Sequence alignment for CL0502

PF01740

SUT22_ARATH/540-662YPMANKTAGL....LTLRISSPLLCF-ANANF-IRDRILN--SV--------QE--IEGEENEQ................
J7JX08_BACIU/161-267APIMPITDGI....GILPLVGE.IDT-HRART-ILESVLE--QC--------SA--LK......................
S26A2_HUMAN/569-715YKNLQIKPGI....KIFRFVAP.LYY-INKEC-FKSALYK--QT--------VN--PILIKVAWKKAAK...........
O45016_CAEEL/553-725YETANDIPGI....KIFRFDSP.IYF-GNSEM-FVRKIHQ--AC--------GL--NPLIVRGELETENKKKDARK....
SULP3_CAEEL/546-696KRDLERIQGN...VCIFRMDAP.LIF-TSSDR-FTMSVWQ--CV--------KK--W.ERCKSESFVTIE..........
D6EY97_STRLI/11-115HLRVRHHRGH....TVLEFRGE.IDI-ASAAE-IAPYLDR--ET--------GR--PG......................
O04001_SPOST/529-651YKDAQRIPGF....LILATEAP.INF-ANSNY-LNERIKR--WI--------EE--ESSAQT..................
SUT32_ARATH/505-623YPQAITRSSL....LILHIDGP.IYF-ANSTY-LRDRIGR--WI--------DE--EEDKLR..................
F7UTR9_SYNYG/440-540QILRAANGRI....FMFHLSGP.MSF-GAAKS-IARRLAI--VE--------NY--........................
D4G5E9_BACNB/4-107NVDVKQNEND....IQVNIAGE.IDV-YSAPV-LREKLVP--LA--------EQ--G.......................
O69205_ACTPA/8-112AVVTVASDVVR.GVPVLRVAGE.IDA-NVADE-VRRALLP--WL--------DG--L.......................
F7UNW5_SYNYG/4-107NIESEIINNA....AKLTLIGE.LDG-GTAPL-FKEKIEE--VA--------QA--E.......................
SP2AA_LYSSH/4-107QLEMVTRETV.....VIRLFGE.LDH-HAVEQ-IRAKISA--AI--------FQ--GT......................
B0B7Z6_CHLT2/3-107NFQKEEQGQT....GILHLQGK.LDG-VSSPA-VQESISE--SL--------SN--G.......................
A0A038FD55_MYCTX/15-120AIAVRTQDSV....VILTADGA.LDS-SSSAL-LRDSLTR--AT--------LE--QP......................
S26A1_RAT/529-685AAEFEGLLPPP.EVRVFRFTGP.LYY-ANKDF-FLRSLYS--LT--------GL--DAGYSATRKDRGTE..........
F7UNW3_SYNYG/2-105DIQINQQEDI....TVVTLSGE.VDA-NTAPK-IHEVILP--LA--------EP--G.......................
SP2AA_BACME/4-109SIELEFKQDV....LLVRLTGE.LDH-HTAEE-LRSKITE--AI--------EK--ES......................
E8VB29_BACST/421-528VLAKREDPSV....SMYAIEGP.LFF-GSIDS-LESSLLE--HV--------QK--KP......................
A0A024I404_LISMN/4-109SIEIKERDTD...HIDIFVAGE.IDA-YTAPK-VKEALEV--YQ--------VK--EG......................
Q46665_ECOLX/332-437PVVVDVPDDV....LVLRVIGP.LFF-AAAEG-LFTDLES--RL--------EG--K.......................
S26A4_HUMAN/536-725YKNIEEPQGV....KILRFSSP.IFY-GNVDG-FKKCIKS--TV--------GF--DAIRVYNKRLKALRKIQKLIKSGQ
RSBV_BACLI/4-107AVDTKKNDHV....IEVKVAGE.IDV-HTAPA-LRDELMP--LA--------EE--G.......................
D4GA39_TREPC/17-124KMNLQKIDDLE.GGVVVFLNGY.IDT-YNSSF-FQKRIAK--VI--------DA--G.......................
A0A038VVM1_MYCTX/550-649FVSLVESGRI.......VVRGD.VDS-TTAAT-LDRQIAV--ES--------RS--GI......................
O67306_AQUAE/448-564NAEKRGLPECP.QIMFIRPNMS.IYF-GNAQY-VYDYIMN--KV--------ED--ALFN....................
D0ZZC5_CHLPP/2-106NLSAKEYGDI....IVIYLQGS.LDA-VSVPS-VQEYLEQ--FI--------QK--K.......................
SUT31_ARATH/514-633YPSSRTVPGI....LILEIDAP.IYF-ANASY-LRERIIR--WI--------DE--EEERVK..................
Q9Z6P5_CHLPN/441-545KAEVPQNTEI......YEINGP.FFF-GIADR-LKNLLND--IE--------KP--P.......................
O17951_CAEEL/537-690YQETIFYKGI....CIFKFDAP.LLF-HNVEC-FKKCIEK--VY--------DE--WKKSSEFNFVKEPNA.........
A0A038F5T9_MYCTX/6-111SITVTVADHNG..VAVLSIGGE.IDL-ITAAA-LEEAIGE--VV--------AD--N.......................
SP2AA_BACLI/4-109GIDIHVKESV....LCIRLTGE.LDH-HTAET-LRKQVSG--HL--------EQ--TD......................
F7UT52_SYNYG/433-538RWLDEGNGRV....LLFQLSGP.MIF-GVAKA-IAREHNA--IQ--------EC--........................
SULH1_SCHPO/592-725NPNLTVRDPPA.GVLIFRLQES.FTY-PNAGH-VNSMLTS--KA--------KT--VTRRGNANIYKKA...........
A0A038KUN0_MYCTX/29-135RAVTECTGSA....VVVHVGGD.IDA-SNEVA-WQRLVSK--SA--------AI--AI......................
F7UK55_SYNYG/438-545HPENLVISGV....LIYRINGP.ILY-FNINN-IESDLFN--HL--------AQ--QQE.....................
Q9Z841_CHLPN/3-107DIQKEEHGST....TIFHLHGK.LDG-ISSPE-VQENISQ--SL--------AA--G.......................
O07488_YEREN/391-488TSVLEGTSRT......YTVTGQ.VFF-ASADR-FTSHFDF--RE--------AI--E.......................
SUT33_ARATH/498-617YKEAQRIPGF....LVLSIESP.VNF-ANSNY-LTERTSR--WI--------EE--CEEEEA..................
F7UNH6_SYNYG/396-498DRVLTEDENH....RIYNVSGQ.IFF-VSKEE-FLEAFDF--DE--------LV--D.......................
SP2AA_GEOSE/4-109AIDLEVKQDE....LIVRLSGE.LDH-HTAEN-CMNKCRM--CL--------EK--RA......................
S26A3_HUMAN/526-716YYDMYEPEGV....KIFRCPSP.IYF-ANIGF-FRRKLID--AV--------GF--SPLRILRKRNKALRKIRKLQKQGL
SUT41_ARATH/519-638YPEAYTYNGI....VIVRIDSP.IYF-ANISY-IKDRLRE--YE--------VA--VDKYTN..................
B0B8Z1_CHLT2/2-106EWIAREYKNI....FIVSLKGD.MDA-VTVPA-LEEFLTK--SI--------AK--GR......................
A0A038FGB0_MYCTX/18-124KATIQHHDSA....VIIHARGE.IDA-ANEHT-WQDLVTK--AA--------AA--TT......................
D4FVP2_BACNB/147-272EMNAKQQLNAQ.REMILELSSP.VIT-LSKST-ALLPLVG--DI--------DT--ERAKFILE................
SUT1_STYHA/538-656YPKAAQIPGM....LIIRVDSA.IYF-SNSNY-IKERILR--WL--------ID--EGAQRT..................
G2TL00_BACCO/4-109AIDLEVKKDV....LCIRLQGE.LDH-HTAES-LRASVTK--AI--------EE--NG......................
A0A050EIQ5_MYCTX/443-553YPQAKRVPGL....VVYRYDAP.LCF-ANAED-FRRRALT--VV--------DQ--DPGQVE..................
A0A038F804_MYCTX/31-137RATTDGSGAA....LLIHAGGE.IDG-RNEHL-WRQLVTE--AA--------AG--VT......................
SP2AA_PAEPO/4-109QIEMEHHRGV....LIVRLSGE.LDH-HTSDM-VRMQMDE--AI--------QR--RQ......................
A0A023ZIX9_YEASX/572-707SLDVEGTEEIE.GCMIVRIPEP.LTF-TNSED-LKQRLDR--IE--------RY--GSSKIHP.................
SUT21_ARATH/548-668YPMTVKTPGV....LIFRVKSA.LLC-FANAS-SIEERIM--GW--------VD--EEEEEEN.................
B2S2G7_TREPS/5-107NIAKDVRPGC....VLLTVTGA.VSS-YTYGE-FESRVHG--AL--------KE--........................
J7JQU5_BACIU/148-254TPIVPIRNGI....SALPLVGN.LTE-ERFNS-IVCTLTN--IL--------ST--SK......................
D4G5E6_BACNB/5-111KIPILKLYNC....LLVSIQWE.LDD-QTALT-FQEDLLN--KI--------YE--TG......................
A0A038FF51_MYCTX/385-486RKAKVTQDDT....GTYRIDGP.LSF-LSVDG-VFGSLRD--GR--------E.--........................
D4G5E5_BACNB/151-261APLIPVFENI....TVMPLVGT.IDT-ERAKR-IMENLLN--GV--------VK--HR......................
SUT11_ARATH/518-636YPDAAQIPGI....LIIRVDSA.IYF-SNSNY-VRERASR--WV--------RE--EQENAK..................
Y1081_THENE/1-106MFPYKIVEDV....VILMPNKE.LNI-ENAHL-FKKWVFD--EF--------LN--KG......................
SUT3_STYHA/511-631YPMAVTTPGI....LVIRISSG.SLC-FANAG-FVRERIL--KW--------VE--DEEQDNI.................
SULH3_SCHPO/533-653STAVESAPRI....LVVRIPEP.LFF-ANVSQ-LEDRLNR--LE--------KY--GHPRMHP.................
YG35_YEAST/657-777YVQTKFLDGIGEQIYVLKLQNL.LFF-GTIIS-IEEKIER--LL--------QI--SNKDA...................
A0A038FHX3_MYCTX/29-135QIRAYLHHLA....TVVTIRGE.IDA-ANVEQ-ISEHVRR--FS--------LG--T.......................
B2S3D2_TREPS/4-108ELKVRQSGGI....CVVDISGD.MDL-YHSYK-LKDLVLK--LF--------DR--G.......................
F7UM20_SYNYG/3-107SFNPQIVTRD.....VFYPQGT.LSA-AVTQA-FQADLAS--WL--------AT--TS......................
G4EUZ2_BACIU/163-272ELSAPVIVLFH.SVGLLPLIGD.IDT-VRAKL-IMENTLH--QC--------AK--KK......................
Q40008_HORVU/530-648YPEATKVPGV....MIVRVDSA.IYF-TNSNY-VKERILR--WL--------RD--EEEQQQ..................

PF13466

Q310Z9_DESAG/492-572----------------LQLAGD-ITI.ERSAQ.LQEAFQE..AL........SR..Y.----------------------
B5HV30_9ACTO/31-112----------------LVLAGP-VTR.DEVTE.LGDEVRA..LLR.....TTGA..G.----------------------
A9BX84_DELAS/2-83----------------LQLPRE-LTY.RQARS.CLVQLRP..QV........QAFDG.----------------------
Q0K681_CUPNH/47-125----------------LSLGTS-LTN.QNAAA.VLRDGLA..RL........AQ..G.----------------------
B5H529_STRPR/9-95----------------MHITGR-ITP.ADVPR.LCEELRH..LLRDDGTGGGA...P.----------------------
Q0RDC2_FRAAA/24-104----------------VRLVGR-VDV.RTVGT.LRSLLHA..AI........DN..G.----------------------
D1AD83_THECD/187-267----------------LALSGE-LDA.ARHAV.FGEALSQ..ALA......RAN..G.----------------------
D2SCD5_GEOOG/29-109----------------ITAAGE-LDR.AVAHR.LSDALDA..LA........LT..G.----------------------
A1VK31_POLNA/2-82----------------LKLPAV-LTH.AVASG.FFHTVAK..EVL......SLP..K.----------------------
A8ZVX1_DESOH/4-85----------------IVLHGD-CLV.NRAEE.LHQLFCH..LL........KQ..S.----------------------
Q3SFW3_THIDA/281-359----------------VRLSGE-ITP.ADDSA.LQQLSAH..AA........NH..N.----------------------
B9TGW9_RICCO/228-309----------------LSVSGV-LDF.ETTVQ.LLAQGRE..WIE......SAA..P.----------------------
A1W422_ACISJ/2-83----------------LVLPAE-LTH.RHAGA.TLRMLLQ..GL........KA..QD----------------------
A1U461_MARAV/15-95----------------LCVTGD-VDA.DTVLA.LRKQGEQ..EIR......QAD..G.----------------------
Q21UA2_ALBFT/4-85----------------LVLPQE-LTQ.RQATV.CLRALVQ..DLA......SLP..G.----------------------
B1Y2Z1_LEPCP/2-84----------------LSLPER-LTHVETPPT.LRSLFAEMDAL........PA..G.----------------------
Q8EEQ5_SHEON/14-91----------------VNLTEE-LTI.YSVME.FRDALVG..HL........QP..G.----------------------
D2S5L7_GEOOG/30-110----------------VDLAGH-LDR.RTVHL.LHDAIST..LL.......LTD..G.----------------------
A7MNS4_CROS8/14-91----------------LRLNGT-LDR.ETLTP.LWEQRQ...SI........TD..G.----------------------
B9JTP2_AGRVS/23-100----------------LKLASV-LDL.NEASQ.LKDKLLS...M........RG..G.----------------------
B8DPA7_DESVM/571-651----------------LVLSGE-VTI.ERGAD.LREALLD..VL........GS..F.----------------------
C6C1P3_DESAD/15-93----------------MNISGR-LDA.EGAGE.VWDKARA..AV........AA..G.----------------------
E3I167_RHOVT/14-94----------------LELEGD-LRP.RDASA.LHEALLV..AL........SG..E.----------------------
E3IYM7_FRASU/24-104----------------IELAGE-LDA.PGRRC.LRDQIAE..LL........GR..G.----------------------
C1D624_LARHH/5-83----------------LALPSA-VTF.DEVSG.LLRNWLP..AV........RA..A.----------------------
A4YXB4_BRASO/320-399----------------LSLSGP-ADA.RHVDR.AIPVFRS..AV........AV..R.----------------------
D1C014_XYLCX/37-113----------------IVLSGE-IDA.DIGAE.LSEMSAE..AE........AT..G.----------------------
C6WD00_ACTMD/919-1001----------------LHLGGD-LDL.DGVRA.LREFLLG..RVD......VAD..R.----------------------
E3J1T6_FRASU/56-136----------------LSIDGD-IDA.SVLPA.LVGTLAK..VA........HH..G.----------------------
C6WQ84_ACTMD/60-139----------------LHVAGE-IDQ.LSAPV.LRGALDL..AL........KH..R.----------------------
Q2SPQ4_HAHCH/13-91----------------IKLPGA-FSI.SSVEK.VYEQVNN..AP........AT..Q.----------------------
D2SFP4_GEOOG/531-612----------------VRATGA-VDM.LGAEQ.MRIRLLE..ASH......GGT..G.----------------------
D2B5R7_STRRD/72-150----------------LKVSGD-IDR.TTRRL.WEEALDG..LV........TQ..G.----------------------
B8DLB2_DESVM/179-259----------------VRIRGT-VNS.PAEPV.LRHVFEE..AL........LT..G.----------------------
D0KYU0_HALNC/26-108----------------VRVQGD-LLR.SSIES.LSDLSLP..MPD.....GQTP..G.----------------------
D5X3Z8_THIK1/566-644----------------LHLSGE-I.L.GSSSD.FLNPLEQ..AA........KT..H.----------------------
B9J943_AGRRK/10-87----------------VSLAAV-LDL.NEASA.LRGKLMG..L.........RG..S.----------------------
B1W2W2_STRGG/20-107----------------LTVTGR-VSR.AVVAD.LCVELER..ALADPGGAAPAP..G.----------------------
A1SBD9_SHEAM/6-85----------------VELGSE-LTI.RNIQP.IYSQLAD..LL........HQ..G.----------------------
A0LC67_MAGSM/14-94----------------ISLVGS-FSH.AIFKE.FKNAYLP..LT........PG..P.----------------------
A4YMN9_BRASO/16-97----------------VVVRGA-LTS.DTQTA.FKQQVEP..VL........SN..PS----------------------
C7LTF6_DESBD/15-91----------------IKLSGN-LTL.DHSRD.IHAELLA..RL........PQ..A.----------------------
B1LTK1_METRJ/26-107----------------LALDGR-WTA.DQAPT.VEAAAAR..IA........AA..GR----------------------
Q0RZA3_RHOSR/48-126----------------LRVSGD-LDM.VTAPI.LAACLDE..VV........LR..G.----------------------
C5BID3_TERTT/281-360----------------LTLTGA-MGS.DFSRN.LMAEVVD..HA........RP..H.----------------------
Q2SBJ1_HAHCH/18-100----------------LSISGI-VDL.SNVAD.LLAEGEK..AV........QA..AD----------------------
B5HHQ5_STRPR/28-107----------------LVFSGV-LDA.HALPE.LEERLLD.PRL.......RQA..G.----------------------
Q1QXI2_CHRSD/17-99----------------LKLSGD-VRL.TLCAT.LDQQAQR..VA.......DSP..G.----------------------
Q12BT3_POLSJ/427-501----------------LALRGR-ATW.MHCDA.FYETARA..VL........EE..G.----------------------
C9R4W7_AGGAD/20-98----------------LRLKGE-LSQ.NTLLP.LWQQRAS..FLL.....ARKT..E.----------------------
D9T369_MICAI/189-267----------------VALAGE-LDP.SNHRD.FAAALER..ADP.....RPVA..G.----------------------
Q31HM4_THICR/6-86----------------IELPEN-LTI.HHIEE.EFGNLKI..AF........QS..D.----------------------
Q31GZ5_THICR/18-93----------------IKLSGQ-INM.DAVAS.FYAQGIK..SL........VN..P.----------------------
A7H922_ANADF/18-92----------------IRLSGV-FDH.ASAAE.LAQRLQQ..E.........AA..T.----------------------
Q21SV7_ALBFT/514-592----------------VELSGE-VLG.DAAEA.LDKLQAG..LY........DA..K.----------------------
A3N1T8_ACTP2/20-99----------------VKLSGE-LTR.DTLLP.LWKQRAS..FL.......SPK..G.----------------------
B2FP86_STRMK/2-73----------------......-LDR.AAVIA.LWPQLQ...AL........PA..K.----------------------
F9ZTS0_ACICS/20-97----------------LRLSGD-WRL.DALDEALRSEELR..SL........AV..D.----------------------
Q2IMF1_ANADE/97-172----------------ISLDGV-LDV.PTARR.LAAQLAA..A.........AP..G.----------------------
Q3J3N5_RHOS4/5-82----------------LDLPAR-LDH.QGARQ.LYAALLS..M.........PP..G.----------------------
Q3J659_RHOS4/7-80----------------LTLSGT-LRL.QDAPG.LIERLAA..AL........AA..G.----------------------
Q6DAF4_PECAS/14-89----------------LALTGD-LDR.ETLLP.FWQQRES..LL........A...G.----------------------
Q87LF2_VIBPA/15-93----------------LTLTGA-LDR.DSVPS.LWAFAQQ..WK........PS..Q.----------------------

PF01740

SUT22_ARATH/540-662..............EVLK......................................ENGLQVVILDMSCV..MGVDTSGV
J7JX08_BACIU/161-267...........................................................LSYLFLDISGV..PIVDTMVA
S26A2_HUMAN/569-715.........RKIKEKVV.TLGGIQDE......................MSVQLSHDPLELHTIVIDCSAI..QFLDTAGI
O45016_CAEEL/553-725...EKEEEDAEIPKETE.KETKLEVTTHQAKV.........LDEKHAEPEPNPADQYERLTHIIIDCSTI..IYVDLMGQ
SULP3_CAEEL/546-696........QMNSDRSAD.IFDSKLKSA....................RRRWKRDQKSENRCKLVIDCDGF..PYVDYLGL
D6EY97_STRLI/11-115............................................................ARVVLDLDGI..EFFDCSGL
O04001_SPOST/529-651.......................................................KQTELRFVILDLSAV..PAIDTSGV
SUT32_ARATH/505-623................T.S....................................GDISLQYIVLDMSAV..GNIDTSGI
F7UTR9_SYNYG/440-540............................................................DVLILDLATV..PRLGVTAL
D4G5E9_BACNB/4-107............................................................ADLRICLKDV..SYMDSTGL
O69205_ACTPA/8-112...........................................................RGPGVLDLTGV..RFMASTGL
F7UNW5_SYNYG/4-107...........................................................ISKLVLMMDQL..EYMSSAGL
SP2AA_LYSSH/4-107...........................................................VTTIIWNLEGL..SFMDSSGV
B0B7Z6_CHLT2/3-107...........................................................MKNIILDCGDL..DYISSAGI
A0A038FD55_MYCTX/15-120............................................................SAVIVNVTEL..QVAEESAW
S26A1_RAT/529-685........VGVSNRSLV.DRKDLGSVS....................SGDGLVVPLAFGFHTVVIDCAPL..LFLDVAGM
F7UNW3_SYNYG/2-105............................................................SKILLDMTAV..PYMSSAGL
SP2AA_BACME/4-109...........................................................ISHLILNLQHL..TFMDSSGL
E8VB29_BACST/421-528............................................................KTLILLMNKV..HYMDTSAE
A0A024I404_LISMN/4-109............................................................IVLRIDLTEV..SYMDSTGL
Q46665_ECOLX/332-437............................................................RIVILKWDAV..PVLDAGGL
S26A4_HUMAN/536-725LRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTK.EIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAI..SFLDVVGV
RSBV_BACLI/4-107............................................................KDLKVSLKDV..SYMDSTGL
D4GA39_TREPC/17-124...........................................................YTRIVFNCASL..NYVSSTGI
A0A038VVM1_MYCTX/550-649............................................................APVTIDLSAV..THLGSAGV
O67306_AQUAE/448-564........................................................GRPLKFVLIDMEAV..NYVDATGA
D0ZZC5_CHLPP/2-106...........................................................HLKIALNFTDV..SYISSAGI
SUT31_ARATH/514-633................Q.S....................................GESSLQYIILDMSAV..GNIDTSGI
Q9Z6P5_CHLPN/441-545............................................................KIFILCMTRV..PTIDASAM
O17951_CAEEL/537-690........GKGSKFTFE.GMHRIAPITE..................IPLHPGINRDPILPRHFVIDCSGF..TFIDLMGV
A0A038F5T9_MYCTX/6-111...........................................................PTALVIDLSAV..EFLGSVGL
SP2AA_BACLI/4-109...........................................................IRHIVMNLADL..SFMDSSGL
F7UT52_SYNYG/433-538............................................................AAIVFDLSDV..PHLGVTAS
SULH1_SCHPO/592-725..........SDRPWND.PAPRKKK.......................NAPEVEDTRPLLRAIILDFSAV..NHIDTTGV
A0A038KUN0_MYCTX/29-135..........................................................APGPFVIDIRDL..DFMGSCAY
F7UK55_SYNYG/438-545..........................................................PVELVIFEMGTS..PGIDTPAA
Q9Z841_CHLPN/3-107...........................................................SKNIILDCAHL..DYMSSAGI
O07488_YEREN/391-488.............................................................NVVIDVSHA..HFWDITSV
SUT33_ARATH/498-617................Q.E....................................KHSSLQFLILEMSAV..SGVDTNGV
F7UNH6_SYNYG/396-498.............................................................RVTIDLTHA..HLWDQGAV
SP2AA_GEOSE/4-109...........................................................IRHIVLNLGQL..TFMDSSGL
S26A3_HUMAN/526-716LQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAV..SFLDVSSV
SUT41_ARATH/519-638................R.G...................................LEVDRINFVILEMSPV..THIDSSAV
B0B8Z1_CHLT2/2-106............................................................VNVLLNMEKV..FYMSSAGL
A0A038FGB0_MYCTX/18-124..........................................................APEPLVVNLNGL..DFMGCCAV
D4FVP2_BACNB/147-272...............NT.LQ.................................ACAKRRVEHLLIDLSGV..VVVDTMVA
SUT1_STYHA/538-656................E.S....................................ELPEIQHLITEMSPV..PDIDTSGI
G2TL00_BACCO/4-109...........................................................IRHLVLNLEQL..SFMDSSGL
A0A050EIQ5_MYCTX/443-553................W.F....................................VLNAESNVEVDLTAL..DALD....
A0A038F804_MYCTX/31-137..........................................................APGPLIVDVTGL..DFMGCCAF
SP2AA_PAEPO/4-109...........................................................CEHIVLSLKNL..QFMDSSGL
A0A023ZIX9_YEASX/572-707...............GR.KS.................................LRSKDSIKYVIFDLGGM..TSIDSSAA
SUT21_ARATH/548-668................T.KS..................................NAKRKILFVVLDMSSL..INVDTSGI
B2S2G7_TREPS/5-107............................................................NHVVLDLSGV..TAMSSSGL
J7JQU5_BACIU/148-254..........................................................D.DYLIIDLSGL..AQVNEQTA
D4G5E6_BACNB/5-111...........................................................ANGVVIDLTSV..DMIDSFIA
A0A038FF51_MYCTX/385-486.............................................................DVSLDLQHV..TYLDTSGA
D4G5E5_BACNB/151-261...........................................................SQVVLIDITGV..PVVDTMVA
SUT11_ARATH/518-636................E.Y....................................GMPAIRFVIIEMSPV..TDIDTSGI
Y1081_THENE/1-106...........................................................YNKILLVLSDV..ESIDSFSL
SUT3_STYHA/511-631................E.E...................................AAKGRVQAIIIDMTDL..TNVDTSGI
SULH3_SCHPO/533-653...............GE.TP.................................YRRIEDIEVVVFDMVGV..SSIDSSAL
YG35_YEAST/657-777.......................................................TKRRIKYLILDFKNINADNIDYSAA
A0A038FHX3_MYCTX/29-135............................................................NPMVLDLSEL..SHFSGAGI
B2S3D2_TREPS/4-108...........................................................PRCIVIDLEAV..EYIDSSGI
F7UM20_SYNYG/3-107...........................................................SPVMVIDFSQV..DFLDSAIL
G4EUZ2_BACIU/163-272...........................................................VTQLYIDLSGV..AVIDTMVA
Q40008_HORVU/530-648................E.Q....................................KLSKTEFLIVELSPV..TDIDTSGI

PF13466

Q310Z9_DESAG/492-572----------------------------------------------------------..EVLRIDSQQL--ESADLTLV
B5HV30_9ACTO/31-112----------------------------------------------------------...VVVCDVAGL--GPPGLGAV
A9BX84_DELAS/2-83----------------------------------------------------------..AQVRVDASGV--EVFDSAAL
Q0K681_CUPNH/47-125----------------------------------------------------------...EVQVDCTGL--AQVDSSAV
B5H529_STRPR/9-95----------------------------------------------------------..CEVFCDVGGL--AQVNLAAV
Q0RDC2_FRAAA/24-104----------------------------------------------------------.SGPLRVDVAGL--ELGDHAAL
D1AD83_THECD/187-267----------------------------------------------------------..SPVHVDMAEL--KFIDVGAL
D2SCD5_GEOOG/29-109----------------------------------------------------------.HRTWTVDTSGI--TFCDAEGL
A1VK31_POLNA/2-82----------------------------------------------------------...EVVVDASAL--SQFDSSAL
A8ZVX1_DESOH/4-85----------------------------------------------------------.DDQVAVDMSAV--GRCDVSFF
Q3SFW3_THIDA/281-359----------------------------------------------------------...EVLVDLSEV--ARVDYGSV
B9TGW9_RICCO/228-309----------------------------------------------------------..AQFTIDLSRV--EYSSSAGL
A1W422_ACISJ/2-83----------------------------------------------------------.ESLVVVDAGAL--TAFDSSAL
A1U461_MARAV/15-95----------------------------------------------------------...TLEVDLSGL--GTAHSVVL
Q21UA2_ALBFT/4-85----------------------------------------------------------..PEAVVDASPL--NRFDSSAL
B1Y2Z1_LEPCP/2-84----------------------------------------------------------..TSVVIDGHQL--GRFDSSAL
Q8EEQ5_SHEON/14-91----------------------------------------------------------..VDISVDLSQV--TEVDTAGL
D2S5L7_GEOOG/30-110----------------------------------------------------------..DTWVVDASHV--TACDPAGI
A7MNS4_CROS8/14-91----------------------------------------------------------...LQRIDLSGL--ERVDTAGL
B9JTP2_AGRVS/23-100----------------------------------------------------------...AIEIDASGV--ERMGALCA
B8DPA7_DESVM/571-651----------------------------------------------------------..ATVRIDLSGV--TAADLTLV
C6C1P3_DESAD/15-93----------------------------------------------------------...CLVVECSGI--EYLDGGGA
E3I167_RHOVT/14-94----------------------------------------------------------..DEILVDARRV--TSLDVSIL
E3IYM7_FRASU/24-104----------------------------------------------------------.GATVTVDVGGL--RRVDIPGL
C1D624_LARHH/5-83----------------------------------------------------------...DCRLDWAAV--RRVDSAAL
A4YXB4_BRASO/320-399----------------------------------------------------------..KHVRLDFSNV--CAIDARFL
D1C014_XYLCX/37-113----------------------------------------------------------..LPVEIDAHHI--TFMDSSGV
C6WD00_ACTMD/919-1001----------------------------------------------------------..RPVELDLSGL--GYLSSSGV
E3J1T6_FRASU/56-136----------------------------------------------------------.RGDVRVDLGRL--RRVDVGGL
C6WQ84_ACTMD/60-139----------------------------------------------------------.PPVLVVDLGEV--RLLAVAGL
Q2SPQ4_HAHCH/13-91----------------------------------------------------------...RIKFDGAEV--EVMDAAAL
D2SFP4_GEOOG/531-612----------------------------------------------------------...RVELDLTEV--TLFSSAAV
D2B5R7_STRRD/72-150----------------------------------------------------------..DDMHIDLAGL--TFVDVRGT
B8DLB2_DESVM/179-259----------------------------------------------------------.APTVVLDFEPS--VSVNGAGI
D0KYU0_HALNC/26-108----------------------------------------------------------..TRLEIALGSV--GRIDTAGV
D5X3Z8_THIK1/566-644----------------------------------------------------------..EQMSISLRQL--RRIDFSSA
B9J943_AGRRK/10-87----------------------------------------------------------...NVAIDASSV--ERIGALCI
B1W2W2_STRGG/20-107----------------------------------------------------------..AAVDCDVGGV--TRPDLTLV
A1SBD9_SHEAM/6-85----------------------------------------------------------..RPVTLNAARL--IKADTAGL
A0LC67_MAGSM/14-94----------------------------------------------------------.SFRYCIDLSQV--KSLDSSVL
A4YMN9_BRASO/16-97----------------------------------------------------------.VSKIKLDFSGL--QSIEAASS
C7LTF6_DESBD/15-91----------------------------------------------------------..SAITLDLADS--EKSDLSFV
B1LTK1_METRJ/26-107----------------------------------------------------------.AGPVAVDLSGI--ERLDTLGA
Q0RZA3_RHOSR/48-126----------------------------------------------------------..RCAVVDLLPA--GFVGCAAL
C5BID3_TERTT/281-360----------------------------------------------------------..KPLQLDLSGL--EYMDNSFI
Q2SBJ1_HAHCH/18-100----------------------------------------------------------ATSPLRIDVSLV--ENAQSVLI
B5HHQ5_STRPR/28-107----------------------------------------------------------...DRVLDMSGL--ERIELACA
Q1QXI2_CHRSD/17-99----------------------------------------------------------.LAAVMIDLREA--TNVDSTAL
Q12BT3_POLSJ/427-501----------------------------------------------------------..RPLVLDLSGC--DYLDSTCL
C9R4W7_AGGAD/20-98----------------------------------------------------------.TLDVHWDLSQV--NRIDSAGF
D9T369_MICAI/189-267----------------------------------------------------------...RVVFDAAEL--RFVDHR..
Q31HM4_THICR/6-86----------------------------------------------------------.AETYKLVAGNV--ESIDTSGL
Q31GZ5_THICR/18-93----------------------------------------------------------...IEVIDCSNV--KEADSSCL
A7H922_ANADF/18-92----------------------------------------------------------...EVVLDFSLV--REFADLGV
Q21SV7_ALBFT/514-592----------------------------------------------------------...HLVISCSRL--IRVDFSAA
A3N1T8_ACTP2/20-99----------------------------------------------------------.NQHIYWDLKDL--ERVDSAGF
B2FP86_STRMK/2-73----------------------------------------------------------...LARLDLAEV--ERVDSAGL
F9ZTS0_ACICS/20-97----------------------------------------------------------...RVRL..DDV--DAADSATL
Q2IMF1_ANADE/97-172----------------------------------------------------------..SLVRIDLTHV--RELHDFGL
Q3J3N5_RHOS4/5-82----------------------------------------------------------...DTCLAAGQV--SFVGGLAL
Q3J659_RHOS4/7-80----------------------------------------------------------...DVEIDASGV--LAVDAAAV
Q6DAF4_PECAS/14-89----------------------------------------------------------...KTTLDVSGL--NRVDSAGL
Q87LF2_VIBPA/15-93----------------------------------------------------------..KELECSLEEI--ERVDSAGM

PF01740

SUT22_ARATH/540-662FALEELHQELA.S-NDIRLVI-AS-PRWR-VL-HK.........LKRAKLD.EKIK.......TENIYMTVGEA
J7JX08_BACIU/161-267YQIFKVIDSTK.L-LGIETII-SG-IRPE-IA-QT.........VVKLGLD.FSN.........VKTEQSLAKA
S26A2_HUMAN/569-715HTLKEVRRDYE.A-IGIQVLL-AQ-CNPT-VR-DS.........LTNGEYC.KKEE.......ENLLFYSVYEA
O45016_CAEEL/553-725GALKDVYNDYK.T-IGISVLF-AN-TNEH-VR-QN.........FETSQFF.EEVP.......RGRMFVSVSDA
SULP3_CAEEL/546-696STLKSVYVDLQ.A-AGIQCFF-VV-QKSD-LK-KL.........FRATDFY.EVVD.......ESKVFNKVGDA
D6EY97_STRLI/11-115RLLYRARSQVL.D-GGGQVRL-VC-THAM-TL-RM.........LRITGLA.RLL..........PPWPTLDEA
O04001_SPOST/529-651AFLIDIKKSIE.K-RGLELVL-VN-PTGE-GH-GKNTASERGTQAFQVGIA.CIL..........TTGEAVASL
SUT32_ARATH/505-623SMLEELNKILG.R-RELKLVI-AN-PGAE-VM-KK.........LSKSTFI.ESIG.......KERIYLTVAEA
F7UTR9_SYNYG/440-540LAIETMLKDAL.A-KQREVFL-VG-AKGQ-VQ-AR.........LQRLPVL.A............QLSPHHRLE
D4G5E9_BACNB/4-107GVFVGTFKMVK.K-QGGSLKL-EN-LSER-LI-RL.........FDITGLK.DII..........DISAKSEGG
O69205_ACTPA/8-112SLLVEAARRGR..-..ARLVL-AT-AQRG-VL-RP.........LQLTGMS.ALL..........PTHPTVDLA
F7UNW5_SYNYG/4-107RILVFAKQKMG..-SGVEIFL-VG-TQEM-VN-DT.........IEQTGLH.HSF..........HLVESYDFH
SP2AA_LYSSH/4-107GLVLGRMRELE.A-VAGRTIL-LN-PSPT-MR-KV.........FQFSGLG.PWM...........MDATEEQA
B0B7Z6_CHLT2/3-107RVLLQSYHQVG.K-NAGKIAL-TS-VSKT-VE-QT.........LYVTGFL.SYF..........KVFDSVNEA
A0A038FD55_MYCTX/15-120SVFISARWQADFR-ADVPVLL-VC-GHRA-GR-AA.........VTRTGVA.RFM..........PVYPTEKAA
S26A1_RAT/529-685ATLKDLRKNYR.A-LDITLLL-AC-CSPS-VR-DT.........LRKGGFL.GEDQG....TAEELLFPSVHSA
F7UNW3_SYNYG/2-105RLLLYLYRQTT.A-NSAQLVL-VG-LSEE-LI-DT.........MAVTGFL.DFF..........TTRPTLAEG
SP2AA_BACME/4-109GVILGRYKQVH.N-NGGEMVV-CA-ISPA-IE-RL.........FNMSGLF.KII..........RFEPNEANA
E8VB29_BACST/421-528AVLGNIMNRIK.R-HNGKLMI-VG-LQSQ-PK-EL.........LHKTGLF.HKIG.......KQHFFDHHDEI
A0A024I404_LISMN/4-109GVFVGAFKSLR.Q-RQSELVL-FG-LSDR-LF-RL.........FEITGLS.DII..........EIKNVEGEM
Q46665_ECOLX/332-437DAFQRFVKRLP..-EGCELRV-CN-VEFQ-PL-RT.........MARAGIQ.PIPG.......RLAFFPNRRAA
S26A4_HUMAN/536-725RSLRVIVKEFQ.R-IDVNVYF-AS-LQDY-VI-EK.........LEQCGFF.DDNI......RKDTFFLTVHDA
RSBV_BACLI/4-107GVFVGIYKAVN.R-TGGSLVL-EN-LSER-LI-RL.........FDITGLK.DII..........DISGKSEGG
D4GA39_TREPC/17-124GSFTAFLKTVK.P-KGGDIVL-LD-IQPR-VY-EV.........FQLLGFS.QFF..........NIRDSIADA
A0A038VVM1_MYCTX/550-649GALAAACDRAR.K-QGTECVL-VA-PPGS-PA-HH........VLSLVQLP..............VVGADTEDI
O67306_AQUAE/448-564ETIVRLVKDIK.Q-KGVEVAF-AN-IGCD-VY-PI.........LENAGFD.EVVN.......QDLVFNAKGEA
D0ZZC5_CHLPP/2-106RLLLSNFKLVQ.S-LGGKMCL-CC-VKES-VT-EV.........MRIAGLD.QLI..........LLCQSEQEC
SUT31_ARATH/514-633SMMVEIKKVID.R-RALKLVL-SN-PKGE-VV-KK.........LTRSKFIGDHLG.......KEWMFLTVGEA
Q9Z6P5_CHLPN/441-545HALEEFFLECD.R-QGTLLLL-AG-VKKT-PL-AD.........LKRYHLD.ELIG.......VDHIFSNIKSA
O17951_CAEEL/537-690SALKEVFSDLR.K-KRVQVYF-AS-TKVP-VR-EM.........FEKCSFF.DFVS.......KENFYPTLRDA
A0A038F5T9_MYCTX/6-111KILAATSEKIG..-QSVKFGV-VA-RGSV-TR-RP.........IHLMGLD.KTF..........RLFSTLHDA
SP2AA_BACLI/4-109GVVLGRYKEIK.Q-LGGEMIV-CA-ISPA-VK-RL.........FDMSGLF.KII..........RLEQSEQRA
F7UT52_SYNYG/433-538LALENAIEEAA.E-KGRAVYI-VG-ATGQ-TK-RR.........LEKLQVF.RFVP.......ESNCYDDRSEA
SULH1_SCHPO/592-725QALVDTRKELE..-.......-IY-AGDE-VE-FH.........FTDINND..............WIKRTLVAA
A0A038KUN0_MYCTX/29-135AVLAQESVRCR.R-RGVNMRL-VS-NQPI-VA-RT.........IAACGLR.RLI..........PLYATVETA
F7UK55_SYNYG/438-545RWFKTLSQSLN.Q-QGITLKL-VN-ASGF-VR-DR.........LRAEGLE.GEV..........GTFRRLDTV
Q9Z841_CHLPN/3-107RVLLQSYHQVG.Q-HSGKIVL-TT-VPKT-IE-QT.........LYVTGFL.SYF..........KIFNTVDEA
O07488_YEREN/391-488SALDKVVIKFR.R-EGAGVEI-RG-MNEA-TR-TI.........VDRFGVH.DKP.............EEVEKL
SUT33_ARATH/498-617SFFKELKKTTA.K-KDIELVF-VN-PLSE-VV-EK.........LQRADEQ.KEFM......RPEFLFLTVAEA
F7UNH6_SYNYG/396-498GTVEQIMTKFR.R-NGIDVEL-VG-LNGA-SA-TL.........WQKLIKE.PEL..........KLINSSAEN
SP2AA_GEOSE/4-109GVILGRYKQIK.N-VGGQMVV-CA-VSPA-VK-RL.........FDMSGLF.KII..........RVEADEQFA
S26A3_HUMAN/526-716RGLKSILQEFI.R-IKVDVYI-VG-TDDD-FI-EK.........LNRYEFF.DGEV......KSSIFFLTIHDA
SUT41_ARATH/519-638EALKELYQEYK.T-RDIQLAI-SN-PNKD-VH-LT.........IARSGMV.ELVG.......KEWFFVRVHDA
B0B8Z1_CHLT2/2-106RTLLSLAKLTQ.N-HNGKLCI-CC-LRDE-VA-DI.........IRIAGLD.KVI..........TIRKAEQES
A0A038FGB0_MYCTX/18-124AVLAHEAERCR.R-RGVDVRL-VS-RDRA-VA-RI.........IHACGYG.DVL..........PVHPTTESA
D4FVP2_BACNB/147-272HQIFKLIEALN.L-IGVRSTL-SG-IRPE-IA-QT.........AVQLGID.FSN.........ITIKTNLAQA
SUT1_STYHA/538-656HAFEELYKTLQ.K-REVQLIL-AN-PGPV-VI-EK.........LHASKLT.ELIG.......EDKIFLTVADA
G2TL00_BACCO/4-109GVILGRYKQIK.Q-KNGEMIV-CA-ISPA-VK-RL.........FELSGLF.KII..........RLDESEQYA
A0A050EIQ5_MYCTX/443-553....QLRTELL.R-RGIVFAM-AR-VKQD-LR-ES.........LRAASLL.DKIG.......EDHIFMTLPTA
A0A038F804_MYCTX/31-137AALADEAQRCR.C-RGIDLRL-VS-HQPI-VA-RI.........AEAGGLS.RVL..........PIYPTVDTA
SP2AA_PAEPO/4-109GVILGRYKLIN.Q-KGGEMAV-CD-VNPP-VH-RL.........LDMSGLF.KIM..........PIYDNEVNA
A0A023ZIX9_YEASX/572-707QVLEEIITSYK.R-RNVFIYL-VN-VSIN-DK-VRR.......RLFKAGVA.ASVERAQANNNENNTSNTFSDA
SUT21_ARATH/548-668TALLELHNKLI.K-TGVELVI-VN-PKWQ-VI-HK.........LNQAKFV.DRIG........GKVYLTIGEA
B2S2G7_TREPS/5-107GVLISAYDEGL.K-YQRRLCI-LN-PSES-VR-RA.........IELTGFS.EMF..........TVIKSLDEL
J7JQU5_BACIU/148-254DQIFKLSHLLK.L-TGTELII-TG-IKPE-LA-MK.........MNKLDAN.FSS.........LKTYSNVKDA
D4G5E6_BACNB/5-111KVLGDVITMSK.L-MGAKVVL-TG-IQPA-VA-VT........LIELGIAL.EEI..........ETALDLEQG
A0A038FF51_MYCTX/385-486RALLYFIDHSE.K-DGVAVSI-KR-IPPR-LE-S...........QLTALA.DNEQ.......RDKLRTVLESA
D4G5E5_BACNB/151-261HHIIQASEAVR.L-VGAKCLL-AG-IRPE-IA-QT.........IVNLGID.LSQVI.....TKNTLQKGIQTA
SUT11_ARATH/518-636HSIEELLKSLE.K-QEIQLIL-AN-PGPV-VI-EK.........LYASKFV.EEIG.......EKNIFLTVGDA
Y1081_THENE/1-106GVIVNILKSVS.S-VGGFFAL-VS-PNER-VE-RV.........LSITNLD.RIV..........KIYDTISEA
SUT3_STYHA/511-631LALEELHKKLL.S-RGVELAM-VN-PRWE-VI-HK.........LKVANFV.DKIG.......KERVFLTVAEA
SULH3_SCHPO/533-653FAFQRILKEYV.E-HQVEVHL-VS-LDPQ-VL-HI.........FEKHGLL.DLI..........GGYDHVQDS
YG35_YEAST/657-777EGFNRIKRFTE.T-KRIKLII-SS-IKER-DR-IYN.......AFNNVGLL.NDV..........ELFADLNSA
A0A038FHX3_MYCTX/29-135SLLCILDEDCR.A-AGVQWAL-VA-SPAV-VE-QLG......GRCDQGEHE.SMF..........PMARSVHKA
B2S3D2_TREPS/4-108GVLIYLCSTVK.K-LKIHFFI-SG-VHGS-VK-KV.........IELTRLL.NYF..........PIAESVDEA
F7UM20_SYNYG/3-107VVLVNTYKELQ.S-QNRTLLL-SG-VSPE-LK-II.........FELTQLN.RVF..........PIYSNPEVA
G4EUZ2_BACIU/163-272HQLFSLIEALR.L-IGVSSTL-SG-IRPE-IA-QT.........AVQLGLS.FEG.........ISLRSTLASA
Q40008_HORVU/530-648HALEELLKALE.K-RKIQLIL-AN-PGPA-VI-QK.........LRSAKFT.DLIG.......DDKIFLSVGDA

PF13466

Q310Z9_DESAG/492-572QLLCAAAAQAK-E.RGGRLES.EG.LPSAGLM.QT---------LVLAGFD-----------------------
B5HV30_9ACTO/31-112DLLARLQLAAR-R.AGGRIRL.RD.PDPA.LH.AL---------LDLVGLR-----------------------
A9BX84_DELAS/2-83AVLLACRRTAK-A.ADKQLVV.VG.LPQG.LQ.SM---------AALYGVD-----------------------
Q0K681_CUPNH/47-125AVLLAWNRAAA-A.RNQALSL.RG.VPPQ.LS.QL---------ASLYGVD-----------------------
B5H529_STRPR/9-95DALARLHLTAR-R.HGSRLRL.RN.AGPD.LL.TL---------LDLVGLP-----------------------
Q0RDC2_FRAAA/24-104GVLLGGARRAR-A.AGRSMVL.VD.VPSA.LG.RM---------FAADRLG-----------------------
D1AD83_THECD/187-267AMLARAA.DAR-P.RGGPLVL.DR.MPAP.VR.SM---------VEMIGLD-----------------------
D2SCD5_GEOOG/29-109RVLAAGEALAD-S.RGCTLQL.VG.PAPF.TA.RL---------LRVVGMG-----------------------
A1VK31_POLNA/2-82AILLECRRQAM-A.AGKVFSV.QG.APGR.LL.QL---------AEVYGVS-----------------------
A8ZVX1_DESOH/4-85QVICSAARSFA-Q.RDKHLAL.DA.PPPAAFS.RQ---------LEKSGMA-----------------------
Q3SFW3_THIDA/281-359SQFISVLMQCL-G.SGKSITL.RG.HNAL.IH.EL---------FRVMGID-----------------------
B9TGW9_RICCO/228-309ALLLEWLRIAE-V.KQKQVAL.TG.MPAH.MQ.AL---------VRVGGLE-----------------------
A1W422_ACISJ/2-83AVLLECRRAAV-F.ENRGFVV.KA.LPPA.LS.SL---------AGLYGVQ-----------------------
A1U461_MARAV/15-95SMLLCWQRLAL-S.RHCHLSF.TG.ASER.LR.SL---------AALSNLQ-----------------------
Q21UA2_ALBFT/4-85AVLLEFRRAAL-A.QGKRFST.QG.LPKR.LA.DL---------AALYGVV-----------------------
B1Y2Z1_LEPCP/2-84GLLLSCRRHAQ-T.HGRGFST.QA.LPQR.LV.RL---------ASLYGLS-----------------------
Q8EEQ5_SHEON/14-91QWLLALKGL..-N.VVQRVEF.CH.HSKA.VI.DA---------LELSGLS-----------------------
D2S5L7_GEOOG/30-110RGLGTAYRRAL-R.HDRRLGL.TG.APPF.LH.QE---------LIRLRLD-----------------------
A7MNS4_CROS8/14-91ALLVHLVALTQ-A.GGRGVTL.EG.MSEN.LT.TL---------AKLYNLP-----------------------
B9JTP2_AGRVS/23-100QVLVSGAKTWE-E.DQKTFSI.KK.ASDA.FT.KT---------IQLLGLN-----------------------
B8DPA7_DESVM/571-651QLLQSAAVTAR-A.RGVDLAA.TGLVSEA.VA.EA---------ARRTGLD-----------------------
C6C1P3_DESAD/15-93SLFMMMKAGCR-D.RGSSLVI.NG.LRPE.FA.SF---------LELFDLD-----------------------
E3I167_RHOVT/14-94QVLIAADIAGE-K.LGRTITL.LRVPEGA.VE.AS---------FARAGLA-----------------------
E3IYM7_FRASU/24-104AALLRADLLLR-R.VRGSLEI.RS.ATPA.FL.EL---------VTATGLT-----------------------
C1D624_LARHH/5-83ALALELSREAG-Q.HGHSLQH.LH.LPVE.VE.SL---------IDLYGLQ-----------------------
A4YXB4_BRASO/320-399GLLLMLRKQLD-S.QGCTATF.AG.VSPQ.LA.RI---------FHFGGLE-----------------------
D1C014_XYLCX/37-113AFLARLATRM.-...PQKVRI.LR.APPT.VR.FL---------LDVTRIG-----------------------
C6WD00_ACTMD/919-1001ALLLEAAEVAA-G.RGRGVGVVVT.EGSA.PA.RI---------MAVSGLH-----------------------
E3J1T6_FRASU/56-136RALVASAGNLH-R.DGRGLVL.HA.VAPW.LL.GL---------LIVTGWD-----------------------
C6WQ84_ACTMD/60-139AALTAAYLRAG-G.RTRLLVV.AG..HRA.VL.RP---------LRIAALD-----------------------
Q2SPQ4_HAHCH/13-91QLLLAVQKRQL-S.HGGGIDW.LE.ASDY.MK.QV---------VRLLSLQ-----------------------
D2SFP4_GEOOG/531-612RVVLAMARIAG-E.EGWRLVV.HA.PEGG.VTRHV---------LEISGLG-----------------------
D2B5R7_STRRD/72-150WLLAQAAHSL.-P.TGKKVFL.HH.APYC.LR.SV---------LALIGPD-----------------------
B8DLB2_DESVM/179-259AVLAELVRHAR-G.LGRAVRI.SG.VSPN.LS.TV---------FDVVGIA-----------------------
D0KYU0_HALNC/26-108AFLLGWQAEAA-A.QSVTVRY.TH.PPKA.MR.AM---------MRVYDLD-----------------------
D5X3Z8_THIK1/566-644GALLNWAMMQH-D.QGKTLQF.TG.VHRL.IA.GL---------FSILGLH-----------------------
B9J943_AGRRK/10-87QVIMAAAKTWD-E.DKLSFTF.SK.VSDA.FQ.KT---------LQMIGID-----------------------
B1W2W2_STRGG/20-107EAVARLALVAR-R.SGRTLRL.RR.VPPE.LR.SL---------LDLVGLA-----------------------
A1SBD9_SHEAM/6-85QLLLCLQSHCE-N.SSIPLNW.KG.ITTE.LV.AQ---------FKQMGMQ-----------------------
A0LC67_MAGSM/14-94GMFLMLRAHAG-E.AEADITL.RN.PTNL.VL.RM---------LLAARFD-----------------------
A4YMN9_BRASO/16-97GMLMFLSATAK-S.KNKSLGV.SN.ANQQ.VL.AV---------MHKANLG-----------------------
C7LTF6_DESBD/15-91QILCSLLK...-D.EDKRISF.VN.LPTH.LL.EN---------AASLGAD-----------------------
B1LTK1_METRJ/26-107WVLERTRAEIE-Q.AGSALTY.LG.ARPE.HR.IL---------LGEVRLR-----------------------
Q0RZA3_RHOSR/48-126AVLADAGTRLR-E.QRSRLTV.AA..FGP.LR.HI---------LDDAGID-----------------------
C5BID3_TERTT/281-360AFLLLMDCRLQ-K.YHSRLEI.IA.VSDA.LA.KT---------FQQQGVA-----------------------
Q2SBJ1_HAHCH/18-100SLLLRLVAAAE-A.KGLNVSV.SG.LTGK.MF.DI---------ARVSGVE-----------------------
B5HHQ5_STRPR/28-107YGLLRAVTVAP-E.A.AVITV.RG.ARRG.VV.RT---------LRQAGLD-----------------------
Q1QXI2_CHRSD/17-99GFLAKVAMAVE-GRLEQPPTI.VA.EHPD.VR.RM---------LDVMGFS-----------------------
Q12BT3_POLSJ/427-501GTVHELVG...-...RGRVVL.AG.VTPV.VR.AL---------FEELSMD-----------------------
C9R4W7_AGGAD/20-98ALLCDFLNERK-Q.L.....L.QN.PPSQ.LL.TL---------ADLFGLS-----------------------
D9T369_MICAI/189-267.SLLHLRDHAR-R.HDAVAVL.RT.PSRA.PA.RL---------VDLLGLS-----------------------
Q31HM4_THICR/6-86QALLALIKSAM-A.NQKKIQW.DS.PTDT.LK.MG---------AEKLGLT-----------------------
Q31GZ5_THICR/18-93ALLLYFQSLI.-...DHPLKV.LS.LPDD.LK.VL---------VNLYNLD-----------------------
A7H922_ANADF/18-92AALAHGLAGG.-...RQRLLM.RG.LRQH.QL.RI---------FRYFGVD-----------------------
Q21SV7_ALBFT/514-592GSILNWVALRE-S.EGCSVQF.RD.VPRL.VA.AF---------FNVIGIN-----------------------
A3N1T8_ACTP2/20-99TLLAELLNYYQ-K.Q.TPNCL.IH.VPEV.VK.TL---------ADLFDL.-----------------------
B2FP86_STRMK/2-73ALLAELAARAR-K.AGHPLVI.TG.APAG.YN.EL---------SAAYRLS-----------------------
F9ZTS0_ACICS/20-97ALLLDWQERAL-Q.RKRPLVL.TG.LGPG.LR.EL---------VHLYGLE-----------------------
Q2IMF1_ANADE/97-172AVLAQALS...-A.RGIRASF.RG.LGQH.QL.RL---------LRYLGLD-----------------------
Q3J3N5_RHOS4/5-82QLLLAAAAKWR-A.EGHQFTC.QP.MSPA.FT.DD---------VTRLGVD-----------------------
Q3J659_RHOS4/7-80QVLVSAARTAG-A.TGRRLVL.AQ.DHPA.LT.DA---------FA.....-----------------------
Q6DAF4_PECAS/14-89ALLMHVYQQP.-S.SGGEIAI.VG.ASDR.LK.TL---------IALYNL.-----------------------
Q87LF2_VIBPA/15-93VMLIHLLEHAK-K.QNCHIML.SF.VPAQ.LR.TL---------FQLSNV.-----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window