAIIIDM---
SULH3_SCHPO/533-653.........................GE.TP.................................YRRIEDIEVVVFDM---
YG35_YEAST/657-777.................................................................TKRRIKYLILDF---
O33361_MYCTU/29-135......................................................................NPMVLDL---
O83551_TREPA/4-108.....................................................................PRCIVIDL---
P73108_SYNY3/3-107.....................................................................SPVMVIDF---
RSBRC_BACSU/163-272.....................................................................VTQLYIDL---
Q40008_HORVU/530-648..........................E.Q....................................KLSKTEFLIVEL---

PF13466

Q310Z9_DESAG/492-572--------------------------------------------------------------------..EVLRIDS---
B5HV30_9ACTN/31-112--------------------------------------------------------------------...VVVCDV---
A9BX84_DELAS/2-83--------------------------------------------------------------------..AQVRVDA---
Q0K681_CUPNH/47-125--------------------------------------------------------------------...EVQVDC---
B5H529_STRPR/9-95--------------------------------------------------------------------..CEVFCDV---
Q0RDC2_FRAAA/24-104--------------------------------------------------------------------.SGPLRVDV---
D1AD83_THECD/187-267--------------------------------------------------------------------..SPVHVDM---
D2SCD5_GEOOG/29-109--------------------------------------------------------------------.HRTWTVDT---
A1VK31_POLNA/2-82--------------------------------------------------------------------...EVVVDA---
A8ZVX1_DESOH/4-85--------------------------------------------------------------------.DDQVAVDM---
Q3SFW3_THIDA/281-359--------------------------------------------------------------------...EVLVDL---
B9TGW9_RICCO/228-309--------------------------------------------------------------------..AQFTIDL---
A1W422_ACISJ/2-83--------------------------------------------------------------------.ESLVVVDA---
A1U461_MARHV/15-95--------------------------------------------------------------------...TLEVDL---
Q21UA2_RHOFT/4-85--------------------------------------------------------------------..PEAVVDA---
B1Y2Z1_LEPCP/2-84--------------------------------------------------------------------..TSVVIDG---
Q8EEQ5_SHEON/14-91--------------------------------------------------------------------..VDISVDL---
D2S5L7_GEOOG/30-110--------------------------------------------------------------------..DTWVVDA---
A7MNS4_CROS8/14-91--------------------------------------------------------------------...LQRIDL---
B9JTP2_AGRVS/23-100--------------------------------------------------------------------...AIEIDA---
B8DPA7_DESVM/571-651--------------------------------------------------------------------..ATVRIDL---
C6C1P3_DESAD/15-93--------------------------------------------------------------------...CLVVEC---
E3I167_RHOVT/14-94--------------------------------------------------------------------..DEILVDA---
E3IYM7_FRASU/24-104--------------------------------------------------------------------.GATVTVDV---
C1D624_LARHH/5-83--------------------------------------------------------------------...DCRLDW---
A4YXB4_BRASO/320-399--------------------------------------------------------------------..KHVRLDF---
D1C014_XYLCX/37-113--------------------------------------------------------------------..LPVEIDA---
C6WD00_ACTMD/919-1001--------------------------------------------------------------------..RPVELDL---
E3J1T6_FRASU/56-136--------------------------------------------------------------------.RGDVRVDL---
C6WQ84_ACTMD/60-139--------------------------------------------------------------------.PPVLVVDL---
Q2SPQ4_HAHCH/13-91--------------------------------------------------------------------...RIKFDG---
D2SFP4_GEOOG/531-612--------------------------------------------------------------------...RVELDL---
D2B5R7_STRRD/72-150--------------------------------------------------------------------..DDMHIDL---
B8DLB2_DESVM/179-259--------------------------------------------------------------------.APTVVLDF---
D0KYU0_HALNC/26-108--------------------------------------------------------------------..TRLEIAL---
D5X3Z8_THIK1/566-644--------------------------------------------------------------------..EQMSISL---
B9J943_AGRRK/10-87--------------------------------------------------------------------...NVAIDA---
B1W2W2_STRGG/20-107--------------------------------------------------------------------..AAVDCDV---
A1SBD9_SHEAM/6-85--------------------------------------------------------------------..RPVTLNA---
A0LC67_MAGMM/14-94--------------------------------------------------------------------.SFRYCIDL---
A4YMN9_BRASO/16-97--------------------------------------------------------------------.VSKIKLDF---
C7LTF6_DESBD/15-91--------------------------------------------------------------------..SAITLDL---
B1LTK1_METRJ/26-107--------------------------------------------------------------------.AGPVAVDL---
Q0RZA3_RHOJR/48-126--------------------------------------------------------------------..RCAVVDL---
C5BID3_TERTT/281-360--------------------------------------------------------------------..KPLQLDL---
Q2SBJ1_HAHCH/18-100--------------------------------------------------------------------ATSPLRIDV---
B5HHQ5_STRPR/28-107--------------------------------------------------------------------...DRVLDM---
Q1QXI2_CHRSD/17-99--------------------------------------------------------------------.LAAVMIDL---
Q12BT3_POLSJ/427-501--------------------------------------------------------------------..RPLVLDL---
C9R4W7_AGGAD/20-98--------------------------------------------------------------------.TLDVHWDL---
D9T369_MICAI/189-267--------------------------------------------------------------------...RVVFDA---
Q31HM4_THICR/6-86--------------------------------------------------------------------.AETYKLVA---
Q31GZ5_THICR/18-93--------------------------------------------------------------------...IEVIDC---
A7H922_ANADF/18-92--------------------------------------------------------------------...EVVLDF---
Q21SV7_RHOFT/514-592--------------------------------------------------------------------...HLVISC---
A3N1T8_ACTP2/20-99--------------------------------------------------------------------.NQHIYWDL---
B2FP86_STRMK/2-73--------------------------------------------------------------------...LARLDL---
F9ZTS0_ACICS/20-97--------------------------------------------------------------------...RVRL..---
Q2IMF1_ANADE/97-172--------------------------------------------------------------------..SLVRIDL---
Q3J3N5_RHOS4/5-82--------------------------------------------------------------------...DTCLAA---
Q3J659_RHOS4/7-80--------------------------------------------------------------------...DVEIDA---
Q6DAF4_PECAS/14-89--------------------------------------------------------------------...KTTLDV---
Q87LF2_VIBPA/15-93--------------------------------------------------------------------..KELECSL---

PF14213

G2J3X0_PSEUL/31-97----------------------------------------------------------------------EMVEIDL---
C5AFW9_BURGB/238-293----------------------------------------------------------------------RRVAFDF---
R6DUG2_9CLOT/21-84----------------------------------------------------------------------KIVTLDF---
D8P9E0_9BACT/36-91----------------------------------------------------------------------REIIVDF---
D9QF83_BRESC/26-91----------------------------------------------------------------------QSVLVDL---
K8GP23_9CYAN/208-263----------------------------------------------------------------------KEIVLDF---
D7E2C2_NOSA0/17-80----------------------------------------------------------------------ESVKIDF---
D9SDG1_GALCS/27-91----------------------------------------------------------------------KGLTIEL---
C4Z656_EUBE2/22-87----------------------------------------------------------------------KNFEIEF---
R5XRA0_9FIRM/285-340----------------------------------------------------------------------KQVEFDC---
R6PJ48_9CLOT/285-340----------------------------------------------------------------------KEVIFDF---
A3QA48_SHELP/32-98----------------------------------------------------------------------DKVIVDL---
R5ZPG5_9CLOT/24-98----------------------------------------------------------------------EKLFIDF---
Q73PI2_TREDE/278-333----------------------------------------------------------------------LEVILDF---
K9ZH15_ANACC/18-81----------------------------------------------------------------------DSVELDF---
H8H3V4_DEIGI/24-87----------------------------------------------------------------------NIVKLSF---
H8XUH7_FLAIG/24-92----------------------------------------------------------------------EKLIVDL---
A0LXZ9_GRAFK/27-97----------------------------------------------------------------------KKVIVNL---
Q8XHB8_CLOPE/17-78----------------------------------------------------------------------ENVELDF---
Q5NEH5_FRATT/276-331----------------------------------------------------------------------KTVIFDF---
R4K797_CLOPA/19-79----------------------------------------------------------------------DTVVLDF---
A9H234_GLUDA/27-96----------------------------------------------------------------------QVVCVSL---
D5BER1_ZUNPS/19-78----------------------------------------------------------------------NEIEISF---
I4C4U2_DESTA/277-332----------------------------------------------------------------------KIAVFDF---
G0AI14_COLFT/270-325----------------------------------------------------------------------QSVILDF---
K9ZPS4_ANACC/341-404----------------------------------------------------------------------DQITLDF---
H6LER3_ACEWD/283-338----------------------------------------------------------------------KEVTIDF---
E6N6U4_9ARCH/18-73----------------------------------------------------------------------KKVVIDF---
F8I7N0_SULAT/28-91----------------------------------------------------------------------DPVTLDF---
F5YCP5_TREAZ/25-79----------------------------------------------------------------------EEIVLDF---
A5G5Z8_GEOUR/270-325----------------------------------------------------------------------REVVLDF---
H6RW13_BLASD/80-135----------------------------------------------------------------------REVRVDF---
L0D9F9_SINAD/118-173----------------------------------------------------------------------VRLTLDF---
D8IQ15_HERSS/25-89----------------------------------------------------------------------EIVMIEM---
Q82UU3_NITEU/25-95----------------------------------------------------------------------EKVKVEL---
B5EI93_GEOBB/335-400----------------------------------------------------------------------QKIIIDM---
L0DGU6_SINAD/19-82----------------------------------------------------------------------ACAILDF---
W6RWL6_9CLOT/19-83----------------------------------------------------------------------AEILLDF---
B4U9L3_HYDS0/40-103----------------------------------------------------------------------VKIILDF---
K9TRC5_9CYAN/18-81----------------------------------------------------------------------RPVELDF---
K4IKE5_PSYTT/20-83----------------------------------------------------------------------LKVDLDF---
K4L2N6_9FIRM/328-393----------------------------------------------------------------------FAVSINM---
K9UH85_9CYAN/18-81----------------------------------------------------------------------QTVELDF---
B4SE54_PELPB/33-96----------------------------------------------------------------------KHVVVSF---
B7XKG1_ENTBH/25-91----------------------------------------------------------------------DVVEVDF---
E6U4T1_ETHHY/18-81----------------------------------------------------------------------ETVELDF---
A6L6I8_BACV8/31-97----------------------------------------------------------------------ETIEIII---
K9RV87_SYNP3/278-333----------------------------------------------------------------------KIVIFDF---
E3H2Y7_ROTDC/336-394----------------------------------------------------------------------EYVVLDF---
C7MM94_CRYCD/17-81----------------------------------------------------------------------EKTVFDF---
B1ZYW4_OPITP/20-83----------------------------------------------------------------------PRITLDF---
F3ZTR7_9BACE/27-97----------------------------------------------------------------------KKVIVDL---
Q5E361_VIBF1/32-98----------------------------------------------------------------------DSVLVDL---
W0PBU4_9BURK/27-91----------------------------------------------------------------------QEVTVDL---
Q7NLA4_GLOVI/5-68----------------------------------------------------------------------RQVELDF---
A7I365_CAMHC/26-89----------------------------------------------------------------------KPIYIDV---
Q7VJH0_HELHP/18-83----------------------------------------------------------------------QKIEVSF---
D1B345_SULD5/22-85----------------------------------------------------------------------KKASLSF---
R6I2W7_9FIRM/273-328----------------------------------------------------------------------EEVILDF---
A1BGI6_CHLPD/273-328----------------------------------------------------------------------STVILDF---
K9VZ93_9CYAN/30-93----------------------------------------------------------------------HEVELDF---
Q97FP7_CLOAB/19-80----------------------------------------------------------------------DDITLDF---
A1SAB7_SHEAM/362-425----------------------------------------------------------------------KRIVIDF---
E3HBI7_ILYPC/11-75----------------------------------------------------------------------KNIILDF---
V5SDX9_9RHIZ/278-333----------------------------------------------------------------------QEVILDF---
A4XX40_PSEMY/363-426----------------------------------------------------------------------KKIVLDF---
S6ABL2_9PROT/28-89----------------------------------------------------------------------FEVAFDF---
K9V072_9CYAN/33-96----------------------------------------------------------------------KRVRLSF---
I3Z1N7_BELBD/17-80----------------------------------------------------------------------ETIEVSF---
R6H1A0_9FIRM/21-84----------------------------------------------------------------------KDIFLDF---
M4VBB1_9DELT/264-319----------------------------------------------------------------------NHIILDF---
Q8TKH8_METAC/27-90----------------------------------------------------------------------RKVELSF---
I0K8N5_9BACT/19-82----------------------------------------------------------------------QPFTLSF---
W6RYG0_9CLOT/18-79----------------------------------------------------------------------EYIELDF---
H2J416_MARPK/19-82----------------------------------------------------------------------DIIYIDF---
Q3JEZ3_NITOC/23-86----------------------------------------------------------------------KQVTISF---
D4M3H3_9FIRM/23-78----------------------------------------------------------------------KELVIDF---
R6G1E0_9CLOT/19-80----------------------------------------------------------------------DGIQLDF---

PF11964

L0GYF4_9GAMM/12-118----------------------------------------------------------------------VRLLVELI.D
W8EVU9_9BACT/23-129----------------------------------------------------------------------VRWLVNL...
D5V1Z3_ARCNC/21-125----------------------------------------------------------------------IRAICDCT.E
Q11VP6_CYTH3/12-119----------------------------------------------------------------------LNYMLVLDTS
A5FC98_FLAJ1/11-118----------------------------------------------------------------------INFLLVLDTD
Q28QM9_JANSC/19-126----------------------------------------------------------------------VDMLLDL...
Q093V8_STIAD/17-124----------------------------------------------------------------------LYLLGDLRLS
E0TIJ6_PARBH/12-118----------------------------------------------------------------------AGLLVVME.E
Q3SKE6_THIDA/10-113----------------------------------------------------------------------VNLLFDL...
Q3ID73_PSEHT/20-125----------------------------------------------------------------------VKVLIDGS.Q
B2HRZ3_MYCMM/12-119----------------------------------------------------------------------VRIYYEIGSD
J7Q7E4_METSZ/12-118----------------------------------------------------------------------IRIYYEIAPD
E8X7D9_GRATM/13-120----------------------------------------------------------------------..LTGMLGS.
Q3J4W4_RHOS4/41-148----------------------------------------------------------------------VDMLVVLPEF
F0SJ20_RUBBR/12-119----------------------------------------------------------------------IRMLEVI.RS
D5SV07_PLAL2/13-118----------------------------------------------------------------------LRLLFEMH.D
A4XX57_PSEMY/12-120----------------------------------------------------------------------GKMFYRVGS.
A0LIB8_SYNFM/14-120----------------------------------------------------------------------VRLLATL.DD
I4C386_DESTA/12-119----------------------------------------------------------------------ARFLFFMDKD
I4AGM8_FLELS/70-181----------------------------------------------------------------------SGLLVDA...
M4SAG0_9SPHN/140-247----------------------------------------------------------------------LKILVRMKRY
F0SJC2_RUBBR/13-118----------------------------------------------------------------------IRLLVVLH.D
M9R3U0_9RHOB/11-120----------------------------------------------------------------------GVMMYKIPS.
A9WJT9_CHLAA/12-112----------------------------------------------------------------------TDLLVDG...
W8EZJ6_9BACT/24-132----------------------------------------------------------------------SEVYGDW...
Q8EB52_SHEON/21-126----------------------------------------------------------------------IYALVDVT.E
L0K3H2_9EURY/13-119----------------------------------------------------------------------AKLLLDLSGV
B1MER2_MYCA9/12-121----------------------------------------------------------------------LRIVEVIASD
F9ZWL7_METMM/13-118----------------------------------------------------------------------LRLLFDMT.D
X5E4J9_9BACT/13-117----------------------------------------------------------------------NQLLKEF...
E4TNT7_MARTH/14-124----------------------------------------------------------------------IAITFDAN..
Q8TPB5_METAC/12-119----------------------------------------------------------------------IRMLYQLGPN
A3QHM0_SHELP/21-124----------------------------------------------------------------------IVALIDIT.E
B0JM20_MICAN/12-118----------------------------------------------------------------------LAGVIIEVPK
Q7UVW9_RHOBA/74-179----------------------------------------------------------------------VRILVHLR.D
A4FCH9_SACEN/137-244----------------------------------------------------------------------LHGLVVHARE
A0LXE0_GRAFK/12-118----------------------------------------------------------------------IKILGIY...
E1RHG3_METP4/12-115----------------------------------------------------------------------ISWLFVI...
G2J2P9_PSEUL/12-113----------------------------------------------------------------------PDIFLDL...
A5G4W5_GEOUR/116-227----------------------------------------------------------------------VKLLVMVGED
A3CYB3_METMJ/12-120----------------------------------------------------------------------VRILLKIE.G
Q5V739_HALMA/20-132----------------------------------------------------------------------IHVYEEV...
I4C4Z7_DESTA/12-119----------------------------------------------------------------------AKMLLYLPGD
M4NFH5_9GAMM/12-119----------------------------------------------------------------------LRLLYVTADD
A1S706_SHEAM/12-119----------------------------------------------------------------------VRIWYEIADG
M4V983_9DELT/11-119----------------------------------------------------------------------VSIYADLLDL
D4ZLE1_SHEVD/12-119----------------------------------------------------------------------IKLWYEFDEG
B2HE07_MYCMM/27-133----------------------------------------------------------------------LAGLILNAPS
J7L4H1_NOCAA/12-117----------------------------------------------------------------------ARLLVRI...
F2LY86_HIPMA/12-118----------------------------------------------------------------------IRILYHVTKE
F0SJ19_RUBBR/12-119----------------------------------------------------------------------IRLLKHV.RS
Q3JB38_NITOC/148-256----------------------------------------------------------------------VRLLNRMRHF
W8EXL7_9BACT/35-135----------------------------------------------------------------------YRILIDQ...
H8MXZ5_CORCM/21-129----------------------------------------------------------------------LYLVADLSTS
E1RH74_METP4/11-116----------------------------------------------------------------------INIMFKT...
K9XV53_STAC7/12-117----------------------------------------------------------------------IRILVEF...
A5FDC3_FLAJ1/11-118----------------------------------------------------------------------INFLFLIDNK
G8RQ72_MYCRN/12-121----------------------------------------------------------------------VRIVEVIAPD
Q07X46_SHEFN/12-116----------------------------------------------------------------------VCLYIEA...
A9GPE4_SORC5/20-127----------------------------------------------------------------------VFVLADARRV
G2KMS5_MICAA/17-122----------------------------------------------------------------------IRMVLLF...
Q6MQZ1_BDEBA/34-138----------------------------------------------------------------------VSVLEEV...
E3FV03_STIAD/12-119----------------------------------------------------------------------ANMIRDV...
D2QV97_SPILD/12-116----------------------------------------------------------------------PRLYWEME.Y
Q7NXU0_CHRVO/12-113----------------------------------------------------------------------PDMLLDL...
D5ER41_CORAD/12-118----------------------------------------------------------------------LSCLYQLGPD
A1SV34_PSYIN/12-119----------------------------------------------------------------------LNGILIDAES
B3QUM5_CHLT3/13-124----------------------------------------------------------------------TSLLFDF...
G0J0D1_CYCMS/13-117----------------------------------------------------------------------VDFYFELE.N
A0M0N9_GRAFK/12-117----------------------------------------------------------------------VRWYFEME.N
Q1CW14_MYXXD/23-128----------------------------------------------------------------------YYLIADIGRS
Q6AK92_DESPS/134-240----------------------------------------------------------------------VHLLLDLR.D
V5WKN4_9SPIO/39-142----------------------------------------------------------------------VNLLTVIENG
A6Q9H2_SULNB/14-120----------------------------------------------------------------------LNGIIIYTKS
F8GCM7_NITSI/10-113----------------------------------------------------------------------ANLLFDW...
C4ZLU4_THASP/10-113----------------------------------------------------------------------VDLLFDL...
Q6AK92_DESPS/12-119----------------------------------------------------------------------LKMLCQMGPE
F0M0B1_VIBFN/20-125----------------------------------------------------------------------VKVLFDAT.A
A6WZX1_OCHA4/19-126----------------------------------------------------------------------IDLLIRLTGY
E3FKU0_STIAD/13-119----------------------------------------------------------------------VAVMAKL...
Q0AQY4_MARMM/16-124----------------------------------------------------------------------MTILTRA...
Q6LKJ4_PHOPR/20-124----------------------------------------------------------------------VNVYIDGT.E
D5BJF0_ZUNPS/25-118----------------------------------------------------------------------YPVFCDL...
C7P248_HALMD/57-169----------------------------------------------------------------------VHLYEET...
A1S9K0_SHEAM/21-126----------------------------------------------------------------------IYMLVDAT.E
D3FPZ4_BACPE/12-117----------------------------------------------------------------------IKILVRL...
Q087X8_SHEFN/21-125----------------------------------------------------------------------VSLFLDAT.E
C0QCX2_DESAH/11-120----------------------------------------------------------------------GRMLYDIVD.
Q1LPD1_CUPMC/12-120----------------------------------------------------------------------VRLYYELGPD
A3HTM6_9BACT/12-125----------------------------------------------------------------------INILIKLDEL
F7XLD9_METZD/12-119----------------------------------------------------------------------ICFLYHLDEN
B1WXR6_CYAA5/19-124----------------------------------------------------------------------LRILEEI.RS
D0J5L7_COMT2/12-119----------------------------------------------------------------------LHGVMIQSKD
H6L5W1_SAPGL/20-121----------------------------------------------------------------------LWLLSDLRQM
B7VP41_VIBTL/20-124----------------------------------------------------------------------LKMLVDIS.T
K0NMI2_DESTT/11-120----------------------------------------------------------------------GKMLYDVID.
F4CCE8_SPHS2/23-130----------------------------------------------------------------------INFIVLLETG
G8PHU6_PSEUV/12-120----------------------------------------------------------------------VSVLVIL...
A0M5Q5_GRAFK/11-116----------------------------------------------------------------------VNVYIEL...
A3CYB0_METMJ/12-120----------------------------------------------------------------------LRILFHIV.S
F4AVZ8_DOKS4/11-116----------------------------------------------------------------------INIYLED...
I3YWJ5_AEQSU/12-117----------------------------------------------------------------------IKFYVEIDEL
Q083D4_SHEFN/12-118----------------------------------------------------------------------ISLLFEFD.N
B0BYZ0_ACAM1/138-242----------------------------------------------------------------------VKVLEEI.RS
E3FWM2_STIAD/2-108----------------------------------------------------------------------IYLLVDASHG
D5B9R4_ZUNPS/12-117----------------------------------------------------------------------IRWYLEMN.D
M4SAG0_9SPHN/11-120----------------------------------------------------------------------..IFVEVLD.
I4AIU7_FLELS/23-135----------------------------------------------------------------------AWLVLKF...
A5GKD8_SYNPW/21-126----------------------------------------------------------------------LRLVFDAR.E
A9GKE1_SORC5/12-119----------------------------------------------------------------------TELLRDI...
E1V9S9_HALED/39-147----------------------------------------------------------------------ISLYAEI...
A8LJW8_DINSH/13-117----------------------------------------------------------------------LSLVEVI...
C5BJV0_TERTT/11-120----------------------------------------------------------------------GGVLFDVVD.
S6B665_9PROT/11-113----------------------------------------------------------------------VNLLIDL...
G0J0C5_CYCMS/12-117----------------------------------------------------------------------VRWYFEMQ.D
Q1CYP8_MYXXD/13-120----------------------------------------------------------------------VTAMASL...
I0JIE9_HALH3/13-116----------------------------------------------------------------------FKVLAFVPEL
E6U1C5_BACCJ/13-120----------------------------------------------------------------------REELVKH...
Q47BJ5_DECAR/11-113----------------------------------------------------------------------VDLYFDL...
K9X8Y1_9CHRO/10-123----------------------------------------------------------------------FAILAIAHED
Q8ED76_SHEON/12-119----------------------------------------------------------------------IRLWYEFSAD
A1T9B4_MYCVP/12-121----------------------------------------------------------------------IRLVEVVSDD
J1L360_9EURY/12-120----------------------------------------------------------------------VRVLVDIV.D
A3QIC9_SHELP/12-116----------------------------------------------------------------------VCLYIEA...
G2J2S0_PSEUL/12-117----------------------------------------------------------------------ARLYAQFD.D
D5CNM7_SIDLE/10-114----------------------------------------------------------------------INLLFDL...
Q093V7_STIAD/21-127----------------------------------------------------------------------LYLLGDVRQS
W8S663_9RHOB/15-124----------------------------------------------------------------------GACLMRAEG.
A9GPD9_SORC5/60-166----------------------------------------------------------------------VLVLSDARRT
Q11I87_CHESB/20-127----------------------------------------------------------------------IDVIVIIHDY
C1DA99_LARHH/12-113----------------------------------------------------------------------PNVLLDL...
B3QXG2_CHLT3/14-123----------------------------------------------------------------------NHYLVDI...
H2FUI0_OCESG/21-126----------------------------------------------------------------------ILALVDLT.G
E1QK88_DESB2/12-119----------------------------------------------------------------------FRILLDFDED
W8S5M5_9RHOB/17-125----------------------------------------------------------------------IDMLLVFETE
I4EWX0_9ACTN/5-112----------------------------------------------------------------------IRLLYLLGAE
V5XBD7_MYCNE/12-121----------------------------------------------------------------------IRIVEVIDQD
D5B9R0_ZUNPS/6-111----------------------------------------------------------------------VDFYFEME.D
F5XYL0_RAMTT/15-117----------------------------------------------------------------------ANLLAVE...
Q1ZBL2_9GAMM/21-125----------------------------------------------------------------------VDVLIDGT.E
A3QF38_SHELP/12-119----------------------------------------------------------------------IKLWYEFSEE
Q3JB38_NITOC/16-125----------------------------------------------------------------------LSFLIDF...
D6XVY9_BACIE/11-115----------------------------------------------------------------------VKMLLVI...
Q2YCI1_NITMU/10-113----------------------------------------------------------------------VNVLFDW...
C6Y0C1_PEDHD/12-119----------------------------------------------------------------------IYYLLVLETD
B1LYM2_METRJ/12-117----------------------------------------------------------------------IKLLEDI.RA
Q7MEX7_VIBVY/25-130----------------------------------------------------------------------MNMLADIS.E
Q12ZF4_METBU/12-119----------------------------------------------------------------------IRVLYQLGPD
L0G526_ECHVK/12-117----------------------------------------------------------------------VRWYFEME.N
F4C7J2_SPHS2/12-119----------------------------------------------------------------------IYYLLILNTS
B0BYZ0_ACAM1/12-117----------------------------------------------------------------------LKLLEEI.RS
A6Q671_SULNB/23-127----------------------------------------------------------------------VDLLVDMR.K
A0LXE0_GRAFK/144-249----------------------------------------------------------------------IKLLAIL...
W8EUS5_9BACT/21-126----------------------------------------------------------------------SQVSSEWEKG
H6L5S2_SAPGL/58-159----------------------------------------------------------------------LLVLVNLHQM
G8R3P5_OWEHD/12-122----------------------------------------------------------------------IKLYVEIPRY
W0RC97_9BACT/11-121----------------------------------------------------------------------AEFLAFT...
C6C2B1_DESAD/11-117----------------------------------------------------------------------IAVYVEVEEI
H6L5W0_SAPGL/30-131----------------------------------------------------------------------IFIYIDVSTI
D9QNG3_BRESC/27-134----------------------------------------------------------------------IDILLLIRRF
G2KMS4_MICAA/16-122----------------------------------------------------------------------YNLLVYY...
H6L0F3_SAPGL/30-131----------------------------------------------------------------------LKVFAESSKM
A0LXC2_GRAFK/12-117----------------------------------------------------------------------LRWYFEMN.D
Q2RZR2_SALRD/34-139----------------------------------------------------------------------LLVMEDVDD.
G2KMS2_MICAA/25-131----------------------------------------------------------------------LRMLIEY...
G0L8K0_ZOBGA/13-125----------------------------------------------------------------------VNVLVKLDEL
Q82UI4_NITEU/10-112----------------------------------------------------------------------ANLLLDL...
I1YHY0_METFJ/11-119----------------------------------------------------------------------GLMLYDIVS.
C6X1D7_FLAB3/12-118----------------------------------------------------------------------LNYLLLLDTD
I4ANF2_FLELS/25-134----------------------------------------------------------------------QDWLDKV...
V5WM94_9SPIO/3-107----------------------------------------------------------------------VNLLTVIEEG
X2HCK2_9NEIS/13-113----------------------------------------------------------------------PNLLLDL...
S6ATB1_PSERE/11-120----------------------------------------------------------------------GRMLYRVGS.
E6WYT5_NITSE/23-127----------------------------------------------------------------------LDILVDMR.Q
D5BJR6_ZUNPS/18-118----------------------------------------------------------------------YPIFCDL...
C7RNF8_ACCPU/11-113----------------------------------------------------------------------VDLFFDL...
A8ZX31_DESOH/24-127----------------------------------------------------------------------IDLLIDL...
H0PYZ6_9RHOO/10-113----------------------------------------------------------------------VNLLIDL...
F0JGN8_DESDE/12-119----------------------------------------------------------------------ADALLFMDAD
A9GPD8_SORC5/37-144----------------------------------------------------------------------VLVLADARGN
G2KMS3_MICAA/30-137----------------------------------------------------------------------IRLLIEF...
Q31FZ2_THICR/21-125----------------------------------------------------------------------VKALVDLT.E
A9GPE2_SORC5/23-130----------------------------------------------------------------------VLVLADARRC
X5E3H4_9BACT/12-117----------------------------------------------------------------------VKLYIQLN.Y
M1NQM0_9CORY/12-118----------------------------------------------------------------------VRLLTEFG.D
A0M0L9_GRAFK/12-115----------------------------------------------------------------------VYWYIEME.N
A6Q807_SULNB/11-120----------------------------------------------------------------------GKILYTIYD.
C6BYE1_DESAD/13-119----------------------------------------------------------------------CRALLYMDEN
Q73Z58_MYCPA/13-121----------------------------------------------------------------------IRIVEVIDSD
K9RD27_9CYAN/12-117----------------------------------------------------------------------YEFLRIYVEI
D9SJ90_GALCS/11-114----------------------------------------------------------------------LNLLFDL...
W6RYK2_9CLOT/10-116----------------------------------------------------------------------IERLKEL...
H8N2H1_CORCM/12-120----------------------------------------------------------------------VGEMARL...
I0KHL1_9BACT/11-115----------------------------------------------------------------------SRLYWEME.Y
A6VRW9_MARMS/21-125----------------------------------------------------------------------AGLLVDIS.E
A4FCH9_SACEN/14-119----------------------------------------------------------------------IRLLYQVAPD
Q6LS91_PHOPR/11-120----------------------------------------------------------------------GTMLYTIHE.
G8QLC0_DECSP/10-113----------------------------------------------------------------------VNLFFDL...
M4S571_9SPHN/11-120----------------------------------------------------------------------ISILADLA.D
A9B5K6_HERA2/29-133----------------------------------------------------------------------VDMLANGIRR
A4VJY0_PSEU5/11-120----------------------------------------------------------------------GRMLYRIGD.
I3Z121_BELBD/12-117----------------------------------------------------------------------LRWYFEME.N
A9ENE2_SORC5/23-130----------------------------------------------------------------------VLVLADARHM
E4TRL3_MARTH/24-128----------------------------------------------------------------------AGVLSLD...
A1SAI8_SHEAM/12-116----------------------------------------------------------------------VCLYIEA...
K9SIP1_9CYAN/14-118----------------------------------------------------------------------VKMIEIV.KD
I5B5J2_9DELT/12-119----------------------------------------------------------------------LIIYQEV...

PF01740

SUT22_ARATH/540-662--------------------------------------------------------SC-V..M-------------GVD-
RSBRD_BACSU/161-267--------------------------------------------------------SG-V..P-------------IVD-
S26A2_HUMAN/569-715--------------------------------------------------------SA-I..Q-------------FLD-
O45016_CAEEL/553-725--------------------------------------------------------ST-I..I-------------YVD-
SULP3_CAEEL/546-696--------------------------------------------------------DG-F..P-------------YVD-
D6EY97_STRLI/11-115--------------------------------------------------------DG-I..E-------------FFD-
O04001_SPOST/529-651--------------------------------------------------------SA-V..P-------------AID-
SUT32_ARATH/505-623--------------------------------------------------------SA-V..G-------------NID-
Q55814_SYNY3/440-540--------------------------------------------------------AT-V..P-------------RLG-
RSBV_BACSU/4-107--------------------------------------------------------KD-V..S-------------YMD-
O69205_ACTPA/8-112--------------------------------------------------------TG-V..R-------------FMA-
P73609_SYNY3/4-107--------------------------------------------------------DQ-L..E-------------YMS-
SP2AA_LYSSH/4-107--------------------------------------------------------EG-L..S-------------FMD-
O84431_CHLTR/3-107--------------------------------------------------------GD-L..D-------------YIS-
P71568_MYCTU/15-120--------------------------------------------------------TE-L..Q-------------VAE-
S26A1_RAT/529-685--------------------------------------------------------AP-L..L-------------FLD-
P73607_SYNY3/2-105--------------------------------------------------------TA-V..P-------------YMS-
SP2AA_BACME/4-109--------------------------------------------------------QH-L..T-------------FMD-
YVDB_BACSU/421-528--------------------------------------------------------NK-V..H-------------YMD-
RSBV_LISMO/4-109--------------------------------------------------------TE-V..S-------------YMD-
Q46665_ECOLX/332-437--------------------------------------------------------DA-V..P-------------VLD-
S26A4_HUMAN/536-725--------------------------------------------------------GA-I..S-------------FLD-
RSBV_BACLI/4-107--------------------------------------------------------KD-V..S-------------YMD-
O83261_TREPA/17-124--------------------------------------------------------AS-L..N-------------YVS-
Y1364_MYCTU/550-649--------------------------------------------------------SA-V..T-------------HLG-
O67306_AQUAE/448-564--------------------------------------------------------EA-V..N-------------YVD-
Q9Z6Z7_CHLPN/2-106--------------------------------------------------------TD-V..S-------------YIS-
SUT31_ARATH/514-633--------------------------------------------------------SA-V..G-------------NID-
Q9Z6P5_CHLPN/441-545--------------------------------------------------------TR-V..P-------------TID-
O17951_CAEEL/537-690--------------------------------------------------------SG-F..T-------------FID-
RSFB_MYCTU/6-111--------------------------------------------------------SA-V..E-------------FLG-
SP2AA_BACLI/4-109--------------------------------------------------------AD-L..S-------------FMD-
Q55415_SYNY3/433-538--------------------------------------------------------SD-V..P-------------HLG-
SULH1_SCHPO/592-725--------------------------------------------------------SA-V..N-------------HID-
O07728_MYCTU/29-135--------------------------------------------------------RD-L..D-------------FMG-
P72770_SYNY3/438-545--------------------------------------------------------GT-S..P-------------GID-
Q9Z841_CHLPN/3-107--------------------------------------------------------AH-L..D-------------YMS-
O07488_YEREN/391-488--------------------------------------------------------SH-A..H-------------FWD-
SUT33_ARATH/498-617--------------------------------------------------------SA-V..S-------------GVD-
P73474_SYNY3/396-498--------------------------------------------------------TH-A..H-------------LWD-
SP2AA_GEOSE/4-109--------------------------------------------------------GQ-L..T-------------FMD-
S26A3_HUMAN/526-716--------------------------------------------------------SA-V..S-------------FLD-
SUT41_ARATH/519-638--------------------------------------------------------SP-V..T-------------HID-
O84770_CHLTR/2-106--------------------------------------------------------EK-V..F-------------YMS-
RSFA_MYCTU/18-124--------------------------------------------------------NG-L..D-------------FMG-
RSBRB_BACSU/147-272--------------------------------------------------------SG-V..V-------------VVD-
SUT1_STYHA/538-656--------------------------------------------------------SP-V..P-------------DID-
G2TL00_BACCO/4-109--------------------------------------------------------EQ-L..S-------------FMD-
Y1739_MYCTU/443-553--------------------------------------------------------TA-L..D-------------ALD-
I6X4W0_MYCTU/31-137--------------------------------------------------------TG-L..D-------------FMG-
SP2AA_PAEPO/4-109--------------------------------------------------------KN-L..Q-------------FMD-
SULX_YEAST/572-707--------------------------------------------------------GG-M..T-------------SID-
SUT21_ARATH/548-668--------------------------------------------------------SS-L..I-------------NVD-
O83249_TREPA/5-107--------------------------------------------------------SG-V..T-------------AMS-
PHOT_BACSU/148-254--------------------------------------------------------SG-L..A-------------QVN-
RSBS_BACSU/5-111--------------------------------------------------------TS-V..D-------------MID-
O33206_MYCTU/385-486--------------------------------------------------------QH-V..T-------------YLD-
RSBRA_BACSU/151-261--------------------------------------------------------TG-V..P-------------VVD-
SUT11_ARATH/518-636--------------------------------------------------------SP-V..T-------------DID-
Y1081_THENE/1-106--------------------------------------------------------SD-V..E-------------SID-
SUT3_STYHA/511-631--------------------------------------------------------TD-L..T-------------NVD-
SULH3_SCHPO/533-653--------------------------------------------------------VG-V..S-------------SID-
YG35_YEAST/657-777--------------------------------------------------------KN-INAD-------------NID-
O33361_MYCTU/29-135--------------------------------------------------------SE-L..S-------------HFS-
O83551_TREPA/4-108--------------------------------------------------------EA-V..E-------------YID-
P73108_SYNY3/3-107--------------------------------------------------------SQ-V..D-------------FLD-
RSBRC_BACSU/163-272--------------------------------------------------------SG-V..A-------------VID-
Q40008_HORVU/530-648--------------------------------------------------------SP-V..T-------------DID-

PF13466

Q310Z9_DESAG/492-572--------------------------------------------------------QQ-L--E-------------SAD-
B5HV30_9ACTN/31-112--------------------------------------------------------AG-L--G-------------PPG-
A9BX84_DELAS/2-83--------------------------------------------------------SG-V--E-------------VFD-
Q0K681_CUPNH/47-125--------------------------------------------------------TG-L--A-------------QVD-
B5H529_STRPR/9-95--------------------------------------------------------GG-L--A-------------QVN-
Q0RDC2_FRAAA/24-104--------------------------------------------------------AG-L--E-------------LGD-
D1AD83_THECD/187-267--------------------------------------------------------AE-L--K-------------FID-
D2SCD5_GEOOG/29-109--------------------------------------------------------SG-I--T-------------FCD-
A1VK31_POLNA/2-82--------------------------------------------------------SA-L--S-------------QFD-
A8ZVX1_DESOH/4-85--------------------------------------------------------SA-V--G-------------RCD-
Q3SFW3_THIDA/281-359--------------------------------------------------------SE-V--A-------------RVD-
B9TGW9_RICCO/228-309--------------------------------------------------------SR-V--E-------------YSS-
A1W422_ACISJ/2-83--------------------------------------------------------GA-L--T-------------AFD-
A1U461_MARHV/15-95--------------------------------------------------------SG-L--G-------------TAH-
Q21UA2_RHOFT/4-85--------------------------------------------------------SP-L--N-------------RFD-
B1Y2Z1_LEPCP/2-84--------------------------------------------------------HQ-L--G-------------RFD-
Q8EEQ5_SHEON/14-91--------------------------------------------------------SQ-V--T-------------EVD-
D2S5L7_GEOOG/30-110--------------------------------------------------------SH-V--T-------------ACD-
A7MNS4_CROS8/14-91--------------------------------------------------------SG-L--E-------------RVD-
B9JTP2_AGRVS/23-100--------------------------------------------------------SG-V--E-------------RMG-
B8DPA7_DESVM/571-651--------------------------------------------------------SG-V--T-------------AAD-
C6C1P3_DESAD/15-93--------------------------------------------------------SG-I--E-------------YLD-
E3I167_RHOVT/14-94--------------------------------------------------------RR-V--T-------------SLD-
E3IYM7_FRASU/24-104--------------------------------------------------------GG-L--R-------------RVD-
C1D624_LARHH/5-83--------------------------------------------------------AA-V--R-------------RVD-
A4YXB4_BRASO/320-399--------------------------------------------------------SN-V--C-------------AID-
D1C014_XYLCX/37-113--------------------------------------------------------HH-I--T-------------FMD-
C6WD00_ACTMD/919-1001--------------------------------------------------------SG-L--G-------------YLS-
E3J1T6_FRASU/56-136--------------------------------------------------------GR-L--R-------------RVD-
C6WQ84_ACTMD/60-139--------------------------------------------------------GE-V--R-------------LLA-
Q2SPQ4_HAHCH/13-91--------------------------------------------------------AE-V--E-------------VMD-
D2SFP4_GEOOG/531-612--------------------------------------------------------TE-V--T-------------LFS-
D2B5R7_STRRD/72-150--------------------------------------------------------AG-L--T-------------FVD-
B8DLB2_DESVM/179-259--------------------------------------------------------EP-S--V-------------SVN-
D0KYU0_HALNC/26-108--------------------------------------------------------GS-V--G-------------RID-
D5X3Z8_THIK1/566-644--------------------------------------------------------RQ-L--R-------------RID-
B9J943_AGRRK/10-87--------------------------------------------------------SS-V--E-------------RIG-
B1W2W2_STRGG/20-107--------------------------------------------------------GG-V--T-------------RPD-
A1SBD9_SHEAM/6-85--------------------------------------------------------AR-L--I-------------KAD-
A0LC67_MAGMM/14-94--------------------------------------------------------SQ-V--K-------------SLD-
A4YMN9_BRASO/16-97--------------------------------------------------------SG-L--Q-------------SIE-
C7LTF6_DESBD/15-91--------------------------------------------------------AD-S--E-------------KSD-
B1LTK1_METRJ/26-107--------------------------------------------------------SG-I--E-------------RLD-
Q0RZA3_RHOJR/48-126--------------------------------------------------------LP-A--G-------------FVG-
C5BID3_TERTT/281-360--------------------------------------------------------SG-L--E-------------YMD-
Q2SBJ1_HAHCH/18-100--------------------------------------------------------SL-V--E-------------NAQ-
B5HHQ5_STRPR/28-107--------------------------------------------------------SG-L--E-------------RIE-
Q1QXI2_CHRSD/17-99--------------------------------------------------------RE-A--T-------------NVD-
Q12BT3_POLSJ/427-501--------------------------------------------------------SG-C--D-------------YLD-
C9R4W7_AGGAD/20-98--------------------------------------------------------SQ-V--N-------------RID-
D9T369_MICAI/189-267--------------------------------------------------------AE-L--R-------------FVD-
Q31HM4_THICR/6-86--------------------------------------------------------GN-V--E-------------SID-
Q31GZ5_THICR/18-93--------------------------------------------------------SN-V--K-------------EAD-
A7H922_ANADF/18-92--------------------------------------------------------SL-V--R-------------EFA-
Q21SV7_RHOFT/514-592--------------------------------------------------------SR-L--I-------------RVD-
A3N1T8_ACTP2/20-99--------------------------------------------------------KD-L--E-------------RVD-
B2FP86_STRMK/2-73--------------------------------------------------------AE-V--E-------------RVD-
F9ZTS0_ACICS/20-97--------------------------------------------------------DD-V--D-------------AAD-
Q2IMF1_ANADE/97-172--------------------------------------------------------TH-V--R-------------ELH-
Q3J3N5_RHOS4/5-82--------------------------------------------------------GQ-V--S-------------FVG-
Q3J659_RHOS4/7-80--------------------------------------------------------SG-V--L-------------AVD-
Q6DAF4_PECAS/14-89--------------------------------------------------------SG-L--N-------------RVD-
Q87LF2_VIBPA/15-93--------------------------------------------------------EE-I--E-------------RVD-

PF14213

G2J3X0_PSEUL/31-97--------------------------------------------------------DG.A--R-------------GYG-
C5AFW9_BURGB/238-293--------------------------------------------------------EG.V--D-------------SIG-
R6DUG2_9CLOT/21-84--------------------------------------------------------GD.V--E-------------SII-
D8P9E0_9BACT/36-91--------------------------------------------------------RD.V--R-------------SVG-
D9QF83_BRESC/26-91--------------------------------------------------------SD.A--R-------------GLA-
K8GP23_9CYAN/208-263--------------------------------------------------------HA.V--D-------------SIG-
D7E2C2_NOSA0/17-80--------------------------------------------------------RR.V--E-------------VFA-
D9SDG1_GALCS/27-91--------------------------------------------------------DG.T--R-------------GYG-
C4Z656_EUBE2/22-87--------------------------------------------------------PDYI--E-------------MIA-
R5XRA0_9FIRM/285-340--------------------------------------------------------SG.I--D-------------FMG-
R6PJ48_9CLOT/285-340--------------------------------------------------------SE.I--D-------------FMG-
A3QA48_SHELP/32-98--------------------------------------------------------TG.Y--N-------------RYG-
R5ZPG5_9CLOT/24-98--------------------------------------------------------DG.G--Y-------------GYG-
Q73PI2_TREDE/278-333--------------------------------------------------------QG.V--S-------------EIG-
K9ZH15_ANACC/18-81--------------------------------------------------------TG.V--R-------------KFL-
H8H3V4_DEIGI/24-87--------------------------------------------------------AG.V--R-------------YII-
H8XUH7_FLAIG/24-92--------------------------------------------------------DN.T--G-------------GYA-
A0LXZ9_GRAFK/27-97--------------------------------------------------------DG.T--A-------------GYG-
Q8XHB8_CLOPE/17-78--------------------------------------------------------GG.I--G-------------RVS-
Q5NEH5_FRATT/276-331--------------------------------------------------------RD.V--N-------------LIG-
R4K797_CLOPA/19-79--------------------------------------------------------AG.I--N-------------EVP-
A9H234_GLUDA/27-96--------------------------------------------------------EN.V--L-------------SFG-
D5BER1_ZUNPS/19-78--------------------------------------------------------EG.I--E-------------LLS-
I4C4U2_DESTA/277-332--------------------------------------------------------QE.V--E-------------SIG-
G0AI14_COLFT/270-325--------------------------------------------------------SG.V--D-------------EIG-
K9ZPS4_ANACC/341-404--------------------------------------------------------SD.V--Q-------------AAP-
H6LER3_ACEWD/283-338--------------------------------------------------------EG.V--S-------------DLG-
E6N6U4_9ARCH/18-73--------------------------------------------------------EG.V--R-------------SIT-
F8I7N0_SULAT/28-91--------------------------------------------------------RQ.I--D-------------VMT-
F5YCP5_TREAZ/25-79--------------------------------------------------------EE.I--K-------------VMT-
A5G5Z8_GEOUR/270-325--------------------------------------------------------ER.V--K-------------EIG-
H6RW13_BLASD/80-135--------------------------------------------------------AG.V--E-------------EVG-
L0D9F9_SINAD/118-173--------------------------------------------------------SD.L--E-------------SVG-
D8IQ15_HERSS/25-89--------------------------------------------------------DG.V--R-------------GYG-
Q82UU3_NITEU/25-95--------------------------------------------------------DG.V--R-------------GYN-
B5EI93_GEOBB/335-400--------------------------------------------------------SG.I--P-------------VIS-
L0DGU6_SINAD/19-82--------------------------------------------------------SG.V--R-------------TLT-
W6RWL6_9CLOT/19-83--------------------------------------------------------SG.L--K-------------LIT-
B4U9L3_HYDS0/40-103--------------------------------------------------------EG.V--E-------------LIT-
K9TRC5_9CYAN/18-81--------------------------------------------------------SK.V--K-------------IFA-
K4IKE5_PSYTT/20-83--------------------------------------------------------EG.I--H-------------VMT-
K4L2N6_9FIRM/328-393--------------------------------------------------------SE.V--G-------------VLS-
K9UH85_9CYAN/18-81--------------------------------------------------------ER.V--T-------------VFA-
B4SE54_PELPB/33-96--------------------------------------------------------DG.V--S-------------MFI-
B7XKG1_ENTBH/25-91--------------------------------------------------------DG.S--M-------------GYS-
E6U4T1_ETHHY/18-81--------------------------------------------------------SG.I--S-------------LFA-
A6L6I8_BACV8/31-97--------------------------------------------------------PENI--K-------------SIN-
K9RV87_SYNP3/278-333--------------------------------------------------------SE.V--E-------------AIG-
E3H2Y7_ROTDC/336-394--------------------------------------------------------ES.I--D-------------VIS-
C7MM94_CRYCD/17-81--------------------------------------------------------SG.V--G-------------SIT-
B1ZYW4_OPITP/20-83--------------------------------------------------------TG.V--R-------------SAN-
F3ZTR7_9BACE/27-97--------------------------------------------------------DG.T--D-------------GYG-
Q5E361_VIBF1/32-98--------------------------------------------------------TG.Y--N-------------RYG-
W0PBU4_9BURK/27-91--------------------------------------------------------DN.V--M-------------GFG-
Q7NLA4_GLOVI/5-68--------------------------------------------------------DR.V--E-------------IFA-
A7I365_CAMHC/26-89--------------------------------------------------------NGVE--S-------------SLG-
Q7VJH0_HELHP/18-83--------------------------------------------------------DK.V--.-------------MVI-
D1B345_SULD5/22-85--------------------------------------------------------LH.V--N-------------KLT-
R6I2W7_9FIRM/273-328--------------------------------------------------------DS.I--E-------------WMG-
A1BGI6_CHLPD/273-328--------------------------------------------------------ED.V--E-------------EIG-
K9VZ93_9CYAN/30-93--------------------------------------------------------AG.V--E-------------IVA-
Q97FP7_CLOAB/19-80--------------------------------------------------------SG.L--G-------------DVP-
A1SAB7_SHEAM/362-425--------------------------------------------------------DG.V--E-------------SAP-
E3HBI7_ILYPC/11-75--------------------------------------------------------HS.L--E-------------SLN-
V5SDX9_9RHIZ/278-333--------------------------------------------------------SG.I--D-------------TIG-
A4XX40_PSEMY/363-426--------------------------------------------------------DN.V--I-------------SAP-
S6ABL2_9PROT/28-89--------------------------------------------------------SG.V--E-------------A.T-
K9V072_9CYAN/33-96--------------------------------------------------------KN.G--E-------------DIT-
I3Z1N7_BELBD/17-80--------------------------------------------------------KD.A--S-------------APS-
R6H1A0_9FIRM/21-84--------------------------------------------------------SN.V--E-------------SMI-
M4VBB1_9DELT/264-319--------------------------------------------------------KG.I--K-------------TVG-
Q8TKH8_METAC/27-90--------------------------------------------------------AE.N--D-------------ELT-
I0K8N5_9BACT/19-82--------------------------------------------------------AG.L--D-------------TCS-
W6RYG0_9CLOT/18-79--------------------------------------------------------LG.M--D-------------KIP-
H2J416_MARPK/19-82--------------------------------------------------------NN.I--N-------------VVT-
Q3JEZ3_NITOC/23-86--------------------------------------------------------EN.V--T-------------MLI-
D4M3H3_9FIRM/23-78--------------------------------------------------------RG.I--E-------------FMG-
R6G1E0_9CLOT/19-80--------------------------------------------------------EG.F--N-------------RIP-

PF11964

L0GYF4_9GAMM/12-118F..HG...WDPKA...AW....DDF.............K.LGI....RH.......YADF--E.............RMA.
W8EVU9_9BACT/23-129.........................................................HGM--P.............ALS.
D5V1Z3_ARCNC/21-125L..EG...WELKA...AW....DDL.............K.IGL....KH.......GNQF--E.............KIA.
Q11VP6_CYTH3/12-119V..KD...FTAGA...WF....KDA.............V.LGV....KN.......LTKW--N.............RAA.
A5FC98_FLAJ1/11-118I..KN...FTAGA...WL....QDA.............L.LGL....KH.......LGKW--N.............RAA.
Q28QM9_JANSC/19-126........TAFTGSDWDSMLDGDVI.............K.SRF....RS.......LSEV--R.............RYA.
Q093V8_STIAD/17-124TGFSPQA...............RRS...............MGENPHP..........VQY--K.............AMA.
E0TIJ6_PARBH/12-118L..EGYERWQAA.....L....SDL.............K.ADL....RY.......NDRF--A.............KIA.
Q3SKE6_THIDA/10-113...RDMLSYSVDV...AW....EEL.............K.FSR....EH.......KNDF--G.............RIA.
Q3ID73_PSEHT/20-125L..EG...WGIRA...AW....DDL.............K.LGL....KH.......GKNF--K.............KVA.
B2HRZ3_MYCMM/12-119F..GG...FDPGA...MW....EDT.............K.LGF....SH.......FLRW--E.............RFA.
J7Q7E4_METSZ/12-118F..SG...FDPGA...MW....EDF.............R.VGM....EH.......LTRW--E.............RVA.
E8X7D9_GRATM/13-120....G...W..GA...RW....DEM.............R.FLQ....RH.......TAHI--S.............RMA.
Q3J4W4_RHOS4/41-148TGL.T...PAAAL...DL....EGL.............K.AGF....RS.......LGKV--R.............RYA.
F0SJ20_RUBBR/12-119I..E....TPPIPWSKFW....DNF.............K.FEF....EH.......LSDI--T.............HAA.
D5SV07_PLAL2/13-118F..HG...WTMGA...LW....QDI.............K.FDF....KH.......GKDI--E.............KLA.
A4XX57_PSEMY/12-120........FEWPT....L....GAV.............G.VELKRIPQLLRL....IRQF--D.............RVA.
A0LIB8_SYNFM/14-120F..EG...WRKGA...DW....GDI.............A.FFM....TH.......GNDV--A.............RMA.
I4C386_DESTA/12-119F..GG...WTSGG...FW....DYA.............K.FGT....KH.......QNDF--D.............KVA.
I4AGM8_FLELS/70-181......................................MELGYVSMFARAWLMLDWMPRM--Q.............QQEI
M4SAG0_9SPHN/140-247DGF.A...PAILA...DP....KIV.............E.RKL....SL.......LHRV--S.............RYA.
F0SJC2_RUBBR/13-118F..HG...WDAGA...MW....EDI.............K.FDL....HH.......FRDI--E.............RLA.
M9R3U0_9RHOB/11-120........FSMPT....G....GAL.............A.AEMMRLPKLFSL....IKHF--S.............RCA.
A9WJT9_CHLAA/12-112......................RRI...............SGADRGARQRTEAIVHHKHL--G.............RIA.
W8EZJ6_9BACT/24-132........................................WKAGEWVGQVFAFELGKRGI--R.............AVA.
Q8EB52_SHEON/21-126L..DG...WELQA...AW....DDL.............K.LGV....KH.......IRHF--E.............RIA.
L0K3H2_9EURY/13-119SDS.Y...AEFDA...YE....EDF.............G.FYL....RH.......GEDM--D.............CYA.
B1MER2_MYCA9/12-121Y..EG...FGPGG...LA....EDL.............K.LGLGMLFQH.......HSAF--K.............KIA.
F9ZWL7_METMM/13-118F..HG...WELSA...AW....EDF.............K.FGI....DH.......FADI--E.............RLA.
X5E4J9_9BACT/13-117..........................................................EI--S.............HVA.
E4TNT7_MARTH/14-124......................KAV...............IPK.............LSHQ--R.............KQA.
Q8TPB5_METAC/12-119F..TG...FTYNA...MW....DDA.............K.VGI....WH.......LTAF--E.............KIA.
A3QHM0_SHELP/21-124L..DG...LSLHA...AW....DDL.............K.LGL....KH.......GKEF--K.............RVA.
B0JM20_MICAN/12-118F..TG...WESFG..ALV....AHF.............R.LIR....DH.......HKYV--S.............KVA.
Q7UVW9_RHOBA/74-179F..RG...WNLRA...FD....PNP.............G.LGL....QG.......DEEV--E.............QVA.
A4FCH9_SACEN/137-244F..PG...WQNFP..SLL....RHM.............K.FVR....DH.......HRRI--G.............RVA.
A0LXE0_GRAFK/12-118......................KDFPGFENFKAFNETLK.LKA....KA.......FNAI--E.............KYA.
E1RHG3_METP4/12-115...KTGRYETVRA...FY....EDI.............S.WLL....RN.......LKHF--D.............RMA.
G2J2P9_PSEUL/12-113...SELKDFTIDM...AV....EEL.............R.FVR....AH.......DKEL--G.............RVA.
A5G4W5_GEOUR/116-227F..CG...WVGGE...VW....NDM.............T.FFV....HY.......GDRI--A.............KIA.
A3CYB3_METMJ/12-120F..RS...WRPGE...GW....DAF.............K.QWP.....G.......MEQV--D.............RIA.
Q5V739_HALMA/20-132.................................PNWTFRAFLTHLHGVVPDLRYGPEFDI--D.............RYA.
I4C4Z7_DESTA/12-119F..AG...WEAHA...AW....DDA.............I.FGL....RH.......RNDF--E.............KLA.
M4NFH5_9GAMM/12-119F..TG...FDPGA...MW....DDA.............K.LSL....RH.......FSGW--D.............RVA.
A1S706_SHEAM/12-119C..RG...VSLLS...LW....QDV.............L.LGL....FH.......LDDF--R.............RIA.
M4V983_9DELT/11-119NHVTAQAVAKRIA...........................YSIAKIGE........WHRF--P.............RVA.
D4ZLE1_SHEVD/12-119F..KG...ITVET...LW....DDA.............M.LGF....FH.......LTDF--S.............RVV.
B2HE07_MYCMM/27-133F..PG...WDSFG..AMV....NHF.............R.FIR....DH.......QKHV--K.............KIA.
J7L4H1_NOCAA/12-117...HGRPSTETPT...LE....ERL.............R.FAK....EH.......LHDI--E.............RYA.
F2LY86_HIPMA/12-118F..KS...YQLKA...VI....DDA.............K.AGL....MF.......FNAW--E.............KIA.
F0SJ19_RUBBR/12-119I..Q....FPPIPMSRMW....DDF.............K.FVH....EH.......LGDI--T.............HVA.
Q3JB38_NITOC/148-256GGI.D...PAVFM...QG....GLV.............S.MKL....AA.......MQKV--E.............RYA.
W8EXL7_9BACT/35-135................................RQMRAFSTAEQQWIVQEWLPRAVTEGGY--R.............FGA.
H8MXZ5_CORCM/21-129EGLSVAP...............RKY...............LAKHLSP..........TWF--R.............AVC.
E1RH74_METP4/11-116......................ENFEGRTAHAAWDDFINWPK..............IAAV--N.............ETA.
K9XV53_STAC7/12-117...IQMQGLEASA...FW....EDL.............R.FSL....TH.......FKDI--S.............RYA.
A5FDC3_FLAJ1/11-118V..EN...FNTSA...WL....EDT.............L.IGL....RN.......LGKW--N.............RTA.
G8RQ72_MYCRN/12-121Y..DG...FGHGG...LV....EDL.............K.QGFGVLIKH.......HSAF--K.............RVA.
Q07X46_SHEFN/12-116......................DVL...............LEGWEFGSLTGSGEVQLPAF--D.............ALV.
A9GPE4_SORC5/20-127GTLTAAA...............RSA...............MAEELRG..........VRF--G.............GVA.
G2KMS5_MICAA/17-122......................EKF.............LGWEEEAAMADLASTLFLARHL--K.............KLA.
Q6MQZ1_BDEBA/34-138......................RDI.............GKVELAAFWKDLRFGIKNLKKI--P.............KAA.
E3FV03_STIAD/12-119...................................................QEFGLRSGV--K.............RVA.
D2QV97_SPILD/12-116F..RG...WQPEE...LW....RDL.............Q.FDL....TV.......TADF--A.............RIV.
Q7NXU0_CHRVO/12-113...TELKDFTLDM...AM....EEV.............K.FMR....AH.......EEKL--G.............RVA.
D5ER41_CORAD/12-118F..EG...FEPAA...LW....NDA.............S.IGM....RH.......PFSW--T.............RIA.
A1SV34_PSYIN/12-119F..PG...WENFA..GLV....SHL.............R.FIN....QY.......EKKV--K.............RIA.
B3QUM5_CHLT3/13-124.............................................SEAYIDADYYELDRL--RNYISAICDFLGECKCA.
G0J0D1_CYCMS/13-117L..RR...YKLEG...LW....EGL.............K.VDT....AH.......LSDY--G.............KTE.
A0M0N9_GRAFK/12-117F..TG...WDFPG...LW....EDL.............K.MDT....AH.......AKDY--E.............KIA.
Q1CW14_MYXXD/23-128Q.LEAAG...............RRY...............MSEKASS..........DWY--H.............AIL.
Q6AK92_DESPS/134-240F..NG...WQGLA..GVI....EHL.............H.LVI....QH.......RHVP--K.............KIA.
V5WKN4_9SPIO/39-142GKTNHVKNSIQRQ...........................FSKSAGPHVHKSAVVGASGM--I.............KVA.
A6Q9H2_SULNB/14-120F..PG...WEDFA..ALS....RHI.............T.FVK....NH.......HQKI--R.............RLA.
F8GCM7_NITSI/10-113...RDMLDYTVDV...AW....EEI.............K.FMR....DH.......GSEF--N.............KVA.
C4ZLU4_THASP/10-113...RQMAGFTLDV...AW....EEI.............K.FSR....QH.......AGDF--R.............RIA.
Q6AK92_DESPS/12-119F..DG...YTSGA...AW....DDT.............Q.LGL....KH.......WKGF--E.............RLA.
F0M0B1_VIBFN/20-125L..HG...WELRA...AW....DDF.............K.LGL....KY.......GSDF--D.............KIA.
A6WZX1_OCHA4/19-126EGF.D...WTAAF...SE....SML.............S.MRS....KS.......LKKL--R.............HYA.
E3FKU0_STIAD/13-119...................................................NAFAQLKGM--K.............RSAR
Q0AQY4_MARMM/16-124................................SLSAMPGPAMTELQTRMAKADPVKSGPR--R.............RAA.
Q6LKJ4_PHOPR/20-124F..DG...WQLQA...AW....DDL.............K.IGL....KH.......GKKF--D.............KVA.
D5BJF0_ZUNPS/25-118............................................................--...............SA.
C7P248_HALMD/57-169.................................VDWTARSALSNCYGILPDLRRGSSFDI--G.............RYA.
A1S9K0_SHEAM/21-126L..DG...WEARA...MW....DDL.............K.LGI....RH.......GRHF--E.............KIA.
D3FPZ4_BACPE/12-117...NEMAGVELSA...ID....DRL.............A.FTK....EH.......LSDI--E.............KYA.
Q087X8_SHEFN/21-125L..DG...WDLRA...AW....DDL.............K.LGL....KH.......KSEF--E.............RVA.
C0QCX2_DESAH/11-120........YNLPS....F....GAI.............G.IELSRFPSMFAL....MKKF--D.............RVA.
Q1LPD1_CUPMC/12-120FTITS...MEPGA...LW....DDF.............K.LGV....SH.......YLKW--E.............SVV.
A3HTM6_9BACT/12-125KIS.K...SSIKT...FF....EDI.............I.YTL....RN.......YKLM--G.............HIA.
F7XLD9_METZD/12-119F..DK...FTREA...LL....EDA.............K.VGK....EY.......FTSF--E.............KIA.
B1WXR6_CYAA5/19-124F..DG...IDPIA...LW....KDV.............R.FGF....GY.......INNF--T.............HAA.
D0J5L7_COMT2/12-119F..PG...WENWA..GFS....AHM.............G.FVR....DH.......RHQV--E.............QIA.
H6L5W1_SAPGL/20-121KKTNQEV...............RSA...............LSSGKIV............A--V.............GAA.
B7VP41_VIBTL/20-124L..TG...WELRA...AW....DDF.............K.LGL....EL.......NSKI--D.............KIA.
K0NMI2_DESTT/11-120........FHIPS....I....GAI.............V.IEFSRLPSMFGL....IKKF--S.............KAA.
F4CCE8_SPHS2/23-130F..ED...YSLQA...LL....EYI.............K.VSF....EH.......FSKW--N.............RMA.
G8PHU6_PSEUV/12-120......................NEK.............AHWGIEAGYEDLKWAMTHAKSF--H.............RIA.
A0M5Q5_GRAFK/11-116...EKGRHITFSA...LM....KGI.............K.FKY....SN.......SEHF--D.............KIA.
A3CYB0_METMJ/12-120F..HG...WKPHG...YW....EKL.............K.DWP.....G.......MEKV--D.............RIA.
F4AVZ8_DOKS4/11-116......................DDV.............DEIEIRAFIDHTFFDISYAKRI--N.............RLV.
I3YWJ5_AEQSU/12-117Q.......YTAKA...MW....EDF.............K.DGL....HY.......WRDI--K.............FVA.
Q083D4_SHEFN/12-118F..SG...WDLDA...AI....DDI.............K.FGM....KH.......LSDF--E.............RIA.
B0BYZ0_ACAM1/138-242F..EG...MDPMA...LW....KDL.............Q.QAY.....M.......VKDI--T.............HVA.
E3FWM2_STIAD/2-108SGYSHEA...............RRA...............IGEEPRL..........SPY--T.............AIV.
D5B9R4_ZUNPS/12-117F..QG...WHIEG...LW....KDF.............S.KDV....GH.......EKEY--E.............KIA.
M4SAG0_9SPHN/11-120........LQSIA....P....DAL.............L.FDLRHVLHYLAR....LRQF--G.............RIA.
I4AIU7_FLELS/23-135.................................................IPMLQKQLGTN--F.............EVA.
A5GKD8_SYNPW/21-126L..VG...WEPQA...AV....DDL.............R.LGL....RH.......GRHV--E.............RVA.
A9GKE1_SORC5/12-119...................................................AATSTAMGV--I.............RAA.
E1V9S9_HALED/39-147......................DDI..........RWMTFTAFLRDLGYGLTQIGDMDRY--Y.............RAA.
A8LJW8_DINSH/13-117......................DSF.............EGFDARTLWDGLKFDLAHWSEF--R.............RVA.
C5BJV0_TERTT/11-120........YHLPS....F....GAI.............A.IELWRLPQVLRL....LRRF--S.............HAA.
S6B665_9PROT/11-113...RDMARFTVDV...AW....EEI.............K.FTR....EH.......RFDL--W.............KIA.
G0J0C5_CYCMS/12-117F..TG...WDMKG...LW....ADL.............K.MDL....SH.......ANDY--E.............KIA.
Q1CYP8_MYXXD/13-120...................................................NAFAQLHGM--K.............RSAR
I0JIE9_HALH3/13-116NG......STLEG...FW....EGT.............K.VNL....KR.......WRQF--S.............KFA.
E6U1C5_BACCJ/13-120...................................................QEWLKEAGM--K.............RAA.
Q47BJ5_DECAR/11-113...SQMAGLTLDV...AW....EEV.............K.FSR....AH.......ANDF--K.............RVA.
K9X8Y1_9CHRO/10-123NSKNREKGVNSTI.........GKW...............IKHNK............PQL--T.............KFC.
Q8ED76_SHEON/12-119F..IG...ITVGA...LW....DDA.............L.LSV....FH.......FSDF--S.............RVV.
A1T9B4_MYCVP/12-121Y..QG...FGPGG...LV....EDL.............K.MGLGTLVRH.......HSGF--R.............RVA.
J1L360_9EURY/12-120F..KG...EDFGA...MA....DDL.............I.QDI.....K.......VSSV--E.............REA.
A3QIC9_SHELP/12-116......................DVL...............LEGWESQSLSGVGELQLPRF--D.............ALV.
G2J2S0_PSEUL/12-117F..HG...WDLHA...VW....DDM.............K.FGT....RH.......YADF--E.............RIA.
D5CNM7_SIDLE/10-114...RGMLAYTPDV...AW....EEI.............KFFRR....EH.......NHDF--N.............RIA.
Q093V7_STIAD/21-127TGYSLES...............RQA...............IGAEKER..........VPY--T.............AVA.
W8S663_9RHOB/15-124........VAWPS....L....GAI.............G.VEIRHWVQMMAM....VEKL--D.............KVA.
A9GPD9_SORC5/60-166GTISASA...............RKV...............MAEELRG..........VRF--D.............AIA.
Q11I87_CHESB/20-127EGIDWGGAWKEQA...YL....QKV......................KA.......LKHI--R.............RYA.
C1DA99_LARHH/12-113...SEVMDFTIDM...AI....EEL.............R.FVR....AH.......QHDF--G.............RVA.
B3QXG2_CHLT3/14-123.............................................RQVEITASKVEILRL--PKTQYTAEGLDMKSRIA.
H2FUI0_OCESG/21-126F..SG...WEARA...FW....EEI.............R.FTQ....QH.......GDDF--S.............RLA.
E1QK88_DESB2/12-119I..KG...MTMTE...AI....EMA.............S.FVI....EQ.......QGQL--E.............KVA.
W8S5M5_9RHOB/17-125RSA.E...PGANW...SV....DAM.............K.AQA....KA.......VTSV--R.............NYV.
I4EWX0_9ACTN/5-112M..GE...YEGDT...LT....EEM.............Q.FAV....RH.......PSAY--E.............RVA.
V5XBD7_MYCNE/12-121Y..DG...FGPGG...LT....EDL.............K.MGFGALLHH.......HSAF--K.............RIA.
D5B9R0_ZUNPS/6-111F..KG...YTLKG...FW....EDL.............K.IDS....AH.......LGDY--G.............KMA.
F5XYL0_RAMTT/15-117......................................GQLAFTQHFQMGHQVARQLGHL--E.............RMAS
Q1ZBL2_9GAMM/21-125L..EG...WELRA...AW....DDF.............K.LGL....KH.......NNEF--N.............KIA.
A3QF38_SHELP/12-119F..EG...VSVET...LW....DDA.............K.LGF....FH.......LTDF--S.............RVA.
Q3JB38_NITOC/16-125...TGLSDMNANA...FV....EGT.............K.ADLEFL.GH.......IDRF--S.............RCA.
D6XVY9_BACIE/11-115......................DNI.............H.VTLKGLIEDLKFDMKYWNDF--D.............KIA.
Q2YCI1_NITMU/10-113...RDMLSYTIDV...AW....EDI.............K.FVR....EH.......GSEF--N.............RIA.
C6Y0C1_PEDHD/12-119V..QN...FTAGA...WI....QDL.............I.AGI....KH.......LTEW--K.............KIA.
B1LYM2_METRJ/12-117F..EG...MEPAA...FF....KDP.............R.FGF....SM.......MKSV--S.............HVA.
Q7MEX7_VIBVY/25-130F..SG...WEPRA...AW....DDF.............Q.LGL....KI.......GFNV--N.............KVA.
Q12ZF4_METBU/12-119Y..EK...FSRKA...ML....EDM.............E.LGV....KN.......ITSF--D.............RIA.
L0G526_ECHVK/12-117F..TG...WSIEG...LW....ADA.............K.MDL....SH.......AKDY--E.............KIA.
F4C7J2_SPHS2/12-119V..QN...FDSSA...WL....QDM.............L.AGI....KY.......FNKW--K.............KMA.
B0BYZ0_ACAM1/12-117F..EG...IDPIA...LW....KDA.............Q.FGL....SH.......VNDF--S.............HVA.
A6Q671_SULNB/23-127F..KG...WEMLA...AW....DDF.............K.FGI....KH.......RNKF--D.............KMA.
A0LXE0_GRAFK/144-249......................KNF............KAYKDINVLLSGIKADFSALNKV--T.............KYA.
W8EUS5_9BACT/21-126ARWVGTEYYRLLA...........................................QQGM--R.............SVA.
H6L5S2_SAPGL/58-159PSLPIEV...............RKH...............LRSKEVSQF.......HENS--K.............ATA.
G8R3P5_OWEHD/12-122EGTDWEVVWHSLK...........................FAIGKLKTY.......FSKV--D.............KIA.
W0RC97_9BACT/11-121................................................ERRLGMVLPNPI--K.............SAL.
C6C2B1_DESAD/11-117GG......ISFNA...LI....EDL.............K.FAL....PN.......LKRF--S.............KKA.
H6L5W0_SAPGL/30-131GGISADA...............RKY...............F....AKAV.......NPRS--R.............ACA.
D9QNG3_BRESC/27-134EGATPGALFEPTA...LK....AEA......................AS.......ILGV--R.............RYV.
G2KMS4_MICAA/16-122..................................DRDFKGWSEQAAALSFKCITDIGSTA--R.............RLA.
H6L0F3_SAPGL/30-131QRLNRCA...............REY...............MRSEEAKSYDQYVV......--..............GSA.
A0LXC2_GRAFK/12-117F..DG...WSAKG...FW....EDL.............K.MDS....KH.......ASDY--E.............KIA.
Q2RZR2_SALRD/34-139........WAPEE...RW....EDL.............A.FDVRHLSDV...........--D.............KVA.
G2KMS2_MICAA/25-131...................................VDFLGWEDDAAELNLKTIFYQAPFA--T.............RLA.
G0L8K0_ZOBGA/13-125KIS.H...SEVKA...LV....EDA.............K.WTL....GN.......YGQI--G.............NIA.
Q82UI4_NITEU/10-112...RDMVSYSVDV...AW....KEI.............R.FMR....EH.......GSKI--N.............RVA.
I1YHY0_METFJ/11-119........FHLPS....L....SAI.............G.VELSRLPAMLKL....VKQF--D.............RVA.
C6X1D7_FLAB3/12-118L..DK...FTAGA...WM....QDA.............F.LGL....QN.......LTKW--N.............RAA.
I4ANF2_FLELS/25-134..................................................WFSKAYKHGY--R.............TSA.
V5WM94_9SPIO/3-107FESNAVRSKNERN...........................FSKEVNPYVRKSAVVGATGM--M.............KVT.
X2HCK2_9NEIS/13-113...SQMKDFTIDM...AL....EHL.............R.FLR....QH.......AHDF--G.............RTA.
S6ATB1_PSERE/11-120........FEMPT....L....GAM.............A.VEVSQLPQLFKV....VRRF--D.............RMA.
E6WYT5_NITSE/23-127F..EG...WSFEA...AL....DDM.............K.FGL....KL.......RNAF--K.............KMA.
D5BJR6_ZUNPS/18-118......................................RGVTTAQKQARDYLAIEGGNLT--K.............ALA.
C7RNF8_ACCPU/11-113...REMADFTLDV...AW....EDI.............V.FAR....AH.......ASDF--S.............RIA.
A8ZX31_DESOH/24-127.....................................NRAGKTSSRSRKFFKAFTETGKC--R.............KVA.
H0PYZ6_9RHOO/10-113...REMAGFTLDV...AW....EEI.............K.FSR....QH.......AHDF--G.............RIA.
F0JGN8_DESDE/12-119F..KG...WEFKA...MW....DDA.............K.FGL....AH.......RKDF--R.............RLA.
A9GPD8_SORC5/37-144GALPPPA...............RKA...............FAEGLSS..........ARL--D.............AVA.
G2KMS3_MICAA/30-137..................................GPNFAGWDDEAAELNFKTVLRQCPHV--R.............KLV.
Q31FZ2_THICR/21-125M..EG...WELRA...AW....DDF.............K.MGL....SY.......GGEF--E.............KIA.
A9GPE2_SORC5/23-130GAVAPAA...............RKV...............YLDGLRS..........ARL--D.............GIA.
X5E3H4_9BACT/12-117V..DG...ISPKA...FW....EDV.............K.TYL....KH.......FNHM--K.............KIA.
M1NQM0_9CORY/12-118IEPGR...IEPKA...WI....EDL.............R.MT.....GI.......LGDI--E.............KMA.
A0M0L9_GRAFK/12-115F..EG...WTASA...YW....EGI.............E.LKL....PN.......EERV--K.............KVA.
A6Q807_SULNB/11-120........FDFPS....M....DAI.............M.VKLSRLPELFGL....LKRF--D.............RMA.
C6BYE1_DESAD/13-119F..KG...WDLKA...MW....EDT.............K.FGF....AH.......RNDF--E.............KLA.
Q73Z58_MYCPA/13-121Y..QG...FGPGG...LV....EDL.............K.LGLGAVLPH.......HSAF--R.............RIA.
K9RD27_9CYAN/12-117EGIEG...FSLET...II....KEF.............E.FTL....SQ.......FHRF--E.............KEA.
D9SJ90_GALCS/11-114...RGMLDYSVDV...AW....EEI.............KFFSR....QH.......NHDF--S.............KIA.
W6RYK2_9CLOT/10-116......................................................FISSKV--N.............KGA.
H8N2H1_CORCM/12-120...................................................NAYAQQRGM--K.............RSAR
I0KHL1_9BACT/11-115F..RG...WQPDE...LW....RDL.............Q.FDL....TV.......PADF--T.............RIA.
A6VRW9_MARMS/21-125F..EG...WSMKS...AW....TEF.............L.LSQ....RL.......GGEF--D.............RIA.
A4FCH9_SACEN/14-119F..QG...LAPAA...VW....EDT.............K.VGL....SS.......LKLF--D.............GCA.
Q6LS91_PHOPR/11-120........FDFPT....L....SAI.............G.VELTRLPELFRH....TRKF--K.............KVA.
G8QLC0_DECSP/10-113...RQMADVTLDT...AL....EEI.............R.FSK....AH.......ANDF--E.............RIA.
M4S571_9SPHN/11-120F..RD...MTFQA...GL....KDM.............R.YSLSKL.FQ.......LNRF--S.............REA.
A9B5K6_HERA2/29-133PRLLDL................REA...............LPISREVRRFYMQPATRNSA--T.............IVA.
A4VJY0_PSEU5/11-120........FDLPT....L....GAV.............G.VELSRLPQLLRF....IRRF--D.............RCA.
I3Z121_BELBD/12-117F..KG...WELKA...FW....QDA.............K.FDL....KH.......ANDF--E.............KIA.
A9ENE2_SORC5/23-130GPVSAQA...............RKA...............VTEEMRG..........ARV--D.............AVA.
E4TRL3_MARTH/24-128...........................................DQKWVSENLIPKAAQEV--E.............KIAV
A1SAI8_SHEAM/12-116......................DVL...............LEGWEQASLSGAGEVQLPPF--D.............ALV.
K9SIP1_9CYAN/14-118F..SG...FELSM...LG....KAI.............K.FDI....DH.......LKDF--S.............HCA.
I5B5J2_9DELT/12-119...VSIGGVEFNAMIEKWKFFLAFG...............................LSHF--S.............RIA.

PF01740

SUT22_ARATH/540-662---------------TSGVFALEELHQELA.S-------------------NDIR----LVI-A---------S-PRWR-
RSBRD_BACSU/161-267---------------TMVAYQIFKVIDSTK.L-------------------LGIE----TII-S---------G-IRPE-
S26A2_HUMAN/569-715---------------TAGIHTLKEVRRDYE.A-------------------IGIQ----VLL-A---------Q-CNPT-
O45016_CAEEL/553-725---------------LMGQGALKDVYNDYK.T-------------------IGIS----VLF-A---------N-TNEH-
SULP3_CAEEL/546-696---------------YLGLSTLKSVYVDLQ.A-------------------AGIQ----CFF-V---------V-QKSD-
D6EY97_STRLI/11-115---------------CSGLRLLYRARSQVL.D-------------------GGGQ----VRL-V---------C-THAM-
O04001_SPOST/529-651---------------TSGVAFLIDIKKSIE.K-------------------RGLE----LVL-V---------N-PTGE-
SUT32_ARATH/505-623---------------TSGISMLEELNKILG.R-------------------RELK----LVI-A---------N-PGAE-
Q55814_SYNY3/440-540---------------VTALLAIETMLKDAL.A-------------------KQRE----VFL-V---------G-AKGQ-
RSBV_BACSU/4-107---------------STGLGVFVGTFKMVK.K-------------------QGGS----LKL-E---------N-LSER-
O69205_ACTPA/8-112---------------STGLSLLVEAARRGR..-------------------..AR----LVL-A---------T-AQRG-
P73609_SYNY3/4-107---------------SAGLRILVFAKQKMG..-------------------SGVE----IFL-V---------G-TQEM-
SP2AA_LYSSH/4-107---------------SSGVGLVLGRMRELE.A-------------------VAGR----TIL-L---------N-PSPT-
O84431_CHLTR/3-107---------------SAGIRVLLQSYHQVG.K-------------------NAGK----IAL-T---------S-VSKT-
P71568_MYCTU/15-120---------------ESAWSVFISARWQADFR-------------------ADVP----VLL-V---------C-GHRA-
S26A1_RAT/529-685---------------VAGMATLKDLRKNYR.A-------------------LDIT----LLL-A---------C-CSPS-
P73607_SYNY3/2-105---------------SAGLRLLLYLYRQTT.A-------------------NSAQ----LVL-V---------G-LSEE-
SP2AA_BACME/4-109---------------SSGLGVILGRYKQVH.N-------------------NGGE----MVV-C---------A-ISPA-
YVDB_BACSU/421-528---------------TSAEAVLGNIMNRIK.R-------------------HNGK----LMI-V---------G-LQSQ-
RSBV_LISMO/4-109---------------STGLGVFVGAFKSLR.Q-------------------RQSE----LVL-F---------G-LSDR-
Q46665_ECOLX/332-437---------------AGGLDAFQRFVKRLP..-------------------EGCE----LRV-C---------N-VEFQ-
S26A4_HUMAN/536-725---------------VVGVRSLRVIVKEFQ.R-------------------IDVN----VYF-A---------S-LQDY-
RSBV_BACLI/4-107---------------STGLGVFVGIYKAVN.R-------------------TGGS----LVL-E---------N-LSER-
O83261_TREPA/17-124---------------STGIGSFTAFLKTVK.P-------------------KGGD----IVL-L---------D-IQPR-
Y1364_MYCTU/550-649---------------SAGVGALAAACDRAR.K-------------------QGTE----CVL-V---------A-PPGS-
O67306_AQUAE/448-564---------------ATGAETIVRLVKDIK.Q-------------------KGVE----VAF-A---------N-IGCD-
Q9Z6Z7_CHLPN/2-106---------------SAGIRLLLSNFKLVQ.S-------------------LGGK----MCL-C---------C-VKES-
SUT31_ARATH/514-633---------------TSGISMMVEIKKVID.R-------------------RALK----LVL-S---------N-PKGE-
Q9Z6P5_CHLPN/441-545---------------ASAMHALEEFFLECD.R-------------------QGTL----LLL-A---------G-VKKT-
O17951_CAEEL/537-690---------------LMGVSALKEVFSDLR.K-------------------KRVQ----VYF-A---------S-TKVP-
RSFB_MYCTU/6-111---------------SVGLKILAATSEKIG..-------------------QSVK----FGV-V---------A-RGSV-
SP2AA_BACLI/4-109---------------SSGLGVVLGRYKEIK.Q-------------------LGGE----MIV-C---------A-ISPA-
Q55415_SYNY3/433-538---------------VTASLALENAIEEAA.E-------------------KGRA----VYI-V---------G-ATGQ-
SULH1_SCHPO/592-725---------------TTGVQALVDTRKELE..-------------------....----...-I---------Y-AGDE-
O07728_MYCTU/29-135---------------SCAYAVLAQESVRCR.R-------------------RGVN----MRL-V---------S-NQPI-
P72770_SYNY3/438-545---------------TPAARWFKTLSQSLN.Q-------------------QGIT----LKL-V---------N-ASGF-
Q9Z841_CHLPN/3-107---------------SAGIRVLLQSYHQVG.Q-------------------HSGK----IVL-T---------T-VPKT-
O07488_YEREN/391-488---------------ITSVSALDKVVIKFR.R-------------------EGAG----VEI-R---------G-MNEA-
SUT33_ARATH/498-617---------------TNGVSFFKELKKTTA.K-------------------KDIE----LVF-V---------N-PLSE-
P73474_SYNY3/396-498---------------QGAVGTVEQIMTKFR.R-------------------NGID----VEL-V---------G-LNGA-
SP2AA_GEOSE/4-109---------------SSGLGVILGRYKQIK.N-------------------VGGQ----MVV-C---------A-VSPA-
S26A3_HUMAN/526-716---------------VSSVRGLKSILQEFI.R-------------------IKVD----VYI-V---------G-TDDD-
SUT41_ARATH/519-638---------------SSAVEALKELYQEYK.T-------------------RDIQ----LAI-S---------N-PNKD-
O84770_CHLTR/2-106---------------SAGLRTLLSLAKLTQ.N-------------------HNGK----LCI-C---------C-LRDE-
RSFA_MYCTU/18-124---------------CCAVAVLAHEAERCR.R-------------------RGVD----VRL-V---------S-RDRA-
RSBRB_BACSU/147-272---------------TMVAHQIFKLIEALN.L-------------------IGVR----STL-S---------G-IRPE-
SUT1_STYHA/538-656---------------TSGIHAFEELYKTLQ.K-------------------REVQ----LIL-A---------N-PGPV-
G2TL00_BACCO/4-109---------------SSGLGVILGRYKQIK.Q-------------------KNGE----MIV-C---------A-ISPA-
Y1739_MYCTU/443-553---------------........QLRTELL.R-------------------RGIV----FAM-A---------R-VKQD-
I6X4W0_MYCTU/31-137---------------CCAFAALADEAQRCR.C-------------------RGID----LRL-V---------S-HQPI-
SP2AA_PAEPO/4-109---------------SSGLGVILGRYKLIN.Q-------------------KGGE----MAV-C---------D-VNPP-
SULX_YEAST/572-707---------------SSAAQVLEEIITSYK.R-------------------RNVF----IYL-V---------N-VSIN-
SUT21_ARATH/548-668---------------TSGITALLELHNKLI.K-------------------TGVE----LVI-V---------N-PKWQ-
O83249_TREPA/5-107---------------SSGLGVLISAYDEGL.K-------------------YQRR----LCI-L---------N-PSES-
PHOT_BACSU/148-254---------------EQTADQIFKLSHLLK.L-------------------TGTE----LII-T---------G-IKPE-
RSBS_BACSU/5-111---------------SFIAKVLGDVITMSK.L-------------------MGAK----VVL-T---------G-IQPA-
O33206_MYCTU/385-486---------------TSGARALLYFIDHSE.K-------------------DGVA----VSI-K---------R-IPPR-
RSBRA_BACSU/151-261---------------TMVAHHIIQASEAVR.L-------------------VGAK----CLL-A---------G-IRPE-
SUT11_ARATH/518-636---------------TSGIHSIEELLKSLE.K-------------------QEIQ----LIL-A---------N-PGPV-
Y1081_THENE/1-106---------------SFSLGVIVNILKSVS.S-------------------VGGF----FAL-V---------S-PNER-
SUT3_STYHA/511-631---------------TSGILALEELHKKLL.S-------------------RGVE----LAM-V---------N-PRWE-
SULH3_SCHPO/533-653---------------SSALFAFQRILKEYV.E-------------------HQVE----VHL-V---------S-LDPQ-
YG35_YEAST/657-777---------------YSAAEGFNRIKRFTE.T-------------------KRIK----LII-S---------S-IKER-
O33361_MYCTU/29-135---------------GAGISLLCILDEDCR.A-------------------AGVQ----WAL-V---------A-SPAV-
O83551_TREPA/4-108---------------SSGIGVLIYLCSTVK.K-------------------LKIH----FFI-S---------G-VHGS-
P73108_SYNY3/3-107---------------SAILVVLVNTYKELQ.S-------------------QNRT----LLL-S---------G-VSPE-
RSBRC_BACSU/163-272---------------TMVAHQLFSLIEALR.L-------------------IGVS----STL-S---------G-IRPE-
Q40008_HORVU/530-648---------------TSGIHALEELLKALE.K-------------------RKIQ----LIL-A---------N-PGPA-

PF13466

Q310Z9_DESAG/492-572---------------LTLVQLLCAAAAQAK-E------------------.RGGR----LES.E---------G.LPSAG
B5HV30_9ACTN/31-112---------------LGAVDLLARLQLAAR-R------------------.AGGR----IRL.R---------D.PDPA.
A9BX84_DELAS/2-83---------------SAALAVLLACRRTAK-A------------------.ADKQ----LVV.V---------G.LPQG.
Q0K681_CUPNH/47-125---------------SSAVAVLLAWNRAAA-A------------------.RNQA----LSL.R---------G.VPPQ.
B5H529_STRPR/9-95---------------LAAVDALARLHLTAR-R------------------.HGSR----LRL.R---------N.AGPD.
Q0RDC2_FRAAA/24-104---------------HAALGVLLGGARRAR-A------------------.AGRS----MVL.V---------D.VPSA.
D1AD83_THECD/187-267---------------VGALAMLARAA.DAR-P------------------.RGGP----LVL.D---------R.MPAP.
D2SCD5_GEOOG/29-109---------------AEGLRVLAAGEALAD-S------------------.RGCT----LQL.V---------G.PAPF.
A1VK31_POLNA/2-82---------------SSALAILLECRRQAM-A------------------.AGKV----FSV.Q---------G.APGR.
A8ZVX1_DESOH/4-85---------------VSFFQVICSAARSFA-Q------------------.RDKH----LAL.D---------A.PPPAA
Q3SFW3_THIDA/281-359---------------YGSVSQFISVLMQCL-G------------------.SGKS----ITL.R---------G.HNAL.
B9TGW9_RICCO/228-309---------------SAGLALLLEWLRIAE-V------------------.KQKQ----VAL.T---------G.MPAH.
A1W422_ACISJ/2-83---------------SSALAVLLECRRAAV-F------------------.ENRG----FVV.K---------A.LPPA.
A1U461_MARHV/15-95---------------SVVLSMLLCWQRLAL-S------------------.RHCH----LSF.T---------G.ASER.
Q21UA2_RHOFT/4-85---------------SSALAVLLEFRRAAL-A------------------.QGKR----FST.Q---------G.LPKR.
B1Y2Z1_LEPCP/2-84---------------SSALGLLLSCRRHAQ-T------------------.HGRG----FST.Q---------A.LPQR.
Q8EEQ5_SHEON/14-91---------------TAGLQWLLALKGL..-N------------------.VVQR----VEF.C---------H.HSKA.
D2S5L7_GEOOG/30-110---------------PAGIRGLGTAYRRAL-R------------------.HDRR----LGL.T---------G.APPF.
A7MNS4_CROS8/14-91---------------TAGLALLVHLVALTQ-A------------------.GGRG----VTL.E---------G.MSEN.
B9JTP2_AGRVS/23-100---------------ALCAQVLVSGAKTWE-E------------------.DQKT----FSI.K---------K.ASDA.
B8DPA7_DESVM/571-651---------------LTLVQLLQSAAVTAR-A------------------.RGVD----LAA.T---------GLVSEA.
C6C1P3_DESAD/15-93---------------GGGASLFMMMKAGCR-D------------------.RGSS----LVI.N---------G.LRPE.
E3I167_RHOVT/14-94---------------VSILQVLIAADIAGE-K------------------.LGRT----ITL.L---------RVPEGA.
E3IYM7_FRASU/24-104---------------IPGLAALLRADLLLR-R------------------.VRGS----LEI.R---------S.ATPA.
C1D624_LARHH/5-83---------------SAALALALELSREAG-Q------------------.HGHS----LQH.L---------H.LPVE.
A4YXB4_BRASO/320-399---------------ARFLGLLLMLRKQLD-S------------------.QGCT----ATF.A---------G.VSPQ.
D1C014_XYLCX/37-113---------------SSGVAFLARLATRM.-.------------------..PQK----VRI.L---------R.APPT.
C6WD00_ACTMD/919-1001---------------SSGVALLLEAAEVAA-G------------------.RGRG----VGVVV---------T.EGSA.
E3J1T6_FRASU/56-136---------------VGGLRALVASAGNLH-R------------------.DGRG----LVL.H---------A.VAPW.
C6WQ84_ACTMD/60-139---------------VAGLAALTAAYLRAG-G------------------.RTRL----LVV.A---------G..HRA.
Q2SPQ4_HAHCH/13-91---------------AAALQLLLAVQKRQL-S------------------.HGGG----IDW.L---------E.ASDY.
D2SFP4_GEOOG/531-612---------------SAAVRVVLAMARIAG-E------------------.EGWR----LVV.H---------A.PEGG.
D2B5R7_STRRD/72-150---------------VRGTWLLAQAAHSL.-P------------------.TGKK----VFL.H---------H.APYC.
B8DLB2_DESVM/179-259---------------GAGIAVLAELVRHAR-G------------------.LGRA----VRI.S---------G.VSPN.
D0KYU0_HALNC/26-108---------------TAGVAFLLGWQAEAA-A------------------.QSVT----VRY.T---------H.PPKA.
D5X3Z8_THIK1/566-644---------------FSSAGALLNWAMMQH-D------------------.QGKT----LQF.T---------G.VHRL.
B9J943_AGRRK/10-87---------------ALCIQVIMAAAKTWD-E------------------.DKLS----FTF.S---------K.VSDA.
B1W2W2_STRGG/20-107---------------LTLVEAVARLALVAR-R------------------.SGRT----LRL.R---------R.VPPE.
A1SBD9_SHEAM/6-85---------------TAGLQLLLCLQSHCE-N------------------.SSIP----LNW.K---------G.ITTE.
A0LC67_MAGMM/14-94---------------SSVLGMFLMLRAHAG-E------------------.AEAD----ITL.R---------N.PTNL.
A4YMN9_BRASO/16-97---------------AASSGMLMFLSATAK-S------------------.KNKS----LGV.S---------N.ANQQ.
C7LTF6_DESBD/15-91---------------LSFVQILCSLLK...-D------------------.EDKR----ISF.V---------N.LPTH.
B1LTK1_METRJ/26-107---------------TLGAWVLERTRAEIE-Q------------------.AGSA----LTY.L---------G.ARPE.
Q0RZA3_RHOJR/48-126---------------CAALAVLADAGTRLR-E------------------.QRSR----LTV.A---------A..FGP.
C5BID3_TERTT/281-360---------------NSFIAFLLLMDCRLQ-K------------------.YHSR----LEI.I---------A.VSDA.
Q2SBJ1_HAHCH/18-100---------------SVLISLLLRLVAAAE-A------------------.KGLN----VSV.S---------G.LTGK.
B5HHQ5_STRPR/28-107---------------LACAYGLLRAVTVAP-E------------------.A.AV----ITV.R---------G.ARRG.
Q1QXI2_CHRSD/17-99---------------STALGFLAKVAMAVE-G------------------RLEQP----PTI.V---------A.EHPD.
Q12BT3_POLSJ/427-501---------------STCLGTVHELVG...-.------------------..RGR----VVL.A---------G.VTPV.
C9R4W7_AGGAD/20-98---------------SAGFALLCDFLNERK-Q------------------.L...----..L.Q---------N.PPSQ.
D9T369_MICAI/189-267---------------HR...SLLHLRDHAR-R------------------.HDAV----AVL.R---------T.PSRA.
Q31HM4_THICR/6-86---------------TSGLQALLALIKSAM-A------------------.NQKK----IQW.D---------S.PTDT.
Q31GZ5_THICR/18-93---------------SSCLALLLYFQSLI.-.------------------..DHP----LKV.L---------S.LPDD.
A7H922_ANADF/18-92---------------DLGVAALAHGLAGG.-.------------------..RQR----LLM.R---------G.LRQH.
Q21SV7_RHOFT/514-592---------------FSAAGSILNWVALRE-S------------------.EGCS----VQF.R---------D.VPRL.
A3N1T8_ACTP2/20-99---------------SAGFTLLAELLNYYQ-K------------------.Q.TP----NCL.I---------H.VPEV.
B2FP86_STRMK/2-73---------------SAGLALLAELAARAR-K------------------.AGHP----LVI.T---------G.APAG.
F9ZTS0_ACICS/20-97---------------SATLALLLDWQERAL-Q------------------.RKRP----LVL.T---------G.LGPG.
Q2IMF1_ANADE/97-172---------------DFGLAVLAQALS...-A------------------.RGIR----ASF.R---------G.LGQH.
Q3J3N5_RHOS4/5-82---------------GLALQLLLAAAAKWR-A------------------.EGHQ----FTC.Q---------P.MSPA.
Q3J659_RHOS4/7-80---------------AAAVQVLVSAARTAG-A------------------.TGRR----LVL.A---------Q.DHPA.
Q6DAF4_PECAS/14-89---------------SAGLALLMHVYQQP.-S------------------.SGGE----IAI.V---------G.ASDR.
Q87LF2_VIBPA/15-93---------------SAGMVMLIHLLEHAK-K------------------.QNCH----IML.S---------F.VPAQ.

PF14213

G2J3X0_PSEUL/31-97---------------SSFLEEAFGGLLRKTRL..SF-------------ATVKPR....LHF-I---------S-EEDP-
C5AFW9_BURGB/238-293---------------QGFADEIFRVFKNQHPE....-------------....VS....IAV-L---------N-ANDD-
R6DUG2_9CLOT/21-84---------------TPFLNVSIGKLYEKFSS....-------------KELEER....LRI-V---------N-YPDG-
D8P9E0_9BACT/36-91---------------QGFADEVFRVFTTRHPG....-------------....IV....IHP-E---------H-ASPP-
D9QF83_BRESC/26-91---------------ASFLEEAFGGLVREGLS...V-------------EELRRL....LKV-V---------S-NTDS-
K8GP23_9CYAN/208-263---------------HSFADEIFRVYRVKNPD....-------------....VV....IKT-I---------N-VGEQ-
D7E2C2_NOSA0/17-80---------------SPFVNFAFGQLLKDVPA....-------------ERLNQL....LEF-I---------S-LSDD-
D9SDG1_GALCS/27-91---------------SSFLEEAFGGAVREGFA...P-------------ATVTQT....FTL-I---------S-EDNS-
C4Z656_EUBE2/22-87---------------SSFVQGLFSDIVNQIGL....-------------ANTESR....LTI-K---------A-ATLD-
R5XRA0_9FIRM/285-340---------------QGFADEVFRVFQNKYPD....-------------....IQ....LEV-T---------N-ANET-
R6PJ48_9CLOT/285-340---------------QGFADEIFRVFQNRHPD....-------------....IV....LTV-N---------N-ANEE-
A3QA48_SHELP/32-98---------------RSFLDEAFGGLISRRGF..TK-------------EELDEK....LTI-K---------H-DTVE-
R5ZPG5_9CLOT/24-98---------------SSFLEEAFGGLIRELKE..EK-------------NSIYKKALDIIEI-K---------S-DDEP-
Q73PI2_TREDE/278-333---------------QAFADEVFRVFRNAHPD....-------------....VH....LKP-I---------N-CVPA-
K9ZH15_ANACC/18-81---------------SVFFNLAIGQLLRDMKV....-------------EEFEKL....LIV-N---------G-LNSF-
H8H3V4_DEIGI/24-87---------------SAFLNPAFGKLYLRFDQ....-------------DYIREH....LKA-V---------N-TTPE-
H8XUH7_FLAIG/24-92---------------SSFLDEAFGNLVFDFTL....-------------EKVKNK....IEI-I---------S-TQEP-
A0LXZ9_GRAFK/27-97---------------TSFLEEIFGGLIRENNF..DY-------------TEVINR....LEI-I---------S-NEED-
Q8XHB8_CLOPE/17-78---------------TTFLTCLFTDMINKEGR....-------------ENIISK....INV-K---------N-LSNY-
Q5NEH5_FRATT/276-331---------------QAFADEIFRVYANKHKD....-------------....IK....LEY-V---------N-INSD-
R4K797_CLOPA/19-79---------------TTFFYNLFSDFLYTADR....-------------DKSFQR....IKV-K---------N-LSDI-
A9H234_GLUDA/27-96---------------SSFLEEAFGGLVRKGIA...D-------------KKFLKS....HLI-I---------D-PGKP-
D5BER1_ZUNPS/19-78---------------SAFLNESIGKFVMMFPD....-------------....KE....SNV-K---------F-IYPI-
I4C4U2_DESTA/277-332---------------QAFADEIFRVFSEEYPD....-------------....IT....ILH-M---------N-ANEY-
G0AI14_COLFT/270-325---------------QAFADEVFRVFQNAHPE....-------------....IS....MIP-F---------K-ASAS-
K9ZPS4_ANACC/341-404---------------HSFLSALLATPITRLGM....-------------.LAYKK....IKV-I---------N-ALPE-
H6LER3_ACEWD/283-338---------------QAFCHEIFVVFQNKFPD....-------------....IQ....IKA-I---------N-ANEN-
E6N6U4_9ARCH/18-73---------------GAFAHQYI..LRKRASR....-------------....KK....VIE-Q---------N-MPEA-
F8I7N0_SULAT/28-91---------------SAFADECFGKLWDSFDH....-------------QVIRRT....IVL-T---------G-LSGN-
F5YCP5_TREAZ/25-79---------------PSWLDEFITGIKTEFNN....-------------.....E....LKY-I---------N-TENP-
A5G5Z8_GEOUR/270-325---------------QAFADEIFRVFRLANPH....-------------....VH....LIP-V---------N-ANES-
H6RW13_BLASD/80-135---------------QGFVDEVFRVWPSQNPR....-------------....TT....VVP-L---------G-MAGP-
L0D9F9_SINAD/118-173---------------QGFADEAFRVWEKEHLD....-------------....SI....ITY-T---------N-ANPE-
D8IQ15_HERSS/25-89---------------SSFLEEAFGGLIRLGYQ....-------------RDFLKS....HLY-F---------T-TSKP-
Q82UU3_NITEU/25-95---------------SSFLEEAFGGLVRSGKF.AST-------------RDLSER....FEF-V---------S-TDKS-
B5EI93_GEOBB/335-400---------------SSFADEVLGKIFMEIGQ....-------------TNFNRR....FGL-K---------N-MNKT-
L0DGU6_SINAD/19-82---------------SSFLNSAVSCLFANFSV....-------------DALSQR....LNW-T---------G-LDST-
W6RWL6_9CLOT/19-83---------------TAFLNNAIGKLYKNYGK....-------------EKLNNR....LKI-K---------N-ITDK-
B4U9L3_HYDS0/40-103---------------QGFGDEIVGVFVRKNGV....-------------DFIKQN....IKL-I---------N-AKDF-
K9TRC5_9CYAN/18-81---------------SPFFNFAIGQLLRDIQP....-------------NELNCL....LKV-S---------N-LNLV-
K4IKE5_PSYTT/20-83---------------TAFLNAAIGQLYSKFTT....-------------VEIKPY....LHL-I---------H-VADD-
K4L2N6_9FIRM/328-393---------------SSFADELFGKLAVKFGI....-------------LDFSRF....VKL-I---------Q-VNPL-
K9UH85_9CYAN/18-81---------------SAFFNVAIGQLLQDIPS....-------------DTLNEK....LII-E---------N-LSPH-
B4SE54_PELPB/33-96---------------PLFMNVAIGQLYSMFSE....-------------GEIRAQ....LEV-S---------G-LASD-
B7XKG1_ENTBH/25-91---------------SSFLEEAFGGLIRKEKF..SK-------------ELLHKK....LRL-Y---------Y-KEDP-
E6U4T1_ETHHY/18-81---------------TMFFNASIGNFVMKLSP....-------------DECAEK....IRL-T---------N-ISDL-
A6L6I8_BACV8/31-97---------------PSFFEELFRNVVTKHGR....-------------DEFMNK....YKF-R---------S-LGTY-
K9RV87_SYNP3/278-333---------------QAFADEVFRVFKKQHPE....-------------....IE....IVD-L---------N-ANEE-
E3H2Y7_ROTDC/336-394---------------SSFADEIIKAEILYH......-------------....RK....IFF-M---------N-QNDD-
C7MM94_CRYCD/17-81---------------NSFADEVFGRMAFEMGM....-------------EAMRKK....TSF-K---------G-INPF-
B1ZYW4_OPITP/20-83---------------SSFMNALVAGLVEQHGE....-------------.AALAR....FVF-K---------G-CNPM-
F3ZTR7_9BACE/27-97---------------TSFLEESFGGLIRNDGI..KY-------------NEIIDR....LEI-I---------S-NEEE-
Q5E361_VIBF1/32-98---------------RSFLDEAFGGLISREHF..TK-------------AELDKK....LTV-K---------H-DDVE-
W0PBU4_9BURK/27-91---------------SSFLEEAFGGLMRHGVS...Y-------------ETIVDK....LHI-K---------S-SVET-
Q7NLA4_GLOVI/5-68---------------SPFFNYAVGQLLGSIKP....-------------EALDRL....LIV-Q---------N-LGAA-
A7I365_CAMHC/26-89---------------SSFLSEAFGNIAVKYGK....-------------DKFLEI....VHF-V---------D-GEKN-
Q7VJH0_HELHP/18-83---------------SHFLNVAIGKLYFEFPET.SW-------------DSLDKD....IVY-R---------G-LSED-
D1B345_SULD5/22-85---------------TAFLNNAIGKLYGEFDE....-------------NKIKES....LSV-Q---------D-LSDS-
R6I2W7_9FIRM/273-328---------------QGFAHQVFVVFHNEHPG....-------------....IT....IVP-I---------N-MNEN-
A1BGI6_CHLPD/273-328---------------QAFADEIFRVFASNHPE....-------------....VK....LIT-A---------H-ATDA-
K9VZ93_9CYAN/30-93---------------SPFFNFAIGQLLRDIEP....-------------ETLNRL....LKF-S---------N-LNTV-
Q97FP7_CLOAB/19-80---------------TTFFYNLFSELLYSNNR....-------------NYILDH....IKV-K---------N-LANM-
A1SAB7_SHEAM/362-425---------------HSFLSALLASPIKSIGM....-------------.FAYKQ....LKI-V---------N-SNQE-
E3HBI7_ILYPC/11-75---------------YGFLEESIGKLLDSYTF....-------------EALQFK....ITF-K---------N-VDVG-
V5SDX9_9RHIZ/278-333---------------QAFADEIFRVFASQHPE....-------------....IR....IIT-L---------R-TNPD-
A4XX40_PSEMY/363-426---------------HSFLSALIASPTKRLGM....-------------.TTYKI....IKI-T---------N-ATAE-
S6ABL2_9PROT/28-89---------------QSFIDELVGVLILRHGP....-------------.DILGR....LIF-K---------S-CSED-
K9V072_9CYAN/33-96---------------SAFLAEAFFRLYANYPE....-------------ELVDTS....LSI-A---------D-VNSD-
I3Z1N7_BELBD/17-80---------------SSFLNSSFGALIEEIGL....-------------QEFLSL....VKP-R---------E-LTPT-
R6H1A0_9FIRM/21-84---------------SPFLNNAIGQLYGSYTG....-------------EYISKH....LHL-E---------N-FPPT-
M4VBB1_9DELT/264-319---------------QAFVDEVFRVFKERFPH....-------------....IE....IDV-T---------N-TNED-
Q8TKH8_METAC/27-90---------------PAFLNSAVGQLYGTFPA....-------------ELIEKN....LSF-A---------D-LDPE-
I0K8N5_9BACT/19-82---------------TQFLNASIGKLYRTFEE....-------------ADINAH....MTI-T---------G-IDSQ-
W6RYG0_9CLOT/18-79---------------STFFFTLFSDLIYNKGR....-------------NFIIDK....IKI-T---------N-LKNP-
H2J416_MARPK/19-82---------------HSFLDQAVGTLFSEYGP....-------------.IVFKR....IKF-K---------N-AQNS-
Q3JEZ3_NITOC/23-86---------------SLFLNVAIGQLYGSFGE....-------------ETIRAQ....LKV-E---------G-LSSD-
D4M3H3_9FIRM/23-78---------------RGFADEVFRVFQEEHPE....-------------....IK....ITP-L---------H-ASTS-
R6G1E0_9CLOT/19-80---------------TTFLNCLLSDLIEKCGR....-------------KYISKQ....VDV-K---------N-LSNT-

PF11964

L0GYF4_9GAMM/12-118.......LIGDK...DW.EAWM.GQLAKPF.T...R.............A....T----VRH-F..DAA....E-ADAA-
W8EVU9_9BACT/23-129.......LSDQHWLEQHYLPQLVRLPLQYMALILTSHRQHEDLLDVTAHFPPPFE----VQV-F....D....D-LTTA-
D5V1Z3_ARCNC/21-125.......IITGK...SW.IKIG.SKITSWF.I...Q.............G....E----VKN-F....E....N-ELEA-
Q11VP6_CYTH3/12-119.......IVSDE...KG.VKTF.TDVFSVL.V...P.............G....E----FKV-F..EHK....D-QQKA-
A5FC98_FLAJ1/11-118.......IVTDS...ED.IISF.TNGFSYV.V...P.............G....E----FHG-F..KKE....A-FNKA-
Q28QM9_JANSC/19-126.......VIGAP...DR.AAKM.IEFMDKIIP.................V....E----AKA-F..DAN....Q-KDAA-
Q093V8_STIAD/17-124.......FFGAS...FT.MRTIFNMLGRAQLL.................M....G----RKT-A..STA.FTDT-EQEA-
E0TIJ6_PARBH/12-118.......IVGNA...RW.EEAV.TKAAEPF.A...E.............A....E----LRN-F..DAE....E-QGTA-
Q3SKE6_THIDA/10-113.......ILTGD...EW.VAWS.MWVNRMF.M...S.............A....D----IRL-F....D....E-LEAA-
Q3ID73_PSEHT/20-125.......VYGNK...EW.QATL.AKVAGWF.V...A.............G....K----VAY-F....E....N-ATTA-
B2HRZ3_MYCMM/12-119.......VVTDI...EW.IKQT.VKFVGFL.M...P.............G....E----LRT-F..TPT....Q-AEEA-
J7Q7E4_METSZ/12-118.......LVTDA...EW.IKHT.MQFFSFM.M...P.............G....E----MKA-F..STA....Q-ADQA-
E8X7D9_GRATM/13-120.......VVSDN...RW.EEVAEMIVVATAVL...Q.............A....E----TLY-F..HSS....E-MIQA-
Q3J4W4_RHOS4/41-148.......VVEPP...KI.AALM.IETSDW.FM...P.............V....Q----ART-F..PLT....Q-RDAA-
F0SJ20_RUBBR/12-119.......VVADQ...GW.IHSL.SKLINPM.F...K.............M....E----IKA-F..NLA....E-IDQA-
D5SV07_PLAL2/13-118.......IVGES...KW.EEGM.AAFCKPF.T...G.............A....S----IKY-F..DIS....K-LEEA-
A4XX57_PSEMY/12-120.......VVADQ...QW.LRTA.SEVEGALIP...G.............L....T----IKA-F..DSI....H-EAQA-
A0LIB8_SYNFM/14-120.......IVGDE...RW.KDQI.FAFVGKGLR...D.............T....E----VEF-F..PLS....S-EGEA-
I4C386_DESTA/12-119.......AVGGP...KW.LEQW.MKFKSYF.V...R.............A....Q----IKT-F..PVE....S-LEEA-
I4AGM8_FLELS/70-181ESAKLAILRTDAPMHKVGIDYVVSYLQQVLPY......................D----CRF-Y....V....N-KENA-
M4SAG0_9SPHN/140-247.......IVGGP...DW.LATL.VKLFDP.LF...R.............I....E----LRH-F..PLD....S-EDAA-
F0SJC2_RUBBR/13-118.......IVGES...RW.EKGM.ASFCRPF.T...T.............A....N----VKY-F..EKE....Q-LDEA-
M9R3U0_9RHOB/11-120.......VLTDI...GW.LQTA.ARIEGALIP...G.............L....E----IKC-F..DMA....D-EAKA-
A9WJT9_CHLAA/12-112.......FIVSE............................HHLLIFAPLVRFVSG----IGL-F....A....T-EQEA-
W8EZJ6_9BACT/24-132.......WINAM...DWPSRHSVASTLPHVQG.................L....E----VWI-F..DFD....E-QDAA-
Q8EB52_SHEON/21-126.......VVGKT...TF.QEVM.AKLANGL.T...P.............A....K----VKF-F....V....D-KLDA-
L0K3H2_9EURY/13-119.......VVGDD...SV.LEWG.TELSDR.VT...E.............T....D----IEF-F..DAE....D-LDDA-
B1MER2_MYCA9/12-121.......VVTDK...EW.VAHT.LHALAWM.V...P.............G....E----ISL-F..GLD....E-LDRA-
F9ZWL7_METMM/13-118.......MVGDR...QW.QHGM.AIFCKPF.T...N.............A....M----VRY-F..DHA....D-ADEA-
X5E4J9_9BACT/13-117.......FIGGSAANRMIAKVMLKTGALKI........................K----GDF-F....K....T-VDEG-
E4TNT7_MARTH/14-124.......LWLSQ...HWKLMENYCLGTAYVIP...SAAIRAVLKMIFSFQNQPVP----YKI-F....S....N-SEEA-
Q8TPB5_METAC/12-119.......VVSDV...DW.IIDA.VKVFKFA.I...P.............C....P----VKT-F..RNK....E-FAEA-
A3QHM0_SHELP/21-124.......IIGQG...EL.QEWA.TRVANWF.T...P.............G....E----FKF-F....E....D-KRDA-
B0JM20_MICAN/12-118.......VVTDS...TL.VKLI.ESLASHF.V...A.............A....E----VRQ-F..PWG....E-TEVA-
Q7UVW9_RHOBA/74-179.......IVGDR...RW.EHGM.SLFCRRF.R...T.............V....G----LEY-F..EPD....E-LNVA-
A4FCH9_SACEN/137-244.......LAADS...KL.AELV.PHLAKHF.V...Q.............A....E----VNR-F..GYD....D-LDEA-
A0LXE0_GRAFK/12-118.......ILTDK...SW.LEAL.LPIGNAFTP...N.............L....P----IKS-F..KLN....E-RAEA-
E1RHG3_METP4/12-115.......IVGET...KA.EELL.VKADGLLF.......................G----EKY-F..DIS....A-IDEA-
G2J2P9_PSEUL/12-113.......IVVED...VW.IKLA.AHIAGLM.S...H.............T....K----VQY-F....D....T-AEAA-
A5G4W5_GEOUR/116-227.......IVGDP...KW.ETRM.LMFTGAGFR...R.............A....P----VKY-F..AEN....R-LAEA-
A3CYB3_METMJ/12-120.......VVGGE...RW.REWM.NHLPGLF.VGFDG.............V....D----VRY-F..PET....R-LRDA-
Q5V739_HALMA/20-132.......AVGDT...RW.................AKLLFDWWYAIRPIWPVAPNE----MRY-F..DIK....K-RERA-
I4C4Z7_DESTA/12-119.......VVGGA...KW.IEWA.TKIASHF.M...K.............G....E----VRT-F..SEA....Q-LKEA-
M4NFH5_9GAMM/12-119.......LVTDV...VW.LRGT.AMAFSFA.I...P.............A....Q----FRL-F..HGA....D-IEEA-
A1S706_SHEAM/12-119.......ILTNR...PA.FRRM.GELIGLF.M...P.............C....P----VCV-F..SLD....E-VQIA-
M4V983_9DELT/11-119.......LLTEK...SW.MSAM.SKISSALIP...R.............V....Q----IKT-F..DRA....S-KDEA-
D4ZLE1_SHEVD/12-119.......IITDS...DW.ITGM.AKAMAYM.I...P.............C....P----VRV-F..DKS....S-SHLA-
B2HE07_MYCMM/27-133.......VVTDS...HL.GDVA.EHLTSHF.V...S.............A....E----VRH-F..PAG....Q-VEQA-
J7L4H1_NOCAA/12-117.......VVGDD...RI.IRFL.TTLADAFVD.................M....D----LRF-F..ELD....Q-EDAA-
F2LY86_HIPMA/12-118.......VVSDV...EW.IING.VKAFSFI.I...P.............A....K----VKV-F..SNN....E-IGNA-
F0SJ19_RUBBR/12-119.......SVTDV...SG.VESM.VKLLNPM.F...K.............A....E----MKH-F..KSA....E-LEAA-
Q3JB38_NITOC/148-256.......IVGAP...GW.MRKI.IKSINPAFT...D.............M....D----MRT-F..SKD....K-EQDA-
W8EXL7_9BACT/35-135.......IVVSEDVFTRLATAYVTTSVQGLPL......................V----YRT-F....T....E-EAAA-
H8MXZ5_CORCM/21-129.......FFGAK...RT.HREVLRALVAVVNF.................T....S----GTR-V..EAE.FVDS-EARA-
E1RH74_METP4/11-116.......VVFDE...KW.DEFMSWLFKSYAFISHIY...................----MKF-F..KED....R-IDEA-
K9XV53_STAC7/12-117.......IVGEQ...TW.LQAW.TNLVKPFIP.................C....E----VKY-F..KSN....E-LEEA-
A5FDC3_FLAJ1/11-118.......VVTEC...EK.AISF.TNSFRYI.V...S.............G....E----FRC-Y..KKE....S-FQEA-
G8RQ72_MYCRN/12-121.......VVADK...EW.VRHT.VHAVGWM.M...P.............Y....E----LEV-F..GLD....D-LERA-
Q07X46_SHEFN/12-116.......FVGGP...DW.VGNSVRLMGPFMQG......................E----VAW-F..PLE....R-KQEA-
A9GPE4_SORC5/20-127.......VFGAS...FS.VRVVTTLASRSVQF.................F....T----GEV-Y..PMA.FFDT-EDEA-
G2KMS5_MICAA/17-122.......IVNLP...........EKMVQYVGMRQ...............AALKTD----LRI-F..NTD....Q-FQDA-
Q6MQZ1_BDEBA/34-138.......IVTDI...HW.VKNVSNFFDPIVGT......................D----IEV-F..TRK....E-LDQA-
E3FV03_STIAD/12-119.......ELVESQIVALQLNRLARESGTDK........................I----LRR-F....W....E-EASA-
D2QV97_SPILD/12-116.......LVGTA...GT.LALI.TPVMQTI.F...R.............A....E----RRS-F..SPD....K-KPLA-
Q7NXU0_CHRVO/12-113.......IVVGD...VW.IRLA.THIAGLL.S...H.............T....H----VQY-F....D....M-IEEA-
D5ER41_CORAD/12-118.......CVTDV...DW.IFNT.TKAFGFL.S...A.............G....H----MRV-F..RNA....E-LEAA-
A1SV34_PSYIN/12-119.......AVTDI...GI.LSIL.PKIVKHF.V...S.............A....E----VRH-F..SYK....E-RELA-
B3QUM5_CHLT3/13-124.......FVTHNNPSKVVIKLLSIMCEA.....................YHLGFH----AQI-F....E....E-QAAA-
G0J0D1_CYCMS/13-117.......FEGNK...KW.QEWA.AKAMDLF.T...D.............S....E----VKF-F..DLQ....E-KQKA-
A0M0N9_GRAFK/12-117.......MVGNK...KW.QDWI.TKFMKPF.T...N.............A....E----VKY-F..DLE....E-KEIA-
Q1CW14_MYXXD/23-128.......YVGAD...IV.MQTFVKAIALALLF.................T....G----KST-F..ETV.FVKT-QDEA-
Q6AK92_DESPS/134-240.......IVGNK...KW.QKLA.ERIFSKF.I...S.............A....E----VQY-F..EET....R-ADSA-
V5WKN4_9SPIO/39-142.......LAGVK.....................................MVTGRK----IQA-F....E....S-EEDA-
A6Q9H2_SULNB/14-120.......FVTDT...SV.IEFS.KMIAAPF.V...D.............A....E----IKV-F..DYD....D-FEEA-
F8GCM7_NITSI/10-113.......IVTDD...EW.QAWG.AWVSNLF.T...N.............A....N----VVV-F....H....N-YEEA-
C4ZLU4_THASP/10-113.......VLTED...QW.LTWS.AWVSQLF.V...T.............A....E----VKV-F....D....D-EDEA-
Q6AK92_DESPS/12-119.......IVSDV...PW.VKTL.LRAMAFT.L...P.............C....P----VKI-F..ELD....E-YLQA-
F0M0B1_VIBFN/20-125.......LYGKP...GW.QELA.AKIGSWF.I...S.............G....D----IRF-F....E....D-EAQA-
A6WZX1_OCHA4/19-126.......IVGGP...LW.IQAS.ITLMQP.FL...S.............I....E----LRA-F..EAD....E-ENEA-
E3FKU0_STIAD/13-119.......VVSTA...ASGLQAWRMTKQAMLNI......................P----ART-F....E....T-RDEA-
Q0AQY4_MARMM/16-124.......IVCNDELSHAMLAFWEATAGQRLTT......................E----ERV-F....E....T-ERDA-
Q6LKJ4_PHOPR/20-124.......LYGNQ...HW.QEVM.SKIGSWF.V...S.............G....E----VRY-F....D....D-PLEA-
D5BJF0_ZUNPS/25-118.......VVDSTSMARRYFAAQGTTLMSAIAIYAGSPVAISHAEFYMRTLMHKIP----TAF-F....T....Q-KYQA-
C7P248_HALMD/57-169.......AVGDS...VW.................ARGLFDCWRAIAPVWPVSPDE----MRY-F..GPG....E-REAA-
A1S9K0_SHEAM/21-126.......VFGRP...GW.QEWM.TKLADWF.T...P.............A....D----ARF-F....V....D-RQDA-
D3FPZ4_BACPE/12-117.......IVSDG...NL.TEYI.SKLADKMTE.................M....D----MRH-F..AKD....E-EKIA-
Q087X8_SHEFN/21-125.......ILGNK...DW.QEWA.AKIGSWF.I...A.............G....E----IKY-F....E....D-EDDA-
C0QCX2_DESAH/11-120.......VLTDE...AW.LKMA.SEIEGALYP...G.............L....E----IKA-F..ARD....Q-KKAA-
Q1LPD1_CUPMC/12-120.......VVTDH...DW.VRHS.INVFRFL.V...P.............G....Q----IRT-F..PMS....Q-SREA-
A3HTM6_9BACT/12-125.......IVAHS...KI.LKAL.VPIDNLFFE...R.............ASKGRE----ERY-F..DIS....K-LDDA-
F7XLD9_METZD/12-119.......VVSDK...DW.LLNT.VEIFKFV.I...P.............A....S----VKT-F..SNE....E-LADA-
B1WXR6_CYAA5/19-124.......VVADA...KW.MRTF.AEAVGSI.L...S.............A....E----VKA-F..ETS....E-IETA-
D0J5L7_COMT2/12-119.......LVTDS...HL.AGMA.EFVGRHI.T...H.............A....E----VRH-F..PFT....E-DAMA-
H6L5W1_SAPGL/20-121.......VIMGN...GL.SKIIGNLFLK.....................F....S----KPK-I..TTR.IFTD-EEKA-
B7VP41_VIBTL/20-124.......IYGDK...SW.QEFA.SKVGSWF.V...S.............G....E----IKS-F....E....D-HDSA-
K0NMI2_DESTT/11-120.......VLTDK...NW.IKNV.SELEGALIP...G.............L....E----IKA-F..SKE....E-KKDA-
F4CCE8_SPHS2/23-130.......IVSDQ...QW.VRKI.YDILSPL.V...H.............G....E----IRT-Y..RLE....D-RQRA-
G8PHU6_PSEUV/12-120.......IVSDRKIWEW.LVAMDSPFAAMLGI......................G----EKH-F..DMA....N-LDKA-
A0M5Q5_GRAFK/11-116.......IVTDS...NW.FQNA.VNVSDIFLD.................V....D----VRT-Y..DLK....D-RLEA-
A3CYB0_METMJ/12-120.......IVGGE...KW.EEWM.NHLPGLF.TGFTG.............I....D----VRY-F..TEG....H-LDTA-
F4AVZ8_DOKS4/11-116.......IVSNR...SW.IRRV.VRLKDLLMT.................S....D----VKA-Y..SSK....K-RVDA-
I3YWJ5_AEQSU/12-117.......LVTDK...GW.LEKT.MEVFGAIIP...G.............M....K----VKG-F..DLN....E-RQEA-
Q083D4_SHEFN/12-118.......MVGDK...SW.EHWM.ALIAKPFLI...S.............S....E----VRY-F..NRE....N-LQQA-
B0BYZ0_ACAM1/138-242.......LVADA...QW.MRTV.AEAVSAI.F...P.............A....E----IKA-F..ERS....Q-IELA-
E3FWM2_STIAD/2-108.......LFGAS...TT.MRAISALMIRALAL.................L....G----RMP-Q..GTMVFKDT-EEEA-
D5B9R4_ZUNPS/12-117.......LVGEK...KW.RKWA.AQFMKPF.C...N.............A....E----IKY-F..DPD....E-KQEA-
M4SAG0_9SPHN/11-120.......IVTDQ...SW.VRIA.SRIESALLP...Y.............V....S----YEV-Y..PVT....Q-RDRA-
I4AIU7_FLELS/23-135.......VVKSS...TTFQRITAQVLLKSIMA.................INNKFR----IGY-F....E....D-RNTA-
A5GKD8_SYNPW/21-126.......LITEA...RW.LTLL.SSVVGLL.M...P.............G....E----LRH-F....E....D-RASA-
A9GKE1_SORC5/12-119.......ELVQSDLAALQASRIAREAGTAQ........................L----VRV-F....K....D-EAAA-
E1V9S9_HALED/39-147.......TVSDK...HW.IRHLVRIENHVFRS.................M....E----MRT-F..RVR....D-KRAA-
A8LJW8_DINSH/13-117.......VVSDL...TW.FSPFTRLADRLTHL......................Q----IRE-F..KRD....Q-LEEA-
C5BJV0_TERTT/11-120.......VLADQ...TW.LQAM.SHWSADLVP...G.............L....T----IKT-F..KRS....E-KAAA-
S6B665_9PROT/11-113.......VVTDS...QW.ITWS.TWLTSLF.T...P.............A....E----TRV-F....D....D-YNLA-
G0J0C5_CYCMS/12-117.......MVGEK...KW.QDWI.TRFMKPF.T...N.............A....D----IRY-F..DLE....E-KQKA-
Q1CYP8_MYXXD/13-120.......VVSDA...PSGLQAWRMTKRAMLSI......................P----TRT-F....E....T-RGEA-
I0JIE9_HALH3/13-116.......VVTER...AL.IELG.TQAADY.LP...G.............L....K----AQD-Y..KPN....Q-LEEA-
E6U1C5_BACCJ/13-120.......VVVEGAVAKMQLKRTAKQSNHS.........................E----EYH-F....N....S-YDEA-
Q47BJ5_DECAR/11-113.......VVTDS...QW.VTWS.AWISQTF.V...N.............A....D----VEV-F....D....N-ADEA-
K9X8Y1_9CHRO/10-123.......FGYAT...VT.TSTVFALYKPMTKL.................I....G----TKM-MGCPCD.VFVS-VEEA-
Q8ED76_SHEON/12-119.......MIADM...QI.LGAM.VNTLAFM.L...P.............C....P----VKV-F..GEN....E-RQLA-
A1T9B4_MYCVP/12-121.......VVADK...DW.IRHA.MHALGWM.V...P.............G....E----LKL-F..GIA....E-LDEA-
J1L360_9EURY/12-120.......IVGGE...EW.ETRL.LSVQPAF.FLFSS.............T....D----VRF-F..RPE....H-RQEA-
A3QIC9_SHELP/12-116.......LVGGP...DW.FGNAVRLMGPFMQG......................E----VAW-Y..ALE....D-KPQA-
G2J2S0_PSEUL/12-117.......VVGDE...TW.QEWM.VKLVRPF.T...L.............A....S----LRY-F..PSE....E-TPAA-
D5CNM7_SIDLE/10-114.......VVTDN...QW.LTWQ.AWLSRLF.V...D.............A....D----IRV-F....N....D-YSEA-
Q093V7_STIAD/21-127.......FFGAS...FT.MKTVSNMILRANSI.................L....G----RST-G..TQAVFMDT-EEEA-
W8S663_9RHOB/15-124.......VLTDE...TW.VRAI.AAVESALIP...N.............L....V----IRA-F..APD....Q-EERA-
A9GPD9_SORC5/60-166.......VFGAS...FA.VRVVSTLAAKSVQI.................L....T----RQS-Y..PVE.FFET-EGEA-
Q11I87_CHESB/20-127.......VVGGP...TW.VQAM.MGIVKPFLS.................V....E----MKH-F..ELE....Q-AEAA-
C1DA99_LARHH/12-113.......VVVKD...GW.MKLA.THIADLL.A...N.............T....E----TAH-F....E....D-GDAA-
B3QXG2_CHLT3/14-123.......LLQPDSAKSRKAAHFYETAS......................LNRGWN----VKI-F....K....N-QDDA-
H2FUI0_OCESG/21-126.......IVGCN...LK.EKIM.ATLVDWFML...G.............S....Q----VQY-F....E....S-RSEA-
E1QK88_DESB2/12-119.......LVGRP...EW.ASSF.ADYLGLA.T...N.............V....K----FKY-F..QHG....L-LPQA-
W8S5M5_9RHOB/17-125.......VANAP...GD.AGSI.VETVGK.AL...P.............V....E----AKS-F..DTE....E-..AA-
I4EWX0_9ACTN/5-112.......VVSDE...DW.LRPA.LRVLSVL.V...P.............G....Q----LRG-Y..PVA....Q-LPRA-
V5XBD7_MYCNE/12-121.......VVSDK...DW.VRHT.MHAIGWM.V...P.............G....E----LAV-F..GGN....E-LDRA-
D5B9R0_ZUNPS/6-111.......FVGNK...KW.QELA.AKATDFF.I...K.............S....E----VKF-F..DIS....E-KQQA-
F5XYL0_RAMTT/15-117.......VVPED.....KITRTSEKVAQSLGM......................T----LRV-F....T....R-LDQA-
Q1ZBL2_9GAMM/21-125.......IYGNK...NW.QEIA.AKVGSWF.L...S.............G....E----VKY-F....E....N-LTNA-
A3QF38_SHELP/12-119.......IITDS...EW.VANT.AKVMAYM.A...P.............C....P----VKV-F..ARQ....A-ADEA-
Q3JB38_NITOC/16-125.......FVSDK...EW.PQAL.IDFIGPVLP...T.............L....E----MKV-F..TPE....Q-SDEA-
D6XVY9_BACIE/11-115.......VVSDK...KS.VEIV.TRLSSVLPK.................L....E----MKH-F..TLS....K-VTDA-
Q2YCI1_NITMU/10-113.......IITEN...QW.RAWA.AWVSNLF.V...D.............A....D----IRV-F....R....D-YAAA-
C6Y0C1_PEDHD/12-119.......IVTDQ...QA.VEKF.TDIFSYI.S...P.............G....E----AKG-Y..KLS....E-LPIA-
B1LYM2_METRJ/12-117.......LVTDA...PW.LKAL.AETFNFV.S...P.............T....Q----IKV-F..ERA....R-IDEA-
Q7MEX7_VIBVY/25-130.......VYGDK...NW.QELA.AKVGSWF.I...S.............G....E----MKS-F....S....D-YDSA-
Q12ZF4_METBU/12-119.......VVSDV...EW.MNHA.MELFKYM.I...P.............G....Q----VKT-Y..NNE....E-LSEA-
L0G526_ECHVK/12-117.......MVGEK...KW.QDWI.TQFMKPF.T...N.............A....E----IRY-F..DRN....E-KESA-
F4C7J2_SPHS2/12-119.......IVTDE...EN.VRTF.TDMASYI.M...P.............G....I----AKG-F..SHA....E-VGAA-
B0BYZ0_ACAM1/12-117.......VVAEA...EW.VRTI.AAASDNL.L...S.............A....Q----VKA-F..APS....Q-LEAA-
A6Q671_SULNB/23-127.......IVGNK...KW.EEQS.TAMMSHM.M...K.............G....K----SKF-F....L....K-RGEA-
A0LXE0_GRAFK/144-249.......ILTDE...KW.VANI.AELEGKIFK...K.............I....A----VKA-F..PLD....Q-EHRA-
W8EUS5_9BACT/21-126.......WVCPA...HWPARKS.MEMAMWFVT...Q.............P....T----VLL-F....D....D-VAAA-
H6L5S2_SAPGL/58-159.......LVISN...SL.SRLLGNLLLT.....................LVTGQV----IKL-F....A....T-EEKA-
G8R3P5_OWEHD/12-122.......LVTDK...DW.LRFL.ATAEYKLIP...A.............I....D----EKS-F..EFS....D-KEEA-
W0RC97_9BACT/11-121.......VVASR..VQLGIARMFQTLNDHPQV......................T----VEI-F....H....E-LGDA-
C6C2B1_DESAD/11-117.......VVSDI...KW.HEPL.IKVGDKLFP...S.............I....E----VRH-Y..NQD....Q-RAEA-
H6L5W0_SAPGL/30-131.......LLVGS...GI.SRILGNFLVG.....................F....N----KPP-I..PTR.LFSN-KEKA-
D9QNG3_BRESC/27-134.......VVGAP...AW.AEAA.ITLGGWLSP.................V....E----SQT-F..DAA....E-EIQA-
G2KMS4_MICAA/16-122.......YVSPPDQRILLMKMMRPIIKA..........................E----TRY-F..NLE....D-LDDA-
H6L0F3_SAPGL/30-131.......LLTPN...QL.SKMLGNFIIGL....................RKQARP----IKV-F....T....N-EVAA-
A0LXC2_GRAFK/12-117.......MVGDS...EW.QDWM.TQLMKPF.T...N.............A....D----IKF-F..EIE....E-KERA-
Q2RZR2_SALRD/34-139.......IVSDD...PW.ERWL.EKTE.ALFP...M.............S....T----IQT-Y..DAA....D-QEEA-
G2KMS2_MICAA/25-131.......YINPT...ERAVMKSRLILPPKILG......................V----MRV-Y..AAG....E-LEEA-
G0L8K0_ZOBGA/13-125.......VVANS...NI.LKAL.VSLDALFFE...R.............LRKGYE----ERY-F..DIS....Q-LDEA-
Q82UI4_NITEU/10-112.......VVTDS...QW.QVWS.AWVSNLF.T...D.............A....D----VVV-F....S....D-YDEA-
I1YHY0_METFJ/11-119.......VLTDK...QW.IKTV.SELEGALFP...G.............L....T----IKA-F..ERH....Q-QDQA-
C6X1D7_FLAB3/12-118.......IVTDK...NA.VKKF.TDAFSVV.M...P.............G....E----FRG-F..GKE....D-LASA-
I4ANF2_FLELS/25-134.......IVTSK...SIFNQVTVKQIVDKM...................DKEKYK----VQF-F....T....N-LQDA-
V5WM94_9SPIO/3-107.......VASLK.....................................MFSKRE----IQE-F....D....N-ETSA-
X2HCK2_9NEIS/13-113.......IVVDD...IW.IRIG.IRLANLL.T...L.............Q....R----LRY-F....S....D-TATA-
S6ATB1_PSERE/11-120.......VVADK...GW.VRKA.SELEGALIP...G.............L....E----IKA-F..GSA....Q-SAEA-
E6WYT5_NITSE/23-127.......IVGDK...KW.EELS.IELFKHF.S...K.............G....E----IRF-F....S....D-YNEA-
D5BJR6_ZUNPS/18-118.......LLVED...ELAMKVARLYVKA.....................SEPPYP----TQI-F....T....D-KDEA-
C7RNF8_ACCPU/11-113.......VLTHS...QW.VAWS.AWLSQIF.V...R.............A....E----MRI-F....D....D-EVEA-
A8ZX31_DESOH/24-127...............LFGMHPVSMVIASFVMG.................VSRNND----MKF-F....K....T-REDA-
H0PYZ6_9RHOO/10-113.......VLTED...QW.MTWS.AWVSQLF.V...D.............A....E----VLV-F....H....D-EAEA-
F0JGN8_DESDE/12-119.......VVGGP...DW.VRWG.VRLGELL.M...D.............C....E----VKL-Y..PPE....K-LDQA-
A9GPD8_SORC5/37-144.......VFGAS...FS.IRVIGTLVFKSMNL.................L....A----QRS-H..AIA.FFDT-EGEA-
G2KMS3_MICAA/30-137.......YINPS...KRTLAKAHMLLPADLKN......................N----MRM-F..EAG....Q-IAEA-
Q31FZ2_THICR/21-125.......IIGHK...KW.QDFI.AKVGSWF.I...S.............G....N----IKR-F....E....S-EEEA-
A9GPE2_SORC5/23-130.......VFGAS...FS.IRVMATLIVKSINL.................L....T----KRL-P..VLV.FFET-EAEA-
X5E3H4_9BACT/12-117.......VVGKS...RW.DKLW.SELAAPF.I...S.............G....E----VKY-Y..EFT....D-IDEA-
M1NQM0_9CORY/12-118.......VVAGA...AW.LQKW.TELAGGL.I...P.............G....E----VET-F..DAG....Q-RDEA-
A0M0L9_GRAFK/12-115.......LVGNT...KW.QEQF.TEVLIPF.T...R.............A....H----IKC-F..SPE....E-KDLA-
A6Q807_SULNB/11-120.......ILTNK...TW.LQKI.AQFEGFLVP...G.............L....E----IKA-F..DLD....E-IVEA-
C6BYE1_DESAD/13-119.......VVGGP...SW.VEWG.TKVAGAM.V...S.............G....E----VKT-Y..PAE....E-LETA-
Q73Z58_MYCPA/13-121.......VVSDK...EW.VAHT.LHALAWM.V...P.............G....E----LAV-F..GLG....E-LERA-
K9RD27_9CYAN/12-117.......IVIDT...KL.IESL.ENMKDLLVA...G.............V....K----VKC-F..PFE....D-RCQA-
D9SJ90_GALCS/11-114.......VITDD...QW.LTWN.AWLSRLF.V...D.............A....D----IRV-F....T....N-YEEA-
W6RYK2_9CLOT/10-116.......LVVDGLISKMKAQVYLRKIKEK.........................E----IKV-F....T....D-FKDA-
H8N2H1_CORCM/12-120.......VVSDP...GSGLQAWRMTKNAGLTI......................P----AKT-F....E....T-RSEA-
I0KHL1_9BACT/11-115.......LVGTP...DN.IALI.TPVMQTI.F...R.............A....E----LRS-F..SPD....Q-KEAA-
A6VRW9_MARMS/21-125.......IYGKS...PW.QNRL.IRVISWF.I...S.............A....D----IKV-F....K....R-KKEA-
A4FCH9_SACEN/14-119.......VVTDI...GW.IREL.SRLGSFL.V...S.............C....P----TRV-F..GND....E-LGEA-
Q6LS91_PHOPR/11-120.......VLAEQ...QW.IRKI.SELEGMLFP...G.............L....D----IKG-F..PPN....D-TENA-
G8QLC0_DECSP/10-113.......VITES...QW.VTWS.AWLSRAF.V...D.............A....S----IRV-F....S....D-EAEA-
M4S571_9SPHN/11-120.......VITDK...EW.IRMA.IRLLDPVIP...F.............M....A----IKT-F..EPG....E-AEAA-
A9B5K6_HERA2/29-133.......LLVDS...TL.SRVIANLIIGL....................TGNSQA----VQV-F....S....D-EQAA-
A4VJY0_PSEU5/11-120.......VIAGK...EW.LRKA.SEVEGALIP...G.............L....T----IKA-F..DLH....Q-EAEA-
I3Z121_BELBD/12-117.......MVGEK...KW.QEWM.AIFMRPF.T...N.............A....E----IKY-F..DSE....E-RDTA-
A9ENE2_SORC5/23-130.......IIGAS...FS.MRVIMALLAKGVHM.................L....T----GQP-Y..PQQ.FFDT-EGEA-
E4TRL3_MARTH/24-128.......VVSKDVFRKFAAKNILDKQKGKL........................N----FQY-F....N....N-LEDA-
A1SAI8_SHEAM/12-116.......FVGGP...DW.VGNAIRLLGPFVAG......................E----IAW-F..PLQ....D-KAKA-
K9SIP1_9CYAN/14-118.......VVTDS...GW.IGPF.ARAISPF.L...N.............I....Q----LKM-F..KME....Q-KQEA-
I5B5J2_9DELT/12-119.......VVTHK...KW.IHKLVDLEGKLFKS.................I....E----MRG-F..SKE....E-KDQA-

PF01740

SUT22_ARATH/540-662VL-HK.........LKRAKLD.EKIK.......TENIYMTVGEA
RSBRD_BACSU/161-267IA-QT.........VVKLGLD.FSN.........VKTEQSLAKA
S26A2_HUMAN/569-715VR-DS.........LTNGEYC.KKEE.......ENLLFYSVYEA
O45016_CAEEL/553-725VR-QN.........FETSQFF.EEVP.......RGRMFVSVSDA
SULP3_CAEEL/546-696LK-KL.........FRATDFY.EVVD.......ESKVFNKVGDA
D6EY97_STRLI/11-115TL-RM.........LRITGLA.RLL..........PPWPTLDEA
O04001_SPOST/529-651GH-GKNTASERGTQAFQVGIA.CIL..........TTGEAVASL
SUT32_ARATH/505-623VM-KK.........LSKSTFI.ESIG.......KERIYLTVAEA
Q55814_SYNY3/440-540VQ-AR.........LQRLPVL.A............QLSPHHRLE
RSBV_BACSU/4-107LI-RL.........FDITGLK.DII..........DISAKSEGG
O69205_ACTPA/8-112VL-RP.........LQLTGMS.ALL..........PTHPTVDLA
P73609_SYNY3/4-107VN-DT.........IEQTGLH.HSF..........HLVESYDFH
SP2AA_LYSSH/4-107MR-KV.........FQFSGLG.PWM...........MDATEEQA
O84431_CHLTR/3-107VE-QT.........LYVTGFL.SYF..........KVFDSVNEA
P71568_MYCTU/15-120GR-AA.........VTRTGVA.RFM..........PVYPTEKAA
S26A1_RAT/529-685VR-DT.........LRKGGFL.GEDQG....TAEELLFPSVHSA
P73607_SYNY3/2-105LI-DT.........MAVTGFL.DFF..........TTRPTLAEG
SP2AA_BACME/4-109IE-RL.........FNMSGLF.KII..........RFEPNEANA
YVDB_BACSU/421-528PK-EL.........LHKTGLF.HKIG.......KQHFFDHHDEI
RSBV_LISMO/4-109LF-RL.........FEITGLS.DII..........EIKNVEGEM
Q46665_ECOLX/332-437PL-RT.........MARAGIQ.PIPG.......RLAFFPNRRAA
S26A4_HUMAN/536-725VI-EK.........LEQCGFF.DDNI......RKDTFFLTVHDA
RSBV_BACLI/4-107LI-RL.........FDITGLK.DII..........DISGKSEGG
O83261_TREPA/17-124VY-EV.........FQLLGFS.QFF..........NIRDSIADA
Y1364_MYCTU/550-649PA-HH........VLSLVQLP..............VVGADTEDI
O67306_AQUAE/448-564VY-PI.........LENAGFD.EVVN.......QDLVFNAKGEA
Q9Z6Z7_CHLPN/2-106VT-EV.........MRIAGLD.QLI..........LLCQSEQEC
SUT31_ARATH/514-633VV-KK.........LTRSKFIGDHLG.......KEWMFLTVGEA
Q9Z6P5_CHLPN/441-545PL-AD.........LKRYHLD.ELIG.......VDHIFSNIKSA
O17951_CAEEL/537-690VR-EM.........FEKCSFF.DFVS.......KENFYPTLRDA
RSFB_MYCTU/6-111TR-RP.........IHLMGLD.KTF..........RLFSTLHDA
SP2AA_BACLI/4-109VK-RL.........FDMSGLF.KII..........RLEQSEQRA
Q55415_SYNY3/433-538TK-RR.........LEKLQVF.RFVP.......ESNCYDDRSEA
SULH1_SCHPO/592-725VE-FH.........FTDINND..............WIKRTLVAA
O07728_MYCTU/29-135VA-RT.........IAACGLR.RLI..........PLYATVETA
P72770_SYNY3/438-545VR-DR.........LRAEGLE.GEV..........GTFRRLDTV
Q9Z841_CHLPN/3-107IE-QT.........LYVTGFL.SYF..........KIFNTVDEA
O07488_YEREN/391-488TR-TI.........VDRFGVH.DKP.............EEVEKL
SUT33_ARATH/498-617VV-EK.........LQRADEQ.KEFM......RPEFLFLTVAEA
P73474_SYNY3/396-498SA-TL.........WQKLIKE.PEL..........KLINSSAEN
SP2AA_GEOSE/4-109VK-RL.........FDMSGLF.KII..........RVEADEQFA
S26A3_HUMAN/526-716FI-EK.........LNRYEFF.DGEV......KSSIFFLTIHDA
SUT41_ARATH/519-638VH-LT.........IARSGMV.ELVG.......KEWFFVRVHDA
O84770_CHLTR/2-106VA-DI.........IRIAGLD.KVI..........TIRKAEQES
RSFA_MYCTU/18-124VA-RI.........IHACGYG.DVL..........PVHPTTESA
RSBRB_BACSU/147-272IA-QT.........AVQLGID.FSN.........ITIKTNLAQA
SUT1_STYHA/538-656VI-EK.........LHASKLT.ELIG.......EDKIFLTVADA
G2TL00_BACCO/4-109VK-RL.........FELSGLF.KII..........RLDESEQYA
Y1739_MYCTU/443-553LR-ES.........LRAASLL.DKIG.......EDHIFMTLPTA
I6X4W0_MYCTU/31-137VA-RI.........AEAGGLS.RVL..........PIYPTVDTA
SP2AA_PAEPO/4-109VH-RL.........LDMSGLF.KIM..........PIYDNEVNA
SULX_YEAST/572-707DK-VRR.......RLFKAGVA.ASVERAQANNNENNTSNTFSDA
SUT21_ARATH/548-668VI-HK.........LNQAKFV.DRIG........GKVYLTIGEA
O83249_TREPA/5-107VR-RA.........IELTGFS.EMF..........TVIKSLDEL
PHOT_BACSU/148-254LA-MK.........MNKLDAN.FSS.........LKTYSNVKDA
RSBS_BACSU/5-111VA-VT........LIELGIAL.EEI..........ETALDLEQG
O33206_MYCTU/385-486LE-S...........QLTALA.DNEQ.......RDKLRTVLESA
RSBRA_BACSU/151-261IA-QT.........IVNLGID.LSQVI.....TKNTLQKGIQTA
SUT11_ARATH/518-636VI-EK.........LYASKFV.EEIG.......EKNIFLTVGDA
Y1081_THENE/1-106VE-RV.........LSITNLD.RIV..........KIYDTISEA
SUT3_STYHA/511-631VI-HK.........LKVANFV.DKIG.......KERVFLTVAEA
SULH3_SCHPO/533-653VL-HI.........FEKHGLL.DLI..........GGYDHVQDS
YG35_YEAST/657-777DR-IYN.......AFNNVGLL.NDV..........ELFADLNSA
O33361_MYCTU/29-135VE-QLG......GRCDQGEHE.SMF..........PMARSVHKA
O83551_TREPA/4-108VK-KV.........IELTRLL.NYF..........PIAESVDEA
P73108_SYNY3/3-107LK-II.........FELTQLN.RVF..........PIYSNPEVA
RSBRC_BACSU/163-272IA-QT.........AVQLGLS.FEG.........ISLRSTLASA
Q40008_HORVU/530-648VI-QK.........LRSAKFT.DLIG.......DDKIFLSVGDA

PF13466

Q310Z9_DESAG/492-572LM.QT---------LVLAGFD-----------------------
B5HV30_9ACTN/31-112LH.AL---------LDLVGLR-----------------------
A9BX84_DELAS/2-83LQ.SM---------AALYGVD-----------------------
Q0K681_CUPNH/47-125LS.QL---------ASLYGVD-----------------------
B5H529_STRPR/9-95LL.TL---------LDLVGLP-----------------------
Q0RDC2_FRAAA/24-104LG.RM---------FAADRLG-----------------------
D1AD83_THECD/187-267VR.SM---------VEMIGLD-----------------------
D2SCD5_GEOOG/29-109TA.RL---------LRVVGMG-----------------------
A1VK31_POLNA/2-82LL.QL---------AEVYGVS-----------------------
A8ZVX1_DESOH/4-85FS.RQ---------LEKSGMA-----------------------
Q3SFW3_THIDA/281-359IH.EL---------FRVMGID-----------------------
B9TGW9_RICCO/228-309MQ.AL---------VRVGGLE-----------------------
A1W422_ACISJ/2-83LS.SL---------AGLYGVQ-----------------------
A1U461_MARHV/15-95LR.SL---------AALSNLQ-----------------------
Q21UA2_RHOFT/4-85LA.DL---------AALYGVV-----------------------
B1Y2Z1_LEPCP/2-84LV.RL---------ASLYGLS-----------------------
Q8EEQ5_SHEON/14-91VI.DA---------LELSGLS-----------------------
D2S5L7_GEOOG/30-110LH.QE---------LIRLRLD-----------------------
A7MNS4_CROS8/14-91LT.TL---------AKLYNLP-----------------------
B9JTP2_AGRVS/23-100FT.KT---------IQLLGLN-----------------------
B8DPA7_DESVM/571-651VA.EA---------ARRTGLD-----------------------
C6C1P3_DESAD/15-93FA.SF---------LELFDLD-----------------------
E3I167_RHOVT/14-94VE.AS---------FARAGLA-----------------------
E3IYM7_FRASU/24-104FL.EL---------VTATGLT-----------------------
C1D624_LARHH/5-83VE.SL---------IDLYGLQ-----------------------
A4YXB4_BRASO/320-399LA.RI---------FHFGGLE-----------------------
D1C014_XYLCX/37-113VR.FL---------LDVTRIG-----------------------
C6WD00_ACTMD/919-1001PA.RI---------MAVSGLH-----------------------
E3J1T6_FRASU/56-136LL.GL---------LIVTGWD-----------------------
C6WQ84_ACTMD/60-139VL.RP---------LRIAALD-----------------------
Q2SPQ4_HAHCH/13-91MK.QV---------VRLLSLQ-----------------------
D2SFP4_GEOOG/531-612VTRHV---------LEISGLG-----------------------
D2B5R7_STRRD/72-150LR.SV---------LALIGPD-----------------------
B8DLB2_DESVM/179-259LS.TV---------FDVVGIA-----------------------
D0KYU0_HALNC/26-108MR.AM---------MRVYDLD-----------------------
D5X3Z8_THIK1/566-644IA.GL---------FSILGLH-----------------------
B9J943_AGRRK/10-87FQ.KT---------LQMIGID-----------------------
B1W2W2_STRGG/20-107LR.SL---------LDLVGLA-----------------------
A1SBD9_SHEAM/6-85LV.AQ---------FKQMGMQ-----------------------
A0LC67_MAGMM/14-94VL.RM---------LLAARFD-----------------------
A4YMN9_BRASO/16-97VL.AV---------MHKANLG-----------------------
C7LTF6_DESBD/15-91LL.EN---------AASLGAD-----------------------
B1LTK1_METRJ/26-107HR.IL---------LGEVRLR-----------------------
Q0RZA3_RHOJR/48-126LR.HI---------LDDAGID-----------------------
C5BID3_TERTT/281-360LA.KT---------FQQQGVA-----------------------
Q2SBJ1_HAHCH/18-100MF.DI---------ARVSGVE-----------------------
B5HHQ5_STRPR/28-107VV.RT---------LRQAGLD-----------------------
Q1QXI2_CHRSD/17-99VR.RM---------LDVMGFS-----------------------
Q12BT3_POLSJ/427-501VR.AL---------FEELSMD-----------------------
C9R4W7_AGGAD/20-98LL.TL---------ADLFGLS-----------------------
D9T369_MICAI/189-267PA.RL---------VDLLGLS-----------------------
Q31HM4_THICR/6-86LK.MG---------AEKLGLT-----------------------
Q31GZ5_THICR/18-93LK.VL---------VNLYNLD-----------------------
A7H922_ANADF/18-92QL.RI---------FRYFGVD-----------------------
Q21SV7_RHOFT/514-592VA.AF---------FNVIGIN-----------------------
A3N1T8_ACTP2/20-99VK.TL---------ADLFDL.-----------------------
B2FP86_STRMK/2-73YN.EL---------SAAYRLS-----------------------
F9ZTS0_ACICS/20-97LR.EL---------VHLYGLE-----------------------
Q2IMF1_ANADE/97-172QL.RL---------LRYLGLD-----------------------
Q3J3N5_RHOS4/5-82FT.DD---------VTRLGVD-----------------------
Q3J659_RHOS4/7-80LT.DA---------FA.....-----------------------
Q6DAF4_PECAS/14-89LK.TL---------IALYNL.-----------------------
Q87LF2_VIBPA/15-93LR.TL---------FQLSNV.-----------------------

PF14213

G2J3X0_PSEUL/31-97TL------------------------------------------
C5AFW9_BURGB/238-293VT------------------------------------------
R6DUG2_9CLOT/21-84TV------------------------------------------
D8P9E0_9BACT/36-91VL------------------------------------------
D9QF83_BRESC/26-91SL------------------------------------------
K8GP23_9CYAN/208-263VQ------------------------------------------
D7E2C2_NOSA0/17-80GW------------------------------------------
D9SDG1_GALCS/27-91L.------------------------------------------
C4Z656_EUBE2/22-87IA------------------------------------------
R5XRA0_9FIRM/285-340VL------------------------------------------
R6PJ48_9CLOT/285-340VA------------------------------------------
A3QA48_SHELP/32-98NF------------------------------------------
R5ZPG5_9CLOT/24-98NL------------------------------------------
Q73PI2_TREDE/278-333VQ------------------------------------------
K9ZH15_ANACC/18-81GQ------------------------------------------
H8H3V4_DEIGI/24-87QR------------------------------------------
H8XUH7_FLAIG/24-92HW------------------------------------------
A0LXZ9_GRAFK/27-97YL------------------------------------------
Q8XHB8_CLOPE/17-78TD------------------------------------------
Q5NEH5_FRATT/276-331IE------------------------------------------
R4K797_CLOPA/19-79YN------------------------------------------
A9H234_GLUDA/27-96SY------------------------------------------
D5BER1_ZUNPS/19-78DQ------------------------------------------
I4C4U2_DESTA/277-332VK------------------------------------------
G0AI14_COLFT/270-325IT------------------------------------------
K9ZPS4_ANACC/341-404IR------------------------------------------
H6LER3_ACEWD/283-338VQ------------------------------------------
E6N6U4_9ARCH/18-73VR------------------------------------------
F8I7N0_SULAT/28-91NP------------------------------------------
F5YCP5_TREAZ/25-79SV------------------------------------------
A5G5Z8_GEOUR/270-325VQ------------------------------------------
H6RW13_BLASD/80-135VE------------------------------------------
L0D9F9_SINAD/118-173VE------------------------------------------
D8IQ15_HERSS/25-89SL------------------------------------------
Q82UU3_NITEU/25-95L.------------------------------------------
B5EI93_GEOBB/335-400VH------------------------------------------
L0DGU6_SINAD/19-82DE------------------------------------------
W6RWL6_9CLOT/19-83GD------------------------------------------
B4U9L3_HYDS0/40-103IR------------------------------------------
K9TRC5_9CYAN/18-81GQ------------------------------------------
K4IKE5_PSYTT/20-83DK------------------------------------------
K4L2N6_9FIRM/328-393CK------------------------------------------
K9UH85_9CYAN/18-81GE------------------------------------------
B4SE54_PELPB/33-96DM------------------------------------------
B7XKG1_ENTBH/25-91YL------------------------------------------
E6U4T1_ETHHY/18-81GM------------------------------------------
A6L6I8_BACV8/31-97KY------------------------------------------
K9RV87_SYNP3/278-333VK------------------------------------------
E3H2Y7_ROTDC/336-394ID------------------------------------------
C7MM94_CRYCD/17-81MA------------------------------------------
B1ZYW4_OPITP/20-83VR------------------------------------------
F3ZTR7_9BACE/27-97YL------------------------------------------
Q5E361_VIBF1/32-98SF------------------------------------------
W0PBU4_9BURK/27-91Y.------------------------------------------
Q7NLA4_GLOVI/5-68GK------------------------------------------
A7I365_CAMHC/26-89..------------------------------------------
Q7VJH0_HELHP/18-83DD------------------------------------------
D1B345_SULD5/22-85GK------------------------------------------
R6I2W7_9FIRM/273-328VT------------------------------------------
A1BGI6_CHLPD/273-328VN------------------------------------------
K9VZ93_9CYAN/30-93GK------------------------------------------
Q97FP7_CLOAB/19-80KD------------------------------------------
A1SAB7_SHEAM/362-425IR------------------------------------------
E3HBI7_ILYPC/11-75IK------------------------------------------
V5SDX9_9RHIZ/278-333VD------------------------------------------
A4XX40_PSEMY/363-426IR------------------------------------------
S6ABL2_9PROT/28-89VQ------------------------------------------
K9V072_9CYAN/33-96DA------------------------------------------
I3Z1N7_BELBD/17-80QA------------------------------------------
R6H1A0_9FIRM/21-84KN------------------------------------------
M4VBB1_9DELT/264-319ID------------------------------------------
Q8TKH8_METAC/27-90DE------------------------------------------
I0K8N5_9BACT/19-82DT------------------------------------------
W6RYG0_9CLOT/18-79DA------------------------------------------
H2J416_MARPK/19-82VK------------------------------------------
Q3JEZ3_NITOC/23-86DM------------------------------------------
D4M3H3_9FIRM/23-78ML------------------------------------------
R6G1E0_9CLOT/19-80RD------------------------------------------

PF11964

L0GYF4_9GAMM/12-118WAWIR---------------------------------------
W8EVU9_9BACT/23-129LEWL.---------------------------------------
D5V1Z3_ARCNC/21-125FEWLN---------------------------------------
Q11VP6_CYTH3/12-119IDWVS---------------------------------------
A5FC98_FLAJ1/11-118LNWVE---------------------------------------
Q28QM9_JANSC/19-126WAFV.---------------------------------------
Q093V8_STIAD/17-124REWLA---------------------------------------
E0TIJ6_PARBH/12-118LAWLR---------------------------------------
Q3SKE6_THIDA/10-113QAWVT---------------------------------------
Q3ID73_PSEHT/20-125IEWLK---------------------------------------
B2HRZ3_MYCMM/12-119RAWVS---------------------------------------
J7Q7E4_METSZ/12-118RDWI.---------------------------------------
E8X7D9_GRATM/13-120WRWAK---------------------------------------
Q3J4W4_RHOS4/41-148EAWVA---------------------------------------
F0SJ20_RUBBR/12-119REWLK---------------------------------------
D5SV07_PLAL2/13-118KAWIV---------------------------------------
A4XX57_PSEMY/12-120EAWLQ---------------------------------------
A0LIB8_SYNFM/14-120ERWVR---------------------------------------
I4C386_DESTA/12-119WTWIK---------------------------------------
I4AGM8_FLELS/70-181INWI.---------------------------------------
M4SAG0_9SPHN/140-247RAWLS---------------------------------------
F0SJC2_RUBBR/13-118RQWIT---------------------------------------
M9R3U0_9RHOB/11-120EAWLA---------------------------------------
A9WJT9_CHLAA/12-112LRFLG---------------------------------------
W8EZJ6_9BACT/24-132YAWL.---------------------------------------
Q8EB52_SHEON/21-126ITWLK---------------------------------------
L0K3H2_9EURY/13-119WEYVE---------------------------------------
B1MER2_MYCA9/12-121KVWAA---------------------------------------
F9ZWL7_METMM/13-118WSWLS---------------------------------------
X5E4J9_9BACT/13-117VNWLM---------------------------------------
E4TNT7_MARTH/14-124ESWIE---------------------------------------
Q8TPB5_METAC/12-119KAWIS---------------------------------------
A3QHM0_SHELP/21-124LDWL.---------------------------------------
B0JM20_MICAN/12-118TQWI.---------------------------------------
Q7UVW9_RHOBA/74-179RAWIQ---------------------------------------
A4FCH9_SACEN/137-244IAWAA---------------------------------------
A0LXE0_GRAFK/12-118IEWLD---------------------------------------
E1RHG3_METP4/12-115WKYIE---------------------------------------
G2J2P9_PSEUL/12-113QAWLA---------------------------------------
A5G4W5_GEOUR/116-227RAWLE---------------------------------------
A3CYB3_METMJ/12-120WGWLR---------------------------------------
Q5V739_HALMA/20-132LDWLR---------------------------------------
I4C4Z7_DESTA/12-119LEWVR---------------------------------------
M4NFH5_9GAMM/12-119TRWIT---------------------------------------
A1S706_SHEAM/12-119KIWLC---------------------------------------
M4V983_9DELT/11-119LRWA.---------------------------------------
D4ZLE1_SHEVD/12-119EQWIA---------------------------------------
B2HE07_MYCMM/27-133QQWI.---------------------------------------
J7L4H1_NOCAA/12-117WAWVR---------------------------------------
F2LY86_HIPMA/12-118RKWL.---------------------------------------
F0SJ19_RUBBR/12-119REWLQ---------------------------------------
Q3JB38_NITOC/148-256WEWLE---------------------------------------
W8EXL7_9BACT/35-135VAWLR---------------------------------------
H8MXZ5_CORCM/21-129RAWLE---------------------------------------
E1RH74_METP4/11-116WEWLR---------------------------------------
K9XV53_STAC7/12-117WHWLE---------------------------------------
A5FDC3_FLAJ1/11-118LNWVQ---------------------------------------
G8RQ72_MYCRN/12-121KQWAA---------------------------------------
Q07X46_SHEFN/12-116ITWIA---------------------------------------
A9GPE4_SORC5/20-127CAWLL---------------------------------------
G2KMS5_MICAA/17-122LAWA.---------------------------------------
Q6MQZ1_BDEBA/34-138RAWLA---------------------------------------
E3FV03_STIAD/12-119RQWL.---------------------------------------
D2QV97_SPILD/12-116WDWFN---------------------------------------
Q7NXU0_CHRVO/12-113QAWLA---------------------------------------
D5ER41_CORAD/12-118TKWI.---------------------------------------
A1SV34_PSYIN/12-119LSWLQ---------------------------------------
B3QUM5_CHLT3/13-124LKWLQ---------------------------------------
G0J0D1_CYCMS/13-117KEWIG---------------------------------------
A0M0N9_GRAFK/12-117KKWIK---------------------------------------
Q1CW14_MYXXD/23-128RAWVA---------------------------------------
Q6AK92_DESPS/134-240QTWIQ---------------------------------------
V5WKN4_9SPIO/39-142MKWLS---------------------------------------
A6Q9H2_SULNB/14-120KSWIK---------------------------------------
F8GCM7_NITSI/10-113EEWAS---------------------------------------
C4ZLU4_THASP/10-113RAWLA---------------------------------------
Q6AK92_DESPS/12-119RLWLS---------------------------------------
F0M0B1_VIBFN/20-125LAWLA---------------------------------------
A6WZX1_OCHA4/19-126WEWLS---------------------------------------
E3FKU0_STIAD/13-119LAWLK---------------------------------------
Q0AQY4_MARMM/16-124RAWLA---------------------------------------
Q6LKJ4_PHOPR/20-124LAWLR---------------------------------------
D5BJF0_ZUNPS/25-118LKFLK---------------------------------------
C7P248_HALMD/57-169RTWVR---------------------------------------
A1S9K0_SHEAM/21-126LEWLG---------------------------------------
D3FPZ4_BACPE/12-117RSWIR---------------------------------------
Q087X8_SHEFN/21-125LKWLR---------------------------------------
C0QCX2_DESAH/11-120EAWFS---------------------------------------
Q1LPD1_CUPMC/12-120REWI.---------------------------------------
A3HTM6_9BACT/12-125FEFVT---------------------------------------
F7XLD9_METZD/12-119KAWVS---------------------------------------
B1WXR6_CYAA5/19-124RMWLS---------------------------------------
D0J5L7_COMT2/12-119MQWLH---------------------------------------
H6L5W1_SAPGL/20-121IEWLK---------------------------------------
B7VP41_VIBTL/20-124IEWL.---------------------------------------
K0NMI2_DESTT/11-120EAWLN---------------------------------------
F4CCE8_SPHS2/23-130SEWVS---------------------------------------
G8PHU6_PSEUV/12-120WEWVK---------------------------------------
A0M5Q5_GRAFK/11-116IQWIS---------------------------------------
A3CYB0_METMJ/12-120IGWLR---------------------------------------
F4AVZ8_DOKS4/11-116LCWVM---------------------------------------
I3YWJ5_AEQSU/12-117LNWLK---------------------------------------
Q083D4_SHEFN/12-118WDWLR---------------------------------------
B0BYZ0_ACAM1/138-242RVWLA---------------------------------------
E3FWM2_STIAD/2-108RAWVA---------------------------------------
D5B9R4_ZUNPS/12-117KIWIE---------------------------------------
M4SAG0_9SPHN/11-120LAWVK---------------------------------------
I4AIU7_FLELS/23-135KEWLA---------------------------------------
A5GKD8_SYNPW/21-126DAWIR---------------------------------------
A9GKE1_SORC5/12-119RSWL.---------------------------------------
E1V9S9_HALED/39-147LDWV.---------------------------------------
A8LJW8_DINSH/13-117RAWAR---------------------------------------
C5BJV0_TERTT/11-120RLWLE---------------------------------------
S6B665_9PROT/11-113SDWVA---------------------------------------
G0J0C5_CYCMS/12-117KEWIN---------------------------------------
Q1CYP8_MYXXD/13-120LQWLR---------------------------------------
I0JIE9_HALH3/13-116WNWL.---------------------------------------
E6U1C5_BACCJ/13-120FHFLK---------------------------------------
Q47BJ5_DECAR/11-113KAWLA---------------------------------------
K9X8Y1_9CHRO/10-123IAWLE---------------------------------------
Q8ED76_SHEON/12-119KVWLD---------------------------------------
A1T9B4_MYCVP/12-121KAWAA---------------------------------------
J1L360_9EURY/12-120WRWIE---------------------------------------
A3QIC9_SHELP/12-116IEWIT---------------------------------------
G2J2S0_PSEUL/12-117WAWIH---------------------------------------
D5CNM7_SIDLE/10-114QIWAQ---------------------------------------
Q093V7_STIAD/21-127RAWLA---------------------------------------
W8S663_9RHOB/15-124RAWLA---------------------------------------
A9GPD9_SORC5/60-166RAWL.---------------------------------------
Q11I87_CHESB/20-127WEWLG---------------------------------------
C1DA99_LARHH/12-113RAWLH---------------------------------------
B3QXG2_CHLT3/14-123LAWLS---------------------------------------
H2FUI0_OCESG/21-126EAWLD---------------------------------------
E1QK88_DESB2/12-119LEWLR---------------------------------------
W8S5M5_9RHOB/17-125LAWLK---------------------------------------
I4EWX0_9ACTN/5-112KEWLA---------------------------------------
V5XBD7_MYCNE/12-121AEWAA---------------------------------------
D5B9R0_ZUNPS/6-111QNWIK---------------------------------------
F5XYL0_RAMTT/15-117QAWLR---------------------------------------
Q1ZBL2_9GAMM/21-125TLWLK---------------------------------------
A3QF38_SHELP/12-119LRWLG---------------------------------------
Q3JB38_NITOC/16-125MNWVS---------------------------------------
D6XVY9_BACIE/11-115TSWLK---------------------------------------
Q2YCI1_NITMU/10-113KTWLE---------------------------------------
C6Y0C1_PEDHD/12-119IGWLS---------------------------------------
B1LYM2_METRJ/12-117RSWLA---------------------------------------
Q7MEX7_VIBVY/25-130ITWLA---------------------------------------
Q12ZF4_METBU/12-119KAWIS---------------------------------------
L0G526_ECHVK/12-117RQWIG---------------------------------------
F4C7J2_SPHS2/12-119VAWLS---------------------------------------
B0BYZ0_ACAM1/12-117RTWLL---------------------------------------
A6Q671_SULNB/23-127LTWLM---------------------------------------
A0LXE0_GRAFK/144-249MDWLK---------------------------------------
W8EUS5_9BACT/21-126YAWL.---------------------------------------
H6L5S2_SAPGL/58-159IDWLK---------------------------------------
G8R3P5_OWEHD/12-122LEWIR---------------------------------------
W0RC97_9BACT/11-121LSWLA---------------------------------------
C6C2B1_DESAD/11-117LKWVQ---------------------------------------
H6L5W0_SAPGL/30-131LQWLA---------------------------------------
D9QNG3_BRESC/27-134RAWID---------------------------------------
G2KMS4_MICAA/16-122IAWMQ---------------------------------------
H6L0F3_SAPGL/30-131LDWLK---------------------------------------
A0LXC2_GRAFK/12-117KKWIQ---------------------------------------
Q2RZR2_SALRD/34-139LDWIR---------------------------------------
G2KMS2_MICAA/25-131VRWIK---------------------------------------
G0L8K0_ZOBGA/13-125LQFIA---------------------------------------
Q82UI4_NITEU/10-112YGWA.---------------------------------------
I1YHY0_METFJ/11-119EAWL.---------------------------------------
C6X1D7_FLAB3/12-118IYWC.---------------------------------------
I4ANF2_FLELS/25-134IEWIK---------------------------------------
V5WM94_9SPIO/3-107TAWLR---------------------------------------
X2HCK2_9NEIS/13-113QKWLE---------------------------------------
S6ATB1_PSERE/11-120EAWLQ---------------------------------------
E6WYT5_NITSE/23-127LEWLR---------------------------------------
D5BJR6_ZUNPS/18-118LSFLQ---------------------------------------
C7RNF8_ACCPU/11-113RSWLA---------------------------------------
A8ZX31_DESOH/24-127MKWLR---------------------------------------
H0PYZ6_9RHOO/10-113RAWLE---------------------------------------
F0JGN8_DESDE/12-119LEWIV---------------------------------------
A9GPD8_SORC5/37-144RAWLL---------------------------------------
G2KMS3_MICAA/30-137VEWMN---------------------------------------
Q31FZ2_THICR/21-125INWLS---------------------------------------
A9GPE2_SORC5/23-130RAWLL---------------------------------------
X5E3H4_9BACT/12-117RDWVK---------------------------------------
M1NQM0_9CORY/12-118RDWLR---------------------------------------
A0M0L9_GRAFK/12-115KEWME---------------------------------------
A6Q807_SULNB/11-120EAWLS---------------------------------------
C6BYE1_DESAD/13-119LKWTA---------------------------------------
Q73Z58_MYCPA/13-121KQWAA---------------------------------------
K9RD27_9CYAN/12-117RCWI.---------------------------------------
D9SJ90_GALCS/11-114IAWVH---------------------------------------
W6RYK2_9CLOT/10-116IAFC.---------------------------------------
H8N2H1_CORCM/12-120LSWLE---------------------------------------
I0KHL1_9BACT/11-115WQWF.---------------------------------------
A6VRW9_MARMS/21-125TDWVM---------------------------------------
A4FCH9_SACEN/14-119TDWLS---------------------------------------
Q6LS91_PHOPR/11-120EAWLT---------------------------------------
G8QLC0_DECSP/10-113KAWLA---------------------------------------
M4S571_9SPHN/11-120MAWVS---------------------------------------
A9B5K6_HERA2/29-133RQWLR---------------------------------------
A4VJY0_PSEU5/11-120LAWLE---------------------------------------
I3Z121_BELBD/12-117LAWIK---------------------------------------
A9ENE2_SORC5/23-130HAWLL---------------------------------------
E4TRL3_MARTH/24-128KAWLK---------------------------------------
A1SAI8_SHEAM/12-116IAWIQ---------------------------------------
K9SIP1_9CYAN/14-118LDWLK---------------------------------------
I5B5J2_9DELT/12-119IEFLS---------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window