Sequence alignment for CL0504

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------------------------
FII_LAMBD/1-117--------------------------------------------------------------------------------
FII_BPN15/1-117--------------------------------------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------------------------
A3MZN0_ACTP2/1-99--------------------------------------------------------------------------------
B8F4K5_HAEPS/1-99--------------------------------------------------------------------------------
M9X5I9_MANHA/1-99--------------------------------------------------------------------------------
Q8ZQ92_SALTY/1-90--------------------------------------------------------------------------------

PF09393

F6DLR2_DESRL/1-131MA------------------------------------------------------------------------------
R7FA15_9CLOT/4-145IT------------------------------------------------------------------------------
A9KPP0_CLOPH/4-148VT------------------------------------------------------------------------------
A5I2K4_CLOBH/3-146.F------------------------------------------------------------------------------
R6NS73_9FIRM/11-143..------------------------------------------------------------------------------
F2F2L4_SOLSS/3-140.T------------------------------------------------------------------------------
C4Z5U0_EUBE2/2-139.A------------------------------------------------------------------------------
R5BEH1_9FIRM/6-141..------------------------------------------------------------------------------
R5AL39_9FIRM/3-146.Y------------------------------------------------------------------------------
Q65L22_BACLD/1-141MA------------------------------------------------------------------------------
R6M2J8_9FIRM/6-141.K------------------------------------------------------------------------------
R6QFB0_9FIRM/2-146AY------------------------------------------------------------------------------
R5H4V3_9FIRM/3-147KQ------------------------------------------------------------------------------
D1AHR6_SEBTE/5-149ET------------------------------------------------------------------------------
C0Z6Z9_BREBN/3-140.R------------------------------------------------------------------------------
C6D1T3_PAESJ/3-147.F------------------------------------------------------------------------------
A3DIA9_CLOTH/4-148NY------------------------------------------------------------------------------
D3EHB9_GEOS4/2-143AF------------------------------------------------------------------------------
F9VIU9_ARTSS/5-149VK------------------------------------------------------------------------------
Q18BM9_PEPD6/2-140AN------------------------------------------------------------------------------
D4MVP4_ANAHA/2-140KT------------------------------------------------------------------------------
A6TQV7_ALKMQ/4-142SK------------------------------------------------------------------------------
Q24LI3_BPPCD/3-141TS------------------------------------------------------------------------------
D3EHD6_GEOS4/2-130..------------------------------------------------------------------------------
I4D3G0_DESAJ/2-140NN------------------------------------------------------------------------------
Q892H5_CLOTE/3-141GH------------------------------------------------------------------------------
Q184A4_PEPD6/3-147QT------------------------------------------------------------------------------
R6UQ00_9FIRM/3-141EI------------------------------------------------------------------------------
R5TBQ4_9FIRM/10-152.T------------------------------------------------------------------------------
M1MSJ7_9CLOT/3-147NF------------------------------------------------------------------------------
R6PBH3_9FIRM/5-148IT------------------------------------------------------------------------------
A6TRA1_ALKMQ/2-131.S------------------------------------------------------------------------------
R6PLB1_9FIRM/3-147VI------------------------------------------------------------------------------
A5N9B6_CLOK5/3-133DV------------------------------------------------------------------------------
R5BLA9_9FIRM/2-140NS------------------------------------------------------------------------------
L7VLA7_CLOSH/4-149NY------------------------------------------------------------------------------
I0GWR6_SELRL/2-140EN------------------------------------------------------------------------------
R5BQR6_9FIRM/9-143.K------------------------------------------------------------------------------
Q24QE7_DESHY/2-147AF------------------------------------------------------------------------------
D9R927_CLOSW/3-146AY------------------------------------------------------------------------------
R6HTP3_9FIRM/3-147TV------------------------------------------------------------------------------
R6Q009_9FIRM/2-140DK------------------------------------------------------------------------------
A9KKK2_CLOPH/4-149IT------------------------------------------------------------------------------
W8T695_EUBAC/3-142GA------------------------------------------------------------------------------
R6ST47_9CLOT/2-146SF------------------------------------------------------------------------------
C8VZG4_DESAS/2-142AA------------------------------------------------------------------------------
D4M0Z1_9FIRM/4-148VT------------------------------------------------------------------------------
G4L1J2_OSCVS/6-136..------------------------------------------------------------------------------
U5MV98_CLOSA/3-133EV------------------------------------------------------------------------------
F2JK33_CELLD/10-154QQ------------------------------------------------------------------------------
A5N2B8_CLOK5/3-131..------------------------------------------------------------------------------
B2TNV8_CLOBB/5-135KE------------------------------------------------------------------------------
C0ZFE9_BREBN/2-132..------------------------------------------------------------------------------
F3ZZH5_MAHA5/2-128AY------------------------------------------------------------------------------
M1MI16_9CLOT/3-138..------------------------------------------------------------------------------
X2GJE7_9BACI/3-140.K------------------------------------------------------------------------------
A5I4B2_CLOBH/1-131MA------------------------------------------------------------------------------
A6LTZ2_CLOB8/3-133DV------------------------------------------------------------------------------
A6LRW9_CLOB8/3-141NQ------------------------------------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404GE-----NVFDFAVPA---------------------DHSS.SQ...YVVEGNLVA.......FRDID.NYWQFFEIKRV
A5D093_PELTS/222-567GE-----NSLELSVPA---------------------GHED.AQ...YITEENLVA.......IKDLDEDFYQLFVIKEV
A5VJT7_LACRD/39-685SA-----YEISFTLTY---------------------TEQY.KDAFNLVKEKRYVN.......YRG......HDYLIQQV
A5VKI8_LACRD/34-537GD-----YTLTFTAYD---------------------DG...SEAYSMLTNQSWVY.......DHG......EIFVIKQV
B2TMG9_CLOBB/35-355ET-----YELELTYPV---------------------G....SFLYDKLKGNRYIKAKS.NNRYES......QIFRIYYI
B8I7P6_CLOCE/418-720GA-----DTLEFKLPW---------------------NDSK.RV...HLDNEKQVQ.......VAH......DIYRIRTL
C4Z844_AGARV/33-364DA-----GTFEFTVPC---------------------TNPLYSKIENRVSMVQVLKDG..NEIFNG......QVRECSEV
D9SSG9_CLOC7/29-338GD-----ENLSFSYPH---------------------NDDK.YT...FIKEECYLR.......TAQ......NEYVIKEI
F3YBF3_MELPT/27-330EF-----GQLNFTMLD---------------------RKEN.KLAYQLLVPGTKITV.....PESN......NHYKISTN
F9UQU7_LACPL/38-346EK-----WQVTFAITD---------------------SLAY.EQAIKLLDVQNIVH.......YDG......QSYVIIQC
G8M053_CLOCD/417-718GA-----DTLEFKLPF---------------------HDPK.RS...TLENEKQVQ.......IVN......DIYRIRTL
I6T7G9_ENTHA/33-340ET-----WEIGLSVTN---------------------LI.N.QEVFDLIEYESSII.......FNG......QEFIIKKM
Q5WE58_BACSK/33-341GE-----KMLSFSVEK---------------------TERN.AALFDMILPKEVII.......FEN......ERYVIDPF
Q5WIB8_BACSK/8-317GE-----RSISFSLLK---------------------TDRN.AHVFDALTHKQKVE.......VGG......NKYVIDTI
Q65ET7_BACLD/226-551GK-----KSFTFTITK---------------------TQEN.GTEFDLLVDDNILYLD..EKKFKH......QKYYITGV
Q65KF3_BACLD/29-328GQ-----RSIKLNGYK---------------------TTNN.QYGYQFVKNENTVV.......YDD......EEYIIKTH
Q835T2_ENTFA/29-351KI-----GSLDFTMPL---------------------DDPK....NEFIAEMQWVELTDNENEYIG.......LYRVMPT
Q8Y4Z4_LISMO/34-333EM-----WSIEFKVAQ---------------------TPKN.AHCYSFLDYESSVY.......FRG......QEFVVKQL
Q8YAK1_LISMO/33-338TS-----RAISFTVNK---------------------TKQN.AAIFDLVGNEAILT.......YQG......QQFVIKKC
Q9K758_BACHD/67-370GI-----DQVTFTLPW---------------------KDEK.RK...YLVNENLVQ.......LVN......SIYIIRRV
Q9KGP3_BACHD/67-375GI-----DTVTFNIPF---------------------SDEK.NQ...FIQNEHLIQ.......IID......DYYIIRKI
R4K6I2_CLOPA/41-361VA-----EKLTFTVPK---------------------FNPGFDKIYDLVTLIKVIGIRNNEIRFEG......R..VLSSP
V5XMR9_ENTMU/31-336ET-----WEVGFVIRK---------------------TIRN.SVVYDLVTYESSVI.......FQG......QQFVIKEM
W6S0H7_9CLOT/417-718GE-----DTLTFSIPF---------------------RDSK.RK...YLENEKKIQ.......IVD......DVYKVRTI
X5A593_9BACL/39-378AD-----DTLTFSVPM---------------------SS...DDFRDKLPLKGHVK......DERG......QYYVINSR

PF13550

A1AYP0_PARDP/820-985--------------------------------------------------------------------------------
A1B627_PARDP/791-955--------------------------------------------------------------------------------
E0THS4_PARBH/770-933--------------------------------------------------------------------------------
A7HRK9_PARL1/775-940--------------------------------------------------------------------------------
A7IK58_XANP2/791-954--------------------------------------------------------------------------------
A8LQN2_DINSH/795-960--------------------------------------------------------------------------------
A9CJN3_AGRFC/756-923--------------------------------------------------------------------------------
B0SVY2_CAUSK/777-933--------------------------------------------------------------------------------
B0UJ15_METS4/791-954--------------------------------------------------------------------------------
B1LTZ4_METRJ/785-952--------------------------------------------------------------------------------
B6JDQ1_OLICO/759-925--------------------------------------------------------------------------------
B9JU38_AGRVS/757-919--------------------------------------------------------------------------------
Q0AR61_MARMM/759-917--------------------------------------------------------------------------------
Q28RU9_JANSC/978-1139--------------------------------------------------------------------------------
Q3SUI4_NITWN/802-967--------------------------------------------------------------------------------
C6XID3_HIRBI/772-930--------------------------------------------------------------------------------
A8HR63_AZOC5/794-957--------------------------------------------------------------------------------
D9QF99_BRESC/731-889--------------------------------------------------------------------------------
B2JUI8_PARP8/529-699--------------------------------------------------------------------------------
D0J488_COMT2/383-550--------------------------------------------------------------------------------
A9BYF1_DELAS/314-478--------------------------------------------------------------------------------
Q2G3K6_NOVAD/231-396--------------------------------------------------------------------------------
Q1GRM1_SPHAL/243-405--------------------------------------------------------------------------------
Q2N607_ERYLH/223-386--------------------------------------------------------------------------------
B8EKU0_METSB/229-420--------------------------------------------------------------------------------
B2IJD4_BEII9/227-411--------------------------------------------------------------------------------
Q2WA44_MAGSA/316-506--------------------------------------------------------------------------------
C9R735_AGGAD/265-435--------------------------------------------------------------------------------
Q2W6E0_MAGSA/315-503--------------------------------------------------------------------------------
Q2SAL7_HAHCH/191-365--------------------------------------------------------------------------------
A7I049_CAMHC/190-363--------------------------------------------------------------------------------
B2FM10_STRMK/213-385--------------------------------------------------------------------------------
E6WEJ9_PANSA/332-495--------------------------------------------------------------------------------
A6VNR7_ACTSZ/335-501--------------------------------------------------------------------------------
Q8XYR0_RALSO/340-503--------------------------------------------------------------------------------
B2JL07_PARP8/351-514--------------------------------------------------------------------------------
Q2W829_MAGSA/500-665--------------------------------------------------------------------------------
A5CF56_ORITB/744-904--------------------------------------------------------------------------------
B9KI53_ANAMF/694-848--------------------------------------------------------------------------------
C5AYQ3_METEA/784-949--------------------------------------------------------------------------------
D5AU04_RHOCB/799-959--------------------------------------------------------------------------------
G8PN64_PSEUV/767-937--------------------------------------------------------------------------------
N0B519_9RHIZ/827-991--------------------------------------------------------------------------------
TIPJ_LAMBD/332-498--------------------------------------------------------------------------------
Q1QNE9_NITHX/777-937--------------------------------------------------------------------------------
Q3J233_RHOS4/334-499--------------------------------------------------------------------------------
Q3J3J4_RHOS4/795-953--------------------------------------------------------------------------------
Q5F989_NEIG1/222-406--------------------------------------------------------------------------------
Q7ARG4_YERPE/359-522--------------------------------------------------------------------------------

PF16792

H9EDD6_9CAUD/1-372ML-----EANVYDNFN---------------------PNYYNIFDFNLPNGQKAQRGLPTPK----------ARCQVINY
H9ED19_9CAUD/1-372ML-----EANVYDNFN---------------------PNYYNISDFSLPNGKKEKRGLPTPK----------ARCQVINY
D3LCP7_OENOE/1-372ML-----EANVYDNFN---------------------PNYYNISDFSMPNGKKEKRGLPIPK----------ARCQVINY
H9EFC2_9CAUD/1-372ML-----EANVYDNFN---------------------PNYYNISDFSMPNGKKEKRGLPIPK----------ARCQVINY
GP16_BPLP2/1-372ML-----EANVYDNFN---------------------PNYYNISDFSMPNGKKEKRGLPIPK----------ARCQVINY
C7T1V4_9CAUD/1-372ML-----EANVYDNFN---------------------PNYYNISDFTLPNGKKDKRGLPIPK----------ARCQVINY
O80118_9CAUD/1-372ML-----EANIYDNFN---------------------PNYYNISDFNLPNGKKEKRGLPIPR----------ARCQVINY
C7T205_9CAUD/1-372ML-----EANIYDNFN---------------------PNYYNISDFNLPNGKKEKRGLPIPK----------ARCQVINY
C7T2B2_9CAUD/1-372ML-----EANIYDNFN---------------------PNYYNISDFNLPNGKKEKRGLPIPK----------ARCQVINY

PF05954

Q1LDW8_CUPMC/39-340VE.RLG.DPYRVTVQL...T.................HPVDLDRAE..YLNRNATFVIHAG.................DD
C5AP32_BURGB/40-351KA.RLG.RNFEVVVDAL.ST.................SGDSIQFKT..LLMQPVTLWIQQT..................D
A8IB09_AZOC5/33-335KE.GLS.ELFLFTLTM...T..........ST.....KA.DITPDS..LLGKPITVAIARP..................G
A9G446_SORC5/24-329VE.AIS.RPYQIEIFL...LL........QGE.....DAESLDLPD..AVGAKASLVLDW....................
B1M1X9_METRJ/41-344EE.AIS.SLFQAEIAL...A..........SP.....DP.GLDLTA..LLDKPARLTVLDR.................YG
A9GQF5_SORC5/30-340IE.RLS.RCFSFDVTA...RLD......AGVI.....DE.ATFAAT..LMERPACLRVPTS.................AT
A9EVZ6_SORC5/26-317RE.RLH.EPSRFEVTA...A.................VDGSVELGS..LLAQPARLAWALP..................D
Q98IK7_RHILO/26-327RD.EIS.RSFAYTVGF...V..........SK.....SR.DVDPLK..MLGGV..VSVEGE..................S
A9FA22_SORC5/24-354HE.GIS.TLFTVSISA...T...........S.....EDPSVDFDA..IIGQPASFRAARDLA.............FSPL
A9GAG1_SORC5/23-352QE.AVS.ELFAVSVWA...R...........S.....RLSDLELES..LVGQSASLQIQPDAA.............HLHW
C1AEJ4_GEMAT/29-353EE.AVS.SLFHFTVVA...A...........S.....ERNDIKPKE..LLLKGVTLELELG..................G
Q2L040_BORA1/29-322TE.ALS.ALFDFRLRL...R..........SE.....KL.DIDPKA..LLGSQMTVRLQRP..................G
B2U7V1_RALPJ/41-362RE.ALS.ELFTYTVDL...RPVSLAADQSML.........ESDLDA..AIGHEMTLSIELDGMGTG........LLGGVG
A9FDZ6_SORC5/23-354QE.SIS.GLFTLSILA...R...........S.....PNADVDLES..IVGKRASFRIANGFD.............FASS
B4E682_BURCJ/41-356WE.SLDRGGFRFQLTA...L...........T.....ERPDLPLDK..LIGASILIEWQVAD................GQ
B1XWY3_LEPCP/24-338RG.GLS.TLGELELDL...L..........SP.....KP.GLDPLA..LLGQPLSVNVTLH..................D
B4E676_BURCJ/37-356RE.SLS.DLFEWNVDA...L...........S.....TDPALDLDA..MLGQRVAIRTTLA..................N
A1KB80_AZOSB/48-380RE.ALS.RCYRYELSC...L...........S.....PDAAIELKT..LLGRRVEIRLRLA..................D
Q47E10_DECAR/36-349RE.AIS.ESFRFEIDC...V...........S.....TNAYFDLKP..LIGEEITLRLLQA..................D
Q8XUG6_RALSO/40-368RQ.GLC.AGLQAQVIC...L...........S.....EHPDLPQQD..LLGVPVSIQLATN..................E
C5AKJ1_BURGB/40-354TA.RLG.RDYEFVVEAAALL.................DGGDIDARA..ILGSAVTLWIRQT..................D
Q0K251_CUPNH/36-365TE.GIN.SLFEYELEL...KTPDDR.NVLYGP.....AG.DFDLEA..MQGKELTVSIELDGSGSG........LDGGLG
C5BAE3_EDWI9/29-331EE.SVS.DLYRFELEL...F..........ST.....EP.TLEWQK..LVGQAAALRLALP..................D
Q747T8_GEOSL/38-336DE.RIS.HPYDIHLTL...A.................TKDNVDLDE..VIDKEAVLSVDH...................E
A5G0B1_ACICJ/27-330QA.ALS.QCFRYTLSV...R..........AG.....AG.GLDPND..LLYTSVTVAIGSD.................GT
Q6LUC9_PHOPR/30-341HE.EIS.GLFSLKAQA...F...........A.....NGVFINREG..LIGSNVSVALKYNI...............GKQ
A1KCD6_AZOSB/26-329DE.ALS.QVSEFEIDC...L..........SD.....KT.DINLDD..ILGKQLSLRVMLP..................T
C5AHV1_BURGB/44-356HA.RLG.RDVEWTLDVV.S..................TVSNLELKA..LIAQPVTLWIQQG..................D
Q8XRR3_RALSO/37-355RE.ALS.ELFEWRVVA...A...........S.....ANARFALES..FIGQRVTLVTTLA..................D
C6XDI4_METGS/47-391RE.GIN.TLFDYQLTV...RSR......LGEV.....GS.DLDFGP..LMGQVLTCGISLEGHGQFLPGALGDFGMANQG
A9C0N9_DELAS/23-326QE.NIS.QLFSLDVEM...L..........SE.....SE.SIDPKA..LLGKNATIEIETQ..................G
Q87HD9_VIBPA/30-349RE.GIS.ELFSLRAKA...Y...........F.....NDQKNELNE..IVGKEVTISVENSS...............RVS
A6TAS8_KLEP7/34-358AE.KLS.ELYYYTITF...T...........S.....AEKNIDAAQ..LLSKPAMLTM.GGGA.............LQQL
Q0JYG5_CUPNH/32-330RE.ALS.ELFRFSLRM...R..........SA.....DK.ALDAGR..IVGQRLTVTLQHP..................G
B4E680_BURCJ/35-341RE.GIS.ESFRFEIDV...L...........S.....SEPFLDLAP..LIGSAVRLRLATA..................A
C5A958_BURGB/38-352TE.GLS.QNFEFHVRLA.S..................QDSNIELKK..LIGQPVTITLQLTDA..............LAS
Q0JZD4_CUPNH/35-364TE.RLC.ELFEYELEL...KTPDDR.QALFGP.....AA.DLDTKA..LRGQELTVTIQLDGMGTG........MAGGVG
B4EUE4_PROMH/79-373NE.GLS.ELFTLTIQV...V..........ST.....QS.DIDFSY..YLGGASSLTVRRN.................GK
Q7MDQ8_VIBVY/30-349RE.EMS.ELFSLRVYA...Y...........F.....NGQKGELNQ..IMGQPVIIKMDNNS...............QVM
C5AA20_BURGB/41-355HA.ELG.RDYSVTLDLV.S..................SAGDIELKT..LIAQPITLWVRQA..................D
A9FYV0_SORC5/370-667RE.AIS.QLFTFDVEV...V..........CP.....SDAGVDGQT..FTGESVAIVFEQN.................RV
Q88I93_PSEPK/38-347TE.ELS.KLYEFDLALL.S..................QQSDVKLKS..LIGSQATVEIELS..................N
Q3A0Q0_PELCD/27-339KE.ELN.RPFAFDVSV...L.................ADSFAALLD..CLGAPVSLFMTAP..................D
C5AMP3_BURGB/41-355YS.ELG.RDFSVTLDMV.S..................TASDIELKT..LIAQSMTLWILQA..................D
C5ALD6_BURGB/39-369SE.ELG.KLFDYKVLL...RTPDDY.AIPLAA.....SA.NLGLSA..MLGKELTVSIQLDAPAG.........AQGTAQ
Q8XS52_RALSO/44-358CA.RIG.RNYDFQIDAI.H..................VLDAFKPRD..LMAQPVTLWIQQT..................D
Q080W0_SHEFN/30-339TE.AIS.QLFSISVSM...F...........T.....VGTQISLDS..LVGKNVCITLRNAE................SN
Q2SGF0_HAHCH/101-403QE.GYS.QLFQYDVDL...L...........S.....HKRDIRAED..IIGEAVQVTIGAD..................G
D2QZK3_PIRSD/24-327YE.ELG.RLFEYKLRL...L...........S.....KDGAIKLDD..LIGKNVTISVELV..................D
B4EH48_BURCJ/40-354QS.RIG.RDYLFMVDCV.S..................TSNDVQLKA..LISQPITLWIQQT..................D
C5AMI6_BURGB/41-362TE.EMN.TPFVADITV...T...........S.....KDKHIDGAA..VIGRPAIFSIEEHASVPSL.....PGLINPVQ
Q28MX5_JANSC/33-346RE.VIS.GFFEGTLVA...R..........SK.....SR.DLAPGD..LLGSLVDVSVELG..................G
Q47J31_DECAR/32-356RE.ALS.GGFEICIDL...L...........A.....TDTHLELKR..FLGRSLTLNTRLS..................D
C5A8I9_BURGB/40-354RS.RLG.RDYGFTLDVV.S..................SHDDLPLKS..LIAQPVTLWLQQA..................D
Q6FFL7_ACIAD/42-385KH.TLN.EGLEVELTC...L...........S.....INAHIALKQ..FIGCQVAIDQVTD..................T
A1B4U8_PARDP/26-330EE.QVS.APFAFELRF...S..........AR.....TL.DLKPAD..LLGTRATIAVKGA.................ED
Q8XQT0_RALSO/113-430DE.YVN.RLPEIHLDL...L..........SH.....QG.DIQIDQ..IVGQPVSIRLEPKASGSALS....QLMAGPDI
A1K519_AZOSB/50-375EE.GLN.MCHRITVRC...V...........A.....VDARIELIT..MLGLRAAIGIRTA..................D
Q3A0Q1_PELCD/40-341KDHGIS.QDFRFTLTL...T.................AQAELTAST..VVGNRATMEMRW...................G
Q6F782_ACIAD/42-387YH.AIN.DGLSVELIC...I...........S.....TNPYLSLKQ..FIGCQAAIDQVTD..................T
Q1QVA4_CHRSD/41-355EE.RVS.APFTYTLDCI.S..................QQNDLELKT..LLAQPARLSILQA..................D
A7MMD4_CROS8/36-364RE.GLS.TRYRYDVRL...T...........S.....SDKDIDPAM..MLMKNVTFIM.QTLPQTA.......FRRTLAP
A9BLL4_DELAS/23-327RE.EIS.HLFALEIDL...L..........SE.....SD.SIDPKA..LLGKGATVVVETQ..................D
A0KJD1_AERHH/29-325EE.GLN.RPFNLRLEL...A...........S.....AQPDIDFGA..VLDQPCELLVWYN..................G
A1TTP1_ACIAC/24-327EE.ALS.ALSAFEIDL...L...........S.....KDKGIDPKA..LLGLGATVSIETE..................G
B4F002_PROMH/27-319QE.GIS.QLFTLSIQA...V...........S.....PLSEIDFND..VLGMASSLTVKRD..................G
B9JVA0_AGRVS/37-346.E.GVN.RLFEITLSV...R...........A.....KREAVKPEE..LIGKLVDVSLEIRQGE............LDGD
G3XCU8_PSEAE/32-313...GMESDSLTLRID......................DRDGQVALP..RRGAVLEVHL......................
I1SBE4_PECAS/30-328.E.GLN.RPFSLSLSL...A...........S.....ALPDVDFGA..VLDQPCELMIWYE..................G
I2BBZ6_SHIBC/54-354.R.SLESIAGEFDLTI...T...........A.....RWSAAAPRS.IKPGQSCTVSVG.....................
BPD_BPP2/42-365NR.GFEADQLDIELN......................DADGQVGLP..VRGAVLTVYI......................
Q0KDW7_CUPNH/38-356HE.GLS.ELFTYKVDL...RA.........VSPAAEQYLAEADPDA..MIGREMTVTIELDGMGTG........LLGGVG
Q3IWJ2_RHOS4/27-325.D.GLG.RPFRYELLL...A...........S.....KSLDLGAAD..ILGTPVLVTVRG....................
Q5DYX3_VIBF1/29-334.E.TLG.ENYQFDVTF...I...........C.....EEPELNLAQ..WLQLPACLTLHHDN...............NPD
Q63II0_BURPS/23-325EE.ALG.RMFDFRIEA...L...........A.....DNHSLSLKE..LLGKPVTVRIRQQ..................D
Q63K62_BURPS/46-349.D.AIS.QPYRFEITL...V...........S.....RQLRIDFAK..MLSRGATLAILPPF................GE
Q63LB9_BURPS/58-337.....EADTIDIVLD......................DS.KNDLDI.PKRGATIKASI......................
Q63LQ5_BURPS/38-351SE.GLS.VLFDMRLGL...V...........S.....RDPTIELKQ..MIGQAVTISLQPSGA..............IVG
Q63P68_BURPS/44-375.E.GLM.TGIHGRLTC...V...........S.....TRRDLPPGV..LLGIPVSIRLITD..................R
Q63TB7_BURPS/37-356RE.TLS.ENFQWDVYA...L...........A.....TDPGLDLDA..MLGQRVTIRTALA..................N
Q7CGL8_YERPE/58-356NE.AFS.SPFVLHVGL...A...........S.....ADPAVDFSA..VLDEDATLSIWRE..................G
Q7CHB6_YERPE/23-325TR.SIEKLPSSFELSL...MDR.......YPA.....SG.GQ...QWVNPGDPCVVKLG.....................
Q8ZRL1_SALTY/121-429.E.TLS.ELFSYVVQL...KTPDTL.NLGYVS.....PAANLPLKP..MVGKDLCVNIELD..................G
Q9I1A6_PSEAE/30-322.E.ALN.ELGSLTLGG...Y...........S.....AT.ALTLSN..AVATHLTATLHN...................D
Q9I3K1_PSEAE/27-327EE.ALC.EPFRLNLKL...A...........S.....DKNAIDFRQ..VLDQPGTFTLWQD..................G
Q9I737_PSEAE/29-329RE.ELG.RPFAYELEL...I...........S.....ENPDLPLDG..LLGKPASLALELH..................D
Q9PAL7_XYLFA/37-321........ADTLEVVL...A...........D.....HLPNAPLKL.PPMGAELELAL......................

PF09096

BP27_BPT4/203-375---MINQEPYPM------------------------------------IVGEPSLI------------------------

PF06763

Q2SI49_HAHCH/7-189------------------------------------------------IKGADTAIRQL---------------------
K7A372_9ALTE/15-199------------------------------------------------.........DL---------------------
COMPL_BPN15/3-184------------------------------------------------LKGLEQAIENL---------------------
Q8ZN01_SALTY/1-192------------------------------------------------MKGLENAIRNL---------------------
Q8ZQG7_SALTY/3-194------------------------------------------------LKGLENAIRNL---------------------
Q8ZQ91_SALTY/3-188------------------------------------------------VKGLKEAISVL---------------------
COMPL_LAMBD/3-192------------------------------------------------IKGLEQAVENL---------------------

PF09097

BP27_BPT4/5-200QRPGYP--------------------------------------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------MSQ---------SENL--
FII_LAMBD/1-117--------------------------------------------------------------MAD---------FDNL--
FII_BPN15/1-117--------------------------------------------------------------MAD---------FDNL--

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------MSD------------F--
A3MZN0_ACTP2/1-99--------------------------------------------------------------MCS------------P--
B8F4K5_HAEPS/1-99--------------------------------------------------------------MPS------------L--
M9X5I9_MANHA/1-99--------------------------------------------------------------MSS------------P--
Q8ZQ92_SALTY/1-90--------------------------------------------------------------MAD------------L--

PF09393

F6DLR2_DESRL/1-131--------------LDA-----------------------------------------SRVILGT---------YGQV--
R7FA15_9CLOT/4-145--------------MNA-----------------------------------------KDAVSAK---------LAEC--
A9KPP0_CLOPH/4-148--------------MIG-----------------------------------------KDAVSAK---------LAQC--
A5I2K4_CLOBH/3-146--------------LKA-----------------------------------------GDTISGQ---------EARG--
R6NS73_9FIRM/11-143--------------...-----------------------------------------GKVISGT---------HGYF--
F2F2L4_SOLSS/3-140--------------RKS-----------------------------------------KRVINGT---------HGAV--
C4Z5U0_EUBE2/2-139--------------VET-----------------------------------------KRICNGT---------FGEL--
R5BEH1_9FIRM/6-141--------------.IK-----------------------------------------NKIIRGN---------YGKV--
R5AL39_9FIRM/3-146--------------LRA-----------------------------------------KDTVNGA---------LGTC--
Q65L22_BACLD/1-141--------------LKA-----------------------------------------QNTISGK---------EGRL--
R6M2J8_9FIRM/6-141--------------PRG-----------------------------------------NQLCSGT---------FGKL--
R6QFB0_9FIRM/2-146--------------LRA-----------------------------------------KDTVNGA---------LGTC--
R5H4V3_9FIRM/3-147--------------LKS-----------------------------------------YDTISGK---------EGTA--
D1AHR6_SEBTE/5-149--------------MRG-----------------------------------------RDAISGS---------MAKC--
C0Z6Z9_BREBN/3-140--------------PDA-----------------------------------------SRVINGT---------YGRI--
C6D1T3_PAESJ/3-147--------------MLE-----------------------------------------SDAISGK---------QATA--
A3DIA9_CLOTH/4-148--------------VRL-----------------------------------------SDTISSK---------EGKA--
D3EHB9_GEOS4/2-143--------------LRA-----------------------------------------SDTISGQ---------EGKA--
F9VIU9_ARTSS/5-149--------------MHS-----------------------------------------RDTISAA---------LAEC--
Q18BM9_PEPD6/2-140--------------MEA-----------------------------------------RNVMSGT---------WGEL--
D4MVP4_ANAHA/2-140--------------FED-----------------------------------------NDVINGS---------WGEV--
A6TQV7_ALKMQ/4-142--------------IPS-----------------------------------------NKQINGT---------FGAL--
Q24LI3_BPPCD/3-141--------------FES-----------------------------------------KNVINGT---------FGEC--
D3EHD6_GEOS4/2-130--------------LDA-----------------------------------------SRVIMGT---------YGQA--
I4D3G0_DESAJ/2-140--------------YTA-----------------------------------------DQVLNGT---------WGEM--
Q892H5_CLOTE/3-141--------------YAE-----------------------------------------ENVINGT---------WAEL--
Q184A4_PEPD6/3-147--------------INA-----------------------------------------KDTVSAK---------KAEC--
R6UQ00_9FIRM/3-141--------------LDA-----------------------------------------ALVRSGT---------WGSL--
R5TBQ4_9FIRM/10-152--------------MLA-----------------------------------------KDVISAK---------LASA--
M1MSJ7_9CLOT/3-147--------------LNY-----------------------------------------SDTLSGT---------EAKG--
R6PBH3_9FIRM/5-148--------------MNA-----------------------------------------KDAIAAK---------LAKC--
A6TRA1_ALKMQ/2-131--------------FNP-----------------------------------------DRAFYGS---------FSKL--
R6PLB1_9FIRM/3-147--------------MNV-----------------------------------------RDTLSAK---------MAEC--
A5N9B6_CLOK5/3-133--------------LEA-----------------------------------------GRTIHGR---------FGEV--
R5BLA9_9FIRM/2-140--------------MEA-----------------------------------------KRVMNGK---------YADL--
L7VLA7_CLOSH/4-149--------------VRL-----------------------------------------SDTISSH---------EGKA--
I0GWR6_SELRL/2-140--------------MES-----------------------------------------KRVFYGT---------YGQM--
R5BQR6_9FIRM/9-143--------------YRG-----------------------------------------RRRWNGS---------HGHL--
Q24QE7_DESHY/2-147--------------LRA-----------------------------------------EDAVGGK---------QAKA--
D9R927_CLOSW/3-146--------------TKI-----------------------------------------TDLVTGS---------EGSA--
R6HTP3_9FIRM/3-147--------------MNA-----------------------------------------KDAVYGS---------LAEC--
R6Q009_9FIRM/2-140--------------VNT-----------------------------------------NNIIRGT---------YGRV--
A9KKK2_CLOPH/4-149--------------MNA-----------------------------------------KDTISSS---------LAEC--
W8T695_EUBAC/3-142--------------FRG-----------------------------------------KNQLSGS---------HGKL--
R6ST47_9CLOT/2-146--------------LLE-----------------------------------------RDAVNGK---------EGRG--
C8VZG4_DESAS/2-142--------------LDS-----------------------------------------FRTINGS---------YGAV--
D4M0Z1_9FIRM/4-148--------------MKA-----------------------------------------RDTIAAK---------LAEC--
G4L1J2_OSCVS/6-136--------------...-----------------------------------------.RVINGT---------HGAL--
U5MV98_CLOSA/3-133--------------LDA-----------------------------------------SRICNGS---------FGKV--
F2JK33_CELLD/10-154--------------MHA-----------------------------------------KDTVSAS---------LAEC--
A5N2B8_CLOK5/3-131--------------LDS-----------------------------------------SRTIHSR---------YGKI--
B2TNV8_CLOBB/5-135--------------LDS-----------------------------------------SRICSGT---------YGRV--
C0ZFE9_BREBN/2-132--------------...-----------------------------------------KETYSGT---------HGHF--
F3ZZH5_MAHA5/2-128--------------LEP-----------------------------------------DRTILGS---------YGEV--
M1MI16_9CLOT/3-138--------------.QA-----------------------------------------KQVINGT---------WGEV--
X2GJE7_9BACI/3-140--------------LKS-----------------------------------------NRVINGT---------FGSV--
A5I4B2_CLOBH/1-131--------------LDA-----------------------------------------SRTIHGS---------KGKI--
A6LTZ2_CLOB8/3-133--------------LDA-----------------------------------------SRVCSGT---------YGKI--
A6LRW9_CLOB8/3-141--------------ALA-----------------------------------------NKVLTGS---------SGNL--

PF06605

A4J7Q0_DESRM/62-404LDIHG----AGG..LVR-----------------------------------------TAHCEHV.........VYEL--
A5D093_PELTS/222-567EEIHD----E.V..TYK-----------------------------------------RAYCEHA.........AFEL--
A5VJT7_LACRD/39-685EAKHD----ENG.LATL-----------------------------------------QVTATHRLIDAMKDIVLYST--
A5VKI8_LACRD/34-537SDAPS----QGS..SAI-----------------------------------------QVTCSQI.........YTEL--
B2TMG9_CLOBB/35-355SQPIN----.....GEI-----------------------------------------TVKAEHI.........SYKL--
B8I7P6_CLOCE/418-720TDEKG----ADGTGVLT-----------------------------------------TVYAEAA.........FYDL--
C4Z844_AGARV/33-364LK...----.....GEK-----------------------------------------EVKCVGE.........LAFL--
D9SSG9_CLOC7/29-338NVNDD----WTE..VVA-----------------------------------------KVNVEALKGTPFGHFQVNEL--
F3YBF3_MELPT/27-330NGASI----GKY..KQR-----------------------------------------TITALSI.........DRDL--
F9UQU7_LACPL/38-346TKTVS----GGV..SVY-----------------------------------------EVTASHL.........FYRL--
G8M053_CLOCD/417-718TDNKS----EDG.RVIT-----------------------------------------QVYAEAV.........FYDL--
I6T7G9_ENTHA/33-340TKNVV----GGL..VTK-----------------------------------------QIVATHI.........YYTI--
Q5WE58_BACSK/33-341DHSPI----GMT..SEK-----------------------------------------SVEARHE.........IFDI--
Q5WIB8_BACSK/8-317TKTGD----SV...IRK-----------------------------------------SITAQHE.........IVDR--
Q65ET7_BACLD/226-551ELHQE----KNV..ISK-----------------------------------------TVTASHIFTVLLINNRIHET--
Q65KF3_BACLD/29-328RERTY----RKG..VGV-----------------------------------------EATAIHR.........IFDD--
Q835T2_ENTFA/29-351TIKKD----ANN..NQI-----------------------------------------HYSATEA.........LCTL--
Q8Y4Z4_LISMO/34-333SHDAV----GKT..LSK-----------------------------------------DIRAPHI.........YYTC--
Q8YAK1_LISMO/33-338TPKSI----GGT..LSK-----------------------------------------QITAQHI.........CYTV--
Q9K758_BACHD/67-370SVKRS----GLS.PAEI-----------------------------------------EVYAEAL.........WYDL--
Q9KGP3_BACHD/67-375THSRG----SQG.VPIT-----------------------------------------EVYAEAL.........WYDL--
R4K6I2_CLOPA/41-361NKMDN----TGK..FYK-----------------------------------------EVTCEGE.........LAYL--
V5XMR9_ENTMU/31-336QESAV----GEA..VYK-----------------------------------------RVVATHV.........YYTI--
W6S0H7_9CLOT/417-718TDVKD----STG.NTVT-----------------------------------------QVYAEAE.........FYDL--
X5A593_9BACL/39-378QRNRE----DRK..LTA-----------------------------------------QISCSHV.........MFKL--

PF13550

A1AYP0_PARDP/820-985--------------TSI-----------------------------------------.ESPKSS---------IAML--
A1B627_PARDP/791-955--------------SGA-----------------------------------------.ETGRAA---------LQPL--
E0THS4_PARBH/770-933--------------PGP-----------------------------------------.MRVREA---------LGAL--
A7HRK9_PARL1/775-940--------------DRI-----------------------------------------.MSPRAA---------LEPL--
A7IK58_XANP2/791-954--------------DQP-----------------------------------------.MAGRDA---------LEPL--
A8LQN2_DINSH/795-960--------------DNI-----------------------------------------.SSARAS---------LQPL--
A9CJN3_AGRFC/756-923--------------GDI-----------------------------------------.TSARNL---------LEPL--
B0SVY2_CAUSK/777-933--------------DRP-----------------------------------------.MRLRDA---------LAPL--
B0UJ15_METS4/791-954--------------AEV-----------------------------------------.QAPRDS---------LAPL--
B1LTZ4_METRJ/785-952--------------DRP-----------------------------------------.LTARGA---------LETL--
B6JDQ1_OLICO/759-925--------------TER-----------------------------------------.KPVRDM---------IAVL--
B9JU38_AGRVS/757-919--------------GDV-----------------------------------------.SSARSL---------IEPL--
Q0AR61_MARMM/759-917--------------DRP-----------------------------------------.MPARDA---------LAPL--
Q28RU9_JANSC/978-1139--------------AQT-----------------------------------------.QSARAR---------LQPL--
Q3SUI4_NITWN/802-967--------------DRP-----------------------------------------.MSPRAE---------IEAL--
C6XID3_HIRBI/772-930--------------DNA-----------------------------------------.LSIRDS---------LEPL--
A8HR63_AZOC5/794-957--------------SDP-----------------------------------------.TTARAA---------IEPL--
D9QF99_BRESC/731-889--------------DRP-----------------------------------------.MRTRDA---------LEPL--
B2JUI8_PARP8/529-699--------------TNH-----------------------------------------.SATRNN---------LAPL--
D0J488_COMT2/383-550--------------SQT-----------------------------------------.ANTRSA---------LEVL--
A9BYF1_DELAS/314-478--------------ASA-----------------------------------------GYSGADA---------INSL--
Q2G3K6_NOVAD/231-396--------------DQ.-----------------------------------------.GTASDV---------LAVL--
Q1GRM1_SPHAL/243-405--------------S.G-----------------------------------------.DRARDA---------LTPL--
Q2N607_ERYLH/223-386--------------DGG-----------------------------------------.PLAR.S---------LEAI--
B8EKU0_METSB/229-420--------------SNQ-----------------------------------------.ESANSI---------LTRW--
B2IJD4_BEII9/227-411--------------TTQ-----------------------------------------.ETASSL---------ITRW--
Q2WA44_MAGSA/316-506--------------SEQ-----------------------------------------.QTAAQM---------IEDI--
C9R735_AGGAD/265-435--------------NRQ-----------------------------------------.TSIKEF---------IKQI--
Q2W6E0_MAGSA/315-503--------------TEQ-----------------------------------------.QTGAQV---------IDDI--
Q2SAL7_HAHCH/191-365--------------SQQ-----------------------------------------.SKIEQF---------VKEV--
A7I049_CAMHC/190-363--------------SRS-----------------------------------------.NEAKEW---------IKEI--
B2FM10_STRMK/213-385--------------TRQ-----------------------------------------.QAIESF---------IAQV--
E6WEJ9_PANSA/332-495--------------TDA-----------------------------------------.SSARDV---------LDKI--
A6VNR7_ACTSZ/335-501--------------TEQ-----------------------------------------.RNAYDV---------VSDM--
Q8XYR0_RALSO/340-503--------------QQR-----------------------------------------.NDAYPV---------LQDL--
B2JL07_PARP8/351-514--------------QER-----------------------------------------.ADAITL---------LQHF--
Q2W829_MAGSA/500-665--------------DTS-----------------------------------------.MTVWEA---------LTRI--
A5CF56_ORITB/744-904--------------...-----------------------------------------..KTIDV---------INML--
B9KI53_ANAMF/694-848--------------...-----------------------------------------.TSAEAV---------VKEL--
C5AYQ3_METEA/784-949--------------DRP-----------------------------------------.LSAREA---------LEPL--
D5AU04_RHOCB/799-959--------------..D-----------------------------------------.QTGRAG---------LQAL--
G8PN64_PSEUV/767-937--------------.GP-----------------------------------------.TSLRSA---------LTPI--
N0B519_9RHIZ/827-991--------------DDT-----------------------------------------.MSARDA---------LQPL--
TIPJ_LAMBD/332-498--------------..Q-----------------------------------------.RKAWDV---------LSDF--
Q1QNE9_NITHX/777-937--------------DRP-----------------------------------------.MSPRAM---------IEPL--
Q3J233_RHOS4/334-499--------------...-----------------------------------------.TEPLEV---------IEEL--
Q3J3J4_RHOS4/795-953--------------.EV-----------------------------------------.VSARAA---------LQPL--
Q5F989_NEIG1/222-406--------------TEQ-----------------------------------------.GEAQRN---------ISEL--
Q7ARG4_YERPE/359-522--------------TSR-----------------------------------------.QDAYRL---------IQDI--

PF16792

H9EDD6_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
H9ED19_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
D3LCP7_OENOE/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
H9EFC2_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TFTVSVE---------VGDI--
GP16_BPLP2/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
C7T1V4_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
O80118_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
C7T205_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--
C7T2B2_9CAUD/1-372ELWET----GYLYTSSA-----------------------------------------TLTVSVE---------VGDI--

PF05954

Q1LDW8_CUPMC/39-340SEPRK....FAGWISEF....SK.............TRQ...TRD..FCG....Y...EIVVEPL---------VSRL..
C5AP32_BURGB/40-351GNYLP....IHGYVQRA....RR.............LGS...DGS..VSY....F...QIHFSSW---------LSFL..
A8IB09_AZOC5/33-335GDPRY....INGIVTRF....QA............GDRT...VDG..MRR....Y...RVELSPK---------LWLL..
A9G446_SORC5/24-329PKDNVPPFVFAGVLATVGVLHEL...................DGR..SLL........RAVLVPK---------LWLL..
B1M1X9_METRJ/41-344P.PRH....VHGVLALA....ER.............GDT...GAH..HTR....Y...SVLLMPA---------LHRL..
A9GQF5_SORC5/30-340E.ARA....VTGVVTRV....SV.............EGA...DGD.GRAV....V...RVRIEPR---------LALL..
A9EVZ6_SORC5/26-317GSERA....VLGSVDVV....ES.............VAQ.....G.........L...RVTIVPK---------IALL..
Q98IK7_RHILO/26-327DPKRW....FSGLVSDF....KL.............TRI...EDR..LAY....Y...EATVRPW---------LWFL..
A9FA22_SORC5/24-354GAARL....WSGLCNSM....QL.............ARA........EPLGRSTY...HLRIVPR---------LWLL..
A9GAG1_SORC5/23-352LSSRL....WQGVCSHV....EQ.............VQA........EPTGLSTY...YLRIVPR---------LWLL..
C1AEJ4_GEMAT/29-353GKKRT....ICGVVRRF....A..............RGG...EYAEGHST....Y...LLEIVPP---------HWAL..
Q2L040_BORA1/29-322SRARF....LHGLVTRF....GH.............LGA...DAR..NAW....Y...EARLQPR---------MCLM..
B2U7V1_RALPJ/41-362AGVRE....ITGLITAV....EL.............IGG...VDN..NRL....Y...RYTLRPW---------FWLA..
A9FDZ6_SORC5/23-354G.ARF....WTGVCNQI....EQ.............VQA........ETTGLSTY...HLRIVPA---------LWLL..
B4E682_BURCJ/41-356GARRP....FHGHVTAA....ER.............VGY...NGG..LAR....V...RLVVEPW---------LALL..
B1XWY3_LEPCP/24-338GSQRH....FSGLVSRF....GMGRDRPAGAAPTGAAAG...QGR..YYA....Y...RARVVPW---------LWFL..
B4E676_BURCJ/37-356GTTTL....RSGLVAEA....EC.............RGY...DAG..LAR....Y...HLRIVPW---------LAAL..
A1KB80_AZOSB/48-380GAARL....FCGVITEM....EA.............TGA...DGG..FAR....Y...RLVVEPA---------LAML..
Q47E10_DECAR/36-349GSKRS....WHGYVTQA....MQ.............LGA...DGG..LAR....Y...RLIMEPF---------LAFL..
Q8XUG6_RALSO/40-368GVLYP....INGVITDI....QS.............GQS...DGT..LTS....Y...RLTVGDA---------MSLM..
C5AKJ1_BURGB/40-354RSYMP....IHGYVHHF....AE.............LGA...DGS..CAY....Y...QLRFSSW---------LYFL..
Q0K251_CUPNH/36-365RGKRE....ITGIVTDV....RG.............PYH...ENE..RIR....Y...RLTLRPW---------FWLG..
C5BAE3_EDWI9/29-331GQTRY....WHGVIGQA....SY.............RGA...EQH..GYA....Y...YAELVPH---------LAWL..
Q747T8_GEOSL/38-336GGTRY....FHGVVREF....TS.............LGT...DGD.........YDLYHAHIVPA---------LWFL..
A5G0B1_ACICJ/27-330N.QTY....INGLVSSV....VQKPG......NAAGTAI...AAGLELWD....H...ELTVVPA---------LWFL..
Q6LUC9_PHOPR/30-341LLTRY....FNGIVVQI....DC.............VGSRMPDKA..ESELYQDY...ILTIRPD---------FYLA..
A1KCD6_AZOSB/26-329GGKRY....FSGYVTRF....AH.............TGT...QGR..YQT....Y...RASVRPW---------LWFL..
C5AHV1_BURGB/44-356GGYRP....VHGYVLVV....RR.............LGS...DGA..MTL....Y...QLRFTSA---------LHFL..
Q8XRR3_RALSO/37-355GTQAR....RTGLIRQA....EQ.............LGA...DGS..LAR....Y...RLTVVPW---------FWLA..
C6XDI4_METGS/47-391TGTRY....VSGLITDI....RH.............VAE...DSR..HAL....Y...VITLRPW---------LHLA..
A9C0N9_DELAS/23-326GGRRF....IDGIVTRF....GM.............QGQ...DHR..HYA....Y...KARLSPW---------LWLA..
Q87HD9_VIBPA/30-349KSPRF....FHGIVSAAKLEGQR.............VMN...SHN..GEN....YKNIEIIVEPK---------VKFA..
A6TAS8_KLEP7/34-358ADCKR....VHGVVTAF....RR.............ISS...SED..QSK....Y...QITLEPF---------LSLL..
Q0JYG5_CUPNH/32-330GAPRY....LNGIVTRF....AH.............AGA...DHN..HGF....Y...TAELAPR---------LWLL..
B4E680_BURCJ/35-341G.ERC....WNGYVTHA....AY.............AES...DGE..FTR....Y...RLTMESW---------LALL..
C5A958_BURGB/38-352SEERH....FHGYVANF....SH.............LDH...DGG..FTL....Y...RATIVPW---------LWML..
Q0JZD4_CUPNH/35-364AGTRE....ITGMVTDV....RG.............PIA...VGH..QIV....Y...RLTLRPW---------LWLA..
B4EUE4_PROMH/79-373K.IRT....VQGLLSSA....EQ.............SNT...DGI..KTW....Y...QLEIRPE---------MWVM..
Q7MDQ8_VIBVY/30-349LEPRY....FHGFVAKATLAGSR.............VTKFEDGEN.........YKNIELVVVPK---------LNFA..
C5AA20_BURGB/41-355QSYLP....THGYIHTA....RR.............LGA...DGS..LST....Y...QVTFASW---------MHFL..
A9FYV0_SORC5/370-667E.VRR....VHGMVAEV....HD.............MLA...NLR.DHRA....Y...RLHIVPR---------AYRL..
Q88I93_PSEPK/38-347GSFRH....INGYVQRF....ST.............QGS...DGG..YVR....Y...AAVLGPW---------LWML..
Q3A0Q0_PELCD/27-339GYERR....LNGILTEA.....R.............VETDLADGR..SIV........CLSVASR---------LALL..
C5AMP3_BURGB/41-355KSYLP....INGYIHTA....RR.............LGA...EGS..QAS....Y...QLTFASW---------MHFL..
C5ALD6_BURGB/39-369GAVRE....ITGLVTKS....EF.............VRR...EGR..FNV....Y...RVTLKPW---------LWLA..
Q8XS52_RALSO/44-358HTYAP....HHGYVHAV....HK.............IGS...DGG..VHA....V...QLTVSSW---------LHFL..
Q080W0_SHEFN/30-339GAVRY....FHGVVSHL....ES.............AGMRTAASD..DAQNYIDY...QAVIVPQ---------MALM..
Q2SGF0_HAHCH/101-403GAPRV....FSGHVSYF....ES.............TGL........EKRGLYGY...KAVLVPW---------LWFL..
D2QZK3_PIRSD/24-327GRTRY....FNGEVAEF....EQ........................ITESFQDYFVYVAIVRPE---------LWYL..
B4EH48_BURCJ/40-354KSYLP....HHGYIHTA....RK.............LGV...DGG..LAC....Y...QLSFSSW---------LHFL..
C5AMI6_BURGB/41-362QATRT....VHGIVTQW....TR.............VKT...SRD..EAT....Y...QLHLKPR---------LALL..
Q28MX5_JANSC/33-346GERRS....WNALVMGM....TA..............GP...KATRGLQS....Y...TLMLRPE---------AWLL..
Q47J31_DECAR/32-356GSRAS....RSGLVRAA....QK.............LGA...DGG..FAR....Y...RLTVVPW---------IWLL..
C5A8I9_BURGB/40-354QRYRP....IQGHVFTA....RR.............LGA...DGG..LTT....Y...QLTINAW---------LHLL..
Q6FFL7_ACIAD/42-385GQLAR....TSGIITRA....TQ.............GQS...DGA..LTL....Y...TLNIQDS---------TALW..
A1B4U8_PARDP/26-330SEPRH....FDGHVAEF....GL.............AEI...RDD..FAF....Y...RLLLRPA---------LWFA..
Q8XQT0_RALSO/113-430G.KRT....FHGYAASF....GR.............VGH...PGA..VTR....Y...EMTVVPW---------FWFL..
A1K519_AZOSB/50-375GRERI....RCGVVTAG....VA.............LGA...DGG..FAA....Y...EITVEPP---------LALL..
Q3A0Q1_PELCD/40-341GTPLF....LHGLVDHF...................SRE...NDTPEAMC....Y...QVIFTSP---------LSLL..
Q6F782_ACIAD/42-387GKLFR....TTGIITEA....SQ.............GQS...DGA..LTL....Y...RLRLQDA---------TSLW..
Q1QVA4_CHRSD/41-355GSYRP....LHGLVSEA....AL.............LGE...DGG..VTY....Y...QLTLVPW---------LKML..
A7MMD4_CROS8/36-364EVQRT....LYGVITHF....SR.............LSV...SRD..EAT....Y...SLTFEPR---------LSLL..
A9BLL4_DELAS/23-327GGKRY....IDGLVTAF....GMR..........GQDEH.....R..NFL....Y...RARLSPW---------LWLA..
A0KJD1_AERHH/29-325ELQRR....VCGVVSDF....AQ.............GDS...GFR..RTR....Y...QLMVQPA---------LWRL..
A1TTP1_ACIAC/24-327LGRRY....LDGIVTRF....GM.............RGQ...DTS.AQIA....Y...RLTLQPW---------LWLA..
B4F002_PROMH/27-319HILRT....VQGILAAA....EQ.............GNT...DGV..KTW....Y...QFVIRPE---------MWVM..
B9JVA0_AGRVS/37-346GVRRP....FNGLVTNL....SE.............GPP..VTRG..LRS....Y...TLTIRPQ---------LWLL..
G3XCU8_PSEAE/32-313...........GYAGEP...LMR.............MGRFTVDTL..QWAG.PPD...CLTVTAK---------AGDMR.
I1SBE4_PECAS/30-328ELKRR....VCGIISGF....TQ.............GDT...GFR..RTR....Y...QAEVRPA---------LWRL..
I2BBZ6_SHIBC/54-354.NDRV....MTGYIDDF...................IPS..YDAE....N....V...SLRVMGR---------DKTG..
BPD_BPP2/42-365...........GWKGFA...LVC.............KGKFTVDEV.EHRGA..PD...VVTIRAR---------SADFR.
Q0KDW7_CUPNH/38-356AGHRE....ITGVISDI....EH.............VGG...VAE..NRL....Y...RFTLRPW---------LWLA..
Q3IWJ2_RHOS4/27-325EVPRH....FHGIATAF....G..............LDE..IRDD..HAH....Y...RLTMEPS---------MALL..
Q5DYX3_VIBF1/29-334FAPRY....VHGIIESI....EQ.............IST...SFR..NST....Y...RLSLVPI---------FALL..
Q63II0_BURPS/23-325ESERH....LNGIVARA....AL.............VGR..RAER..HYG....Y...QLIVRPW---------LWLA..
Q63K62_BURPS/46-349AGTTR....YAGVLAEF....EQ.............KKR...FRD..FTV....Y...RATLVPR---------LWRL..
Q63LB9_BURPS/58-337...........GWAGEPL..VD..............KGSFVVNEV.EHSGA..PD...IITIRAR---------SAAMT.
Q63LQ5_BURPS/38-351GSPRH....FHGYVTQF....SH.............TGA...DGG..LAT....Y...SATVQPW---------LWML..
Q63P68_BURPS/44-375GQPHT....VNAIISDV....Q..............IGQ..SDGE..LCV....Y...QLTVCDA---------LSLM..
Q63TB7_BURPS/37-356GTSAV....RSGLVAQA....EC.............IGY...DAG..LAR....Y...CLQLVPW---------LAAL..
Q7CGL8_YERPE/58-356ILQRS....ITGMIASF....EQ.............GNT...GFH..QTR....Y...SMVIRPA---------LWRT..
Q7CHB6_YERPE/23-325.NDSV....LNGYIDSW....DN.............AIT...ATT.........H...VVSAMGR---------GKCQ..
Q8ZRL1_SALTY/121-429GGKRH....ISGLVTAA....RV.............VGH...EGR..SVT....Y...ELRMEPW---------VKLL..
Q9I1A6_PSEAE/30-322ADQRP....LDGLVAEI....RQ.............LPG...DAS..AER....Y...QVLLRPW---------LWWL..
Q9I3K1_PSEAE/27-327RPARY....VHGIVSHF....TQ.............GSS...GFR..RTR....Y...ELLLEPQ---------LARL..
Q9I737_PSEAE/29-329GSRRH....FHGIVAAC....SQ.............GSG...NGQ..FAS....Y...QVTLRPW---------LWLL..
Q9PAL7_XYLFA/37-321...........GYDGQL....RP.............MGVFVCSEI.QLSGW..PA...TMTLRAH---------AAPWEG

PF09096

BP27_BPT4/203-375----------------------------------------------------------GQFIQEL---------KYPL--

PF06763

Q2SI49_HAHCH/7-189--------------EGL-----------------------------------------KKEA.DL---------MTVR--
K7A372_9ALTE/15-199--------------NKI-----------------------------------------KASAIPK---------ATTQ--
COMPL_BPN15/3-184--------------NSI-----------------------------------------SKTAVPR---------ASAQ--
Q8ZN01_SALTY/1-192--------------NSL-----------------------------------------DRQMVPR---------ASIW--
Q8ZQG7_SALTY/3-194--------------NSL-----------------------------------------DRHMVPQ---------ASAW--
Q8ZQ91_SALTY/3-188--------------KEL-----------------------------------------DRGYVTR---------AKIR--
COMPL_LAMBD/3-192--------------SRI-----------------------------------------SKTAVPG---------AAAM--

PF09097

BP27_BPT4/5-200----------------------------------------------------------NLSVK-----------LFDS--

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------FD-------TAISQADDAI-----
FII_LAMBD/1-117--------------------------------------------------------FD-------AAIARADETI-----
FII_BPN15/1-117--------------------------------------------------------FD-------EAMSRADGAI-----

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------KK-------LLAEDIDAVF-----
A3MZN0_ACTP2/1-99--------------------------------------------------------FE-------QAMKQADQVI-----
B8F4K5_HAEPS/1-99--------------------------------------------------------FE-------QAFAKADSVI-----
M9X5I9_MANHA/1-99--------------------------------------------------------FE-------QAIAAADQTI-----
Q8ZQ92_SALTY/1-90--------------------------------------------------------FD-------GMKRRMDALI-----

PF09393

F6DLR2_DESRL/1-131--------------------------------------------------------FI....DG-VWQTNVNHLE-----
R7FA15_9CLOT/4-145--------------------------------------------------------YVTIEGRR-YLLMQGKDFE-----
A9KPP0_CLOPH/4-148--------------------------------------------------------FVTIGRNR-YNFMQAINFE-----
A5I2K4_CLOBH/3-146--------------------------------------------------------FITIDGRN-EELFYAKKLE-----
R6NS73_9FIRM/11-143--------------------------------------------------------WW....NN-SICYEITSFE-----
F2F2L4_SOLSS/3-140--------------------------------------------------------WI....NG-EKLFDLESIE-----
C4Z5U0_EUBE2/2-139--------------------------------------------------------WL....DG-DYVGECYKAQ-----
R5BEH1_9FIRM/6-141--------------------------------------------------------WI....DG-ELMANVKSFE-----
R5AL39_9FIRM/3-146--------------------------------------------------------FAIIDGKR-HELMQVKNIQ-----
Q65L22_BACLD/1-141--------------------------------------------------------FL....DG-QEMAHIKTFE-----
R6M2J8_9FIRM/6-141--------------------------------------------------------WI....DG-SLAYEVYKFE-----
R6QFB0_9FIRM/2-146--------------------------------------------------------YARIDGER-HELMQVKNVT-----
R5H4V3_9FIRM/3-147--------------------------------------------------------YVRIDGRN-EELFSAKSIE-----
D1AHR6_SEBTE/5-149--------------------------------------------------------FIDFGDKR-VNFMTAIKLE-----
C0Z6Z9_BREBN/3-140--------------------------------------------------------WV....DG-ELWMEVDEFE-----
C6D1T3_PAESJ/3-147--------------------------------------------------------TATINGRV-EELFYAKSIE-----
A3DIA9_CLOTH/4-148--------------------------------------------------------YITINGQN-RELFEISSLT-----
D3EHB9_GEOS4/2-143--------------------------------------------------------FVKIGDRM-EEMFYIKTLE-----
F9VIU9_ARTSS/5-149--------------------------------------------------------FITIDGSR-YNFMQAINLE-----
Q18BM9_PEPD6/2-140--------------------------------------------------------WL....DG-NKVAEVKKFQ-----
D4MVP4_ANAHA/2-140--------------------------------------------------------WV....DN-DYMAQATALE-----
A6TQV7_ALKMQ/4-142--------------------------------------------------------WL....DG-EKLADVDSFE-----
Q24LI3_BPPCD/3-141--------------------------------------------------------WL....NE-VQIAECKALK-----
D3EHD6_GEOS4/2-130--------------------------------------------------------YI....DG-VWQTHINKLE-----
I4D3G0_DESAJ/2-140--------------------------------------------------------WL....NG-DFMAETIALQ-----
Q892H5_CLOTE/3-141--------------------------------------------------------WI....NG-ELLANATAFQ-----
Q184A4_PEPD6/3-147--------------------------------------------------------FITIEGKR-YNFMQAIDLE-----
R6UQ00_9FIRM/3-141--------------------------------------------------------WL....DG-EQVAECYGCQ-----
R5TBQ4_9FIRM/10-152--------------------------------------------------------YVTVDGNR-YLLFQAKSLE-----
M1MSJ7_9CLOT/3-147--------------------------------------------------------FITVNGRN-EELFYAKKLE-----
R6PBH3_9FIRM/5-148--------------------------------------------------------FITLNGNR-YNFANMIDME-----
A6TRA1_ALKMQ/2-131--------------------------------------------------------LL....DG-EWQTNANSVE-----
R6PLB1_9FIRM/3-147--------------------------------------------------------YVTIENNR-YNFMQAINLT-----
A5N9B6_CLOK5/3-133--------------------------------------------------------LV....DG-VKQTNLQECT-----
R5BLA9_9FIRM/2-140--------------------------------------------------------YI....DG-DLMAEATAFK-----
L7VLA7_CLOSH/4-149--------------------------------------------------------YITINGQN-RELFEISALT-----
I0GWR6_SELRL/2-140--------------------------------------------------------WL....DG-ELLGEVEELK-----
R5BQR6_9FIRM/9-143--------------------------------------------------------WW....DG-ELIFEIAKYE-----
Q24QE7_DESHY/2-147--------------------------------------------------------FATINGRV-EELFYAKSIE-----
D9R927_CLOSW/3-146--------------------------------------------------------FITTDGQN-RYFFELSKIE-----
R6HTP3_9FIRM/3-147--------------------------------------------------------FVTIGDNR-YNFMSLTEFE-----
R6Q009_9FIRM/2-140--------------------------------------------------------WM....NG-ELLAEAKSFE-----
A9KKK2_CLOPH/4-149--------------------------------------------------------FVTIGEER-FNAFHFTQFE-----
W8T695_EUBAC/3-142--------------------------------------------------------WW....NK-NLIAEINKFD-----
R6ST47_9CLOT/2-146--------------------------------------------------------FMTIDGEN-HEMFGLKKFQ-----
C8VZG4_DESAS/2-142--------------------------------------------------------YE....NG-EWLTNFNKMS-----
D4M0Z1_9FIRM/4-148--------------------------------------------------------FITIGSRR-YNFMQMIDME-----
G4L1J2_OSCVS/6-136--------------------------------------------------------WE....DG-NALAEVSAFQ-----
U5MV98_CLOSA/3-133--------------------------------------------------------YI....DG-EWQSNVNECT-----
F2JK33_CELLD/10-154--------------------------------------------------------FVTIEGNR-YNFMQAINLE-----
A5N2B8_CLOK5/3-131--------------------------------------------------------LM....DG-VEQTNVSECT-----
B2TNV8_CLOBB/5-135--------------------------------------------------------FK....DG-KEYPQVSECT-----
C0ZFE9_BREBN/2-132--------------------------------------------------------YDQ...NG-RELPECIGFE-----
F3ZZH5_MAHA5/2-128--------------------------------------------------------YI....DG-ELFANFNHLE-----
M1MI16_9CLOT/3-138--------------------------------------------------------WI....NG-EYVSEVSALQ-----
X2GJE7_9BACI/3-140--------------------------------------------------------WV....NN-EKWLDVEEFE-----
A5I4B2_CLOBH/1-131--------------------------------------------------------LV....DG-EWQTNLTECT-----
A6LTZ2_CLOB8/3-133--------------------------------------------------------YL....DG-KWHNNVSECT-----
A6LRW9_CLOB8/3-141--------------------------------------------------------WF....NG-QLLANLSKIE-----

PF06605

A4J7Q0_DESRM/62-404----------LDD...............................IVTDLR------PTE-CSAY-TALNTALT-G....T
A5D093_PELTS/222-567----------ADE...............................IITDKR------PEN-KMAR-EVLEDILA-A....T
A5VJT7_LACRD/39-685----------IPTEGNPEVSGGGSSD....SGDGDSGDPQPGIVTKQTAV------QQT-YPLN-ERLDHFFN-PNE..W
A5VKI8_LACRD/34-537----------SRSKSVDGNTDWGDIGHKASPDSNAPNQTNQDNKDDENTS------LTP-IGPE-QIMKYYIG-DANNTN
B2TMG9_CLOBB/35-355----------NDN................................FVEKA------TCN-GNCQ-TALNTLNS-NAAFPT
B8I7P6_CLOCE/418-720----------TFS..............................AEKQPRE------FNA-DLPS-APMSYALE-G....T
C4Z844_AGARV/33-364----------YDS...............................IQPQAK------YQN-QSPL-QFFTNLLT-IHNNQV
D9SSG9_CLOC7/29-338----------TLP................................SATID------SIK-KACA-NTINLALA-G....T
F3YBF3_MELPT/27-330----------HAH...............................YIDQVL------KGS-QSLE-SCLNFILK-G....T
F9UQU7_LACPL/38-346----------ANNA............................RQNNVKTG------TLT-YGLS-EAVNFMLD-NND..Q
G8M053_CLOCD/417-718----------SFS..............................AEKEPRE------FNA-DTAD-VPMQYALL-G....T
I6T7G9_ENTHA/33-340----------QDG...............................YQYEKV------TGT-KSIN-QLLTHIFK-AGN..R
Q5WE58_BACSK/33-341----------LKA..............................EYQTKET------TGA-LRIR-KALDLALE-N....T
Q5WIB8_BACSK/8-317----------MRS..............................EFYKESH------TQT-LSIQ-RCMEICFL-S....T
Q65ET7_BACLD/226-551----------V.......................................------SKK-LRLR-DALDFALK-N....T
Q65KF3_BACLD/29-328----------LRN..............................NYIYDEK------TGT-LRLD-AMLSFALE-G....S
Q835T2_ENTFA/29-351----------GDT..............................VLFGCHE------IKN-KTTK-EAIQFLLN-KQ....
Q8Y4Z4_LISMO/34-333----------QDG...............................RQDDAI------TGS-FTLE-QCLTHIFK-TDN..R
Q8YAK1_LISMO/33-338----------QDH.............................VQYNVKSG------RKK-YSIQ-TVLEFALQ-DNV..L
Q9K758_BACHD/67-370----------QFA..............................EPVEHAR------WES-ATPE-VIMKDILD-G....T
Q9KGP3_BACHD/67-375----------QFA..............................EPMDISE------WEG-RAPA-IVMADILR-G....T
R4K6I2_CLOPA/41-361----------NDT...............................RTRSWD------LSG-LSII-QGLQLLID-YHNSHT
V5XMR9_ENTMU/31-336----------QDG...............................YQYNKI------TGR-RTPM-QLLMHILG-TGA..R
W6S0H7_9CLOT/417-718----------TFS..............................VRKEEKK------FDA-EMAD-VAMAYALA-D....T
X5A593_9BACL/39-378----------ADY...............................KFPYAS------YMA-EGYG-IHITQLTA-LIQSAT

PF13550

A1AYP0_PARDP/820-985----------ARH-----------------------------------FG------FDA-CETG.GLIRFVSR.G.....
A1B627_PARDP/791-955----------MLA-----------------------------------HG------FDA-VERD.GVLRFVMR.G.....
E0THS4_PARBH/770-933----------LDI-----------------------------------YQ------IDM-VERG.ALLVMRPR.A.....
A7HRK9_PARL1/775-940----------MLA-----------------------------------CF------FDA-AESE.GTIRLRHF.G.....
A7IK58_XANP2/791-954----------ARA-----------------------------------FA------FEA-GEAE.GRIAFRAH.G.....
A8LQN2_DINSH/795-960----------MLA-----------------------------------HG------FEA-VERN.GTLVFRSR.R.....
A9CJN3_AGRFC/756-923----------MAA-----------------------------------FQ------VDV-AEDG.GTLRFRSR.N.....
B0SVY2_CAUSK/777-933----------LEV-----------------------------------FA------LDA-VERQ.DGVALAGR.S.....
B0UJ15_METS4/791-954----------RTA-----------------------------------FF------FDG-VESG.GVLRFRPL.A.....
B1LTZ4_METRJ/785-952----------AQV-----------------------------------YG------LDV-SAVA.GTLRLRGP.R.....
B6JDQ1_OLICO/759-925----------QTA-----------------------------------YF------FDA-VERD.GVLVFVKR.G.....
B9JU38_AGRVS/757-919----------TEA-----------------------------------FL------IDV-IEDG.AVLRFRSR.Q.....
Q0AR61_MARMM/759-917----------LDL-----------------------------------LG------VSV-LEGA.DSVRFVSA.G.....
Q28RU9_JANSC/978-1139----------MLA-----------------------------------YG------FQA-VERD.GKLVFLPA.P.....
Q3SUI4_NITWN/802-967----------ASA-----------------------------------FA------FDA-VETD.GLIRFIPR.G.....
C6XID3_HIRBI/772-930----------KTA-----------------------------------FG------LRC-NHGD.NLLKFDN..G.....
A8HR63_AZOC5/794-957----------ARA-----------------------------------FA------FDA-VEEG.ATLVFRPR.G.....
D9QF99_BRESC/731-889----------LDA-----------------------------------FD------MVG-AERD.GQVALIGV.E.....
B2JUI8_PARP8/529-699----------MAS-----------------------------------YF------FDA-CDVE.GLIRFVRR.G.....
D0J488_COMT2/383-550----------QKG-----------------------------------WF------FEC-.SAA.DKLTLSPR.A.....
A9BYF1_DELAS/314-478----------RAP-----------------------------------YF------FDC-PEYG.GKIWYHKR.G.....
Q2G3K6_NOVAD/231-396----------SDL-----------------------------------SP------LSC-AVRE.ETVTFRNA.D.....
Q1GRM1_SPHAL/243-405----------FEA-----------------------------------DG------VRL-LSGP.GGWRLAPA.A.....
Q2N607_ERYLH/223-386----------GAV-----------------------------------FP------LSC-DAQG.QGLRFSDP.D.....
B8EKU0_METSB/229-420----------LQL-----------------------------------TN------AAA-VWSG.GQLKFIPY.GDATIV
B2IJD4_BEII9/227-411----------LQL-----------------------------------TN------ATA-VWSG.GLLQIRPY.GDSVVN
Q2WA44_MAGSA/316-506----------GTY-----------------------------------TN------ADV-AWT..GTFNMLPR.CHEVVT
C9R735_AGGAD/265-435----------VDH-----------------------------------IG------AAQ-YDNV.ETGKQAIK.L.....
Q2W6E0_MAGSA/315-503----------AVA-----------------------------------TN------TDV-GCPN.GAITLISR.GCSVVT
Q2SAL7_HAHCH/191-365----------LDH-----------------------------------IG------GVL-TTSP.TNGRFVLK.L.....
A7I049_CAMHC/190-363----------LRT-----------------------------------ID------GVL-YINK.SNSKLALK.I.....
B2FM10_STRMK/213-385----------LDH-----------------------------------VG------GIL-YTDP.EQGRFELK.L.....
E6WEJ9_PANSA/332-495----------ASA-----------------------------------CR------GIA-LWDG.MRFSMIID.N.....
A6VNR7_ACTSZ/335-501----------ASV-----------------------------------FR------AIA-VWTG.TQFTAIQDRT.....
Q8XYR0_RALSO/340-503----------ASV-----------------------------------FR------GMA-YWAS.SNVVAVAD.M.....
B2JL07_PARP8/351-514----------ASI-----------------------------------FN------GLI-FWSG.GALTFSAD.M.....
Q2W829_MAGSA/500-665----------ARC-----------------------------------GR------AVP-IQQG.GIVRIIRD.AP....
A5CF56_ORITB/744-904----------RCC-----------------------------------YF------FDI-KTSAINKISFMKR.N.....
B9KI53_ANAMF/694-848----------QKI-----------------------------------YC------LDV-REKA.GELVFSDS.D.....
C5AYQ3_METEA/784-949----------ARL-----------------------------------FN------LDV-SVSG.GTLRIRDG.R.....
D5AU04_RHOCB/799-959----------MLA-----------------------------------YG------FEA-LERD.GQLVFRMR.D.....
G8PN64_PSEUV/767-937----------LQL-----------------------------------TG------GIA-VDRG.THLAVLPKYA.....
N0B519_9RHIZ/827-991----------SLA-----------------------------------YF------FDS-IESG.GKIVFRHR.G.....
TIPJ_LAMBD/332-498----------CSA-----------------------------------MR------CMP-VWNG.QTLTFVQD.R.....
Q1QNE9_NITHX/777-937----------AGA-----------------------------------YA------FDA-TAAD.GTLRFVSR.G.....
Q3J233_RHOS4/334-499----------LKA-----------------------------------AG------AEM-AEAG.GYFYVRAG.A.....
Q3J3J4_RHOS4/795-953----------MLA-----------------------------------YG------FEA-LERD.GKLIFRMR.D.....
Q5F989_NEIG1/222-406----------LEQ-----------------------------------TN------SAA-VFSQ.GRLKIIPY.GDGSHS
Q7ARG4_YERPE/359-522----------AGA-----------------------------------FR------GMV-FWAG.GMVNVMQD.S.....

PF16792

H9EDD6_9CAUD/1-372----------VQI-------------------------LFPEVVPIEEAL------GQN-KKLN-LDMVYLVT-DVDESN
H9ED19_9CAUD/1-372----------VQI-------------------------LFPEVVPIEEAL------GKK-RNLN-LDMVYLVT-SVDESN
D3LCP7_OENOE/1-372----------VQI-------------------------LFPEVVPIEEAL------GQK-KKLN-LDMVYLVT-DVDESN
H9EFC2_9CAUD/1-372----------VQI-------------------------LFPEVVPIEEAL------GQK-KKLN-LDMVYLVT-DVDESN
GP16_BPLP2/1-372----------VQI-------------------------LFPEVVPIEEAL------GKK-KKLN-LDMVYLVT-DVDESN
C7T1V4_9CAUD/1-372----------VQI-------------------------LFPEVVPVEETL------GKK-RNLN-LDMVYLVT-SVDEGN
O80118_9CAUD/1-372----------VQI-------------------------LFPEVVPIEEAL------GQK-KKLN-LDMVYLVT-DVDESN
C7T205_9CAUD/1-372----------VQI-------------------------LFPEVVPVEEAL------GQK-KKLN-LDMVYLVT-DVDESN
C7T2B2_9CAUD/1-372----------VQI-------------------------LFPEVVPVEETL------GKK-RNLN-LDVVYLVT-SVDESN

PF05954

Q1LDW8_CUPMC/39-340......RLT.QAS-----------------------------------RI......YQQ.KTAP-QIIEAVLRRHD....
C5AP32_BURGB/40-351......KLS.SDR-----------------------------------RD......WQE.ASGS-QILSDVFAKHP....
A8IB09_AZOC5/33-335......TRT.SDC-----------------------------------RI......FQN.QSVV-QIADTLLSEG.....
A9G446_SORC5/24-329......GLS.RRS-----------------------------------RI......FTK.LSLP-DVMKAVLEENG....
B1M1X9_METRJ/41-344......RFA.ADC-----------------------------------RI......FQA.KRVP-EIVEAVLEET.....
A9GQF5_SORC5/30-340......GEG.RQS-----------------------------------RI......FQE.QPLS-GVLGAVLTEA.....
A9EVZ6_SORC5/26-317......ADA.VDY-----------------------------------QV......FVD.EDAV-SIVEEVLSEH.....
Q98IK7_RHILO/26-327......GNT.TDC-----------------------------------RI......FQN.MTAV-EIVEKIFSKY.....
A9FA22_SORC5/24-354......TQR.RGH-----------------------------------RI......FQH.LSIP-DIADKLLGE......
A9GAG1_SORC5/23-352......TQR.RGH-----------------------------------RI......YQH.LSIP-DIVDALLGE......
C1AEJ4_GEMAT/29-353......TLD.SGF-----------------------------------DI......FQN.KTAR-DVCDKLLTG......
Q2L040_BORA1/29-322......AEG.RDR-----------------------------------KI......FQD.MTVP-EILRKVLDQH.....
B2U7V1_RALPJ/41-362......SQT.SDY-----------------------------------KA......FQN.KSVI-DILDEVLADY.....
A9FDZ6_SORC5/23-354......TQR.RNF-----------------------------------RI......YQH.LAIP-DIADRIFAE......
B4E682_BURCJ/41-356......HQR.VDS-----------------------------------YN......FVN.ASVV-EISEQIFAHYAR..G
B1XWY3_LEPCP/24-338......TRT.ADC-----------------------------------RI......FQE.QTVP-DIVKQVFADH.....
B4E676_BURCJ/37-356......AHA.RDE-----------------------------------RT......FVN.QTLA-DVLDTVFAP......
A1KB80_AZOSB/48-380......AQR.YNS-----------------------------------RV......FQD.KDVV-EIIAAVLDEHSAANP
Q47E10_DECAR/36-349......AQR.RDC-----------------------------------YL......FQD.KTVI-DIIGQILAD......
Q8XUG6_RALSO/40-368......RGR.RNM-----------------------------------RT......FVG.KSVP-EILETMLGEWQQ..R
C5AKJ1_BURGB/40-354......RLR.RDQ-----------------------------------RD......WQE.TTGE-QILIDVFRAHPQ..A
Q0K251_CUPNH/36-365......TLT.STF-----------------------------------KR......FQN.MNVL-EIVEVVLSRY.....
C5BAE3_EDWI9/29-331......QHA.QEC-----------------------------------QI......FQE.KTVP-QIIETVLKAR.....
Q747T8_GEOSL/38-336......SLE.QDC-----------------------------------RV......FQF.KNVQ-DIVAEILEES.....
A5G0B1_ACICJ/27-330......GQT.LDC-----------------------------------RI......FQN.KTAV-AIVKEVLDEF.....
Q6LUC9_PHOPR/30-341......SFK.CHY-----------------------------------KI......YQD.KNVE-EILGDVLGRH.....
A1KCD6_AZOSB/26-329......GRT.ADC-----------------------------------RI......FQS.RTVP-DIVKQVFSEH.....
C5AHV1_BURGB/44-356......RYR.RDE-----------------------------------RY......WQD.QAAD-AIIADVLNRHP....
Q8XRR3_RALSO/37-355......TQQ.RHS-----------------------------------QV......FQN.RPLA-DILEQVLSP......
C6XDI4_METGS/47-391......TLT.TDC-----------------------------------KV......FQD.QTVV-EITEAVLADY.....
A9C0N9_DELAS/23-326......TRK.SDF-----------------------------------RI......FQN.QTVP-DIIEQVLGVY.....
Q87HD9_VIBPA/30-349......AYR.NNC-----------------------------------KI......FQK.KNIK-DIISEVLSE......
A6TAS8_KLEP7/34-358......DKQFRSH-----------------------------------RF......FVN.KSVP-EVVEQVLQEHH....
Q0JYG5_CUPNH/32-330......TLG.RDR-----------------------------------AI......YQN.LSAP-QIIRRVLQSF.....
B4E680_BURCJ/35-341......KLR.RNC-----------------------------------LY......FVD.LDAE-GICERVFGD......
C5A958_BURGB/38-352......SRS.RDI-----------------------------------RI......FQE.ENTE-AILSTVFREY.....
Q0JZD4_CUPNH/35-364......TLT.KDF-----------------------------------RI......FQQ.QSAV-EILDTLLSDY.....
B4EUE4_PROMH/79-373......TLN.QDS-----------------------------------RI......FQH.KTVP-EILKHLLDEA.....
Q7MDQ8_VIBVY/30-349......DYK.INS-----------------------------------RI......FQN.KDIK-EIISLILGE......
C5AA20_BURGB/41-355......RFR.SDM-----------------------------------RI......WQD.QPAD-QIVTAVFNAHP....
A9FYV0_SORC5/370-667......ALV.ETT-----------------------------------EI......SMN.KAVP-DLIKQKLELVGL..S
Q88I93_PSEPK/38-347......TCR.FDT-----------------------------------RI......FQE.KSVQ-AVVSEVFAGF.....
Q3A0Q0_PELCD/27-339......QLR.TDS-----------------------------------RL......ILS.ETLP-AIVRQTLCRNG....
C5AMP3_BURGB/41-355......KYR.RDM-----------------------------------RY......WQD.RSVD-AIIADVFNAHP....
C5ALD6_BURGB/39-369......TLT.TDY-----------------------------------RI......FQD.KTVI-EILDTILGEY.....
Q8XS52_RALSO/44-358......HYR.HDA-----------------------------------RN......WQD.KTVE-QILADVFNRHQ....
Q080W0_SHEFN/30-339......KKR.SNC-----------------------------------RI......FQN.KSVI-DIVKDLFGQH.....
Q2SGF0_HAHCH/101-403......GKN.TDC-----------------------------------RV......FQN.MTAP-KILEAVFTEA.....
D2QZK3_PIRSD/24-327......SLT.ADC-----------------------------------KI......FQQ.KTAV-DIIKAVLGD......
B4EH48_BURCJ/40-354......KFR.RDQ-----------------------------------RH......WQD.KTVD-AIIADVFDAHP....
C5AMI6_BURGB/41-362......EQV.HDS-----------------------------------AV......FLD.RSFR-ELLTDTIV.......
Q28MX5_JANSC/33-346......TQT.SDC-----------------------------------RI......WLD.KSSV-DVAEALLGEH.....
Q47J31_DECAR/32-356......SRG.RHN-----------------------------------RV......FQE.KTVI-DIVETVFAD......
C5A8I9_BURGB/40-354......HFR.RDQ-----------------------------------KI......WID.KSAD-AIITDVFNAHP....
Q6FFL7_ACIAD/42-385......HKR.RNS-----------------------------------RV......FMN.KSVA-EISEILFKEWQN..R
A1B4U8_PARDP/26-330......SLA.TDN-----------------------------------RI......FQN.LSVP-DIIEEVLRAY.....
Q8XQT0_RALSO/113-430......TRS.TDC-----------------------------------RI......FQN.RTAE-QILSEIFVEL.....
A1K519_AZOSB/50-375......RHR.WGS-----------------------------------RV......FQA.LTVP-EIVRALVEEHRGRNP
Q3A0Q1_PELCD/40-341......KQN.TNN-----------------------------------RV......FLN.RTVP-QIIGDILRSAG...F
Q6F782_ACIAD/42-387......HKR.RNS-----------------------------------RV......FMN.KSVV-EIIEIVFREWQS..K
Q1QVA4_CHRSD/41-355......ALG.RDS-----------------------------------RI......FQD.RSVV-DVLTQVFEGHA....
A7MMD4_CROS8/36-364......DNS.RRS-----------------------------------AI......YQN.LSVP-EVVEKILREHH...N
A9BLL4_DELAS/23-327......TRR.SDF-----------------------------------RI......FQN.KTVP-DIINEVLGIY.....
A0KJD1_AERHH/29-325......SLR.QNS-----------------------------------RI......FQA.QKPD-EILSILLQ.......
A1TTP1_ACIAC/24-327......TRR.TDF-----------------------------------RI......FQE.MDVP-AIVSQVLSR......
B4F002_PROMH/27-319......TLK.QDS-----------------------------------RI......FQD.TTVP-HILETLLNE......
B9JVA0_AGRVS/37-346......SRR.SDC-----------------------------------RI......WQN.MTAI-QVMETLFSEHG....
G3XCU8_PSEAE/32-313....GSGKT.IRS-----------------------------------GG......WEG.TTLA-QVCRDVGA.......
I1SBE4_PECAS/30-328......GLR.TNA-----------------------------------RI......FQA.QKPE-AIISILLEET.....
I2BBZ6_SHIBC/54-354......DLV..DS-----------------------------------SVVDKAGQWKG.LKLE-QLASTIAK.......
BPD_BPP2/42-365.....GTLNSRRE-----------------------------------GS......WHD.TTLG-AIVKAIAT.......
Q0KDW7_CUPNH/38-356......TQT.SDF-----------------------------------KP......FQK.KTVI-EILDEVLADY.....
Q3IWJ2_RHOS4/27-325......GLR.RDN-----------------------------------RI......FQD.RSVP-EILEAVLGEIP...G
Q5DYX3_VIBF1/29-334......NYR.TNY-----------------------------------QI......FQN.KTVP-DIITEIYQQAG....
Q63II0_BURPS/23-325......TRR.SDC-----------------------------------RI......FQN.KTVP-EIVQDVLGTYG....
Q63K62_BURPS/46-349......SLY.KAS-----------------------------------DV......YLNEQTIP-DIVKRVLRAAS....
Q63LB9_BURPS/58-337.....SGMQERRE-----------------------------------KS......WHR.QTIG-SIVHAIAG.......
Q63LQ5_BURPS/38-351......SRR.VDS-----------------------------------RI......FQD.KSAR-DILDAVFSQY.....
Q63P68_BURPS/44-375......DKR.TNS-----------------------------------RV......FRK.RSVI-DVLATLFNEWQQRSP
Q63TB7_BURPS/37-356......AHG.RDE-----------------------------------RT......FVR.QGVA-DVLGAVFAP......
Q7CGL8_YERPE/58-356......SLR.RNS-----------------------------------RI......FQL.ESVE-AIISTLLKEN.....
Q7CHB6_YERPE/23-325......DLV..DC-----------------------------------SAKWPNSVISQ.STVL-QIAQKLAE.......
Q8ZRL1_SALTY/121-429......THT.SDY-----------------------------------KA......FQN.KTVV-DILDEVLAEY.....
Q9I1A6_PSEAE/30-322......TLA.SNN-----------------------------------RV......FQN.LATS-DIVTQVFDQH.....
Q9I3K1_PSEAE/27-327......ELC.CNW-----------------------------------RI......FQE.KSVP-EILQALLKEH.....
Q9I737_PSEAE/29-329......TRT.SDC-----------------------------------RI......FQN.QKVP-DIIKQVFRDL.....
Q9PAL7_XYLFA/37-321TPKGKSDLQTQKT-----------------------------------RS......WPAGTTLG-AMLSTMAA.......

PF09096

BP27_BPT4/203-375----------AYD-----------------------------------FV------WLT-KSNP-HKRDPMKN-------

PF06763

Q2SI49_HAHCH/7-189--------------------------------------------------------ALN-KGLS-KAATLSNR-------
K7A372_9ALTE/15-199--------------------------------------------------------ALN-KTVK-GVQSDLTK-------
COMPL_BPN15/3-184--------------------------------------------------------AVN-RVAN-RAVSRSVA-------
Q8ZN01_SALTY/1-192--------------------------------------------------------AVN-RVAQ-KAVSVATR-------
Q8ZQG7_SALTY/3-194--------------------------------------------------------AVN-RVAA-SAVSAATH-------
Q8ZQ91_SALTY/3-188--------------------------------------------------------AIN-RVAK-RVVSVSVR-------
COMPL_LAMBD/3-192--------------------------------------------------------AIN-RVAS-SAISQSAS-------

PF09097

BP27_BPT4/5-200----------YDA-------------------------------------------WSN-NRFV-ELAATITT-------

PF05354

Q8ZN00_SALTY/1-117-----------------------------------L--RVM-GTVATITSGVLAGATLTGVF------------------
FII_LAMBD/1-117-----------------------------------R--GYM-GTSATITSGEQSGAVIRGVF------------------
FII_BPN15/1-117-----------------------------------R--GVM-GTEAKVMSGTLSGATLVGVF------------------

PF13856

D4K5F6_9FIRM/1-108-----------------------------------LDDDIF-AEEHTI-----NGQKMKAVI------------------
A3MZN0_ACTP2/1-99-----------------------------------M..ATM-MSEWQL-----QGQPYPAVY------------------
B8F4K5_HAEPS/1-99-----------------------------------E..RVM-MSEWLI-----NGKPYPATY------------------
M9X5I9_MANHA/1-99-----------------------------------Q..QTM-MSEWLI-----GGKPYPATF------------------
Q8ZQ92_SALTY/1-90-----------------------------------A..ERF-GMKVNI-----NGTDCIVVE------------------

PF09393

F6DLR2_DESRL/1-131-----------------------------------AKVAVE-KRELNLSGDDWVRHKKGPKK------------------
R7FA15_9CLOT/4-145-----------------------------------AKFEKT-KKEINVLGKTGSGNKSTGWK------------------
A9KPP0_CLOPH/4-148-----------------------------------AKFEKT-KTEIPILGKTGAGNKSTGWK------------------
A5I2K4_CLOBH/3-146-----------------------------------SKVEKK-KTEVRTLSKRGEQHKAAGWS------------------
R6NS73_9FIRM/11-143-----------------------------------AKIKTN-RETINFSGQMWDDSKLMGVS------------------
F2F2L4_SOLSS/3-140-----------------------------------LRVNVE-WEDVFFPEETGKQRKFMGWT------------------
C4Z5U0_EUBE2/2-139-----------------------------------AKVEFT-KEEIKQCGTFFTDNKVVGCK------------------
R5BEH1_9FIRM/6-141-----------------------------------AKVSLE-YEEVDIQGELGKYQRYVGYS------------------
R5AL39_9FIRM/3-146-----------------------------------AKVKKT-RMTIPILGMTAKQQKSGGWE------------------
Q65L22_BACLD/1-141-----------------------------------ANVEKN-KAEVNIMGRRMTGHKTTGAN------------------
R6M2J8_9FIRM/6-141-----------------------------------AKEKTN-RESVSFAGDTTNDSKLMGVD------------------
R6QFB0_9FIRM/2-146-----------------------------------AIVKKT-RTEIPILGLTGKQHKSGGWE------------------
R5H4V3_9FIRM/3-147-----------------------------------AKIELK-KGAVKCIGRRMEGSKITGMK------------------
D1AHR6_SEBTE/5-149-----------------------------------ATMEKT-KVKVPVLGKTGKGNKATGWE------------------
C0Z6Z9_BREBN/3-140-----------------------------------AKITIA-YEELNFANEPGTFQKGLGWS------------------
C6D1T3_PAESJ/3-147-----------------------------------ATIEKN-KVDVPVLGRTNTPQRSAGWK------------------
A3DIA9_CLOTH/4-148-----------------------------------AQLELQ-VQSRQMLGHRMVQHKVVGAE------------------
D3EHB9_GEOS4/2-143-----------------------------------ATVEKE-KAELKTMGQRAVQHKAIGWK------------------
F9VIU9_ARTSS/5-149-----------------------------------AKFETS-KSEVPILGKPGKGNKKTGWK------------------
Q18BM9_PEPD6/2-140-----------------------------------AKMEFT-KEDIIIAGQMGTDTKYMGYK------------------
D4MVP4_ANAHA/2-140-----------------------------------ATIKFT-KTDVPQTGRLNSGKKVTGIE------------------
A6TQV7_ALKMQ/4-142-----------------------------------SKININ-YEDVNMAEDLATHKKMTGWA------------------
Q24LI3_BPPCD/3-141-----------------------------------AEIKLD-KAEIVRPRKMIKGQKVIGAS------------------
D3EHD6_GEOS4/2-130-----------------------------------ASVELE-KRELKLVGNDWTVHKNGSKK------------------
I4D3G0_DESAJ/2-140-----------------------------------AKVTLT-KTAVEMCGTLVAGQKVTGME------------------
Q892H5_CLOTE/3-141-----------------------------------AKISLK-TADVNMLGTLAKHTKVIGYE------------------
Q184A4_PEPD6/3-147-----------------------------------AKMEKN-KSEVPILGRTTKGNKTTGST------------------
R6UQ00_9FIRM/3-141-----------------------------------IKLNKT-KEDVARCRTLVTGKKLTGIS------------------
R5TBQ4_9FIRM/10-152-----------------------------------ATIEKE-KEEVAILGRLMKGNKSVSAK------------------
M1MSJ7_9CLOT/3-147-----------------------------------STAEKT-KKTGKTLGSRVEQNKATGWK------------------
R6PBH3_9FIRM/5-148-----------------------------------VKLEKA-KSTIPRLGAIMTGHKSTGME------------------
A6TRA1_ALKMQ/2-131-----------------------------------ATVEMS-KGELNVMGDDWTRYKKGQKN------------------
R6PLB1_9FIRM/3-147-----------------------------------AKVEKT-KIQVPILGKTGRGNRSTGWI------------------
A5N9B6_CLOK5/3-133-----------------------------------ADVESD-IKELNLLGADWTDYKAGTKK------------------
R5BLA9_9FIRM/2-140-----------------------------------AEVTLT-KEEVKMLRHVGKGYKVTGYD------------------
L7VLA7_CLOSH/4-149-----------------------------------AQIDLI-VQERRMLGHRMTQHKVVGAT------------------
I0GWR6_SELRL/2-140-----------------------------------ATVKLD-KIEVKMSRHLGKCYKSVGWT------------------
R5BQR6_9FIRM/9-143-----------------------------------CKVTAE-REDVIVGNS..KDSKIVVLA------------------
Q24QE7_DESHY/2-147-----------------------------------ATIEKN-KADVPVLGRTNVGKKAAGWT------------------
D9R927_CLOSW/3-146-----------------------------------ANIEFT-VIAKKLLGHRMKQHKVVGAE------------------
R6HTP3_9FIRM/3-147-----------------------------------SQWEVN-VTEVPILGKVGMGHKAAGGK------------------
R6Q009_9FIRM/2-140-----------------------------------GKATMN-FEEVNLAGDLGTHQRYMGYA------------------
A9KKK2_CLOPH/4-149-----------------------------------ASFKKL-KKKVPILGSTGKGNKTTGWE------------------
W8T695_EUBAC/3-142-----------------------------------LKASGE-REDVVVGMD..IDSKLTAIK------------------
R6ST47_9CLOT/2-146-----------------------------------SDAEFQ-EADFKVVGTRLVQKKTTGVA------------------
C8VZG4_DESAS/2-142-----------------------------------AKVEIQ-KQELKLSGDRWVRHKVTGLK------------------
D4M0Z1_9FIRM/4-148-----------------------------------AKVEKT-KTTVPRLGAIMAGHKSCGME------------------
G4L1J2_OSCVS/6-136-----------------------------------VKVAKN-KSSLNFCGQMAEDSKVTGIK------------------
U5MV98_CLOSA/3-133-----------------------------------ATEEMD-KKDVVTCGSTRTKYKRGATK------------------
F2JK33_CELLD/10-154-----------------------------------AKFEKN-KTEVPILGKTGKGNKATGWK------------------
A5N2B8_CLOK5/3-131-----------------------------------AKVALD-KKEINVVGDEWTRYKRGTKK------------------
B2TNV8_CLOBB/5-135-----------------------------------ADVERD-MKETPTVGSEWIGYKGGLKK------------------
C0ZFE9_BREBN/2-132-----------------------------------LSEEFE-KGESKRAGQLRKRHRVLASS------------------
F3ZZH5_MAHA5/2-128-----------------------------------ATDNYN-LITFNVAGKVRTQHKTGPIE------------------
M1MI16_9CLOT/3-138-----------------------------------AKVTLT-KVDVNFTRDLWKRSKVTGIE------------------
X2GJE7_9BACI/3-140-----------------------------------AKVTID-YEDINMAEDLATHKKMTGWT------------------
A5I4B2_CLOBH/1-131-----------------------------------AEVELD-KKELNLLGDDWTRYKQGSKK------------------
A6LTZ2_CLOB8/3-133-----------------------------------ADVETD-MKSIITCGSEWEDNKAGAKK------------------
A6LRW9_CLOB8/3-141-----------------------------------AKVKGN-FETVEFCGDNATYSRYNGWS------------------

PF06605

A4J7Q0_DESRM/62-404R.....WQAGIVD--------DL-GI----------NS...-.......TNFYYESA.LAAV.Q----------------
A5D093_PELTS/222-567R.....WQAGVVN--------SL-GT----------CS...-.......TTFYYQSV.LSAI.H----------------
A5VJT7_LACRD/39-685G.....ITYKL..--------.H-GN----------FPQAA-VDCTGSLYEWLNSN..LKLF..----------------
A5VKI8_LACRD/34-537GNNWLNFTWEI..--------.K-GQ----------FDPQP-VALDAVSLKTGIS.........----------------
B2TMG9_CLOBB/35-355G.....FKF....--------.Y-SN----------ISMNT-N......FNVELVNL.WDCI.K----------------
B8I7P6_CLOCE/418-720G.....WS.....--------.L-GV----------VDVTT-KR....TWQCQEKNA.LAIL.R----------------
C4Z844_AGARV/33-364EKE.KQFEVGIVT--------VK-DS----------NDSI.-.......YRFTNREDTLTDLRE----------------
D9SSG9_CLOC7/29-338G.....WT.....--------.I-GS----------CNIEK-SR....TVKKGNCSS.YEIL.Q----------------
F3YBF3_MELPT/27-330G.....FTYTLYD--------SY-TH----------YAFS.-.......EDFGNGYA.DELL..----------------
F9UQU7_LACPL/38-346G.....LTAKF..--------.I-GD----------FPRIK-I......ENLGNSSF.NKFL.Q----------------
G8M053_CLOCD/417-718G.....WT.....--------.V-GN----------VTVTT-KR....TWQCTEKNA.LSIL.R----------------
I6T7G9_ENTHA/33-340E.....FTWEVID--------PN-KK----------FLTVQ-Q......ENFGDGNY.LKLI.N----------------
Q5WE58_BACSK/33-341G.....ITYTF..--------VG-ED----------LPSED-F......ENFGNATA.LDML.Q----------------
Q5WIB8_BACSK/8-317G.....MSYEI..--------.R-GS----------FDNKE-F......ENFGQNNQ.WELF.K----------------
Q65ET7_BACLD/226-551D.....FKYIFKT--------PE-SE----------FESAD-Q......ENFGDKNS.TELM.D----------------
Q65KF3_BACLD/29-328G.....YTFEI..--------.D-TT----------DLPAS-VR....VENFGWNNS.LALF.R----------------
Q835T2_ENTFA/29-351......KTKHWVL--------KK-CD----------FSRKL-T......YKWENENGLVEPL.F----------------
Q8Y4Z4_LISMO/34-333G.....FSWEIID--------PS-NI----------LEKVQ-Q......ENFGNNNY.LTLI.D----------------
Q8YAK1_LISMO/33-338G.....FSYEI..--------.Q-GS----------FPLVE-L......EDLGNKNG.LELV.N----------------
Q9K758_BACHD/67-370G.....WR.....--------.V-GK----------VTITR-ERT..LELEAGFTNR.LKAL.Y----------------
Q9KGP3_BACHD/67-375D.....WS.....--------.V-GR----------VELMN-VRN..VSVEPGVTNR.LAAL.S----------------
R4K6I2_CLOPA/41-361TSD.KQFTLGTVD--------VT-GV----------LAIA.-.......TNFENT...LNFIID----------------
V5XMR9_ENTMU/31-336G.....FTWQL..--------.S-GG----------FPATD-K......ENFGDANY.LRLI.N----------------
W6S0H7_9CLOT/417-718E.....WS.....--------.V-GT----------VNVTS-KR....TWTSSEKNA.LSIL.R----------------
X5A593_9BACL/39-378GG...RFSIAV..--------.D-DT----------FDLAD-V......KAFGGGNC.LESL.N----------------

PF13550

A1AYP0_PARDP/820-985.............--------.R.AP---------.AGSVT-T------ADLVRRGEGGG..-.----------------
A1B627_PARDP/791-955.............--------.A.RV---------.DAELG-P------GDMALAEE..V..-.----------------
E0THS4_PARBH/770-933.............--------.G.RP---------.ALTLG-L------EELAVVGD..E..-.----------------
A7HRK9_PARL1/775-940.............--------.E.AP---------.ATVLT-P------AMLAVTEE..A..-.----------------
A7IK58_XANP2/791-954.............--------.V.GT---------.MREIG-T------DDLVRSAD..D..-.----------------
A8LQN2_DINSH/795-960.............--------.Q.ER---------.ATEVD-P------DLFAVDSD..L..-.----------------
A9CJN3_AGRFC/756-923.............--------.T.AV---------.MLVRD-I------AVLADIED..E..-.----------------
B0SVY2_CAUSK/777-933.............--------.G.VA---------.VLTFG-D------DDLAWPDD..R..-.----------------
B0UJ15_METS4/791-954.............--------.R.AP---------.VARFT-Q------ADLVAAGQ..G..-.----------------
B1LTZ4_METRJ/785-952.............--------.R.DR---------.PAVLA-E------ADLVRLSE..D..-.----------------
B6JDQ1_OLICO/759-925.............--------.A.GS---------.PITID-P------NDLGASEN..D..-.----------------
B9JU38_AGRVS/757-919.............--------.A.AS---------.LKAVE-T------RVFVDTED..E..-.----------------
Q0AR61_MARMM/759-917.............--------.V.AS---------GADTLT-L------TDPVDTGE..D..-.----------------
Q28RU9_JANSC/978-1139.............--------.E.RP---------.QQIIE-A------PLTARDDD..G..-.----------------
Q3SUI4_NITWN/802-967.............--------.R.NS---------.VATLT-L------PELAIPDQ..G..-.----------------
C6XID3_HIRBI/772-930.............--------.E.RH---------.EWQVE-L------DEFQTADG.....-.----------------
A8HR63_AZOC5/794-957.............--------.R.RV---------.VTSLD-E------DDLVAQED..A..-.----------------
D9QF99_BRESC/731-889.............--------.A.AS---------..ATLG-L------EALALGDD..A..-.----------------
B2JUI8_PARP8/529-699.............--------.G.AS---------.LATVS-Y------SDLGSSTT.VG..-.----------------
D0J488_COMT2/383-550.............--------.V.AP---------.VVRIP-F------TDLGFGND..SGG-.----------------
A9BYF1_DELAS/314-478.............--------.K.AS---------.VAEIT-M------ADMVEEPD..D..-.----------------
Q2G3K6_NOVAD/231-396.............--------.E.IG---------.SASLP-L------LPLPTAGG..ER.-.----------------
Q1GRM1_SPHAL/243-405.............--------.Q.AG---------..EAVA-L------ADFREKRR..G..-.----------------
Q2N607_ERYLH/223-386.............--------IV.EA---------.DRTLP-E------TARAWEESDFG..-.----------------
B8EKU0_METSB/229-420GALVPSGSSSFAP--------NV.TP---------.IYSLT-D------DDYIVVGD..Q..-.----------------
B2IJD4_BEII9/227-411GN.....GRTFVP--------DV.VP---------.VYDLT-D------ADFIYENG..A..-.----------------
Q2WA44_MAGSA/316-506G......NGVTYT--------PP.ET---------.VFDLG-D------DDWMDSSD..AIT-A----------------
C9R735_AGGAD/265-435.............--------.I.RQ---------.DYNVA-D------LPLFSYDN..GI.-.----------------
Q2W6E0_MAGSA/315-503G......NGRTYT--------PP.EA---------.SFDLT-D------DDWLVDNS..ATT-S----------------
Q2SAL7_HAHCH/191-365.............--------.V.RA---------.NYAQS-A------LPVFGPNT.VI..-.----------------
A7I049_CAMHC/190-363.............--------.L.RD---------.DYNPD-N------LFKINESN..S..-.----------------
B2FM10_STRMK/213-385.............--------.L.RD---------.DYWVD-E------LPQLGPDQ..I..-.----------------
E6WEJ9_PANSA/332-495.............--------PA.DP---------.VAVVT-N------ASVVDG.......-.----------------
A6VNR7_ACTSZ/335-501.............--------.S.DP---------.ICLYT-Q------SNVIDGK......-.----------------
Q8XYR0_RALSO/340-503.............--------PA.SA---------.SYLFH-P------GNVVDGRF..T..-.----------------
B2JL07_PARP8/351-514.............--------PA.DA---------.VDEFS-P------SKIIDGA......-.----------------
Q2W829_MAGSA/500-665.............--------QT.MP---------.VAMFG-P------RNIVKGSF..K..-.----------------
A5CF56_ORITB/744-904.............--------.H.KT---------.NLQLS-A------RQCIIESN..Q..-.----------------
B9KI53_ANAMF/694-848.............--------.P.ES---------.VLHIP-D------EDVVPGS......-.----------------
C5AYQ3_METEA/784-949.............--------.P.RA---------.PAMLV-A------GDFVLGEG..E..-.----------------
D5AU04_RHOCB/799-959.............--------.G.RV---------.AADLA-A------ADLALGEG..E..-.----------------
G8PN64_PSEUV/767-937.............--------AT.AQ---------.NGKLG-L------GDLLEADE..G..-.----------------
N0B519_9RHIZ/827-991.............--------RA.EP---------.QMTLT-A------YGLVEEHA..D..-.----------------
TIPJ_LAMBD/332-498.............--------.PSDK---------.TWTYN-R------SNVVMPDD..G..-.----------------
Q1QNE9_NITHX/777-937.............--------.G.VP---------.VAEFA-E------DDLVLPDD..G..-.----------------
Q3J233_RHOS4/334-499.............--------PA.AP---------.VAHIT-D------DVIIVSDP..I..-.----------------
Q3J3J4_RHOS4/795-953.............--------.G.RA---------.KAEVS-R------EDLVASDD..L..-.----------------
Q5F989_NEIG1/222-406GN.....GAVYVA--------DN.KA---------.AYDLT-D------DDFIVSGA..Q..-.----------------
Q7ARG4_YERPE/359-522.............--------PS.DP---------.VMMFT-N------ANVKDG.......-.----------------

PF16792

H9EDD6_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNFAIIDYLIDPNK--NNLMS----------------
H9ED19_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNVAIVNYLIDPNK--NNLMS----------------
D3LCP7_OENOE/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNSAIIDYLIDPNK--NNLMS----------------
H9EFC2_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNFAIIDYLIDPNK--NNLMS----------------
GP16_BPLP2/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNFAIIDYLIDPNK--NNLMS----------------
C7T1V4_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNSAIIDYLIDPNK--NELMS----------------
O80118_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNFAIIDYLIDPRK--NNLMS----------------
C7T205_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNSAIIDYLIDPNK--NELMS----------------
C7T2B2_9CAUD/1-372KATLKNYFWAMIE--------SLDVP----------NAITK-TTNSAIIDYLIDPNK--NNLMS----------------

PF05954

Q1LDW8_CUPMC/39-340LKGHQFA.FNLRR.K......YPQLG.........FRMQHQ.LSDWDYIRLLMEQNGIYCYF...APGK...........
C5AP32_BURGB/40-351QANGQYK.LELRA.A......MRSYS.........HRVQW..ETDWNFVHRSMEEVGVFPRFDFAKDG............
A8IB09_AZOC5/33-335GITDYKK.QGLSG.S......HPSRD.........YCVQYR.ETDYAFLQRIFAEEGIYFYFQY.DSS............
A9G446_SORC5/24-329IGPDEYE.MRLGS........YEVEE.........HICQYR.ESDLDFLARWMEREGIFYFFEHTPD.............
B1M1X9_METRJ/41-344GVTAYRF.A.LTE.P......HPARE.........YCVQYR.ETHLAFIERLLAEEGIAYHFEH.TEG............
A9GQF5_SORC5/30-340GLPHRFS...LAA.P......RPPRV.........YCVQHQ.ESDLAFIARLCAEDGVFFWFEPPEGGDP.........A
A9EVZ6_SORC5/26-317GISVERR.LVREA.........PKRA.........QCVQCF.ESDLDFVSRLCAEEGISWFIVA.GA.............
Q98IK7_RHILO/26-327GIAKFEK.R.LQG.S......YPSRE.........YCVQYD.ESDLDFVQRLFEHEGIFYFFEH.DED............
A9FA22_SORC5/24-354.WNIDPI.WQIDRPL......YPKLE.........YKVQYG.ETDYAFLSRLLEEAGIAFTFPN...DD..........A
A9GAG1_SORC5/23-352.WAIEPA.WKIDRGA......YPRLE.........YKVQHG.ESDHAFLSRLLEEAGIAYTF...PDRG...........
C1AEJ4_GEMAT/29-353..TPHEW.KMVRT........LDPRP.........YCFRYR.ESRWACTSRLLEQEGVWYRFDH.KSG............
Q2L040_BORA1/29-322AIRVTPK.L.RDT.N......YPRRE.........YCVQFD.ESPLDFVSRLMEEEGIFYFFDF.SES............
B2U7V1_RALPJ/41-362PYSVDKR...LDT.SV.....FPKLI.........WEVQHG.ETDAHFIQRLTEEWGISYFFEH.DGS............
A9FDZ6_SORC5/23-354.WQITPT.WSIER......AKYPKLE.........YRCQYG.ESDYAFLSRLLEEAGIA..FTHPDDQA...........
B4E682_BURCJ/41-356AIAPAWR.WALAD.....PAKYANRS.........LTAQAG.ESDFAFLERLWAEEGIFYWFEHQGDAHST.......DL
B1XWY3_LEPCP/24-338DIASFEF.K.LFR.S......YRKLG.........YCVQYR.ESDFHFVARLLEHEGIYWYVEH.GDG............
B4E676_BURCJ/37-356.YAGIAR.WRLTPDAGRRLDALGPTA.........YRVQYRTHTHYEFVQHLLAEAGLGFCFVEDEDAP...........
A1KB80_AZOSB/48-380AWASFSH.RSEVI......RPLSRRS.........YCVQYR.ESDLAFIERLAAEEGLSYRFSHGSGELSVSSNAADDAC
Q47E10_DECAR/36-349..YPEAH.WSNQV.....TQSLRSHS.........VATQYR.ETDFEFIHRLLSEEGLSFRFEHDQSAAAGD....DATH
Q8XUG6_RALSO/40-368SAAMDRV.FDFEL..LLDRGRYPKRA.........QTLQLD.ESDYGFLDRMTRHDGIWCFVKAGTRDGSA......SNA
C5AKJ1_BURGB/40-354TTHNAYR.FDLNE.P......MPAYS.........YRMQW..ETDLNFVYRSMEEAGVFGRFEFAEDG............
Q0K251_CUPNH/36-365TFPVERR...LSL.IE.....YPKRQ.........YQLQAG.ETDYQFVRRLLAEWGLNFHWEH.TNG............
C5BAE3_EDWI9/29-331GISDFRL.S.LSQ.H......YAPRE.........YCVQYR.ESDLSFISRLMEEEGIFYWFDH.SES............
Q747T8_GEOSL/38-336NITSDRYRFALSR.E......DRLRK.........FCVQYR.ETDLNFVSRLLEEEGIFYFFEHYED.............
A5G0B1_ACICJ/27-330EITSYE....LPS.G......GTSYD.........YTVMFN.ETYLDFINRILARDGLFYYFVH.EKS............
Q6LUC9_PHOPR/30-341.GISFRD.DRSKT........YPIYG.........YKVQYH.ESDLDFVLRLLQDEGIFFFFEHSQD.............
A1KCD6_AZOSB/26-329GVADFRN.A.LSG.S......YRTRE.........YCVQYR.ETDLAFVSRLLEEEGIYYFFEH.DEN............
C5AHV1_BURGB/44-356QLQGRFR.FDLSR.K......LPTRS.........YCRQH..ETDWNFVHRLMESEGLYCYWEYASDG............
Q8XRR3_RALSO/37-355.YAPYAA.WRFAAGAEDRMAAFGTRS.........HIAQFR.ETDYRFVTRLLAEAGLGFTTVEDEQAP...........
C6XDI4_METGS/47-391PYAVEKR...LIE.T......YPARD.........YSVQYN.ESDFAFLTRLWREWGISFHFRH.DDG............
A9C0N9_DELAS/23-326GHPLQKK...LTR.A......YRSWD.........YCVQYN.ESDCDFVSRLMEHEGIYYFFEH.ASG............
Q87HD9_VIBPA/30-349.HGVAFK.FELKN.T......YPQYS.........YKVQYE.ESDLAFVQRLLAEEGLSFCFSHSKS.............
A6TAS8_KLEP7/34-358LHDWEYE.FNLKQ.H......YPRRE.........QINQYQ.ESDLAFIQRLLAEVGIFYFFTL.QEEA...........
Q0JYG5_CUPNH/32-330DVAFEAR.I.TET.R......YPMRE.........YCVQYD.ESPFDFISRLMEEEGIFYFFTF.ADG............
B4E680_BURCJ/35-341..YPEAH.WRYEL.....VEPLRSFR.........LRGQYR.ETDLDFVSRQLSEAGLSFRIEHGQDAGKA.......PS
C5A958_BURGB/38-352GKMASFE.FRLSK.A......TKNRS.........YCTQYR.ETDLEFVERLMQEDGLFFFFEHAKD.............
Q0JZD4_CUPNH/35-364TFPVERR...LDV.AR.....YPKRE.........YQVQYG.ESDFDFFQRLTQEWGISWHIEH.SEG............
B4EUE4_PROMH/79-373HIKYDNR.LYQPE.L......HQPRH.........YVTQKR.ESAYDFWCRLAFEEGINFWFEE................
Q7MDQ8_VIBVY/30-349.HGVDFS.FSLTK.S......YAKYN.........YKVQYE.ESDLQFVKRLLSEEGLSFCFSHTKS.............
C5AA20_BURGB/41-355QAQGRFL.FQLSK.P......LPPRS.........YCRQS..ETDWQFVHRLLESEGLFGFWRFAPDG............
A9FYV0_SORC5/370-667GSDVELR...LTG.T......YAPRE.........FVVQYQ.ETDLAFISRLAEHAGISFFFEH.QDG............
Q88I93_PSEPK/38-347GTLAKYE.FRVSK.P......LKSHS.........YITQYR.ESDFNFVQRLLESEGLFYYFEHTAD.............
Q3A0Q0_PELCD/27-339IDENALR.LELAR.Q......YPVRP.........STLQAQ.ENDLDFLLRLTGRQGMFIW....TDAA..........D
C5AMP3_BURGB/41-355QARGQFQ.FALSK.P......LPSRS.........YCRQS..ESDWNFVHRLMEEEGLFGFWRQNKDG............
C5ALD6_BURGB/39-369PYPVEKR...LDV.SR.....YVLMGESERNEPRAYQVQYG.ESDFRFMQRLMEEWGIYWFIEH.SDG............
Q8XS52_RALSO/44-358RAQGAFR.FVLRN.P......LPVRS.........FVQQF..EDDWNFVHRLMEEEGLFFYFEQAEDG............
Q080W0_SHEFN/30-339.KVEFQN.KTTNT........YPKYE.........YCVQYL.ESDVDFVCRLLQQEGIFFFFEHSVS.............
Q2SGF0_HAHCH/101-403GFSDFRF.TGLYN.E......YPELE.........YCVQYR.ESDLNFALRLMEQEGIYFYFEQAQK.............
D2QZK3_PIRSD/24-327.GAVTYR.TSLSK.T......YRTLE.........YCVQYN.ESDFNFVSRLMEQEGIYYFFEHAQG.............
B4EH48_BURCJ/40-354QARGMYR.FELSQ.P......LPSRS.........YCRQD..ETDWNFVHRLLESEGLYGVWRQAQDG............
C5AMI6_BURGB/41-362...DRDL.FQSYDVEFELDGLDAKLH.........QTVMYE.ETIANFIDRHCRRAGVFYYFKHAKKEDG.........P
Q28MX5_JANSC/33-346GITAPVI.GGITS.P......PPPKH.........YSVQYN.ETDWAYLVRRLEEDGIFYWFEH.EEG............
Q47J31_DECAR/32-356.YADVAA.WQWSDEVAGFLADARPRS.........YCVQYG.ESDYAFVSRLLAEEGLGWCVEEDKEAP...........
C5A8I9_BURGB/40-354QANGRFR.FALSQ.P......LASRS.........YTRQH..ETDWNFVHRLLESEGLYGYWEQGSDG............
Q6FFL7_ACIAD/42-385SSLFAAS.LTLDL.SGLA.QNYDIRP.........FTMQIN.ETDYEFLTRLWRSEGINWLVDEKNTVVTHP....LQPI
A1B4U8_PARDP/26-330PDVVLDK.R.LEG.S......YPPRD.........YCVQFE.ESDLDFLQRLMEEEGIFYFFEH.GED............
Q8XQT0_RALSO/113-430GFHDFEF.H.LKT.P......PATLE.........YVVMYR.ESYYNFCARLMEQEGMLWTFRY.EAD............
A1K519_AZOSB/50-375IFNAGLG.LRFDL.....QRRYECRS.........YCVQYH.ESDLEFIERLLAEEGIGWRFDHEEDAAGA.......GP
Q3A0Q1_PELCD/40-341EQDDYAV.DLTET........YPLRE.........FVIQYA.ETDFAFLCRLLARSGIFFMFESDAE.............
Q6F782_ACIAD/42-387SPLFAAT.LKLDT.SHLTNKQYDIRP.........FSMQSN.ESDYAYLTRLMREEAINWLIDESNYLVMSQ....TQAI
Q1QVA4_CHRSD/41-355LARGRYR.FDLRR.D......YPARS.........YCVQYR.ESDLNFISRLCEEEGLFYYTEFAGDDDD.........F
A7MMD4_CROS8/36-364WPGWLFE.FRLSN.T......YPSRE.........IITQFM.LSDAEFIDRLLSEVGIWYNFTQ.DIET...........
A9BLL4_DELAS/23-327GHPMQQR...LTR.S......YRTWE.........YCVQYN.ETDFQFVSRLMEHEGICYYHQH.SAG............
A0KJD1_AERHH/29-325...E....HGITDYAFALKNEHVKRE.........YCVQYR.ESDLDFVNRLAAEEGMFYFHEF.EAG............
A1TTP1_ACIAC/24-327.YGRPFV.LRLTR.G......YRSRP.........YTVQYH.ESDYQFVSRLCESEGIYWFVEHASG.............
B4F002_PROMH/27-319..SH....IKYDK.QLYHPEEHLQRA.........YTTQKR.ETMYDFWCRLAAEEGINFWFEE................
B9JVA0_AGRVS/37-346IPAPAYA..PLHK.T......PPSRE.........YSTQWN.ETDLDYLLRRFEQEGLFFWFEH.ETG............
G3XCU8_PSEAE/32-313...R....NGWRV.E...CPLQVAIA.........RVDQVN.ESDYHFVTRLARQYDCTAKLAE................
I1SBE4_PECAS/30-328.GITDYA.FSLRH.D......HTVRE.........YCVQYR.ESDLAFLTRLTAEEGLYFFHEF.EEG............
I2BBZ6_SHIBC/54-354...P....YGIEV.INETDTGDAFGS.........ITLEQG.ETGFELLDRLAKQRGVLVT....SDA............
BPD_BPP2/42-365...R....NRLEA.SVAPSLAGIKIP.........HIDQSQ.ESDAKFLTRLAERNGGEVSVKM................
Q0KDW7_CUPNH/38-356PFSVEKR...LDT.S.....VYPKLA.........WEVQHG.ETDAHFIQRLTEEYGITYFFEH.DGG............
Q3IWJ2_RHOS4/27-325LDWD....FRLQA.S......YPPRD.........YCVQYG.ETDLDFVQRLMEHEGIGYFFEHEAE.............
Q5DYX3_VIBF1/29-334ILSNHFT.IELFN.T......HEPRE.........YCVQYG.ESDAMFVQRLLSEEGLVYYFEHTES.............
Q63II0_BURPS/23-325FPIE....NHLTD.T......YAPRD.........YCVQYN.ETDAAFVSRLMEFEGIYYYFKHAAQ.............
Q63K62_BURPS/46-349FGSR..D.FRMRH.....GGGYRKRS.........FVCQYD.ESHLDFVSRWMEKEGLYYYFEH.DGR............
Q63LB9_BURPS/58-337...R....YSLAP.IVGDALARILIA.........HIDQTH.ESDMSFLTRLAKRYDAVMNVKD................
Q63LQ5_BURPS/38-351SALASYE.FRAGR.T......LKPYS.........YCTQYR.ETDLNFVLRLMELEGLFFYFEHTED.............
Q63P68_BURPS/44-375ALARAFE.FDLSG...LRADRYPPRE.........LTRQVN.ESDAHFVRRLLRREGITVFAKAGPAKGERPL...QGDA
Q63TB7_BURPS/37-356.YGAIAR.WRFTADANQRIAELGARD.........YRVQYRTHTHFDFVRHVLAEAGLGFCFVEEADAP...........
Q7CGL8_YERPE/58-356.GINDFA.FGFRH.S......HPARE.........FCVQYQ.ESDFDFIQRLTAEEGIFYYFEF.STG............
Q7CHB6_YERPE/23-325...P....YGITV.TSDITDMTIVPT.........FTLNWG.ETAQTVIENVTRWAALLYY....DQL............
Q8ZRL1_SALTY/121-429PYPVEK...RLVE.S......YPVRT.........WQVQYG.ETDFDFLQRLMQEWGIYWWFEHSED.............
Q9I1A6_PSEAE/30-322.GFS........DYQLQLSGSYQPRE.........YCVQYG.ESDLAFVSRLLEEDGIFWFFTHAAG.............
Q9I3K1_PSEAE/27-327RVLD.YE.QRIYH.......EHLPRE.........YCVQAG.DSDHYLHDRLAFEEGLVYYFRF.DEH............
Q9I737_PSEAE/29-329.GFSDFE.DALSR.S......YREWE.........YCVQYR.ETSFDFVSRLMEQEGIYYWFRHEQS.............
Q9PAL7_XYLFA/37-321...E....HGMTS.AISPSLSGVALP.........HIDQTE.ESDINVLLRLAQRYDAIAKPAG................

PF09096

BP27_BPT4/203-375------------------------------------ATIYA-HSFLDSSIPMITTGK-----------------------

PF06763

Q2SI49_HAHCH/7-189---------------------EIRGQ----------V....-....NLKLNYVKERMTL.........------------
K7A372_9ALTE/15-199---------------------MLSKV----------T....-....GIGQRDVRSDLKI...TKANKV------------
COMPL_BPN15/3-184---------------------VVSKD----------T....-....RVPRKLVKQRARV.KRATVNKP------------
Q8ZN01_SALTY/1-192---------------------KVARE----------TVAGD-NQVRGLPLKLVRQRVRLFKAGTDGKR------------
Q8ZQG7_SALTY/3-194---------------------RVAKE----------AVAGD-NQKKGIPFRLVKQRVRLWKASATGKH------------
Q8ZQ91_SALTY/3-188---------------------SAAAL----------VVAGD-NRRQGIPVRTVRRRARV.RLARADKP------------
COMPL_LAMBD/3-192---------------------QVARE----------T....-....KVRRKLVKERARL.KRATVKNP------------

PF09097

BP27_BPT4/5-200---------------------LTMRD-----------------------SLYGRNEGMLQFYDS----------------

PF05354

Q8ZN00_SALTY/1-117----------------------------------------------------------------------------DDPE
FII_LAMBD/1-117----------------------------------------------------------------------------DDPE
FII_BPN15/1-117----------------------------------------------------------------------------DDPE

PF13856

D4K5F6_9FIRM/1-108----------------------------------------------------------------------------SNDT
A3MZN0_ACTP2/1-99----------------------------------------------------------------------------DEAP
B8F4K5_HAEPS/1-99----------------------------------------------------------------------------DEAP
M9X5I9_MANHA/1-99----------------------------------------------------------------------------DEAP
Q8ZQ92_SALTY/1-90----------------------------------------------------------------------------SDFL

PF09393

F6DLR2_DESRL/1-131----------------------------------------------------------------------------GTGT
R7FA15_9CLOT/4-145----------------------------------------------------------------------------GTGK
A9KPP0_CLOPH/4-148----------------------------------------------------------------------------GTGS
A5I2K4_CLOBH/3-146----------------------------------------------------------------------------GSGT
R6NS73_9FIRM/11-143----------------------------------------------------------------------------GTWT
F2F2L4_SOLSS/3-140----------------------------------------------------------------------------GEGS
C4Z5U0_EUBE2/2-139----------------------------------------------------------------------------GTGS
R5BEH1_9FIRM/6-141----------------------------------------------------------------------------IAGT
R5AL39_9FIRM/3-146----------------------------------------------------------------------------GTGT
Q65L22_BACLD/1-141----------------------------------------------------------------------------GTGT
R6M2J8_9FIRM/6-141----------------------------------------------------------------------------YEFS
R6QFB0_9FIRM/2-146----------------------------------------------------------------------------GTGK
R5H4V3_9FIRM/3-147----------------------------------------------------------------------------GSGT
D1AHR6_SEBTE/5-149----------------------------------------------------------------------------GSGT
C0Z6Z9_BREBN/3-140----------------------------------------------------------------------------GEGT
C6D1T3_PAESJ/3-147----------------------------------------------------------------------------GSGT
A3DIA9_CLOTH/4-148----------------------------------------------------------------------------GTGS
D3EHB9_GEOS4/2-143----------------------------------------------------------------------------GSGT
F9VIU9_ARTSS/5-149----------------------------------------------------------------------------GTGS
Q18BM9_PEPD6/2-140----------------------------------------------------------------------------GKGS
D4MVP4_ANAHA/2-140----------------------------------------------------------------------------GSGT
A6TQV7_ALKMQ/4-142----------------------------------------------------------------------------GEGT
Q24LI3_BPPCD/3-141----------------------------------------------------------------------------AEGS
D3EHD6_GEOS4/2-130----------------------------------------------------------------------------GTGT
I4D3G0_DESAJ/2-140----------------------------------------------------------------------------LKGT
Q892H5_CLOTE/3-141----------------------------------------------------------------------------GKGT
Q184A4_PEPD6/3-147----------------------------------------------------------------------------NTGS
R6UQ00_9FIRM/3-141----------------------------------------------------------------------------GTGT
R5TBQ4_9FIRM/10-152----------------------------------------------------------------------------GSGT
M1MSJ7_9CLOT/3-147----------------------------------------------------------------------------GTGT
R6PBH3_9FIRM/5-148----------------------------------------------------------------------------GTFS
A6TRA1_ALKMQ/2-131----------------------------------------------------------------------------GSGT
R6PLB1_9FIRM/3-147----------------------------------------------------------------------------GKGS
A5N9B6_CLOK5/3-133----------------------------------------------------------------------------GTGT
R5BLA9_9FIRM/2-140----------------------------------------------------------------------------CKGQ
L7VLA7_CLOSH/4-149----------------------------------------------------------------------------GTGS
I0GWR6_SELRL/2-140----------------------------------------------------------------------------GSGS
R5BQR6_9FIRM/9-143----------------------------------------------------------------------------GEGN
Q24QE7_DESHY/2-147----------------------------------------------------------------------------GSGT
D9R927_CLOSW/3-146----------------------------------------------------------------------------GKGS
R6HTP3_9FIRM/3-147----------------------------------------------------------------------------GTWS
R6Q009_9FIRM/2-140----------------------------------------------------------------------------GEGT
A9KKK2_CLOPH/4-149----------------------------------------------------------------------------GTFK
W8T695_EUBAC/3-142----------------------------------------------------------------------------CEGS
R6ST47_9CLOT/2-146----------------------------------------------------------------------------LTGS
C8VZG4_DESAS/2-142----------------------------------------------------------------------------GTGT
D4M0Z1_9FIRM/4-148----------------------------------------------------------------------------GTFS
G4L1J2_OSCVS/6-136----------------------------------------------------------------------------ITGS
U5MV98_CLOSA/3-133----------------------------------------------------------------------------GSGS
F2JK33_CELLD/10-154----------------------------------------------------------------------------GSGS
A5N2B8_CLOK5/3-131----------------------------------------------------------------------------GTGS
B2TNV8_CLOBB/5-135----------------------------------------------------------------------------GSGT
C0ZFE9_BREBN/2-132----------------------------------------------------------------------------VSMT
F3ZZH5_MAHA5/2-128----------------------------------------------------------------------------GTGT
M1MI16_9CLOT/3-138----------------------------------------------------------------------------GKGT
X2GJE7_9BACI/3-140----------------------------------------------------------------------------GEGN
A5I4B2_CLOBH/1-131----------------------------------------------------------------------------GTGS
A6LTZ2_CLOB8/3-133----------------------------------------------------------------------------GSGT
A6LRW9_CLOB8/3-141----------------------------------------------------------------------------GEGT

PF06605

A4J7Q0_DESRM/62-404-..-..KVAQVW---------------------GGEIKIR----LDVTG.GVIANRYIDLRAR..R..........GM.D
A5D093_PELTS/222-567-..-..KMLEVW---------------------KCEVRYR----VKLAG.GKIVGRYVDLLAR..R..........GH.E
A5VJT7_LACRD/39-685-..-........---------------------..GAYWK----PD.......SDMVVGIYDLESL..........K.KP
A5VKI8_LACRD/34-537-..-..KITETW---------------------.TDAVIF----PM........AKHITVYSHDEF..........Y.KD
B2TMG9_CLOBB/35-355-GT-EGSIVDTY---------------------GNGADIV----RD........NFKVSVVQN.............GGQD
B8I7P6_CLOCE/418-720-..-..MTQQIH---------------------..GGDLV----FDS......RNRLVSLLR...F..........SGSD
C4Z844_AGARV/33-364-..-..KLCDQL---------------------.......----..........SGYLRIRKKDGIRYLDLVTLENYGKV
D9SSG9_CLOC7/29-338-..-..EIRKVY---------------------..LCDFK----FDA......INKKVYIYQS..M..........GL.D
F3YBF3_MELPT/27-330-..-........---------------------..MSQLA----KDSNFDFRFINNHINIYKT...............IG
F9UQU7_LACPL/38-346-..-..DYTSKF---------------------..DASYV----ID........NQQIIFYSATYL..........KHQP
G8M053_CLOCD/417-718-..-..TVQNIY---------------------..GGDLV----FDS......ANRQVHLLT...F..........SGTD
I6T7G9_ENTHA/33-340-..-..EILSDY---------------------..NAVVI----PN........NKHLMFYPISEY..........G.QK
Q5WE58_BACSK/33-341-..-..QVMNRF---------------------..GCEYR----IS........GRHLTVATE.............IARY
Q5WIB8_BACSK/8-317-..-..QCLSRF---------------------..DAEYD----VK........GIHVIIAPVGSL..........GVNQ
Q65ET7_BACLD/226-551-..-..EIIEDY---------------------..GIEID----VD........NYKIYIYKK..M..........G.KR
Q65KF3_BACLD/29-328-..-..DILEKF---------------------..GAEFD----YK........GKKIYVAKK..F..........GIQR
Q835T2_ENTFA/29-351-SI-PADFEEEY---------------------LWQWNTE----VY........PFELSLVKP..............PTE
Q8Y4Z4_LISMO/34-333-..-..QLLDDY---------------------..GVVVI----PD........NRHLVFKPREIY..........G.AK
Q8YAK1_LISMO/33-338-..-..LCLEEF---------------------..GAILF----AD........NKKLYFYDEKSW..........Y.VK
Q9K758_BACHD/67-370-..-..ELPSLF---------------------..GGELH----FNT......DTMTVDFTEP..V..........GR.K
Q9KGP3_BACHD/67-375-..-..QLPEVY---------------------..GGELH----FNS......EAMTVDFLAP..V..........GR.Q
R4K6I2_CLOPA/41-361-..-..QFVNKF---------------------..YGVLS----VR.......KENGIRYLDYTGL..........VGQQ
V5XMR9_ENTMU/31-336-..-..EVLQDF---------------------..RLVVV----PD........NKHLRFMSADAF..........G.KK
W6S0H7_9CLOT/417-718-..-..SVANLH---------------------..GGDLV----FDC......PNRLVHLLT...V..........NGKD
X5A593_9BACL/39-378-..-..AVLTLY---------------------..GAEVE----PD........NFTLHVRKK..I..........GDSA

PF13550

A1AYP0_PARDP/820-985-..-....E...---------------------..VIEMV....RG------------------------------QETE
A1B627_PARDP/791-955-..-....D...---------------------..AVEVS....RA------------------------------ADAE
E0THS4_PARBH/770-933-..-....P...---------------------..PITIE....RL------------------------------PAEE
A7HRK9_PARL1/775-940-..-....AT..---------------------.PGYRLT....RG------------------------------QETE
A7IK58_XANP2/791-954-..-....P...---------------------..LVSST....RA------------------------------QESE
A8LQN2_DINSH/795-960-..-....E...---------------------.GVLQLT....RA------------------------------PNAE
A9CJN3_AGRFC/756-923-..-....P...---------------------..LWSEN....RG------------------------------HDSD
B0SVY2_CAUSK/777-933-..-....D...---------------------.APVRAS....RT------------------------------LAA.
B0UJ15_METS4/791-954-..-....P...---------------------..DFRRT....RT------------------------------EEAA
B1LTZ4_METRJ/785-952-..-....R...---------------------.PVLHQV....RA------------------------------EESA
B6JDQ1_OLICO/759-925-..-....SD..---------------------RSRVKVE....RT------------------------------QDTE
B9JU38_AGRVS/757-919-..-....P...---------------------..FWTET....RG------------------------------DSTD
Q0AR61_MARMM/759-917-..-........---------------------..SVTRV....HP------------------------------APLD
Q28RU9_JANSC/978-1139-..-....E...---------------------.GGFTHV....RA------------------------------PDAE
Q3SUI4_NITWN/802-967-..-....ER..---------------------.EEITLT....RG------------------------------QETE
C6XID3_HIRBI/772-930-..-........---------------------..MFERR....RK------------------------------AMEA
A8HR63_AZOC5/794-957-..-....A...---------------------..PLLLT....RA------------------------------QETE
D9QF99_BRESC/731-889-..-....S...---------------------.GPVRER....VL------------------------------DA..
B2JUI8_PARP8/529-699-..-....DDQN---------------------ITPITET....IT------------------------------QEID
D0J488_COMT2/383-550-..-..AEE...---------------------..PLALK....IG------------------------------NDLE
A9BYF1_DELAS/314-478-..-........---------------------.....SE....RQ------------------------------AQIE
Q2G3K6_NOVAD/231-396-..-...AD...---------------------..DAKIEGWSRKR------------------------------QALP
Q1GRM1_SPHAL/243-405-..-....EEA.---------------------AVDTERR....RA------------------------------PLAS
Q2N607_ERYLH/223-386-..-....Q...---------------------.LHGRQS....DR------------------------------STGE
B8EKU0_METSB/229-420-..-....D...---------------------..PVEVT....RA------------------------------DPYD
B2IJD4_BEII9/227-411-..-....D...---------------------..PVLVA....RV------------------------------DPHS
Q2WA44_MAGSA/316-506-SG-TNMTD...---------------------..PVVLV....RA------------------------------RPAD
C9R735_AGGAD/265-435-..-...VA...---------------------..VLDDD....SA------------------------------ATDK
Q2W6E0_MAGSA/315-503-SG-MSSSA...---------------------..PLVMT....AA------------------------------NDFG
Q2SAL7_HAHCH/191-365-..-....E...---------------------..LESFQ....RA------------------------------AWGE
A7I049_CAMHC/190-363-..-....S...---------------------..NIKFT....RK------------------------------SWDD
B2FM10_STRMK/213-385-..-....V...---------------------.RLERFE....RA------------------------------QWGE
E6WEJ9_PANSA/332-495-..-........---------------------..KFTYS....SM------------------------------KRSE
A6VNR7_ACTSZ/335-501-..-........---------------------...FNRQ....YA------------------------------ALKS
Q8XYR0_RALSO/340-503-..-....Y...---------------------..AGSAR....RA------------------------------RKT.
B2JL07_PARP8/351-514-..-........---------------------...FNYV....GS------------------------------PLNQ
Q2W829_MAGSA/500-665-..-........---------------------...IKYV....M.------------------------------PGDD
A5CF56_ORITB/744-904-..-....A...---------------------..SVNHT....II------------------------------AKNQ
B9KI53_ANAMF/694-848-..-........---------------------...YQVT....YA------------------------------PTA.
C5AYQ3_METEA/784-949-..-....A...---------------------.APLRRV....RA------------------------------QESE
D5AU04_RHOCB/799-959-..-....A...---------------------..VVETV....RA------------------------------AEAE
G8PN64_PSEUV/767-937-..-....EE..---------------------.GYNSIN....RN------------------------------DGSD
N0B519_9RHIZ/827-991-..-....D...---------------------.PLYEVT....RA------------------------------QETD
TIPJ_LAMBD/332-498-..-....A...---------------------..PFRYS....FS------------------------------ALKD
Q1QNE9_NITHX/777-937-..-....A...---------------------..PARLT....RA------------------------------QETE
Q3J233_RHOS4/334-499-..-........---------------------...SERP....FQ------------------------------GLNE
Q3J3J4_RHOS4/795-953-..-....E...---------------------.GALERV....RA------------------------------AEVE
Q5F989_NEIG1/222-406-..-....D...---------------------..PVKAG....RK------------------------------TNAD
Q7ARG4_YERPE/359-522-..-........---------------------..MFSYK....GS------------------------------ARKD

PF16792

H9EDD6_9CAUD/1-372-YG-YFFNSTIF---------------------AGRATIN----RK-AETSSATGVAKRIFSKVQFQPTTTIQHSSSVAD
H9ED19_9CAUD/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AKTSSATDVAKRIFSKVQFQPTTTIQHASSETD
D3LCP7_OENOE/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHASSETD
H9EFC2_9CAUD/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSATDVAKRIFSKVQFQPTTTIQHASSETD
GP16_BPLP2/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHAPSETD
C7T1V4_9CAUD/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHASSETD
O80118_9CAUD/1-372-YG-YFFNSTIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHASSEAD
C7T205_9CAUD/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHASSEID
C7T2B2_9CAUD/1-372-YG-YFFNSSIF---------------------AGKATIN----RK-AETSSAHDVAKRIFSKVQFQPTTTIQHASSETD

PF05954

Q1LDW8_CUPMC/39-340FGE.QIVFGDDI.DH.....YIYL.....P...QRIVPYR----ET------------------------------AGLE
C5AP32_BURGB/40-351KSH.QVVIMDDL.YF.....GPS......LP..GGDMKFS----HS------------------------------.SMN
A8IB09_AZOC5/33-335.SH.TLVLSDST.AG.....YVD......SID.KSVI...----.H------------------------------APVT
A9G446_SORC5/24-329.GD.KVIFCDA..KS.....YEE......DPI.GEPVRYH----PQ------------------------------LGYD
B1M1X9_METRJ/41-344.AH.TLVLTDAT.KL.....AAD......APG.AEAIEYN----AE------------------------------PGGT
A9GQF5_SORC5/30-340APE.VIVFADSP.GA.....YAQ......IAG.DPTLAYR----QA------------------------------TGAA
A9EVZ6_SORC5/26-317.RD.RVVLCDHD.GG.....WEP......LPG.LGSMPVR----EP------------------------------GGFG
Q98IK7_RHILO/26-327.KH.TLVLCDAM.SK.....LKP......APG.YEKVLYN----FE------------------------------GYGS
A9FA22_SORC5/24-354NGS.RLLLDDAL.HA.....RPP......R.T.TPPLRYV----DH------------------------------PTEA
A9GAG1_SORC5/23-352ADT.RLTLSDKL.EA.....EPL......R.P.GPPLPYV----DN------------------------------PIET
C1AEJ4_GEMAT/29-353.EA.KLVMGDNSSSATGAWGLDT......LKY.DPNMAGS----HN------------------------------SFTE
Q2L040_BORA1/29-322.GH.TLILADSP.AA.....HRE......CAG.ASELVYA----PQ------------------------------GPDK
B2U7V1_RALPJ/41-362.HH.RLVLVSES.GA.....WRKF....PSGA.YHALSIY----.P------------------------------QGFK
A9FDZ6_SORC5/23-354SGS.TPTLSDKLHLA.....TPR......A...PPALRFV----DS------------------------------PNDA
B4E682_BURCJ/41-356GKH.TLVLADTN.QR.....FAP......A.E.PEVIGFH----QT------------------------------SDGD
B1XWY3_LEPCP/24-338.AH.KLVLVDAM.GA.....HDA......APG.CPSLRYT----ED------------------------------LAQA
B4E676_BURCJ/37-356AGH.TMLVFDDS.AQ.....LAED....DTSARRGGVPRR----SS------------------------------GTAT
A1KB80_AZOSB/48-380GHH.TLILFCAD.HP.....HPC......S.H.TPHLRFH----RT------------------------------VGPE
Q47E10_DECAR/36-349ARH.QLIVFDRE.TE.....LPDG.....V...QPTIRFH----RN------------------------------NATE
Q8XUG6_RALSO/40-368PVH.TLVFCDDP.MR.....LPQ......S.A.AGTVPYH----YG------------------------------AAVK
C5AKJ1_BURGB/40-354RSH.TFVVTDSV.SQ.....VPV......LK..QSVVQLS----HA------------------------------.GDN
Q0K251_CUPNH/36-365.HH.RMVLTDGN.GA.....FQNI....PSPA.YHTINWY----.P------------------------------SSDR
C5BAE3_EDWI9/29-331.HH.VMVLADSN.AA.....VQP......CKT.HSDIVYR----PK------------------------------HMSE
Q747T8_GEOSL/38-336.KH.VIVFSDTG.SG.....YLY......MPG.KRQIPFN----TN------------------------------DGMV
A5G0B1_ACICJ/27-330.GH.KFVVASSS.QS.....LPK......L....GAVKFA----GQ------------------------------TATE
Q6LUC9_PHOPR/30-341.SH.QLIIADSV.DA.....YAE......C.E.DGNVRHV----TG------------------------------SCN.
A1KCD6_AZOSB/26-329.KN.TLVLADAY.AA.....HSS......TAG.YEEIEFV----EN------------------------------RQGG
C5AHV1_BURGB/44-356SSQ.TMVIVDAL.YA.....TP........A..PFDVWFQ----RQ------------------------------.GTH
Q8XRR3_RALSO/37-355SGH.ALLIFADS.PR.....LAED....TASAAEGGIRYH----RA------------------------------HSQE
C6XDI4_METGS/47-391.RH.TLVLADHN.GA.....YTPFQPDDPASG.YHTIAYY----.P------------------------------PDHK
A9C0N9_DELAS/23-326.QH.TLVLCDDIIAS.....HSV......LPG.GASIPFY----PP------------------------------EKAA
Q87HD9_VIBPA/30-349.SH.VLDIFDDV.SF.....YKP..........SPEFMVD----FD------------------------------TGSS
A6TAS8_KLEP7/34-358QSE.VVHFADAQ.RA.....LMF..........DKTLPVN----SP------------------------------SGMS
Q0JYG5_CUPNH/32-330.AH.TMVLADSP.SA.....HPP......GAH.CADLAMH----DM------------------------------ERPQ
B4E680_BURCJ/35-341GDH.TVVVFDRH.AR.....LPD..........GSAIAFN----AQ------------------------------DVGD
C5A958_BURGB/38-352.DH.KLIITDNS.IT.....AKA......IGGRSPVLQYT----KD------------------------------EVLD
Q0JZD4_CUPNH/35-364.KH.RLVLTDGN.GA.....FAPF....ASSA.YHSIRWA----.R------------------------------SSDR
B4EUE4_PROMH/79-373.GP.KLFYSDNHLGM.....TAG......I.....TLTYN----PQ------------------------------SETD
Q7MDQ8_VIBVY/30-349.SH.VIEIFDDA.SY.....YKP..........GAEFLID----FN------------------------------SGTA
C5AA20_BURGB/41-355KSH.TLVVTDDL.HS.....LDK......LV..PDTLGFW----RA------------------------------.GAA
A9FYV0_SORC5/370-667.QD.TMVFTD.G.AG.....FEP......AAG.AESVQFR----EN------------------------------SD..
Q88I93_PSEPK/38-347.SH.LMVITDDS.ST.....LLP......LPE.QPQIRYH----SA------------------------------SVTE
Q3A0Q0_PELCD/27-339DHE.ILHIADTT.NR.....CPM......L...ARELLTY----TP------------------------------NAGM
C5AMP3_BURGB/41-355KSH.TLVVTDDV.HS.....LDQ......IQ..SNPVEFY----RA------------------------------.DAG
C5ALD6_BURGB/39-369.KQ.RLVLCDHI.GA.....HRKS....PNPA.YQKLAFQ----.P------------------------------QEGK
Q8XS52_RALSO/44-358KSH.TMVIVDSV.DA.....LPA......SG..PARVPFC----RS------------------------------.GVG
Q080W0_SHEFN/30-339.AH.TLVLADDI.NA.....YKP......C.A.EEKVRCF----SG------------------------------HLA.
Q2SGF0_HAHCH/101-403.RH.LLVLADDK......................STNALM----EP------------------------------RKIE
D2QZK3_PIRSD/24-327.TH.KMVLADSI.SA.....HKA......IEG.EASIAYM----SR------------------------------RDGF
B4EH48_BURCJ/40-354KSH.TLVMTDRL.QT.....LEP......LA..PATVEFS----RA------------------------------.GVH
C5AMI6_BURGB/41-362QRD.TLVFSNTA.RG.....YMR......A....LEVPLL----PN------------------------------SGLV
Q28MX5_JANSC/33-346.AH.RMHIADHA.SG.....Y..T.....SGN.DPDVRFA----AG------------------------------STD.
Q47J31_DECAR/32-356AGH.RLRLFADS.QR.....FPEDIVSQSANG.GQGIRYH----RA------------------------------DSQE
C5A8I9_BURGB/40-354KSH.TLVVTDAI.TS.....LPE......LA..PRSVSFA----RM------------------------------.ATG
Q6FFL7_ACIAD/42-385APQ.KLRLIDDN.QQ.....FLAL.....S...RGLIRFH----RS------------------------------HATE
A1B4U8_PARDP/26-330.GH.VTVLADAN.AA.....MKP......VPG.AEEIAYE----PD------------------------------SPSA
Q8XQT0_RALSO/113-430.KH.VLVIGDTN.DT.....FRP......LAP.VDSIPYY----GS------------------------------SAAS
A1K519_AZOSB/50-375ST..LLVLFDAA.DS.....LPP......A.E.PPSVRFH----RG------------------------------NASE
Q3A0Q1_PELCD/40-341.KS.RPRFCDRS.AA.....RPA......LPG.VSALRYQ----PQ------------------------------TGTA
Q6F782_ACIAD/42-387EPQ.YLRLVDQN.TE.....YSCL.....E...RSSIRYH----RS------------------------------HATE
Q1QVA4_CHRSD/41-355DGH.RIVFTDDV.DT.....TQP......VS..PQAIRFH----RQ------------------------------.DAT
A7MMD4_CROS8/36-364GHE.MVVFGDSD.RG.....WQY..........GVTVPVV----NL------------------------------AGMH
A9BLL4_DELAS/23-327.QH.VLTLGDDIVAS.....HDP......LQG.GAVIPFH----PP------------------------------GKAA
A0KJD1_AERHH/29-325.KH.RIVFADDA.AA.....LTA..........GPELFFN----LG------------------------------NRSL
A1TTP1_ACIAC/24-327.SH.TVVFADDVVAS.....HAP......LPG.GHVIPFH----PP------------------------------GKTA
B4F002_PROMH/27-319..GPQLFYSDRH.LG.......M.......RA.GISLTYN----PQ------------------------------SDTD
B9JVA0_AGRVS/37-346.VH.RLKVSDSK.VA.....WGSP.....SAS.AEGEQNV----RL------------------------------AQGS
G3XCU8_PSEAE/32-313..G.MLMVLPRQ.SG.......Q......SAT.GRRIEPL----VL------------------------------GRAD
I1SBE4_PECAS/30-328.KH.RVVFADDA.GA.....LTK..........GPELFFN----LA------------------------------VQGL
I2BBZ6_SHIBC/54-354.WG.RLIITRAS.TQ................R.AGVALVL----GE------------------------------NILA
BPD_BPP2/42-365..G.KLLFLKAG.QG.......V......TAS.GKKIPQV----TI------------------------------TRSD
Q0KDW7_CUPNH/38-356.HH.RLILAAES.GA.....YRAF....PSEA.YRTLPLY----.P------------------------------RGFK
Q3IWJ2_RHOS4/27-325.GH.RLVLFDTN.AR.....LAP......APG.AEILPYE----PD------------------------------SRVS
Q5DYX3_VIBF1/29-334.GV.KQIISDGP.EI.....YTE..........LPPLCVV----AD------------------------------NGMT
Q63II0_BURPS/23-325.TH.TLMLCDAM.AS.....HVA......LPG.YEHIPFI----AR------------------------------DRTA
Q63K62_BURPS/46-349.HE.TLVIVDDR.RH......QPG.....PAD.DLALRYL----PA------------------------------TSLD
Q63LB9_BURPS/58-337..L.RLLFMPIG.TG.......Q......TAS.GKQLDVL----EL------------------------------TRAS
Q63LQ5_BURPS/38-351.GH.KLIIDDDS.TR.....AKP......IDG.PPSLRYA----SG------------------------------EILE
Q63P68_BURPS/44-375PVH.TLVCCDDP.MS.....LPQ.......AP.AGTVRLH----PR------------------------------DGGA
Q63TB7_BURPS/37-356AGH.TMLIFDDS.TQ.....LPEDE...TSAR.MGGVPQR----.L------------------------------SGTA
Q7CGL8_YERPE/58-356.KN.TVVYADDV.GS.....LPK..........GASLPYN----PN------------------------------VAAQ
Q7CHB6_YERPE/23-325.DG.NLLLTRVG.NR.......K..........AASGVAQ----GV------------------------------NILS
Q8ZRL1_SALTY/121-429.SH.TLVLADAI.SA.....HKA......CPD.SPLVEWH----.Q------------------------------EGLK
Q9I1A6_PSEAE/30-322.KH.TLVLADSN.DA.....FPP......IPN.GPQVAYL----GQ------------------------------GIGV
Q9I3K1_PSEAE/27-327.RH.TLVCSDRL.YV.....QER......IA..GGPVLFS----AQ------------------------------PEGD
Q9I737_PSEAE/29-329.RH.ILVLSDAY.GA.....HQS......PPN.YASVPYY----PP------------------------------TLEQ
Q9PAL7_XYLFA/37-321..G.RLIFAKRG.ES.......K......SVT.GIDMPRI----TL------------------------------TPDE

PF09096

BP27_BPT4/203-375---------------------------------GENSIVV----SR------------------------------SGAY

PF06763

Q2SI49_HAHCH/7-189---------------------------------...IKAN----PD------------------------------RL..
K7A372_9ALTE/15-199---------------------------------SQTAKVD----SS------------------------------EGRA
COMPL_BPN15/3-184---------------------------------RALIRVN----RG------------------------------NLPA
Q8ZN01_SALTY/1-192---------------------------------SARIRIN----RG------------------------------NLPA
Q8ZQG7_SALTY/3-194---------------------------------YARIRVN----RG------------------------------NLPA
Q8ZQ91_SALTY/3-188---------------------------------FANIYVN----CD------------------------------PLTA
COMPL_LAMBD/3-192---------------------------------QARIKVN----RG------------------------------DLPV

PF09097

BP27_BPT4/5-200-----------------------------------KNIHT----KM------------------------------DGNE

PF05354

Q8ZN00_SALTY/1-117SV-----SYAAG---------GVRIEGDKPTF------------------------------------------------
FII_LAMBD/1-117NI-----SYAGQ---------GVRVEGSSPSL------------------------------------------------
FII_BPN15/1-117NI-----GYAGA---------GIRVEGTSPTL------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108LK-----ESGGHWEGGVRQSFGTQIYTTSKKL------------------------------------------------
A3MZN0_ACTP2/1-99KV-----FEGLH.FNE.....DTAINGTSRTL------------------------------------------------
B8F4K5_HAEPS/1-99HI-----MEGLH.VSD.....EQALNGTLRTL------------------------------------------------
M9X5I9_MANHA/1-99AI-----FNGLHSTD......DRAIHGTERTL------------------------------------------------
Q8ZQ92_SALTY/1-90AE-----LG..............PVEGNGKNV------------------------------------------------

PF09393

F6DLR2_DESRL/1-131MS-----GFKVTSGM..LQRG........FNK------------------------------------------------
R7FA15_9CLOT/4-145IT-----IYKNTSIF..DELMERYKNTGEDIY------------------------------------------------
A9KPP0_CLOPH/4-148AT-----FHYNTSIF..RQMMIDFKNTGEDVY------------------------------------------------
A5I2K4_CLOBH/3-146LT-----VYYVTSLF..RELMIKYIKTGVDTY------------------------------------------------
R6NS73_9FIRM/11-143AK-----IKKIYSRG...KTYAEKLSAGIDER------------------------------------------------
F2F2L4_SOLSS/3-140LV-----VKKIFSRG..SGMLAAGVKSGQMPE------------------------------------------------
C4Z5U0_EUBE2/2-139LT-----MHKVNSRM..AIKVANMVRNKQDVR------------------------------------------------
R5BEH1_9FIRM/6-141IL-----LHKVDSKI..INKLDAGIRSGALPD------------------------------------------------
R5AL39_9FIRM/3-146MT-----VYYVSSLF..RRVMADYMKNGVDTY------------------------------------------------
Q65L22_BACLD/1-141AT-----FYKVTSQF..VTLMMNYVKKGDDPY------------------------------------------------
R6M2J8_9FIRM/6-141YT-----VRKVYSRG...KEIADGHKKGKDTR------------------------------------------------
R6QFB0_9FIRM/2-146MT-----VYYVSSLF..RKVMLDYMKNGVDTY------------------------------------------------
R5H4V3_9FIRM/3-147MK-----IYYGSPLF..SSMVGDYKDTGRSLY------------------------------------------------
D1AHR6_SEBTE/5-149LT-----LHFNNSII..RELAIKYAETGEDFY------------------------------------------------
C0Z6Z9_BREBN/3-140MK-----IKKIYSRV..QRKMAANVRKGIYPR------------------------------------------------
C6D1T3_PAESJ/3-147LT-----VYYVTSVF..RQLMWSYIQTGQDFW------------------------------------------------
A3DIA9_CLOTH/4-148MT-----MYFMNSDM..LRLAIQYIKEGKYGG------------------------------------------------
D3EHB9_GEOS4/2-143MT-----IYYVTTLF..RELMMEYIQTGKDAY------------------------------------------------
F9VIU9_ARTSS/5-149AT-----FHYNTSIF..RKLMERYKDTGEDIY------------------------------------------------
Q18BM9_PEPD6/2-140IT-----LYHVSSRM..HKLIGEKIKRGSEPR------------------------------------------------
D4MVP4_ANAHA/2-140LK-----LNHASSYF..KKRILTDIKNGKNTP------------------------------------------------
A6TQV7_ALKMQ/4-142LA-----LKKVYSTG..ASLIGQKLKEGIMPV------------------------------------------------
Q24LI3_BPPCD/3-141IT-----LYHVDSNM..LKYITQIIKEGREPK------------------------------------------------
D3EHD6_GEOS4/2-130MS-----GYKVTSDM..ISRG........FTK------------------------------------------------
I4D3G0_DESAJ/2-140LK-----MNKVSSAM..IKANSDNMKAGKTPE------------------------------------------------
Q892H5_CLOTE/3-141LK-----LNKVDSMF..IKLMADNIKKGKQTK------------------------------------------------
Q184A4_PEPD6/3-147AT-----FHYNTSIF..RELLYRYKETGEDIY------------------------------------------------
R6UQ00_9FIRM/3-141VR-----IYNATSRL..IQAEAQALKNGQDLR------------------------------------------------
R5TBQ4_9FIRM/10-152LT-----IYKNTSLF..ENMMLKYVNQGVDTY------------------------------------------------
M1MSJ7_9CLOT/3-147LT-----VYYVTSLF..REMMINYIKTGKDVY------------------------------------------------
R6PBH3_9FIRM/5-148GT-----MHYNQSVL..RKVLEDYKNTGEDVY------------------------------------------------
A6TRA1_ALKMQ/2-131FS-----GYKVTSKM..IEQG........FER------------------------------------------------
R6PLB1_9FIRM/3-147AK-----FHYNTSIF..RRLLKEYKNTGQDIY------------------------------------------------
A5N9B6_CLOK5/3-133MK-----GYKVTSDM..IKRG........FKR------------------------------------------------
R5BLA9_9FIRM/2-140LK-----LHKVSSYM..IKKMNDNIKAGKQTV------------------------------------------------
L7VLA7_CLOSH/4-149MT-----MYFMNSQM..LNQAIQYLRTGNYRG------------------------------------------------
I0GWR6_SELRL/2-140FK-----LHKVSSFM..IEKLAPHMKEGKQVL------------------------------------------------
R5BQR6_9FIRM/9-143FT-----IKSVINRN..LNKMLEAWKAGTDPR------------------------------------------------
Q24QE7_DESHY/2-147LT-----IYYITSLF..RQLMIDYVKTGRDFY------------------------------------------------
D9R927_CLOSW/3-146MT-----IYNVSPAA..LAVYQQYIKDGGVPQ------------------------------------------------
R6HTP3_9FIRM/3-147GT-----AHYNQSIF..RKIADAYQKTGVMPY------------------------------------------------
R6Q009_9FIRM/2-140MV-----LHKVDSKI..AKTIAEGIRTGILPD------------------------------------------------
A9KKK2_CLOPH/4-149AT-----MHYNSSIF..RRMLMAYKNTAEDVY------------------------------------------------
W8T695_EUBAC/3-142LE-----FKKIFSRY..KKDIVDAWKKGEDIR------------------------------------------------
R6ST47_9CLOT/2-146MT-----IYYGTPYF..LKLLQEYLKTGKLPY------------------------------------------------
C8VZG4_DESAS/2-142IS-----GFKVTSRMTTLNQAVTLDNRAVTTR------------------------------------------------
D4M0Z1_9FIRM/4-148GT-----AHYNQSVL..RQALLDYKNTGEDVY------------------------------------------------
G4L1J2_OSCVS/6-136MT-----LHKIYTRG..SDDV.EQVQAGHDLR------------------------------------------------
U5MV98_CLOSA/3-133IK-----GYHITSKM..IQQG........FKK------------------------------------------------
F2JK33_CELLD/10-154AT-----FHYNTSIF..RELLVRFKENGEDVY------------------------------------------------
A5N2B8_CLOK5/3-131FT-----GYHVTSDM..IKRD........FKR------------------------------------------------
B2TNV8_CLOBB/5-135LK-----GWKVTSEM..TQQG........FNR------------------------------------------------
C0ZFE9_BREBN/2-132AT-----FERTSD....IQQLIMEIAANPEKK------------------------------------------------
F3ZZH5_MAHA5/2-128LS-----GFKVTSRM..LQMPH.......NSR------------------------------------------------
M1MI16_9CLOT/3-138LK-----LHHVSSRM..AILMKDNIKQGKQTV------------------------------------------------
X2GJE7_9BACI/3-140LK-----AKKVYSRG..ANLLAEAVKKGIVPE------------------------------------------------
A5I4B2_CLOBH/1-131IS-----GYKVSSKM..IQQG........FKR------------------------------------------------
A6LTZ2_CLOB8/3-133IK-----GYKVTSDM..IKQG........FKK------------------------------------------------
A6LRW9_CLOB8/3-141LT-----VKKIDSTI..WKICADAYKSGVMPD------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404TG-----KQFAYAKDI..DGIEREADITEVVT---ALY.....G...---------------------------------
A5D093_PELTS/222-567TG-----RRFEYTRDM..KKVTRKVDSTSIKT---ALY.....G...---------------------------------
A5VJT7_LACRD/39-685TN-----KVFRYLHDM..SNVDIQSDATNLIN---DVW.....V...---------------------------------
A5VKI8_LACRD/34-537RG-----HRLDYLNNV..SDIQIDIDSNSIIN---EAR.....C...---------------------------------
B2TMG9_CLOBB/35-355NN-----VLICYKKNM..TGFTCEENWTGCIT---RIY.....P...---------------------------------
B8I7P6_CLOCE/418-720SG-----ALFAYKKNL..TSIKRVVDTRSLVT---RLY.....A...---------------------------------
C4Z844_AGARV/33-364CA-----QPIQFGYNL..LDFTCGTSGTDIAT---AVI.....P...---------------------------------
D9SSG9_CLOC7/29-338RG-----SYFSEELNL..KKIEIQSNSYDYCT---RII.....P...---------------------------------
F3YBF3_MELPT/27-330RK-----NRFLFIDGATIAKISESTDYTTITT---HIK.....G...---------------------------------
F9UQU7_LACPL/38-346VI-----DTLFYQHDV..ENVKLSLDTTSLAN---EVR.....C...---------------------------------
G8M053_CLOCD/417-718SG-----ALFSYRKNL..KSIQRVVDTRELVT---RLY.....A...---------------------------------
I6T7G9_ENTHA/33-340VE-----EQIRYKYNT..DEVTFDIDTYSLKT---QIK.....G...---------------------------------
Q5WE58_BACSK/33-341TD-----GQVRHGHNL..KSISEHQDGTDIIT---HIE.....G...---------------------------------
Q5WIB8_BACSK/8-317VQ-----TQFRHDHNT..VTIEEHIDASELAT---............---------------------------------
Q65ET7_BACLD/226-551IN-----FTLDSRYNM..PGISITTNSQNSTT---RAW.....G...---------------------------------
Q65KF3_BACLD/29-328DE-----PFLRYRFNV..KDPEKEIDTSSFAT---YIR.....G...---------------------------------
Q835T2_ENTFA/29-351PV-----ARIQEGYNM..QGFEIERNPKMLIN---RIY.....P...---------------------------------
Q8Y4Z4_LISMO/34-333TE-----NFIRYKYNT..DEASFDIDTLSLKT---KIK.....G...---------------------------------
Q8YAK1_LISMO/33-338TE-----KQFRYLYNT..EEVSVDTNTDNLKT---EIK.....C...---------------------------------
Q9K758_BACHD/67-370SG-----AAIAYSKNL..EEVEAIYDTEELVT---KLY.....L...---------------------------------
Q9KGP3_BACHD/67-375SG-----AAIVYEKNI..HSIEAIYDTEDLIT---RIY.....P...---------------------------------
R4K6I2_CLOPA/41-361SS-----TTIHLGYNM..KDMTLENDVTNIAS---RVI.....P...---------------------------------
V5XMR9_ENTMU/31-336VH-----EPIRFKHNT..DEVTFDIDTYNLKT---QIR.....G...---------------------------------
W6S0H7_9CLOT/417-718SG-----ALFAYKKNM..KSIERVVDTRSLVT---RLY.....A...---------------------------------
X5A593_9BACL/39-378SD-----YRVQVTRNL..LTASFTDSGASLCT---RLFCEMKDSRTW---------------------------------

PF13550

A1AYP0_PARDP/820-985IP-----QALKWQVAR--ND..EEYDGVMVEA---RR......A...---------------------------------
A1B627_PARDP/791-955MV-----GRIRLTHVE--AG..GDYAARTAET---AM......P...---------------------------------
E0THS4_PARBH/770-933VP-----GRLRLTFTD--SL..ASYGSAEVAI---SD......P...---------------------------------
A7HRK9_PARL1/775-940LP-----VSAKLLYIE--GN..GEYRQAAVEA---RR......L...---------------------------------
A7IK58_XANP2/791-954LP-----LQVSIGFVD--SL..KDYRRATVAS---RR......L...---------------------------------
A8LQN2_DINSH/795-960LS-----GRVQLRYIE--EG..GDYATRSAEA---LF......P...---------------------------------
A9CJN3_AGRFC/756-923FA-----AEAVLTSFN--PA..LDYEQASARS---RR......I...---------------------------------
B0SVY2_CAUSK/777-933PV-----QALRLRFID--AA..RDYQTGSVIV---RR......D...---------------------------------
B0UJ15_METS4/791-954LP-----AALSLSFVD--PA..RGYQSAAVEA---RR......L...---------------------------------
B1LTZ4_METRJ/785-952LP-----RSVELGITD--SE.SPDYRRAAASA---VR......P...---------------------------------
B6JDQ1_OLICO/759-925LP-----IAVDIVHLD--EG..RDYQSSTVTV---RK......Q...---------------------------------
B9JU38_AGRVS/757-919YA-----GQAVLDFYD--PA..NDYEDASVRS---RR......V...---------------------------------
Q0AR61_MARMM/759-917LV-----RDIALGFYD--DR..ASYRTGHASA---RG......T...---------------------------------
Q28RU9_JANSC/978-1139TV-----GRLRIGYTE--AE..GAYVSKVAEA---IF......P...---------------------------------
Q3SUI4_NITWN/802-967LP-----NEVAIGFTD--AI..DDYKPGAVSA---NR......L...---------------------------------
C6XID3_HIRBI/772-930EA-----INLRLKYID--AA..NDYMPAIAIS---ES......E...---------------------------------
A8HR63_AZOC5/794-957LP-----LEVEIAFGD--GG..ADYRRRTVSS---RR......L...---------------------------------
D9QF99_BRESC/731-889PP-----EAARVRFID--EG..ADYQTGTVVV---RA......D...---------------------------------
B2JUI8_PARP8/529-699LP-----RSLALTYSG--MN..SDYNPNTQRA---FR......N...---------------------------------
D0J488_COMT2/383-550QP-----AQLALTYAN--MA..ADYNADTQFS---DR......L...---------------------------------
A9BYF1_DELAS/314-478YP-----RKLHLTFQS--AA..VNYQTAQATS---ER......V...---------------------------------
Q2G3K6_NOVAD/231-396AA-----RQCVVRYYD--TA..RDYQPGLQRS---IG......R...---------------------------------
Q1GRM1_SPHAL/243-405LP-----GTMRLRHYE--PD..RDYQLGQQTS---HV......A...---------------------------------
Q2N607_ERYLH/223-386PS-----LPHAVRYYD--PA..RDYQPGIQRA---VG......P...---------------------------------
B8EKU0_METSB/229-420AK-----NWVSIEILQ--RS..NHYDATPVEA---WD......Q...---------------------------------
B2IJD4_BEII9/227-411IA-----NMQTLECFD--RA..NNYAATPVRA---FD......Q...---------------------------------
Q2WA44_MAGSA/316-506AI-----NQVTLEYLN--RA..NQYSPEPVTA---RD......V...---------------------------------
C9R735_AGGAD/265-435QA-----NQIIVKYLE--PVTNREDQAIANNI---AA......V...---------------------------------
Q2W6E0_MAGSA/315-503AV-----TQVQVEYLN--RA..SGYNPLPATA---RL......L...---------------------------------
Q2SAL7_HAHCH/191-365TT-----NELVLIYTH--PE..S.FKETSVTV---QD......L...---------------------------------
A7I049_CAMHC/190-363TY-----SKCIIKYTD--NV..QNIEASVSAI---NT......A...---------------------------------
B2FM10_STRMK/213-385LP-----NELTVVYTD--WQ..TGNEATV.TV---EN......L...---------------------------------
E6WEJ9_PANSA/332-495RY-----NAVVVSWTD--PN..NGWSASKEYV---SD......D...---------------------------------
A6VNR7_ACTSZ/335-501IY-----TAAEVEFAD--ER..NMYQSAVEYV---AD......DLMI---------------------------------
Q8XYR0_RALSO/340-503..-----.VALVSWND--PG..DQYRAKVEHV---ED......G...---------------------------------
B2JL07_PARP8/351-514RH-----TIALVTWND--PA..QKYAQAIEYV---ED......A...---------------------------------
Q2W829_MAGSA/500-665TA-----DAVTVEYFS--SR..T.WKPDETTA---KL......A...---------------------------------
A5CF56_ORITB/744-904IL-----NNINLKFID--AN..NNYCLASFNY---TL......E...---------------------------------
B9KI53_ANAMF/694-848PC-----EAQALLYVS--RR..FGYQPRLRNP---QA......C...---------------------------------
C5AYQ3_METEA/784-949LP-----RSVAIGFSD--GE.SPDYRRATASA---AR......P...---------------------------------
D5AU04_RHOCB/799-959IA-----GRVRLAYVE--AE..GDFEVKAVEA---VF......P...---------------------------------
G8PN64_PSEUV/767-937LP-----AELRLRGMD--PN..NDFEALVVTS---RR......L...---------------------------------
N0B519_9RHIZ/827-991LP-----ASAKVRYIS--SA..DVYPQAVAEA---RR......L...---------------------------------
TIPJ_LAMBD/332-498RH-----NAVEVNWID--PN..NGWETATELV---ED......T...---------------------------------
Q1QNE9_NITHX/777-937LP-----REAGFGFTD--GT..VDYRRSAVTS---RR......L...---------------------------------
Q3J233_RHOS4/334-499SY-----NTVRATYPD--PK..AVWESTEAEP---FSKPEWVTA...---------------------------------
Q3J3J4_RHOS4/795-953TA-----GRVRLHFLE--AE..GDYEARQVEA---AF......P...---------------------------------
Q5F989_NEIG1/222-406AF-----NQIQVEYLD--RD..NDYNVAIAEA---KD......Q...---------------------------------
Q7ARG4_YERPE/359-522RP-----SVALVTYNN--KE..DGYKQNIEYV---ED......Q...---------------------------------

PF16792

H9EDD6_9CAUD/1-372PR-----NLLFINFSS------RNWNRNRITT---RV------D------------------------------------
H9ED19_9CAUD/1-372PR-----NLLFINFAS------RSWNRNRITT---RV------D------------------------------------
D3LCP7_OENOE/1-372PR-----NLLFINFAS------RNWNRNRITT---RI------D------------------------------------
H9EFC2_9CAUD/1-372PR-----TLLFINFAS------RNWNRKRITT---RV------D------------------------------------
GP16_BPLP2/1-372PR-----NLLFINFAS------RNWNRKRITT---RV------D------------------------------------
C7T1V4_9CAUD/1-372PR-----NLLFINFAS------RNWNRSRITT---RV------D------------------------------------
O80118_9CAUD/1-372PR-----NLLFINFAS------RSWNRNRITT---RV------D------------------------------------
C7T205_9CAUD/1-372PR-----NLLFINFAS------RSWNRNRITT---RV------D------------------------------------
C7T2B2_9CAUD/1-372PR-----NLLFINFAS------RNWNRNRITT---RI------D------------------------------------

PF05954

Q1LDW8_CUPMC/39-340SG.....QETVFSLKTHAKTIPESFRVADYNQ...NK------AWER.................................
C5AP32_BURGB/40-351EE.....FDGLTQLGEQQDVQSESLTLGAADY...KR------PNT.D...............................Q
A8IB09_AZOC5/33-335TG....ETIAVQEWASGFHFRSGKATLNDYNF...EQ------PAND.................................
A9G446_SORC5/24-329VS....AGMSLRTFTSQHTTLPAVIKLKDYDY...AR------PNLS.................................
B1M1X9_METRJ/41-344VK.....GPHVGRFTWREVVAPSDVVQRDHFF...RN------PVHD.................................
A9GQF5_SORC5/30-340ALA..PEERHVTRFVRRQAKAPRGARVKGFDF...AR------PALD.................................
A9EVZ6_SORC5/26-317ET.....EESVTEARVRVARVYDEVTLRDYNC...ET------PLVD.................................
Q98IK7_RHILO/26-327RR....DVEYITEWIPGSAVRPGAYAHTDYDF...EK------PGAD.................................
A9FA22_SORC5/24-354AA....EHEIVTEVRLVHDVRPGAYAVRDVDF...RN------PAFP.................................
A9GAG1_SORC5/23-352AE.....REFVTRVRLGHEVRPGASTIRGHDF...RK------PSFA.................................
C1AEJ4_GEMAT/29-353PAVFDLNTEAVPHLAKSKVRSATEFLATNNLS...EE------ITGK.................................
Q2L040_BORA1/29-322PG....LFD.LALSAEVEGPAP...VLADYDY...LN------ATVL.................................
B2U7V1_RALPJ/41-362ID.....QEHLTRFEPINRLRTGKVTFKDYDP...RQ------PKAD.................................
A9FDZ6_SORC5/23-354AE.....SEYVTEVTITHEVEPGATTIRDYDF...RN------PAFP.................................
B4E682_BURCJ/41-356P......RGGIRQFMNARRWRIGSIARASWDH...RS------LSTRP...............................S
B1XWY3_LEPCP/24-338PP....DQEFVTRWRFAEGVKSGKVALTSYDF...ER------PSTP.................................
B4E676_BURCJ/37-356GA.....DDVILGIGQSLSLTADRITLISSDYRVNRA------TTAS.................................
A1KB80_AZOSB/48-380S......VDAVDKWQAVRRLQAGRTSLLSFDY...KQ------AAPHAA.............................TA
Q47E10_DECAR/36-349A......SDTLQQWHEIRTALPNAVSLAGWDY...KT------LVATGAQ............................AQ
Q8XUG6_RALSO/40-368E......RDSITRWSEARSLIPGAIRGTSPDH...ET------GKVD.................................
C5AKJ1_BURGB/40-354EE.....FDGFVSFRERMQLQSARLTANTFDY...KQ------PSA.D...............................K
Q0K251_CUPNH/36-365VD.....EEHLHQFEVRDCLITGSWAHGDYDY...NQ------PRAD.................................
C5BAE3_EDWI9/29-331SG....DD..IQLWMPSLSVVPANVFLNTYTF...EQ------PTAS.................................
Q747T8_GEOSL/38-336PG.....KESVFDFIYSRRVRPGKVSQRDYCY...KH------TNLD.................................
A5G0B1_ACICJ/27-330VG........VHTLSRADSTTIGKFIGNDYNY...ET------ASTG.................................
Q6LUC9_PHOPR/30-341.......DPHVHHWTTGLQLAAGQSAISGFDL...QS------PMNP.................................
A1KCD6_AZOSB/26-329GD....ELGFVSQWQFERQVMPGKVMLRDYDF...TK------PSVG.................................
C5AHV1_BURGB/44-356VE.....ADALGHWASSRVLQSAHHTTRTFDY...KN------PSTPYN.............................PK
Q8XRR3_RALSO/37-355E......RDAIQALICHSRTAVGGVAVAAWDAQAKRA------FRAHVPSRFCG....................IAGSPD
C6XDI4_METGS/47-391TD.....AEYLHHFSDAEQLTSGVYASRDYDY...TR------PRAE.................................
A9C0N9_DELAS/23-326AG....DQENIHAWQLEQEIKPGRHYSDDYDF...KK------PRAD.................................
Q87HD9_VIBPA/30-349ES....S..HISAWNETQVLTTKSSQKSGFNM...LK------PASQ.................................
A6TAS8_KLEP7/34-358DS....GTESIWGLSITHNVVEANVTTRDYNP...RD------AQSVLQ..............................S
Q0JYG5_CUPNH/32-330AG....AAR.MLAFGMARQLGAATQVLADYDY...LQ------ARTS.................................
B4E680_BURCJ/35-341P......DGVMTQFSDRRQLVPDRVVATSWKASELHA------LAGHAQ.............................QP
C5A958_BURGB/38-352D......LAVITTFQASRQLESTHVGLKTFDY...KV------PHARR................................
Q0JZD4_CUPNH/35-364ID.....EEHLHEFELHDRLVSGQWTSSDYDF...VK------TRAD.................................
B4EUE4_PROMH/79-373IT.....DSTATKWRYIERLCSDVRIDKDYNQ...IR------PSYP.................................
Q7MDQ8_VIBVY/30-349E......LGHISSWHEAQSMVIMRSHKSGYDM...KK------PASH.................................
C5AA20_BURGB/41-355SE.....ANALTQWSGSRTLQSVTHTTRTFDY...KA------PAPAAN.............................PK
A9FYV0_SORC5/370-667.......TRDVFELEARSRLVPSVYVARDYNY...RQ------PMLD.................................
Q88I93_PSEPK/38-347T......ADSITQWQSTRQLQSGQIAVRTFDY...RQ------PRNFL................................
Q3A0Q0_PELCD/27-339ETDKGPGKVGMLGIIDRAEMVPARHWVHDVHE...NA------PEHPIL.............................SG
C5AMP3_BURGB/41-355SE.....VDAFTQWAGSRTLQSSVHTTRTFDY...KA------PSLGAN.............................SK
C5ALD6_BURGB/39-369TD.....AEYISAFSTAEMICPGSYLTNDFDF...TW------PRAD.................................
Q8XS52_RALSO/44-358EE.....SDGFTHWEEAGELHSTQLTTRTFDY...KQ------PASAAW.............................PK
Q080W0_SHEFN/30-339.......ESHVSHWQGGMSMVSGGFIQKGYDY...EQ------PKLY.................................
Q2SGF0_HAHCH/101-403HSSRPRNGGYIQEWRRTYQYFSGKWSLSDFNF...EK------SDQS.................................
D2QZK3_PIRSD/24-327DD....DTDHVFDWKVRHKVRTGVWAHTDFDF...VK------PKSN.................................
B4EH48_BURCJ/40-354GE.....VDALTQWAGTRTLQSVLLSTRTFDY...KN------PSTPAN.............................PK
C5AMI6_BURGB/41-362SW.....HEAILELNVTRSLVPQTVREWDHNY...RQ------PDGPLQ.............................VE
Q28MX5_JANSC/33-346.......RNHITRFETRLAYTPGVHAGGDWNF...ET------PG...................................
Q47J31_DECAR/32-356D......QDAILAFGERHRLASSVISAITYDYKAKKN------VTLNIT.............................SA
C5A8I9_BURGB/40-354AE.....TDALTQWSGTRTLQSVSLTTRTFDY...KN------PAVSGN.............................PK
Q6FFL7_ACIAD/42-385H......FDSMTHLVAHRQLQSTAAYVQRWQADGLLQ------DEGSGSVLSAHQ.................HSDQQSNE
A1B4U8_PARDP/26-330PR....EGDYLTGWVPRASVRIGGFAQTDYDF...LK------PSSD.................................
Q8XQT0_RALSO/113-430E......RNGIDRWDEAFSFRVGKITYRDFNY...ST------PSSP.................................
A1K519_AZOSB/50-375T......EDSLTSWSAQRSVGAGRTTLTSFDY...KP------AATTTA.............................RA
Q3A0Q1_PELCD/40-341RA.....VETIYALHSHARLLPGTVRVTDYNY...RT------PETL.................................
Q6F782_ACIAD/42-387Q......QDSITSLIAQRQLQSTAIYVQRWQADALSQ------EDASGSVLSNHQ.................HSQQHGNE
Q1QVA4_CHRSD/41-355ET.....EDALNQWGGVRQQQPTRVSVGTFDY...KQ------PSL.T...............................K
A7MMD4_CROS8/36-364DN....RAESVWNLQAHHQVTERSVSTHDYNY...RT------ADVIM...............................N
A9BLL4_DELAS/23-327VA....REECIHAWELHQRVKPGRHYNDDYDF...KK------PRAE.................................
A0KJD1_AERHH/29-325EQ.....GPYVRQFHYREAVRPSDVELKDYSF...KT------PAYG.................................
A1TTP1_ACIAC/24-327IA....DREHIFAWRMGQGVAPGRAYLDDYDF...TK------PRAD.................................
B4F002_PROMH/27-319IT.....DSTATTWRYVEQLCSDIRVDKDYNQ...LR------PSYP.................................
B9JVA0_AGRVS/37-346SD.....RNHINEWMRQFSYIPGQRAGADWNF...ET------PSTV.................................
G3XCU8_PSEAE/32-313V........GSFDVTFDDRSLMRTVKTRYQLP...GS------GEVKS...............................V
I1SBE4_PECAS/30-328SE.....GDYVRRFHYAERVSTAEVELKDYSF...KT------PAYG.................................
I2BBZ6_SHIBC/54-354ARGRFSWRERASQYI....VKGSSSAGGSTWD...EQ------PVKV.................................
BPD_BPP2/42-365G........DRHHFAIADRGAYTGVTAKWLHT...KD------PKPQKQKVKLKRKKKEKHLRALEHPKAKPVRQKKAPK
Q0KDW7_CUPNH/38-356ID.....QEHLVRFDPVNRLRTGKVTLNDYDP...RK------PRAN.................................
Q3IWJ2_RHOS4/27-325FR....DGDFITAWLPRAHIRPGKVSQGDYDF...EK------PSSD.................................
Q5DYX3_VIBF1/29-334KD.....GNTITSLMKKQQVSVGKISVRDFNF...ET------PTRLPA..............................G
Q63II0_BURPS/23-325IA....DEEHIDSWLPAQEVSIGKHETSDYDY...TK------PRAD.................................
Q63K62_BURPS/46-349AGI...EADRVQAFTCRATPLPREVVLRDFNH...RK------AELS.................................
Q63LB9_BURPS/58-337G........DSHRYHVSERENYAAVRAHYHST...GR------AKRK.................................
Q63LQ5_BURPS/38-351D......EAVVTQWAAQRQLMSGAVSMKAYDY...KV------PAARR................................
Q63P68_BURPS/44-375AQ.....RDTVTLFALRRQLAPGKAGRPSWDY...KK------ARIDES.............................SV
Q63TB7_BURPS/37-356TE....PDDVIVGIGRSLSLTADRVTLISSDY...RG------NQST.................................
Q7CGL8_YERPE/58-356AQ.....ELSITTFTRSAQVRPAMVQLKDYTF...KN------PKWA.................................
Q7CHB6_YERPE/23-325ASL...HTDINKRFVDYTGVVLSTNAVARRSP...SG------GNNT.................................
Q8ZRL1_SALTY/121-429LD.....KEFIHTITANESLRTGQWVLDDFDF...TK------PRSL.................................
Q9I1A6_PSEAE/30-322RE.....LQGVRSAQYSLQAVSGTYSATDYEF...TT------PGTS.................................
Q9I3K1_PSEAE/27-327NP.....QPVLHSFRYSENVRTARQTQRDYSF...KR------PTYD.................................
Q9I737_PSEAE/29-329RE.....RDHFYDWHMAREVQSGSLSLNDYDF...QR------PGAR.................................
Q9PAL7_XYLFA/37-321I........ASWQMTYATRDSPGTVVAFYRLA...RR------AELH.................................

PF09096

BP27_BPT4/203-375SE-----MTYRNGYEEAIRLQTMAQYDGYAKC------------------------------------------------

PF06763

Q2SI49_HAHCH/7-189.................AAEIKTPRRGTLMTRYPHRV-------------------------------------------
K7A372_9ALTE/15-199KNLINFVSKAYKKPNHFNAKLGKGKRRRYRAKGVTAN-------------------------------------------
COMPL_BPN15/3-184IKL.............GTASVRLSRRKRDK.......-------------------------------------------
Q8ZN01_SALTY/1-192IKL.............GAAQVRMSKRRGKL.......-------------------------------------------
Q8ZQG7_SALTY/3-194IKL.............GSAQVRLSRRGGKL.......-------------------------------------------
Q8ZQ91_SALTY/3-188IRL.............LSSPPSTPMRGR.........-------------------------------------------
COMPL_LAMBD/3-192IKL.............GNARVVLSRRRRRKKGQRSSL-------------------------------------------

PF09097

BP27_BPT4/5-200II-----QISVANANDINNVKTRIYGCKHFSVSVDSK-------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------------------------
FII_LAMBD/1-117--------------------------------------------------------------------------------
FII_BPN15/1-117--------------------------------------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------------------------
A3MZN0_ACTP2/1-99--------------------------------------------------------------------------------
B8F4K5_HAEPS/1-99--------------------------------------------------------------------------------
M9X5I9_MANHA/1-99--------------------------------------------------------------------------------
Q8ZQ92_SALTY/1-90--------------------------------------------------------------------------------

PF09393

F6DLR2_DESRL/1-131--------------------------------------------------------------------------------
R7FA15_9CLOT/4-145--------------------------------------------------------------------------------
A9KPP0_CLOPH/4-148--------------------------------------------------------------------------------
A5I2K4_CLOBH/3-146--------------------------------------------------------------------------------
R6NS73_9FIRM/11-143--------------------------------------------------------------------------------
F2F2L4_SOLSS/3-140--------------------------------------------------------------------------------
C4Z5U0_EUBE2/2-139--------------------------------------------------------------------------------
R5BEH1_9FIRM/6-141--------------------------------------------------------------------------------
R5AL39_9FIRM/3-146--------------------------------------------------------------------------------
Q65L22_BACLD/1-141--------------------------------------------------------------------------------
R6M2J8_9FIRM/6-141--------------------------------------------------------------------------------
R6QFB0_9FIRM/2-146--------------------------------------------------------------------------------
R5H4V3_9FIRM/3-147--------------------------------------------------------------------------------
D1AHR6_SEBTE/5-149--------------------------------------------------------------------------------
C0Z6Z9_BREBN/3-140--------------------------------------------------------------------------------
C6D1T3_PAESJ/3-147--------------------------------------------------------------------------------
A3DIA9_CLOTH/4-148--------------------------------------------------------------------------------
D3EHB9_GEOS4/2-143--------------------------------------------------------------------------------
F9VIU9_ARTSS/5-149--------------------------------------------------------------------------------
Q18BM9_PEPD6/2-140--------------------------------------------------------------------------------
D4MVP4_ANAHA/2-140--------------------------------------------------------------------------------
A6TQV7_ALKMQ/4-142--------------------------------------------------------------------------------
Q24LI3_BPPCD/3-141--------------------------------------------------------------------------------
D3EHD6_GEOS4/2-130--------------------------------------------------------------------------------
I4D3G0_DESAJ/2-140--------------------------------------------------------------------------------
Q892H5_CLOTE/3-141--------------------------------------------------------------------------------
Q184A4_PEPD6/3-147--------------------------------------------------------------------------------
R6UQ00_9FIRM/3-141--------------------------------------------------------------------------------
R5TBQ4_9FIRM/10-152--------------------------------------------------------------------------------
M1MSJ7_9CLOT/3-147--------------------------------------------------------------------------------
R6PBH3_9FIRM/5-148--------------------------------------------------------------------------------
A6TRA1_ALKMQ/2-131--------------------------------------------------------------------------------
R6PLB1_9FIRM/3-147--------------------------------------------------------------------------------
A5N9B6_CLOK5/3-133--------------------------------------------------------------------------------
R5BLA9_9FIRM/2-140--------------------------------------------------------------------------------
L7VLA7_CLOSH/4-149--------------------------------------------------------------------------------
I0GWR6_SELRL/2-140--------------------------------------------------------------------------------
R5BQR6_9FIRM/9-143--------------------------------------------------------------------------------
Q24QE7_DESHY/2-147--------------------------------------------------------------------------------
D9R927_CLOSW/3-146--------------------------------------------------------------------------------
R6HTP3_9FIRM/3-147--------------------------------------------------------------------------------
R6Q009_9FIRM/2-140--------------------------------------------------------------------------------
A9KKK2_CLOPH/4-149--------------------------------------------------------------------------------
W8T695_EUBAC/3-142--------------------------------------------------------------------------------
R6ST47_9CLOT/2-146--------------------------------------------------------------------------------
C8VZG4_DESAS/2-142--------------------------------------------------------------------------------
D4M0Z1_9FIRM/4-148--------------------------------------------------------------------------------
G4L1J2_OSCVS/6-136--------------------------------------------------------------------------------
U5MV98_CLOSA/3-133--------------------------------------------------------------------------------
F2JK33_CELLD/10-154--------------------------------------------------------------------------------
A5N2B8_CLOK5/3-131--------------------------------------------------------------------------------
B2TNV8_CLOBB/5-135--------------------------------------------------------------------------------
C0ZFE9_BREBN/2-132--------------------------------------------------------------------------------
F3ZZH5_MAHA5/2-128--------------------------------------------------------------------------------
M1MI16_9CLOT/3-138--------------------------------------------------------------------------------
X2GJE7_9BACI/3-140--------------------------------------------------------------------------------
A5I4B2_CLOBH/1-131--------------------------------------------------------------------------------
A6LTZ2_CLOB8/3-133--------------------------------------------------------------------------------
A6LRW9_CLOB8/3-141--------------------------------------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404-R----GKGVEIEETGGHGRRLTFADVAWSVANGDPVDKTAGQEWVGDP...............................
A5D093_PELTS/222-567-R----GKGEETDD..GYGRRTTFADVVWSKAGGDPADKPAGQEWVGDPDAL............................
A5VJT7_LACRD/39-685-Y----GGKMEKDITSVLGPGGQTNGATEPQNGDWTPVIQNAASLIGEKLSDADIANIKNRIRIESNGNETIQNNWDSNA
A5VKI8_LACRD/34-537-V----GATYTQQDTSTTDTGLPNGTITSGKGAQAVINDAKKYLGVPYVYGGAGGTRGGNPWSGMDCSSFVSQVYQDFGI
B2TMG9_CLOBB/35-355-.----..............................YVEK........................................
B8I7P6_CLOCE/418-720-Y----GK...........DGMTFATI....NGGKEYVDNYE......................................
C4Z844_AGARV/33-364-L----GARLDQSVIDGLDAYTTIESV.....................................................
D9SSG9_CLOC7/29-338-L----GK...........DGLKITDI....NNGKDYVESYQ......................................
F3YBF3_MELPT/27-330-S----GKQDDKGKPLVSAE............................................................
F9UQU7_LACPL/38-346-L----GKPIDKSSGNNDSQT...........................................................
G8M053_CLOCD/417-718-Y----GK...........DGLTFASI....NGGKEYVEDYT......................................
I6T7G9_ENTHA/33-340-Y----GKLKDGINTEN...................PKDS........................................
Q5WE58_BACSK/33-341-W----GRVDEETNKPVVK.............................................................
Q5WIB8_BACSK/8-317-Y----GEAYANWNDEKEKYDLHVT.......................................................
Q65ET7_BACLD/226-551-Y----GALKKGSSTDDKNPQYEFEPIL....................................................
Q65KF3_BACLD/29-328-Y----GKKDDKGN..................................................................
Q835T2_ENTFA/29-351-L----GSGEGVNKVNIRSVNQGVPYLENKAAIDRYGL..........................................
Q8Y4Z4_LISMO/34-333-Y----GKVDSNGNN.....................Y...........................................
Q8YAK1_LISMO/33-338-Y----GKQKENADK.....................LTGD........................................
Q9K758_BACHD/67-370-Y----GK...........NNMSIADA....NDGVPYLTDFS......................................
Q9KGP3_BACHD/67-375-Y----GK...........ENLSIEDI....NDGVPYLDIRDDPS...................................
R4K6I2_CLOPA/41-361-V----GK........................................................................
V5XMR9_ENTMU/31-336-F----GALKEGVETDN...................PRES........................................
W6S0H7_9CLOT/417-718-V----GA...........NGMTFADI....NNGKAYLEDFT......................................
X5A593_9BACL/39-378-I----GQPASILTPEERSRLEAIPGAIDGAGNLAVNYLVSQYAAD..................................

PF13550

A1AYP0_PARDP/820-985-T....VDS....TRI----------------------------------------------------------------
A1B627_PARDP/791-955-G....AEF....LAV----------------------------------------------------------------
E0THS4_PARBH/770-933-H....RQG....AVT----------------------------------------------------------------
A7HRK9_PARL1/775-940-S....ARS....ERV----------------------------------------------------------------
A7IK58_XANP2/791-954-K....GGS....RHV----------------------------------------------------------------
A8LQN2_DINSH/795-960-D....ETS....NIV----------------------------------------------------------------
A9CJN3_AGRFC/756-923-D....NAG....SRL----------------------------------------------------------------
B0SVY2_CAUSK/777-933-A....GEG....G..----------------------------------------------------------------
B0UJ15_METS4/791-954-S....GRA....ASV----------------------------------------------------------------
B1LTZ4_METRJ/785-952-A....GQR....RRE----------------------------------------------------------------
B6JDQ1_OLICO/759-925-V....GQS....ESV----------------------------------------------------------------
B9JU38_AGRVS/757-919-V....GTS....AKL----------------------------------------------------------------
Q0AR61_MARMM/759-917-L....GTV.....AT----------------------------------------------------------------
Q28RU9_JANSC/978-1139-G....DGA....DQV----------------------------------------------------------------
Q3SUI4_NITWN/802-967-A....GYS....ERK----------------------------------------------------------------
C6XID3_HIRBI/772-930-I....VSG....DDI----------------------------------------------------------------
A8HR63_AZOC5/794-957-A....GAA....RHV----------------------------------------------------------------
D9QF99_BRESC/731-889-Q....ATG....GGG----------------------------------------------------------------
B2JUI8_PARP8/529-699-V....THS....NRD----------------------------------------------------------------
D0J488_COMT2/383-550-V....TGQ....AST----------------------------------------------------------------
A9BYF1_DELAS/314-478-S....PDVR..VTGE----------------------------------------------------------------
Q2G3K6_NOVAD/231-396-N....SPG.....DV----------------------------------------------------------------
Q1GRM1_SPHAL/243-405-.....GGG....ARE----------------------------------------------------------------
Q2N607_ERYLH/223-386-T....PAA.....GQ----------------------------------------------------------------
B8EKU0_METSB/229-420-N....HIESFGLHKA----------------------------------------------------------------
B2IJD4_BEII9/227-411-D....AIERFGMRGG----------------------------------------------------------------
Q2WA44_MAGSA/316-506-A....AIRAYGLNQD----------------------------------------------------------------
C9R735_AGGAD/265-435-Q....MHG....VIS----------------------------------------------------------------
Q2W6E0_MAGSA/315-503-A....EIRTYGLNPG----------------------------------------------------------------
Q2SAL7_HAHCH/191-365-A....NIQAQGAVVS----------------------------------------------------------------
A7I049_CAMHC/190-363-T....KNTL.GYEKT----------------------------------------------------------------
B2FM10_STRMK/213-385-AAIQLQGG....VIN----------------------------------------------------------------
E6WEJ9_PANSA/332-495-E....QISL.YNYNE----------------------------------------------------------------
A6VNR7_ACTSZ/335-501-A....RYG....YNS----------------------------------------------------------------
Q8XYR0_RALSO/340-503-D....GIAR.YSIQQ----------------------------------------------------------------
B2JL07_PARP8/351-514-E....AIAQ.WGIRE----------------------------------------------------------------
Q2W829_MAGSA/500-665-D....SAG....DNP----------------------------------------------------------------
A5CF56_ORITB/744-904-Q....ENY....SQQ----------------------------------------------------------------
B9KI53_ANAMF/694-848-Q....VGG...PKAS----------------------------------------------------------------
C5AYQ3_METEA/784-949-A....GAR....RQE----------------------------------------------------------------
D5AU04_RHOCB/799-959-D....AAA....GAA----------------------------------------------------------------
G8PN64_PSEUV/767-937-E....GMD....RRT----------------------------------------------------------------
N0B519_9RHIZ/827-991-T....GAS....GRI----------------------------------------------------------------
TIPJ_LAMBD/332-498-Q....AIAR.YGRNV----------------------------------------------------------------
Q1QNE9_NITHX/777-937-A....GGS....NRS----------------------------------------------------------------
Q3J233_RHOS4/334-499-D....QGL....ELV----------------------------------------------------------------
Q3J3J4_RHOS4/795-953-D....EAT....FAV----------------------------------------------------------------
Q5F989_NEIG1/222-406-A....NIEQYGLRPK----------------------------------------------------------------
Q7ARG4_YERPE/359-522-E....AMRR.YGERK----------------------------------------------------------------

PF16792

H9EDD6_9CAUD/1-372-I----KQSVSVDTETIVERSAYNFAIVFVKNKTTD--------------------------------------------
H9ED19_9CAUD/1-372-V----KQSVTMDTETIVERSAYNFAVVFVKSSNAD--------------------------------------------
D3LCP7_OENOE/1-372-F----KQNVSMDTETIVERSAYNFVVVFIKNKEAD--------------------------------------------
H9EFC2_9CAUD/1-372-I----KQSVTMDTETIVERSAYNFAVVFVKKSNAD--------------------------------------------
GP16_BPLP2/1-372-I----KQSVTMDTETIVERSAYNFAVVFVKNKATD--------------------------------------------
C7T1V4_9CAUD/1-372-I----KQNVAMDTETIVERSAYNFAVVFVKSLNTD--------------------------------------------
O80118_9CAUD/1-372-I----KQSVTMDTETITERSAYNFAVVFVKNKATD--------------------------------------------
C7T205_9CAUD/1-372-I----KQSVAMDTETIVERSAYNFAVVFVKSSNAD--------------------------------------------
C7T2B2_9CAUD/1-372-F----KQNVSMDTETIVERSTYNFAVVFVKSSNAD--------------------------------------------

PF05954

Q1LDW8_CUPMC/39-340LT----GDAN.VARK............ENTYG------------------------------------------------
C5AP32_BURGB/40-351RV----STPA..ADLD..........ELPGQG------------------------------------------------
A8IB09_AZOC5/33-335.L----TAST..TTVLDN......SAFKS..W------------------------------------------------
A9G446_SORC5/24-329.V----AGSA.RVSPN..........G...AG------------------------------------------------
B1M1X9_METRJ/41-344.F----EARA..QASVLN......GLTRK..L------------------------------------------------
A9GQF5_SORC5/30-340.L----GGTR..GEAIR.........A....R------------------------------------------------
A9EVZ6_SORC5/26-317.Q----TAAA..ASGQ..........G..GPL------------------------------------------------
Q98IK7_RHILO/26-327.L----MAKS..AQSFSH.......KEAS..G------------------------------------------------
A9FA22_SORC5/24-354.T----LGEA..EKAA..........APEDRY------------------------------------------------
A9GAG1_SORC5/23-352.L----TGEA..PPAP..........APEAKY------------------------------------------------
C1AEJ4_GEMAT/29-353.A----DVYS..APSDLAWY..DFDQQMGSQH------------------------------------------------
Q2L040_BORA1/29-322.H----TDG.....AKAQ.......GG.....------------------------------------------------
B2U7V1_RALPJ/41-362.L----TTSD..SLPRDT.......LFSE..F------------------------------------------------
A9FDZ6_SORC5/23-354.L----FGEA..PKAP..........APEDKY------------------------------------------------
B4E682_BURCJ/41-356SV----RASG.................AVAPG------------------------------------------------
B1XWY3_LEPCP/24-338.L----AVDA..VRERDY.......PHAD..Y------------------------------------------------
B4E676_BURCJ/37-356.T----TLGR.................PAGAR------------------------------------------------
A1KB80_AZOSB/48-380HG----RASG.DAGAD..........GVASAL------------------------------------------------
Q47E10_DECAR/36-349SS----HDNG.................ALPRL------------------------------------------------
Q8XUG6_RALSO/40-368RV----EVDT.MLDQG..........KAGNDL------------------------------------------------
C5AKJ1_BURGB/40-354RI----ECAT..ASPD..........GLPVDG------------------------------------------------
Q0K251_CUPNH/36-365.L----NVSV..DDPRET.......SHAT..Y------------------------------------------------
C5BAE3_EDWI9/29-331.L----LTST..ASVARQ......GKLSD..V------------------------------------------------
Q747T8_GEOSL/38-336.L----TTQR....QG..........KVSAQR------------------------------------------------
A5G0B1_ACICJ/27-330.L----VSDA..DTVLKA......KGAAT..R------------------------------------------------
Q6LUC9_PHOPR/30-341.P----SAMH.SHYSQG.........INPPES------------------------------------------------
A1KCD6_AZOSB/26-329.L----EASA..VVPREH.......DEGK..H------------------------------------------------
C5AHV1_BURGB/44-356GT----TLPT.RADQG..........ELPQQL------------------------------------------------
Q8XRR3_RALSO/37-355AY----LSIS.................PSLAP------------------------------------------------
C6XDI4_METGS/47-391.L----AARN..AQPRNT.......AHGD..N------------------------------------------------
A9C0N9_DELAS/23-326.L----THLR..RDPPGH.......AHDG..H------------------------------------------------
Q87HD9_VIBPA/30-349.P----KNVA..AGDT..........ALFTVP------------------------------------------------
A6TAS8_KLEP7/34-358AT----ADMT..RGNG..........EGITYG------------------------------------------------
Q0JYG5_CUPNH/32-330.Q----GTAQ..A.GAAP.......VA.....------------------------------------------------
B4E680_BURCJ/35-341AD----ADAP.................LLPVR------------------------------------------------
C5A958_BURGB/38-352YV----SGGT..EVDQ..........GDVPSY------------------------------------------------
Q0JZD4_CUPNH/35-364.L----TVRA..ADPLDT.......AHAG..Q------------------------------------------------
B4EUE4_PROMH/79-373.L----SQQT..TGKNH.........QQHPIF------------------------------------------------
Q7MDQ8_VIBVY/30-349.P----NNTA..KGSE..........SLFTVP------------------------------------------------
C5AA20_BURGB/41-355GT----TLPT.RGDQG..........ELPSQL------------------------------------------------
A9FYV0_SORC5/370-667.L----TSEH..VLPTGY.......AG.....------------------------------------------------
Q88I93_PSEPK/38-347PV----TMQS..LNQQ..........GDVDRF------------------------------------------------
Q3A0Q0_PELCD/27-339RA----SDQA..NAPA..........RDAAGT------------------------------------------------
C5AMP3_BURGB/41-355GT----TLPT.MVGQG..........NLPEQT------------------------------------------------
C5ALD6_BURGB/39-369.L----HAVN..QQARDT.......DWNT..F------------------------------------------------
Q8XS52_RALSO/44-358GT----SIPT..TGQS..........ALPWAA------------------------------------------------
Q080W0_SHEFN/30-339.P----SGNH.TNANL..........PEQSAL------------------------------------------------
Q2SGF0_HAHCH/101-403LL----AECS.ALNEL..........RGASAY------------------------------------------------
D2QZK3_PIRSD/24-327.L----EAKS.QIVRL..........HPQSSN------------------------------------------------
B4EH48_BURCJ/40-354AT----SVPT.MANQG..........DLPSQA------------------------------------------------
C5AMI6_BURGB/41-362SV----VAEK.GDRSV..........YGSVNC------------------------------------------------
Q28MX5_JANSC/33-346.Q----VPGG..DAPSLV......SLPRNGNY------------------------------------------------
Q47J31_DECAR/32-356QP----IGGK.................NAPVL------------------------------------------------
C5A8I9_BURGB/40-354GT----LTPT.MDQQG..........ALPAQL------------------------------------------------
Q6FFL7_ACIAD/42-385SL----SLEQ.................AWSIG------------------------------------------------
A1B4U8_PARDP/26-330.L----MATA..SRPEGH.......AGDR..R------------------------------------------------
Q8XQT0_RALSO/113-430.L----MHVE..V.PTTL......KNPNIGST------------------------------------------------
A1K519_AZOSB/50-375EG----VEED.GGDAT..........SLEQAL------------------------------------------------
Q3A0Q1_PELCD/40-341.L----EASQ.QSAMG..........AALGEN------------------------------------------------
Q6F782_ACIAD/42-387SL----SLEQ.................AWNIS------------------------------------------------
Q1QVA4_CHRSD/41-355RT----GLDT.LSDQG..........NLP.PT------------------------------------------------
A7MMD4_CROS8/36-364AD----ADLT..HDDD..........K.TTYG------------------------------------------------
A9BLL4_DELAS/23-327.L----SNMR..RNPPGH.......AHDA..Y------------------------------------------------
A0KJD1_AERHH/29-325.L----SHKK..VGTEL........EHQRDTY------------------------------------------------
A1TTP1_ACIAC/24-327.L----SEMR..QSPPG.........HAHDAY------------------------------------------------
B4F002_PROMH/27-319.L----SHQV..TGEV............HQQH------------------------------------------------
B9JVA0_AGRVS/37-346.P----LNVT....PSLI......QMPGAKQR------------------------------------------------
G3XCU8_PSEAE/32-313EL----KNPK..APAT..........AMGEHV------------------------------------------------
I1SBE4_PECAS/30-328.L----SHKK..MSNEL........AHQRESY------------------------------------------------
I2BBZ6_SHIBC/54-354.V----GGR......Q..........IVVSDP------------------------------------------------
BPD_BPP2/42-365VP----.........EAREGEYMAGEADNVFA------------------------------------------------
Q0KDW7_CUPNH/38-356.L----TTDN..SQPRN.........TSFADF------------------------------------------------
Q3IWJ2_RHOS4/27-325.L----TSRA..ENPLG.........HAADGA------------------------------------------------
Q5DYX3_VIBF1/29-334IM----QNDD..Q..GE........CASELAL------------------------------------------------
Q63II0_BURPS/23-325.L----SAQK..IDPRG.........HDHDGF------------------------------------------------
Q63K62_BURPS/46-349.L----EVRE..RVARD........GVGERVS------------------------------------------------
Q63LB9_BURPS/58-337.S----VIVG..GENN...........KNVKV------------------------------------------------
Q63LQ5_BURPS/38-351YV----SGEA..DFNQ..........GEVERY------------------------------------------------
Q63P68_BURPS/44-375AS----...SLDQ..GEAGND.LAKLLT....------------------------------------------------
Q63TB7_BURPS/37-356.S----ATAS..L..............GNPAG------------------------------------------------
Q7CGL8_YERPE/58-356.A----EFSE..QAREL........QNQRPDY------------------------------------------------
Q7CHB6_YERPE/23-325.S----VLVR..VQDTQ.........LAA..L------------------------------------------------
Q8ZRL1_SALTY/121-429.L----ANTV..ANPRE.........TGHATY------------------------------------------------
Q9I1A6_PSEAE/30-322.L----YSQA..EAVSG.........AAGVYQ------------------------------------------------
Q9I3K1_PSEAE/27-327.Q----EHHL..AGEAL........EHQGSSY------------------------------------------------
Q9I737_PSEAE/29-329.L----EVRS..NIARS.........HAAADY------------------------------------------------
Q9PAL7_XYLFA/37-321.Q----VSVG..D..............GHPVH------------------------------------------------

PF09096

BP27_BPT4/203-375-S----TIGNFNLTPG----------------------------------------------------------------

PF06763

Q2SI49_HAHCH/7-189------LKRGVKVRVK----------------------------------------------------------------
K7A372_9ALTE/15-199------AWRSR.....----------------------------------------------------------------
COMPL_BPN15/3-184------KGANSVLRIG----------------------------------------------------------------
Q8ZN01_SALTY/1-192------LYRGSVLKIG----------------------------------------------------------------
Q8ZQG7_SALTY/3-194------LRRGSVLKIG----------------------------------------------------------------
Q8ZQ91_SALTY/3-188------..KGKPLRIG----------------------------------------------------------------
COMPL_LAMBD/3-192------KGGGSVLVVG----------------------------------------------------------------

PF09097

BP27_BPT4/5-200------GDNIIAIELG----------------------------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------------------------
FII_LAMBD/1-117--------------------------------------------------------------------------------
FII_BPN15/1-117--------------------------------------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------------------------
A3MZN0_ACTP2/1-99--------------------------------------------------------------------------------
B8F4K5_HAEPS/1-99--------------------------------------------------------------------------------
M9X5I9_MANHA/1-99--------------------------------------------------------------------------------
Q8ZQ92_SALTY/1-90--------------------------------------------------------------------------------

PF09393

F6DLR2_DESRL/1-131--------------------------------------------------------------------------------
R7FA15_9CLOT/4-145--------------------------------------------------------------------------------
A9KPP0_CLOPH/4-148--------------------------------------------------------------------------------
A5I2K4_CLOBH/3-146--------------------------------------------------------------------------------
R6NS73_9FIRM/11-143--------------------------------------------------------------------------------
F2F2L4_SOLSS/3-140--------------------------------------------------------------------------------
C4Z5U0_EUBE2/2-139--------------------------------------------------------------------------------
R5BEH1_9FIRM/6-141--------------------------------------------------------------------------------
R5AL39_9FIRM/3-146--------------------------------------------------------------------------------
Q65L22_BACLD/1-141--------------------------------------------------------------------------------
R6M2J8_9FIRM/6-141--------------------------------------------------------------------------------
R6QFB0_9FIRM/2-146--------------------------------------------------------------------------------
R5H4V3_9FIRM/3-147--------------------------------------------------------------------------------
D1AHR6_SEBTE/5-149--------------------------------------------------------------------------------
C0Z6Z9_BREBN/3-140--------------------------------------------------------------------------------
C6D1T3_PAESJ/3-147--------------------------------------------------------------------------------
A3DIA9_CLOTH/4-148--------------------------------------------------------------------------------
D3EHB9_GEOS4/2-143--------------------------------------------------------------------------------
F9VIU9_ARTSS/5-149--------------------------------------------------------------------------------
Q18BM9_PEPD6/2-140--------------------------------------------------------------------------------
D4MVP4_ANAHA/2-140--------------------------------------------------------------------------------
A6TQV7_ALKMQ/4-142--------------------------------------------------------------------------------
Q24LI3_BPPCD/3-141--------------------------------------------------------------------------------
D3EHD6_GEOS4/2-130--------------------------------------------------------------------------------
I4D3G0_DESAJ/2-140--------------------------------------------------------------------------------
Q892H5_CLOTE/3-141--------------------------------------------------------------------------------
Q184A4_PEPD6/3-147--------------------------------------------------------------------------------
R6UQ00_9FIRM/3-141--------------------------------------------------------------------------------
R5TBQ4_9FIRM/10-152--------------------------------------------------------------------------------
M1MSJ7_9CLOT/3-147--------------------------------------------------------------------------------
R6PBH3_9FIRM/5-148--------------------------------------------------------------------------------
A6TRA1_ALKMQ/2-131--------------------------------------------------------------------------------
R6PLB1_9FIRM/3-147--------------------------------------------------------------------------------
A5N9B6_CLOK5/3-133--------------------------------------------------------------------------------
R5BLA9_9FIRM/2-140--------------------------------------------------------------------------------
L7VLA7_CLOSH/4-149--------------------------------------------------------------------------------
I0GWR6_SELRL/2-140--------------------------------------------------------------------------------
R5BQR6_9FIRM/9-143--------------------------------------------------------------------------------
Q24QE7_DESHY/2-147--------------------------------------------------------------------------------
D9R927_CLOSW/3-146--------------------------------------------------------------------------------
R6HTP3_9FIRM/3-147--------------------------------------------------------------------------------
R6Q009_9FIRM/2-140--------------------------------------------------------------------------------
A9KKK2_CLOPH/4-149--------------------------------------------------------------------------------
W8T695_EUBAC/3-142--------------------------------------------------------------------------------
R6ST47_9CLOT/2-146--------------------------------------------------------------------------------
C8VZG4_DESAS/2-142--------------------------------------------------------------------------------
D4M0Z1_9FIRM/4-148--------------------------------------------------------------------------------
G4L1J2_OSCVS/6-136--------------------------------------------------------------------------------
U5MV98_CLOSA/3-133--------------------------------------------------------------------------------
F2JK33_CELLD/10-154--------------------------------------------------------------------------------
A5N2B8_CLOK5/3-131--------------------------------------------------------------------------------
B2TNV8_CLOBB/5-135--------------------------------------------------------------------------------
C0ZFE9_BREBN/2-132--------------------------------------------------------------------------------
F3ZZH5_MAHA5/2-128--------------------------------------------------------------------------------
M1MI16_9CLOT/3-138--------------------------------------------------------------------------------
X2GJE7_9BACI/3-140--------------------------------------------------------------------------------
A5I4B2_CLOBH/1-131--------------------------------------------------------------------------------
A6LTZ2_CLOB8/3-133--------------------------------------------------------------------------------
A6LRW9_CLOB8/3-141--------------------------------------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404................................................................................
A5D093_PELTS/222-567................................................................................
A5VJT7_LACRD/39-685QAGHPSIGLVQFIQSTFDYYCRPPYTDIRKGLDQLIAMMNIPNWRQQIAGSGGWSPHGAPISKATIDIKSVVDNSWGWPF
A5VKI8_LACRD/34-537RVPAQTIAMEPSFHQVSTPQTGDVGFYGP...................................................
B2TMG9_CLOBB/35-355................................................................................
B8I7P6_CLOCE/418-720................................................................................
C4Z844_AGARV/33-364................................................................................
D9SSG9_CLOC7/29-338................................................................................
F3YBF3_MELPT/27-330................................................................................
F9UQU7_LACPL/38-346................................................................................
G8M053_CLOCD/417-718................................................................................
I6T7G9_ENTHA/33-340................................................................................
Q5WE58_BACSK/33-341................................................................................
Q5WIB8_BACSK/8-317................................................................................
Q65ET7_BACLD/226-551................................................................................
Q65KF3_BACLD/29-328................................................................................
Q835T2_ENTFA/29-351................................................................................
Q8Y4Z4_LISMO/34-333................................................................................
Q8YAK1_LISMO/33-338................................................................................
Q9K758_BACHD/67-370................................................................................
Q9KGP3_BACHD/67-375................................................................................
R4K6I2_CLOPA/41-361................................................................................
V5XMR9_ENTMU/31-336................................................................................
W6S0H7_9CLOT/417-718................................................................................
X5A593_9BACL/39-378................................................................................

PF13550

A1AYP0_PARDP/820-985--------------------------------------------------------------------------------
A1B627_PARDP/791-955--------------------------------------------------------------------------------
E0THS4_PARBH/770-933--------------------------------------------------------------------------------
A7HRK9_PARL1/775-940--------------------------------------------------------------------------------
A7IK58_XANP2/791-954--------------------------------------------------------------------------------
A8LQN2_DINSH/795-960--------------------------------------------------------------------------------
A9CJN3_AGRFC/756-923--------------------------------------------------------------------------------
B0SVY2_CAUSK/777-933--------------------------------------------------------------------------------
B0UJ15_METS4/791-954--------------------------------------------------------------------------------
B1LTZ4_METRJ/785-952--------------------------------------------------------------------------------
B6JDQ1_OLICO/759-925--------------------------------------------------------------------------------
B9JU38_AGRVS/757-919--------------------------------------------------------------------------------
Q0AR61_MARMM/759-917--------------------------------------------------------------------------------
Q28RU9_JANSC/978-1139--------------------------------------------------------------------------------
Q3SUI4_NITWN/802-967--------------------------------------------------------------------------------
C6XID3_HIRBI/772-930--------------------------------------------------------------------------------
A8HR63_AZOC5/794-957--------------------------------------------------------------------------------
D9QF99_BRESC/731-889--------------------------------------------------------------------------------
B2JUI8_PARP8/529-699--------------------------------------------------------------------------------
D0J488_COMT2/383-550--------------------------------------------------------------------------------
A9BYF1_DELAS/314-478--------------------------------------------------------------------------------
Q2G3K6_NOVAD/231-396--------------------------------------------------------------------------------
Q1GRM1_SPHAL/243-405--------------------------------------------------------------------------------
Q2N607_ERYLH/223-386--------------------------------------------------------------------------------
B8EKU0_METSB/229-420--------------------------------------------------------------------------------
B2IJD4_BEII9/227-411--------------------------------------------------------------------------------
Q2WA44_MAGSA/316-506--------------------------------------------------------------------------------
C9R735_AGGAD/265-435--------------------------------------------------------------------------------
Q2W6E0_MAGSA/315-503--------------------------------------------------------------------------------
Q2SAL7_HAHCH/191-365--------------------------------------------------------------------------------
A7I049_CAMHC/190-363--------------------------------------------------------------------------------
B2FM10_STRMK/213-385--------------------------------------------------------------------------------
E6WEJ9_PANSA/332-495--------------------------------------------------------------------------------
A6VNR7_ACTSZ/335-501--------------------------------------------------------------------------------
Q8XYR0_RALSO/340-503--------------------------------------------------------------------------------
B2JL07_PARP8/351-514--------------------------------------------------------------------------------
Q2W829_MAGSA/500-665--------------------------------------------------------------------------------
A5CF56_ORITB/744-904--------------------------------------------------------------------------------
B9KI53_ANAMF/694-848--------------------------------------------------------------------------------
C5AYQ3_METEA/784-949--------------------------------------------------------------------------------
D5AU04_RHOCB/799-959--------------------------------------------------------------------------------
G8PN64_PSEUV/767-937--------------------------------------------------------------------------------
N0B519_9RHIZ/827-991--------------------------------------------------------------------------------
TIPJ_LAMBD/332-498--------------------------------------------------------------------------------
Q1QNE9_NITHX/777-937--------------------------------------------------------------------------------
Q3J233_RHOS4/334-499--------------------------------------------------------------------------------
Q3J3J4_RHOS4/795-953--------------------------------------------------------------------------------
Q5F989_NEIG1/222-406--------------------------------------------------------------------------------
Q7ARG4_YERPE/359-522--------------------------------------------------------------------------------

PF16792

H9EDD6_9CAUD/1-372--------------------------------------------------------------------------------
H9ED19_9CAUD/1-372--------------------------------------------------------------------------------
D3LCP7_OENOE/1-372--------------------------------------------------------------------------------
H9EFC2_9CAUD/1-372--------------------------------------------------------------------------------
GP16_BPLP2/1-372--------------------------------------------------------------------------------
C7T1V4_9CAUD/1-372--------------------------------------------------------------------------------
O80118_9CAUD/1-372--------------------------------------------------------------------------------
C7T205_9CAUD/1-372--------------------------------------------------------------------------------
C7T2B2_9CAUD/1-372--------------------------------------------------------------------------------

PF05954

Q1LDW8_CUPMC/39-340--------------------------------------------------------------------------------
C5AP32_BURGB/40-351--------------------------------------------------------------------------------
A8IB09_AZOC5/33-335--------------------------------------------------------------------------------
A9G446_SORC5/24-329--------------------------------------------------------------------------------
B1M1X9_METRJ/41-344--------------------------------------------------------------------------------
A9GQF5_SORC5/30-340--------------------------------------------------------------------------------
A9EVZ6_SORC5/26-317--------------------------------------------------------------------------------
Q98IK7_RHILO/26-327--------------------------------------------------------------------------------
A9FA22_SORC5/24-354--------------------------------------------------------------------------------
A9GAG1_SORC5/23-352--------------------------------------------------------------------------------
C1AEJ4_GEMAT/29-353--------------------------------------------------------------------------------
Q2L040_BORA1/29-322--------------------------------------------------------------------------------
B2U7V1_RALPJ/41-362--------------------------------------------------------------------------------
A9FDZ6_SORC5/23-354--------------------------------------------------------------------------------
B4E682_BURCJ/41-356--------------------------------------------------------------------------------
B1XWY3_LEPCP/24-338--------------------------------------------------------------------------------
B4E676_BURCJ/37-356--------------------------------------------------------------------------------
A1KB80_AZOSB/48-380--------------------------------------------------------------------------------
Q47E10_DECAR/36-349--------------------------------------------------------------------------------
Q8XUG6_RALSO/40-368--------------------------------------------------------------------------------
C5AKJ1_BURGB/40-354--------------------------------------------------------------------------------
Q0K251_CUPNH/36-365--------------------------------------------------------------------------------
C5BAE3_EDWI9/29-331--------------------------------------------------------------------------------
Q747T8_GEOSL/38-336--------------------------------------------------------------------------------
A5G0B1_ACICJ/27-330--------------------------------------------------------------------------------
Q6LUC9_PHOPR/30-341--------------------------------------------------------------------------------
A1KCD6_AZOSB/26-329--------------------------------------------------------------------------------
C5AHV1_BURGB/44-356--------------------------------------------------------------------------------
Q8XRR3_RALSO/37-355--------------------------------------------------------------------------------
C6XDI4_METGS/47-391--------------------------------------------------------------------------------
A9C0N9_DELAS/23-326--------------------------------------------------------------------------------
Q87HD9_VIBPA/30-349--------------------------------------------------------------------------------
A6TAS8_KLEP7/34-358--------------------------------------------------------------------------------
Q0JYG5_CUPNH/32-330--------------------------------------------------------------------------------
B4E680_BURCJ/35-341--------------------------------------------------------------------------------
C5A958_BURGB/38-352--------------------------------------------------------------------------------
Q0JZD4_CUPNH/35-364--------------------------------------------------------------------------------
B4EUE4_PROMH/79-373--------------------------------------------------------------------------------
Q7MDQ8_VIBVY/30-349--------------------------------------------------------------------------------
C5AA20_BURGB/41-355--------------------------------------------------------------------------------
A9FYV0_SORC5/370-667--------------------------------------------------------------------------------
Q88I93_PSEPK/38-347--------------------------------------------------------------------------------
Q3A0Q0_PELCD/27-339--------------------------------------------------------------------------------
C5AMP3_BURGB/41-355--------------------------------------------------------------------------------
C5ALD6_BURGB/39-369--------------------------------------------------------------------------------
Q8XS52_RALSO/44-358--------------------------------------------------------------------------------
Q080W0_SHEFN/30-339--------------------------------------------------------------------------------
Q2SGF0_HAHCH/101-403--------------------------------------------------------------------------------
D2QZK3_PIRSD/24-327--------------------------------------------------------------------------------
B4EH48_BURCJ/40-354--------------------------------------------------------------------------------
C5AMI6_BURGB/41-362--------------------------------------------------------------------------------
Q28MX5_JANSC/33-346--------------------------------------------------------------------------------
Q47J31_DECAR/32-356--------------------------------------------------------------------------------
C5A8I9_BURGB/40-354--------------------------------------------------------------------------------
Q6FFL7_ACIAD/42-385--------------------------------------------------------------------------------
A1B4U8_PARDP/26-330--------------------------------------------------------------------------------
Q8XQT0_RALSO/113-430--------------------------------------------------------------------------------
A1K519_AZOSB/50-375--------------------------------------------------------------------------------
Q3A0Q1_PELCD/40-341--------------------------------------------------------------------------------
Q6F782_ACIAD/42-387--------------------------------------------------------------------------------
Q1QVA4_CHRSD/41-355--------------------------------------------------------------------------------
A7MMD4_CROS8/36-364--------------------------------------------------------------------------------
A9BLL4_DELAS/23-327--------------------------------------------------------------------------------
A0KJD1_AERHH/29-325--------------------------------------------------------------------------------
A1TTP1_ACIAC/24-327--------------------------------------------------------------------------------
B4F002_PROMH/27-319--------------------------------------------------------------------------------
B9JVA0_AGRVS/37-346--------------------------------------------------------------------------------
G3XCU8_PSEAE/32-313--------------------------------------------------------------------------------
I1SBE4_PECAS/30-328--------------------------------------------------------------------------------
I2BBZ6_SHIBC/54-354--------------------------------------------------------------------------------
BPD_BPP2/42-365--------------------------------------------------------------------------------
Q0KDW7_CUPNH/38-356--------------------------------------------------------------------------------
Q3IWJ2_RHOS4/27-325--------------------------------------------------------------------------------
Q5DYX3_VIBF1/29-334--------------------------------------------------------------------------------
Q63II0_BURPS/23-325--------------------------------------------------------------------------------
Q63K62_BURPS/46-349--------------------------------------------------------------------------------
Q63LB9_BURPS/58-337--------------------------------------------------------------------------------
Q63LQ5_BURPS/38-351--------------------------------------------------------------------------------
Q63P68_BURPS/44-375--------------------------------------------------------------------------------
Q63TB7_BURPS/37-356--------------------------------------------------------------------------------
Q7CGL8_YERPE/58-356--------------------------------------------------------------------------------
Q7CHB6_YERPE/23-325--------------------------------------------------------------------------------
Q8ZRL1_SALTY/121-429--------------------------------------------------------------------------------
Q9I1A6_PSEAE/30-322--------------------------------------------------------------------------------
Q9I3K1_PSEAE/27-327--------------------------------------------------------------------------------
Q9I737_PSEAE/29-329--------------------------------------------------------------------------------
Q9PAL7_XYLFA/37-321--------------------------------------------------------------------------------

PF09096

BP27_BPT4/203-375--------------------------------------------------------------------------------

PF06763

Q2SI49_HAHCH/7-189--------------------------------------------------------------------------------
K7A372_9ALTE/15-199--------------------------------------------------------------------------------
COMPL_BPN15/3-184--------------------------------------------------------------------------------
Q8ZN01_SALTY/1-192--------------------------------------------------------------------------------
Q8ZQG7_SALTY/3-194--------------------------------------------------------------------------------
Q8ZQ91_SALTY/3-188--------------------------------------------------------------------------------
COMPL_LAMBD/3-192--------------------------------------------------------------------------------

PF09097

BP27_BPT4/5-200--------------------------------------------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------------------------
FII_LAMBD/1-117--------------------------------------------------------------------------------
FII_BPN15/1-117--------------------------------------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------------------------
A3MZN0_ACTP2/1-99--------------------------------------------------------------------------------
B8F4K5_HAEPS/1-99--------------------------------------------------------------------------------
M9X5I9_MANHA/1-99--------------------------------------------------------------------------------
Q8ZQ92_SALTY/1-90--------------------------------------------------------------------------------

PF09393

F6DLR2_DESRL/1-131--------------------------------------------------------------------------------
R7FA15_9CLOT/4-145--------------------------------------------------------------------------------
A9KPP0_CLOPH/4-148--------------------------------------------------------------------------------
A5I2K4_CLOBH/3-146--------------------------------------------------------------------------------
R6NS73_9FIRM/11-143--------------------------------------------------------------------------------
F2F2L4_SOLSS/3-140--------------------------------------------------------------------------------
C4Z5U0_EUBE2/2-139--------------------------------------------------------------------------------
R5BEH1_9FIRM/6-141--------------------------------------------------------------------------------
R5AL39_9FIRM/3-146--------------------------------------------------------------------------------
Q65L22_BACLD/1-141--------------------------------------------------------------------------------
R6M2J8_9FIRM/6-141--------------------------------------------------------------------------------
R6QFB0_9FIRM/2-146--------------------------------------------------------------------------------
R5H4V3_9FIRM/3-147--------------------------------------------------------------------------------
D1AHR6_SEBTE/5-149--------------------------------------------------------------------------------
C0Z6Z9_BREBN/3-140--------------------------------------------------------------------------------
C6D1T3_PAESJ/3-147--------------------------------------------------------------------------------
A3DIA9_CLOTH/4-148--------------------------------------------------------------------------------
D3EHB9_GEOS4/2-143--------------------------------------------------------------------------------
F9VIU9_ARTSS/5-149--------------------------------------------------------------------------------
Q18BM9_PEPD6/2-140--------------------------------------------------------------------------------
D4MVP4_ANAHA/2-140--------------------------------------------------------------------------------
A6TQV7_ALKMQ/4-142--------------------------------------------------------------------------------
Q24LI3_BPPCD/3-141--------------------------------------------------------------------------------
D3EHD6_GEOS4/2-130--------------------------------------------------------------------------------
I4D3G0_DESAJ/2-140--------------------------------------------------------------------------------
Q892H5_CLOTE/3-141--------------------------------------------------------------------------------
Q184A4_PEPD6/3-147--------------------------------------------------------------------------------
R6UQ00_9FIRM/3-141--------------------------------------------------------------------------------
R5TBQ4_9FIRM/10-152--------------------------------------------------------------------------------
M1MSJ7_9CLOT/3-147--------------------------------------------------------------------------------
R6PBH3_9FIRM/5-148--------------------------------------------------------------------------------
A6TRA1_ALKMQ/2-131--------------------------------------------------------------------------------
R6PLB1_9FIRM/3-147--------------------------------------------------------------------------------
A5N9B6_CLOK5/3-133--------------------------------------------------------------------------------
R5BLA9_9FIRM/2-140--------------------------------------------------------------------------------
L7VLA7_CLOSH/4-149--------------------------------------------------------------------------------
I0GWR6_SELRL/2-140--------------------------------------------------------------------------------
R5BQR6_9FIRM/9-143--------------------------------------------------------------------------------
Q24QE7_DESHY/2-147--------------------------------------------------------------------------------
D9R927_CLOSW/3-146--------------------------------------------------------------------------------
R6HTP3_9FIRM/3-147--------------------------------------------------------------------------------
R6Q009_9FIRM/2-140--------------------------------------------------------------------------------
A9KKK2_CLOPH/4-149--------------------------------------------------------------------------------
W8T695_EUBAC/3-142--------------------------------------------------------------------------------
R6ST47_9CLOT/2-146--------------------------------------------------------------------------------
C8VZG4_DESAS/2-142--------------------------------------------------------------------------------
D4M0Z1_9FIRM/4-148--------------------------------------------------------------------------------
G4L1J2_OSCVS/6-136--------------------------------------------------------------------------------
U5MV98_CLOSA/3-133--------------------------------------------------------------------------------
F2JK33_CELLD/10-154--------------------------------------------------------------------------------
A5N2B8_CLOK5/3-131--------------------------------------------------------------------------------
B2TNV8_CLOBB/5-135--------------------------------------------------------------------------------
C0ZFE9_BREBN/2-132--------------------------------------------------------------------------------
F3ZZH5_MAHA5/2-128--------------------------------------------------------------------------------
M1MI16_9CLOT/3-138--------------------------------------------------------------------------------
X2GJE7_9BACI/3-140--------------------------------------------------------------------------------
A5I4B2_CLOBH/1-131--------------------------------------------------------------------------------
A6LTZ2_CLOB8/3-133--------------------------------------------------------------------------------
A6LRW9_CLOB8/3-141--------------------------------------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404................................................................................
A5D093_PELTS/222-567................................................................................
A5VJT7_LACRD/39-685PCGEGHFLGGQLFGVNPGGEFRRNGFHDGLDFGSIDHPGNEVHAIHSGEVKTISWGDGGIGFYVVIQDSSGLNVEYQEAF
A5VKI8_LACRD/34-537................................................................................
B2TMG9_CLOBB/35-355................................................................................
B8I7P6_CLOCE/418-720................................................................................
C4Z844_AGARV/33-364................................................................................
D9SSG9_CLOC7/29-338................................................................................
F3YBF3_MELPT/27-330................................................................................
F9UQU7_LACPL/38-346................................................................................
G8M053_CLOCD/417-718................................................................................
I6T7G9_ENTHA/33-340................................................................................
Q5WE58_BACSK/33-341................................................................................
Q5WIB8_BACSK/8-317................................................................................
Q65ET7_BACLD/226-551................................................................................
Q65KF3_BACLD/29-328................................................................................
Q835T2_ENTFA/29-351................................................................................
Q8Y4Z4_LISMO/34-333................................................................................
Q8YAK1_LISMO/33-338................................................................................
Q9K758_BACHD/67-370................................................................................
Q9KGP3_BACHD/67-375................................................................................
R4K6I2_CLOPA/41-361................................................................................
V5XMR9_ENTMU/31-336................................................................................
W6S0H7_9CLOT/417-718................................................................................
X5A593_9BACL/39-378................................................................................

PF13550

A1AYP0_PARDP/820-985--------------------------------------------------------------------------------
A1B627_PARDP/791-955--------------------------------------------------------------------------------
E0THS4_PARBH/770-933--------------------------------------------------------------------------------
A7HRK9_PARL1/775-940--------------------------------------------------------------------------------
A7IK58_XANP2/791-954--------------------------------------------------------------------------------
A8LQN2_DINSH/795-960--------------------------------------------------------------------------------
A9CJN3_AGRFC/756-923--------------------------------------------------------------------------------
B0SVY2_CAUSK/777-933--------------------------------------------------------------------------------
B0UJ15_METS4/791-954--------------------------------------------------------------------------------
B1LTZ4_METRJ/785-952--------------------------------------------------------------------------------
B6JDQ1_OLICO/759-925--------------------------------------------------------------------------------
B9JU38_AGRVS/757-919--------------------------------------------------------------------------------
Q0AR61_MARMM/759-917--------------------------------------------------------------------------------
Q28RU9_JANSC/978-1139--------------------------------------------------------------------------------
Q3SUI4_NITWN/802-967--------------------------------------------------------------------------------
C6XID3_HIRBI/772-930--------------------------------------------------------------------------------
A8HR63_AZOC5/794-957--------------------------------------------------------------------------------
D9QF99_BRESC/731-889--------------------------------------------------------------------------------
B2JUI8_PARP8/529-699--------------------------------------------------------------------------------
D0J488_COMT2/383-550--------------------------------------------------------------------------------
A9BYF1_DELAS/314-478--------------------------------------------------------------------------------
Q2G3K6_NOVAD/231-396--------------------------------------------------------------------------------
Q1GRM1_SPHAL/243-405--------------------------------------------------------------------------------
Q2N607_ERYLH/223-386--------------------------------------------------------------------------------
B8EKU0_METSB/229-420--------------------------------------------------------------------------------
B2IJD4_BEII9/227-411--------------------------------------------------------------------------------
Q2WA44_MAGSA/316-506--------------------------------------------------------------------------------
C9R735_AGGAD/265-435--------------------------------------------------------------------------------
Q2W6E0_MAGSA/315-503--------------------------------------------------------------------------------
Q2SAL7_HAHCH/191-365--------------------------------------------------------------------------------
A7I049_CAMHC/190-363--------------------------------------------------------------------------------
B2FM10_STRMK/213-385--------------------------------------------------------------------------------
E6WEJ9_PANSA/332-495--------------------------------------------------------------------------------
A6VNR7_ACTSZ/335-501--------------------------------------------------------------------------------
Q8XYR0_RALSO/340-503--------------------------------------------------------------------------------
B2JL07_PARP8/351-514--------------------------------------------------------------------------------
Q2W829_MAGSA/500-665--------------------------------------------------------------------------------
A5CF56_ORITB/744-904--------------------------------------------------------------------------------
B9KI53_ANAMF/694-848--------------------------------------------------------------------------------
C5AYQ3_METEA/784-949--------------------------------------------------------------------------------
D5AU04_RHOCB/799-959--------------------------------------------------------------------------------
G8PN64_PSEUV/767-937--------------------------------------------------------------------------------
N0B519_9RHIZ/827-991--------------------------------------------------------------------------------
TIPJ_LAMBD/332-498--------------------------------------------------------------------------------
Q1QNE9_NITHX/777-937--------------------------------------------------------------------------------
Q3J233_RHOS4/334-499--------------------------------------------------------------------------------
Q3J3J4_RHOS4/795-953--------------------------------------------------------------------------------
Q5F989_NEIG1/222-406--------------------------------------------------------------------------------
Q7ARG4_YERPE/359-522--------------------------------------------------------------------------------

PF16792

H9EDD6_9CAUD/1-372--------------------------------------------------------------------------------
H9ED19_9CAUD/1-372--------------------------------------------------------------------------------
D3LCP7_OENOE/1-372--------------------------------------------------------------------------------
H9EFC2_9CAUD/1-372--------------------------------------------------------------------------------
GP16_BPLP2/1-372--------------------------------------------------------------------------------
C7T1V4_9CAUD/1-372--------------------------------------------------------------------------------
O80118_9CAUD/1-372--------------------------------------------------------------------------------
C7T205_9CAUD/1-372--------------------------------------------------------------------------------
C7T2B2_9CAUD/1-372--------------------------------------------------------------------------------

PF05954

Q1LDW8_CUPMC/39-340--------------------------------------------------------------------------------
C5AP32_BURGB/40-351--------------------------------------------------------------------------------
A8IB09_AZOC5/33-335--------------------------------------------------------------------------------
A9G446_SORC5/24-329--------------------------------------------------------------------------------
B1M1X9_METRJ/41-344--------------------------------------------------------------------------------
A9GQF5_SORC5/30-340--------------------------------------------------------------------------------
A9EVZ6_SORC5/26-317--------------------------------------------------------------------------------
Q98IK7_RHILO/26-327--------------------------------------------------------------------------------
A9FA22_SORC5/24-354--------------------------------------------------------------------------------
A9GAG1_SORC5/23-352--------------------------------------------------------------------------------
C1AEJ4_GEMAT/29-353--------------------------------------------------------------------------------
Q2L040_BORA1/29-322--------------------------------------------------------------------------------
B2U7V1_RALPJ/41-362--------------------------------------------------------------------------------
A9FDZ6_SORC5/23-354--------------------------------------------------------------------------------
B4E682_BURCJ/41-356--------------------------------------------------------------------------------
B1XWY3_LEPCP/24-338--------------------------------------------------------------------------------
B4E676_BURCJ/37-356--------------------------------------------------------------------------------
A1KB80_AZOSB/48-380--------------------------------------------------------------------------------
Q47E10_DECAR/36-349--------------------------------------------------------------------------------
Q8XUG6_RALSO/40-368--------------------------------------------------------------------------------
C5AKJ1_BURGB/40-354--------------------------------------------------------------------------------
Q0K251_CUPNH/36-365--------------------------------------------------------------------------------
C5BAE3_EDWI9/29-331--------------------------------------------------------------------------------
Q747T8_GEOSL/38-336--------------------------------------------------------------------------------
A5G0B1_ACICJ/27-330--------------------------------------------------------------------------------
Q6LUC9_PHOPR/30-341--------------------------------------------------------------------------------
A1KCD6_AZOSB/26-329--------------------------------------------------------------------------------
C5AHV1_BURGB/44-356--------------------------------------------------------------------------------
Q8XRR3_RALSO/37-355--------------------------------------------------------------------------------
C6XDI4_METGS/47-391--------------------------------------------------------------------------------
A9C0N9_DELAS/23-326--------------------------------------------------------------------------------
Q87HD9_VIBPA/30-349--------------------------------------------------------------------------------
A6TAS8_KLEP7/34-358--------------------------------------------------------------------------------
Q0JYG5_CUPNH/32-330--------------------------------------------------------------------------------
B4E680_BURCJ/35-341--------------------------------------------------------------------------------
C5A958_BURGB/38-352--------------------------------------------------------------------------------
Q0JZD4_CUPNH/35-364--------------------------------------------------------------------------------
B4EUE4_PROMH/79-373--------------------------------------------------------------------------------
Q7MDQ8_VIBVY/30-349--------------------------------------------------------------------------------
C5AA20_BURGB/41-355--------------------------------------------------------------------------------
A9FYV0_SORC5/370-667--------------------------------------------------------------------------------
Q88I93_PSEPK/38-347--------------------------------------------------------------------------------
Q3A0Q0_PELCD/27-339--------------------------------------------------------------------------------
C5AMP3_BURGB/41-355--------------------------------------------------------------------------------
C5ALD6_BURGB/39-369--------------------------------------------------------------------------------
Q8XS52_RALSO/44-358--------------------------------------------------------------------------------
Q080W0_SHEFN/30-339--------------------------------------------------------------------------------
Q2SGF0_HAHCH/101-403--------------------------------------------------------------------------------
D2QZK3_PIRSD/24-327--------------------------------------------------------------------------------
B4EH48_BURCJ/40-354--------------------------------------------------------------------------------
C5AMI6_BURGB/41-362--------------------------------------------------------------------------------
Q28MX5_JANSC/33-346--------------------------------------------------------------------------------
Q47J31_DECAR/32-356--------------------------------------------------------------------------------
C5A8I9_BURGB/40-354--------------------------------------------------------------------------------
Q6FFL7_ACIAD/42-385--------------------------------------------------------------------------------
A1B4U8_PARDP/26-330--------------------------------------------------------------------------------
Q8XQT0_RALSO/113-430--------------------------------------------------------------------------------
A1K519_AZOSB/50-375--------------------------------------------------------------------------------
Q3A0Q1_PELCD/40-341--------------------------------------------------------------------------------
Q6F782_ACIAD/42-387--------------------------------------------------------------------------------
Q1QVA4_CHRSD/41-355--------------------------------------------------------------------------------
A7MMD4_CROS8/36-364--------------------------------------------------------------------------------
A9BLL4_DELAS/23-327--------------------------------------------------------------------------------
A0KJD1_AERHH/29-325--------------------------------------------------------------------------------
A1TTP1_ACIAC/24-327--------------------------------------------------------------------------------
B4F002_PROMH/27-319--------------------------------------------------------------------------------
B9JVA0_AGRVS/37-346--------------------------------------------------------------------------------
G3XCU8_PSEAE/32-313--------------------------------------------------------------------------------
I1SBE4_PECAS/30-328--------------------------------------------------------------------------------
I2BBZ6_SHIBC/54-354--------------------------------------------------------------------------------
BPD_BPP2/42-365--------------------------------------------------------------------------------
Q0KDW7_CUPNH/38-356--------------------------------------------------------------------------------
Q3IWJ2_RHOS4/27-325--------------------------------------------------------------------------------
Q5DYX3_VIBF1/29-334--------------------------------------------------------------------------------
Q63II0_BURPS/23-325--------------------------------------------------------------------------------
Q63K62_BURPS/46-349--------------------------------------------------------------------------------
Q63LB9_BURPS/58-337--------------------------------------------------------------------------------
Q63LQ5_BURPS/38-351--------------------------------------------------------------------------------
Q63P68_BURPS/44-375--------------------------------------------------------------------------------
Q63TB7_BURPS/37-356--------------------------------------------------------------------------------
Q7CGL8_YERPE/58-356--------------------------------------------------------------------------------
Q7CHB6_YERPE/23-325--------------------------------------------------------------------------------
Q8ZRL1_SALTY/121-429--------------------------------------------------------------------------------
Q9I1A6_PSEAE/30-322--------------------------------------------------------------------------------
Q9I3K1_PSEAE/27-327--------------------------------------------------------------------------------
Q9I737_PSEAE/29-329--------------------------------------------------------------------------------
Q9PAL7_XYLFA/37-321--------------------------------------------------------------------------------

PF09096

BP27_BPT4/203-375--------------------------------------------------------------------------------

PF06763

Q2SI49_HAHCH/7-189--------------------------------------------------------------------------------
K7A372_9ALTE/15-199--------------------------------------------------------------------------------
COMPL_BPN15/3-184--------------------------------------------------------------------------------
Q8ZN01_SALTY/1-192--------------------------------------------------------------------------------
Q8ZQG7_SALTY/3-194--------------------------------------------------------------------------------
Q8ZQ91_SALTY/3-188--------------------------------------------------------------------------------
COMPL_LAMBD/3-192--------------------------------------------------------------------------------

PF09097

BP27_BPT4/5-200--------------------------------------------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------------------------------------------------
FII_LAMBD/1-117--------------------------------------------------------------------------------
FII_BPN15/1-117--------------------------------------------------------------------------------

PF13856

D4K5F6_9FIRM/1-108--------------------------------------------------------------------------------
A3MZN0_ACTP2/1-99--------------------------------------------------------------------------------
B8F4K5_HAEPS/1-99--------------------------------------------------------------------------------
M9X5I9_MANHA/1-99--------------------------------------------------------------------------------
Q8ZQ92_SALTY/1-90--------------------------------------------------------------------------------

PF09393

F6DLR2_DESRL/1-131--------------------------------------------------------------------------------
R7FA15_9CLOT/4-145--------------------------------------------------------------------------------
A9KPP0_CLOPH/4-148--------------------------------------------------------------------------------
A5I2K4_CLOBH/3-146--------------------------------------------------------------------------------
R6NS73_9FIRM/11-143--------------------------------------------------------------------------------
F2F2L4_SOLSS/3-140--------------------------------------------------------------------------------
C4Z5U0_EUBE2/2-139--------------------------------------------------------------------------------
R5BEH1_9FIRM/6-141--------------------------------------------------------------------------------
R5AL39_9FIRM/3-146--------------------------------------------------------------------------------
Q65L22_BACLD/1-141--------------------------------------------------------------------------------
R6M2J8_9FIRM/6-141--------------------------------------------------------------------------------
R6QFB0_9FIRM/2-146--------------------------------------------------------------------------------
R5H4V3_9FIRM/3-147--------------------------------------------------------------------------------
D1AHR6_SEBTE/5-149--------------------------------------------------------------------------------
C0Z6Z9_BREBN/3-140--------------------------------------------------------------------------------
C6D1T3_PAESJ/3-147--------------------------------------------------------------------------------
A3DIA9_CLOTH/4-148--------------------------------------------------------------------------------
D3EHB9_GEOS4/2-143--------------------------------------------------------------------------------
F9VIU9_ARTSS/5-149--------------------------------------------------------------------------------
Q18BM9_PEPD6/2-140--------------------------------------------------------------------------------
D4MVP4_ANAHA/2-140--------------------------------------------------------------------------------
A6TQV7_ALKMQ/4-142--------------------------------------------------------------------------------
Q24LI3_BPPCD/3-141--------------------------------------------------------------------------------
D3EHD6_GEOS4/2-130--------------------------------------------------------------------------------
I4D3G0_DESAJ/2-140--------------------------------------------------------------------------------
Q892H5_CLOTE/3-141--------------------------------------------------------------------------------
Q184A4_PEPD6/3-147--------------------------------------------------------------------------------
R6UQ00_9FIRM/3-141--------------------------------------------------------------------------------
R5TBQ4_9FIRM/10-152--------------------------------------------------------------------------------
M1MSJ7_9CLOT/3-147--------------------------------------------------------------------------------
R6PBH3_9FIRM/5-148--------------------------------------------------------------------------------
A6TRA1_ALKMQ/2-131--------------------------------------------------------------------------------
R6PLB1_9FIRM/3-147--------------------------------------------------------------------------------
A5N9B6_CLOK5/3-133--------------------------------------------------------------------------------
R5BLA9_9FIRM/2-140--------------------------------------------------------------------------------
L7VLA7_CLOSH/4-149--------------------------------------------------------------------------------
I0GWR6_SELRL/2-140--------------------------------------------------------------------------------
R5BQR6_9FIRM/9-143--------------------------------------------------------------------------------
Q24QE7_DESHY/2-147--------------------------------------------------------------------------------
D9R927_CLOSW/3-146--------------------------------------------------------------------------------
R6HTP3_9FIRM/3-147--------------------------------------------------------------------------------
R6Q009_9FIRM/2-140--------------------------------------------------------------------------------
A9KKK2_CLOPH/4-149--------------------------------------------------------------------------------
W8T695_EUBAC/3-142--------------------------------------------------------------------------------
R6ST47_9CLOT/2-146--------------------------------------------------------------------------------
C8VZG4_DESAS/2-142--------------------------------------------------------------------------------
D4M0Z1_9FIRM/4-148--------------------------------------------------------------------------------
G4L1J2_OSCVS/6-136--------------------------------------------------------------------------------
U5MV98_CLOSA/3-133--------------------------------------------------------------------------------
F2JK33_CELLD/10-154--------------------------------------------------------------------------------
A5N2B8_CLOK5/3-131--------------------------------------------------------------------------------
B2TNV8_CLOBB/5-135--------------------------------------------------------------------------------
C0ZFE9_BREBN/2-132--------------------------------------------------------------------------------
F3ZZH5_MAHA5/2-128--------------------------------------------------------------------------------
M1MI16_9CLOT/3-138--------------------------------------------------------------------------------
X2GJE7_9BACI/3-140--------------------------------------------------------------------------------
A5I4B2_CLOBH/1-131--------------------------------------------------------------------------------
A6LTZ2_CLOB8/3-133--------------------------------------------------------------------------------
A6LRW9_CLOB8/3-141--------------------------------------------------------------------------------

PF06605

A4J7Q0_DESRM/62-404........................................................................DALVQWGR
A5D093_PELTS/222-567......................................................................TAYGRPNGDR
A5VJT7_LACRD/39-685SNQSNITVRVGQQVKTGDVIGYRTTNHLHVGITKHNFPEAFSHAFSNDGTWIDPLSTIKTGIANGGSTPVSSSDGESTTS
A5VKI8_LACRD/34-537.............HGGTHHICLMLDANTMIYEPEPGESCKIEPVSYYPPSWYARNDQMAAVVSQGASDEDDGTDATTTTE
B2TMG9_CLOBB/35-355................................................................................
B8I7P6_CLOCE/418-720...............................................................................Y
C4Z844_AGARV/33-364................................................................................
D9SSG9_CLOC7/29-338...............................................................................Y
F3YBF3_MELPT/27-330................................................................................
F9UQU7_LACPL/38-346................................................................................
G8M053_CLOCD/417-718...............................................................................F
I6T7G9_ENTHA/33-340................................................................................
Q5WE58_BACSK/33-341................................................................................
Q5WIB8_BACSK/8-317................................................................................
Q65ET7_BACLD/226-551................................................................................
Q65KF3_BACLD/29-328................................................................................
Q835T2_ENTFA/29-351................................................................................
Q8Y4Z4_LISMO/34-333................................................................................
Q8YAK1_LISMO/33-338................................................................................
Q9K758_BACHD/67-370...............................................................................F
Q9KGP3_BACHD/67-375.............................................................................YEF
R4K6I2_CLOPA/41-361................................................................................
V5XMR9_ENTMU/31-336................................................................................
W6S0H7_9CLOT/417-718...............................................................................Y
X5A593_9BACL/39-378............................................................................WSSD

PF13550

A1AYP0_PARDP/820-985--------------------------------------------------------------------------------
A1B627_PARDP/791-955--------------------------------------------------------------------------------
E0THS4_PARBH/770-933--------------------------------------------------------------------------------
A7HRK9_PARL1/775-940--------------------------------------------------------------------------------
A7IK58_XANP2/791-954--------------------------------------------------------------------------------
A8LQN2_DINSH/795-960--------------------------------------------------------------------------------
A9CJN3_AGRFC/756-923--------------------------------------------------------------------------------
B0SVY2_CAUSK/777-933--------------------------------------------------------------------------------
B0UJ15_METS4/791-954--------------------------------------------------------------------------------
B1LTZ4_METRJ/785-952--------------------------------------------------------------------------------
B6JDQ1_OLICO/759-925--------------------------------------------------------------------------------
B9JU38_AGRVS/757-919--------------------------------------------------------------------------------
Q0AR61_MARMM/759-917--------------------------------------------------------------------------------
Q28RU9_JANSC/978-1139--------------------------------------------------------------------------------
Q3SUI4_NITWN/802-967--------------------------------------------------------------------------------
C6XID3_HIRBI/772-930--------------------------------------------------------------------------------
A8HR63_AZOC5/794-957--------------------------------------------------------------------------------
D9QF99_BRESC/731-889--------------------------------------------------------------------------------
B2JUI8_PARP8/529-699--------------------------------------------------------------------------------
D0J488_COMT2/383-550--------------------------------------------------------------------------------
A9BYF1_DELAS/314-478--------------------------------------------------------------------------------
Q2G3K6_NOVAD/231-396--------------------------------------------------------------------------------
Q1GRM1_SPHAL/243-405--------------------------------------------------------------------------------
Q2N607_ERYLH/223-386--------------------------------------------------------------------------------
B8EKU0_METSB/229-420--------------------------------------------------------------------------------
B2IJD4_BEII9/227-411--------------------------------------------------------------------------------
Q2WA44_MAGSA/316-506--------------------------------------------------------------------------------
C9R735_AGGAD/265-435--------------------------------------------------------------------------------
Q2W6E0_MAGSA/315-503--------------------------------------------------------------------------------
Q2SAL7_HAHCH/191-365--------------------------------------------------------------------------------
A7I049_CAMHC/190-363--------------------------------------------------------------------------------
B2FM10_STRMK/213-385--------------------------------------------------------------------------------
E6WEJ9_PANSA/332-495--------------------------------------------------------------------------------
A6VNR7_ACTSZ/335-501--------------------------------------------------------------------------------
Q8XYR0_RALSO/340-503--------------------------------------------------------------------------------
B2JL07_PARP8/351-514--------------------------------------------------------------------------------
Q2W829_MAGSA/500-665--------------------------------------------------------------------------------
A5CF56_ORITB/744-904--------------------------------------------------------------------------------
B9KI53_ANAMF/694-848--------------------------------------------------------------------------------
C5AYQ3_METEA/784-949--------------------------------------------------------------------------------
D5AU04_RHOCB/799-959--------------------------------------------------------------------------------
G8PN64_PSEUV/767-937--------------------------------------------------------------------------------
N0B519_9RHIZ/827-991--------------------------------------------------------------------------------
TIPJ_LAMBD/332-498--------------------------------------------------------------------------------
Q1QNE9_NITHX/777-937--------------------------------------------------------------------------------
Q3J233_RHOS4/334-499--------------------------------------------------------------------------------
Q3J3J4_RHOS4/795-953--------------------------------------------------------------------------------
Q5F989_NEIG1/222-406--------------------------------------------------------------------------------
Q7ARG4_YERPE/359-522--------------------------------------------------------------------------------

PF16792

H9EDD6_9CAUD/1-372--------------------------------------------------------------------------------
H9ED19_9CAUD/1-372--------------------------------------------------------------------------------
D3LCP7_OENOE/1-372--------------------------------------------------------------------------------
H9EFC2_9CAUD/1-372--------------------------------------------------------------------------------
GP16_BPLP2/1-372--------------------------------------------------------------------------------
C7T1V4_9CAUD/1-372--------------------------------------------------------------------------------
O80118_9CAUD/1-372--------------------------------------------------------------------------------
C7T205_9CAUD/1-372--------------------------------------------------------------------------------
C7T2B2_9CAUD/1-372--------------------------------------------------------------------------------

PF05954

Q1LDW8_CUPMC/39-340--------------------------------------------------------------------------------
C5AP32_BURGB/40-351--------------------------------------------------------------------------------
A8IB09_AZOC5/33-335--------------------------------------------------------------------------------
A9G446_SORC5/24-329--------------------------------------------------------------------------------
B1M1X9_METRJ/41-344--------------------------------------------------------------------------------
A9GQF5_SORC5/30-340--------------------------------------------------------------------------------
A9EVZ6_SORC5/26-317--------------------------------------------------------------------------------
Q98IK7_RHILO/26-327--------------------------------------------------------------------------------
A9FA22_SORC5/24-354--------------------------------------------------------------------------------
A9GAG1_SORC5/23-352--------------------------------------------------------------------------------
C1AEJ4_GEMAT/29-353--------------------------------------------------------------------------------
Q2L040_BORA1/29-322--------------------------------------------------------------------------------
B2U7V1_RALPJ/41-362--------------------------------------------------------------------------------
A9FDZ6_SORC5/23-354--------------------------------------------------------------------------------
B4E682_BURCJ/41-356--------------------------------------------------------------------------------
B1XWY3_LEPCP/24-338--------------------------------------------------------------------------------
B4E676_BURCJ/37-356--------------------------------------------------------------------------------
A1KB80_AZOSB/48-380--------------------------------------------------------------------------------
Q47E10_DECAR/36-349--------------------------------------------------------------------------------
Q8XUG6_RALSO/40-368--------------------------------------------------------------------------------
C5AKJ1_BURGB/40-354--------------------------------------------------------------------------------
Q0K251_CUPNH/36-365--------------------------------------------------------------------------------
C5BAE3_EDWI9/29-331--------------------------------------------------------------------------------
Q747T8_GEOSL/38-336--------------------------------------------------------------------------------
A5G0B1_ACICJ/27-330--------------------------------------------------------------------------------
Q6LUC9_PHOPR/30-341--------------------------------------------------------------------------------
A1KCD6_AZOSB/26-329--------------------------------------------------------------------------------
C5AHV1_BURGB/44-356--------------------------------------------------------------------------------
Q8XRR3_RALSO/37-355--------------------------------------------------------------------------------
C6XDI4_METGS/47-391--------------------------------------------------------------------------------
A9C0N9_DELAS/23-326--------------------------------------------------------------------------------
Q87HD9_VIBPA/30-349--------------------------------------------------------------------------------
A6TAS8_KLEP7/34-358--------------------------------------------------------------------------------
Q0JYG5_CUPNH/32-330--------------------------------------------------------------------------------
B4E680_BURCJ/35-341--------------------------------------------------------------------------------
C5A958_BURGB/38-352--------------------------------------------------------------------------------
Q0JZD4_CUPNH/35-364--------------------------------------------------------------------------------
B4EUE4_PROMH/79-373--------------------------------------------------------------------------------
Q7MDQ8_VIBVY/30-349--------------------------------------------------------------------------------
C5AA20_BURGB/41-355--------------------------------------------------------------------------------
A9FYV0_SORC5/370-667--------------------------------------------------------------------------------
Q88I93_PSEPK/38-347--------------------------------------------------------------------------------
Q3A0Q0_PELCD/27-339--------------------------------------------------------------------------------
C5AMP3_BURGB/41-355--------------------------------------------------------------------------------
C5ALD6_BURGB/39-369--------------------------------------------------------------------------------
Q8XS52_RALSO/44-358--------------------------------------------------------------------------------
Q080W0_SHEFN/30-339--------------------------------------------------------------------------------
Q2SGF0_HAHCH/101-403--------------------------------------------------------------------------------
D2QZK3_PIRSD/24-327--------------------------------------------------------------------------------
B4EH48_BURCJ/40-354--------------------------------------------------------------------------------
C5AMI6_BURGB/41-362--------------------------------------------------------------------------------
Q28MX5_JANSC/33-346--------------------------------------------------------------------------------
Q47J31_DECAR/32-356--------------------------------------------------------------------------------
C5A8I9_BURGB/40-354--------------------------------------------------------------------------------
Q6FFL7_ACIAD/42-385--------------------------------------------------------------------------------
A1B4U8_PARDP/26-330--------------------------------------------------------------------------------
Q8XQT0_RALSO/113-430--------------------------------------------------------------------------------
A1K519_AZOSB/50-375--------------------------------------------------------------------------------
Q3A0Q1_PELCD/40-341--------------------------------------------------------------------------------
Q6F782_ACIAD/42-387--------------------------------------------------------------------------------
Q1QVA4_CHRSD/41-355--------------------------------------------------------------------------------
A7MMD4_CROS8/36-364--------------------------------------------------------------------------------
A9BLL4_DELAS/23-327--------------------------------------------------------------------------------
A0KJD1_AERHH/29-325--------------------------------------------------------------------------------
A1TTP1_ACIAC/24-327--------------------------------------------------------------------------------
B4F002_PROMH/27-319--------------------------------------------------------------------------------
B9JVA0_AGRVS/37-346--------------------------------------------------------------------------------
G3XCU8_PSEAE/32-313--------------------------------------------------------------------------------
I1SBE4_PECAS/30-328--------------------------------------------------------------------------------
I2BBZ6_SHIBC/54-354--------------------------------------------------------------------------------
BPD_BPP2/42-365--------------------------------------------------------------------------------
Q0KDW7_CUPNH/38-356--------------------------------------------------------------------------------
Q3IWJ2_RHOS4/27-325--------------------------------------------------------------------------------
Q5DYX3_VIBF1/29-334--------------------------------------------------------------------------------
Q63II0_BURPS/23-325--------------------------------------------------------------------------------
Q63K62_BURPS/46-349--------------------------------------------------------------------------------
Q63LB9_BURPS/58-337--------------------------------------------------------------------------------
Q63LQ5_BURPS/38-351--------------------------------------------------------------------------------
Q63P68_BURPS/44-375--------------------------------------------------------------------------------
Q63TB7_BURPS/37-356--------------------------------------------------------------------------------
Q7CGL8_YERPE/58-356--------------------------------------------------------------------------------
Q7CHB6_YERPE/23-325--------------------------------------------------------------------------------
Q8ZRL1_SALTY/121-429--------------------------------------------------------------------------------
Q9I1A6_PSEAE/30-322--------------------------------------------------------------------------------
Q9I3K1_PSEAE/27-327--------------------------------------------------------------------------------
Q9I737_PSEAE/29-329--------------------------------------------------------------------------------
Q9PAL7_XYLFA/37-321--------------------------------------------------------------------------------

PF09096

BP27_BPT4/203-375--------------------------------------------------------------------------------

PF06763

Q2SI49_HAHCH/7-189--------------------------------------------------------------------------------
K7A372_9ALTE/15-199--------------------------------------------------------------------------------
COMPL_BPN15/3-184--------------------------------------------------------------------------------
Q8ZN01_SALTY/1-192--------------------------------------------------------------------------------
Q8ZQG7_SALTY/3-194--------------------------------------------------------------------------------
Q8ZQ91_SALTY/3-188--------------------------------------------------------------------------------
COMPL_LAMBD/3-192--------------------------------------------------------------------------------

PF09097

BP27_BPT4/5-200--------------------------------------------------------------------------------

PF05354

Q8ZN00_SALTY/1-117--------------------------------------FVKTS-----------LTVH-L---------------KR---
FII_LAMBD/1-117--------------------------------------FVRTD-----------EVRQ-L---------------RR---
FII_BPN15/1-117--------------------------------------FVKTS-----------TVSQ-L---------------QR---

PF13856

D4K5F6_9FIRM/1-108--------------------------------------YVKAG-----------DFGKKP---------------KI---
A3MZN0_ACTP2/1-99--------------------------------------TLYRS-----------SGYK.P---------------RT---
B8F4K5_HAEPS/1-99--------------------------------------TLFRS-----------SGYK.P---------------RL---
M9X5I9_MANHA/1-99--------------------------------------TLFRA-----------SGYK.P---------------RL---
Q8ZQ92_SALTY/1-90--------------------------------------VVFSG-----------NVI..P---------------RR---

PF09393

F6DLR2_DESRL/1-131--------------------------------------FELVS-----------KLAD-P---------------ES.YG
R7FA15_9CLOT/4-145--------------------------------------FDIQV-----------SNSD-P---------------TSAAG
A9KPP0_CLOPH/4-148--------------------------------------FEIQV-----------TNED-K---------------TSAAG
A5I2K4_CLOBH/3-146--------------------------------------FDITV-----------TNED-P---------------TSSIG
R6NS73_9FIRM/11-143--------------------------------------LSLIS-----------KLED-P---------------DN.GG
F2F2L4_SOLSS/3-140--------------------------------------FTITT-----------KLAD-P---------------DA.YG
C4Z5U0_EUBE2/2-139--------------------------------------FTLIS-----------KLAD-P---------------DA.YG
R5BEH1_9FIRM/6-141--------------------------------------VKVVA-----------RLAD-P---------------QS.AG
R5AL39_9FIRM/3-146--------------------------------------FELLL-----------TNED-P---------------TGDAG
Q65L22_BACLD/1-141--------------------------------------FTLQA-----------VLDD-Q---------------SSGRG
R6M2J8_9FIRM/6-141--------------------------------------HTLVA-----------RLED-P---------------DN.GG
R6QFB0_9FIRM/2-146--------------------------------------FELML-----------TNED-P---------------TGETG
R5H4V3_9FIRM/3-147--------------------------------------FDLVV-----------ENDD-P---------------ASSVG
D1AHR6_SEBTE/5-149--------------------------------------FDIQV-----------TNED-P---------------TSTVG
C0Z6Z9_BREBN/3-140--------------------------------------SSIVG-----------KVAD-P---------------EA.HG
C6D1T3_PAESJ/3-147--------------------------------------FDLHI-----------TNEQ-P---------------GSASG
A3DIA9_CLOTH/4-148--------------------------------------LKLQI-----------KNED-A---------------QSTIG
D3EHB9_GEOS4/2-143--------------------------------------FMIEV-----------RNED-P---------------GSSTG
F9VIU9_ARTSS/5-149--------------------------------------FDIQI-----------TNYD-P---------------SNRLG
Q18BM9_PEPD6/2-140--------------------------------------FVAIS-----------KLND-P---------------DS.YG
D4MVP4_ANAHA/2-140--------------------------------------CTIIS-----------NLDD-P---------------TV.NG
A6TQV7_ALKMQ/4-142--------------------------------------FTMVS-----------KLQD-P---------------DA.YG
Q24LI3_BPPCD/3-141--------------------------------------FTIIS-----------KLAD-P---------------DA.KG
D3EHD6_GEOS4/2-130--------------------------------------FDIIS-----------KLDD-P---------------ES.YG
I4D3G0_DESAJ/2-140--------------------------------------FTIIS-----------NLDD-P---------------QA.LG
Q892H5_CLOTE/3-141--------------------------------------VTIIS-----------KLSD-P---------------DA.LG
Q184A4_PEPD6/3-147--------------------------------------FDIQV-----------TNED-P---------------TSAVG
R6UQ00_9FIRM/3-141--------------------------------------HTLIS-----------NLDD-P---------------DN.PS
R5TBQ4_9FIRM/10-152--------------------------------------FDLQV-----------VNND-P---------------TSEAG
M1MSJ7_9CLOT/3-147--------------------------------------FDLTV-----------TNED-K---------------SSTIG
R6PBH3_9FIRM/5-148--------------------------------------FDMQI-----------ENND-P---------------TSTAK
A6TRA1_ALKMQ/2-131--------------------------------------FELII-----------SLED-P---------------EA.YG
R6PLB1_9FIRM/3-147--------------------------------------FDIQV-----------VNED-P---------------SSDVG
A5N9B6_CLOK5/3-133--------------------------------------FEIIT-----------KLND-P---------------EA.YG
R5BLA9_9FIRM/2-140--------------------------------------VTIVS-----------VLDD-K---------------DA.IG
L7VLA7_CLOSH/4-149--------------------------------------LKIQV-----------KNED-P---------------QSTVG
I0GWR6_SELRL/2-140--------------------------------------VTIVS-----------KMSD-P---------------DA.IG
R5BQR6_9FIRM/9-143--------------------------------------STLVA-----------DIDD-P---------------DAVDG
Q24QE7_DESHY/2-147--------------------------------------FDLQI-----------VNED-P---------------ASGVG
D9R927_CLOSW/3-146--------------------------------------ISIQV-----------ANDD-P---------------SSTIG
R6HTP3_9FIRM/3-147--------------------------------------FEIQV-----------TNED-P---------------TSAVG
R6Q009_9FIRM/2-140--------------------------------------IKFVG-----------KLED-P---------------TA.LG
A9KKK2_CLOPH/4-149--------------------------------------FEIQV-----------TNED-P---------------NSSSG
W8T695_EUBAC/3-142--------------------------------------FDLFV-----------KVDD-P---------------DA.IG
R6ST47_9CLOT/2-146--------------------------------------FTIQI-----------TNDD-P---------------STSVG
C8VZG4_DESAS/2-142--------------------------------------TELIS-----------KTDD-P---------------EA.FG
D4M0Z1_9FIRM/4-148--------------------------------------FEMQI-----------TNDD-P---------------TSDAG
G4L1J2_OSCVS/6-136--------------------------------------KTLVG-----------ALKD-P---------------DA.YG
U5MV98_CLOSA/3-133--------------------------------------FEVLT-----------SLED-P---------------EA.YG
F2JK33_CELLD/10-154--------------------------------------FDIQV-----------TNED-P---------------TSSVG
A5N2B8_CLOK5/3-131--------------------------------------FELIV-----------GLED-P---------------ES.YG
B2TNV8_CLOBB/5-135--------------------------------------FELLT-----------ELDD-P---------------EA.YG
C0ZFE9_BREBN/2-132--------------------------------------VNFIG-----------ELDD-K---------------VA..G
F3ZZH5_MAHA5/2-128--------------------------------------FEIIS-----------KLAD-P---------------EA.YG
M1MI16_9CLOT/3-138--------------------------------------CTIIS-----------KLAD-P---------------DA.LG
X2GJE7_9BACI/3-140--------------------------------------INMVG-----------KLAD-P---------------DA.FG
A5I4B2_CLOBH/1-131--------------------------------------FETIS-----------SLED-P---------------EA.YG
A6LTZ2_CLOB8/3-133--------------------------------------FELLA-----------ELDD-P---------------EA.YG
A6LRW9_CLOB8/3-141--------------------------------------IKLIS-----------SLTD-K---------------AT.GK

PF06605

A4J7Q0_DESRM/62-404SGRHRF............................SA--FEDDE------------ETD-P---------------AVLLR
A5D093_PELTS/222-567TFRHRT............................GI--FEDQE------------ETD-P---------------VTLLQ
A5VJT7_LACRD/39-685TTSETYYSLVYHFENQESID......KYGRRKG.AP--ITVDS------------IYD-L---------------DALKK
A5VKI8_LACRD/34-537TDTTQYYFQPFIVKDQESID......RWGLFFAPDD--ITNDS------------IQD-K---------------DQMRD
B2TMG9_CLOBB/35-355..DNVRFVLPEKYIDSSYINRDPNPRIAKVDFS.NY--FQDDE------------EFN-I---------------EKLRI
B8I7P6_CLOCE/418-720SNEVRV............................ST--LDLSN------------FTN-P---------------YQMLE
C4Z844_AGARV/33-364.............NDGKDYVFIQNAVDHFGWIR.KV--IHWDD------------VTD-P---------------DNLKK
D9SSG9_CLOC7/29-338SNKVIS............................IY--WEDNR------------YES-K---------------ESLKE
F3YBF3_MELPT/27-330..........YTSPQAKDF.........GIIDA.QF--IQDDR------------FTD-Q---------------KSLLN
F9UQU7_LACPL/38-346.....KYQVDFTYRDDASIQ......KWGLQRG.DP--LSDER------------FTD-Q---------------GSMTE
G8M053_CLOCD/417-718SSEVRV............................ST--LDCSS------------FTN-P---------------YQMLE
I6T7G9_ENTHA/33-340..DYVFTPITYTSPESETW.........GIRIQ.DP--VTDER------------YTI-S---------------RNMLE
Q5WE58_BACSK/33-341..........TVYESEHSEKYKDVTTGKKRLYK.AF--FQDDR------------FTT-Q---------------EGIDA
Q5WIB8_BACSK/8-317..........YISPNAKNYVDE...NGKIKYYN.KV--IYDDR------------FEH-A---------------DALKQ
Q65ET7_BACLD/226-551..........YIHPDEKKFLI.....EGKPRWA.EP--IRDER------------YKK-A---------------SSMIS
Q65KF3_BACLD/29-328.....YLFAEYTSPLAKIY.........GIKHA.DP--VKDER------------YTD-K---------------DSLLA
Q835T2_ENTFA/29-351....LE............................SI--WVEQR------------FSD-P---------------KALKE
Q8Y4Z4_LISMO/34-333.....FSPITYTSPEVEKW.........GIRWQ.EP--VSDER------------YTV-A---------------GNMQR
Q8YAK1_LISMO/33-338..NKYMAVVTYTSPNEAIY.........GKRMA.NA--KSDDK------------ITN-N---------------DDLLI
Q9K758_BACHD/67-370TDKVRV............................RV--TKDER------------FTN-P---------------YHLKE
Q9KGP3_BACHD/67-375TDKLRV............................RI--LKDDR------------FTN-P---------------FHLRE
R4K6I2_CLOPA/41-361.....DNLTIETVNNGKDYLEDAATVAQVGIVE.QI--ADLKD------------IAD-V---------------NALKA
V5XMR9_ENTMU/31-336..DYVFPPVTLTSQESAKW.........GIRIQ.DP--VRDER------------YHH-Q---------------ESMME
W6S0H7_9CLOT/417-718SSEIRI............................ST--LDCSS------------FTN-P---------------YQMKE
X5A593_9BACL/39-378SVPYYD............................DL--LTEQD------------VTD-P---------------LKLLE

PF13550

A1AYP0_PARDP/820-985----------------------------------AA--ESFSI------------VVP-P---------------EEADR
A1B627_PARDP/791-955----------------------------------SD--SELAM------------ALT-R---------------GEGRA
E0THS4_PARBH/770-933----------------------------------AF--RETAL------------VLE-Q---------------GEAEG
A7HRK9_PARL1/775-940----------------------------------ST--AALPM------------VLG-Q---------------ASAQG
A7IK58_XANP2/791-954----------------------------------SH--ADLAV------------VAS-D---------------ATIVR
A8LQN2_DINSH/795-960----------------------------------SQ--SSFPI------------SLT-Y---------------SEGKA
A9CJN3_AGRFC/756-923----------------------------------LR--LDLNA------------ALP-A---------------ETAEA
B0SVY2_CAUSK/777-933----------------------------------AD--LDAPV------------VLS-A---------------AEARA
B0UJ15_METS4/791-954----------------------------------SR--VSLPL------------CLE-E---------------GAARG
B1LTZ4_METRJ/785-952----------------------------------TR--IEAAI------------VTR-R---------------ETGDG
B6JDQ1_OLICO/759-925----------------------------------NT--LSLPV------------VLT-V---------------EQAQE
B9JU38_AGRVS/757-919----------------------------------LS--SDLPA------------VLD-E---------------ASALA
Q0AR61_MARMM/759-917----------------------------------RS--LIVPV------------IAD-A---------------DTARR
Q28RU9_JANSC/978-1139----------------------------------ND--VDLPL------------ALT-S---------------AEGQG
Q3SUI4_NITWN/802-967----------------------------------SD--IRLAL------------VLD-Q---------------VQAQS
C6XID3_HIRBI/772-930----------------------------------KD--VSLAL------------ALD-D---------------GMAGR
A8HR63_AZOC5/794-957----------------------------------TR--LEVPA------------MAS-D---------------ALMVR
D9QF99_BRESC/731-889----------------------------------VD--LDLPA------------VSG-S---------------GLAGA
B2JUI8_PARP8/529-699----------------------------------VV--MNYPI------------VMA-D---------------DEGLM
D0J488_COMT2/383-550----------------------------------QT--LQVPL------------GML-P---------------AEAKA
A9BYF1_DELAS/314-478----------------------------------SA--MQVAV------------VMT-S---------------ELAAQ
Q2G3K6_NOVAD/231-396----------------------------------RS--IELPA------------ALS-A---------------TQARS
Q1GRM1_SPHAL/243-405----------------------------------ER--IDLPA------------ALP-A---------------ASARA
Q2N607_ERYLH/223-386----------------------------------RV--VELPA------------TLD-A---------------ADAKS
B8EKU0_METSB/229-420----------------------------------QS--ITAHE------------ICD-V---------------SVAQR
B2IJD4_BEII9/227-411----------------------------------ST--VTAHE------------ICD-V---------------SMGLL
Q2WA44_MAGSA/316-506----------------------------------KT--RQAHL------------FTT-G---------------TVAR.
C9R735_AGGAD/265-435----------------------------------KT--VEYKG------------VPT-F---------------DLAAR
Q2W6E0_MAGSA/315-503----------------------------------SV--KQSHL------------FAL-P---------------SAAQ.
Q2SAL7_HAHCH/191-365----------------------------------QT--RRYPG------------ITS-D---------------VLASR
A7I049_CAMHC/190-363----------------------------------YE--CEFMT------------VSN-A---------------RNAKI
B2FM10_STRMK/213-385----------------------------------QR--RDYPG------------VNY-G---------------PLAAR
E6WEJ9_PANSA/332-495----------------------------------TT--LEAFG------------CTS-R---------------GQAVR
A6VNR7_ACTSZ/335-501----------------------------------KK--MTAFA------------TTT-R---------------GQAHR
Q8XYR0_RALSO/340-503----------------------------------TE--VTAFG------------CTS-Q---------------SQAQR
B2JL07_PARP8/351-514----------------------------------LQ--IQAFG------------CTS-R---------------GQAHR
Q2W829_MAGSA/500-665----------------------------------AK--VNLFG------------CTA-K---------------DHAQR
A5CF56_ORITB/744-904----------------------------------YN--LNLPI------------VTS-L---------------QNVQN
B9KI53_ANAMF/694-848----------------------------------GI--LQTSL------------VLD-D---------------LHAEA
C5AYQ3_METEA/784-949----------------------------------VR--VEAAI------------VTR-R---------------DAVQA
D5AU04_RHOCB/799-959----------------------------------AG--SELSL------------ALT-R---------------AQAQG
G8PN64_PSEUV/767-937----------------------------------ST--LQLPI------------TTS-L---------------TMARK
N0B519_9RHIZ/827-991----------------------------------AE--ADLPI------------VLD-D---------------GLAGS
TIPJ_LAMBD/332-498----------------------------------TK--MDAFG------------CTS-R---------------GQAHR
Q1QNE9_NITHX/777-937----------------------------------VH--SALAV------------VSD-D---------------AAMSR
Q3J233_RHOS4/334-499----------------------------------AD--IKLSA------------VPF-P---------------RQVRR
Q3J3J4_RHOS4/795-953----------------------------------SQ--SEVPL------------VLT-S---------------GEARG
Q5F989_NEIG1/222-406----------------------------------DA--VRMHG------------ICD-A---------------KVAQK
Q7ARG4_YERPE/359-522----------------------------------TE--VVAFG------------CTS-R---------------GQAHR

PF16792

H9EDD6_9CAUD/1-372----------------------------------DY--TDPPK------------MYT-T---------------KNNGD
H9ED19_9CAUD/1-372----------------------------------DY--ADPPK------------MYT-A---------------KNNGD
D3LCP7_OENOE/1-372----------------------------------DY--IDPPK------------MYT-A---------------KNNGD
H9EFC2_9CAUD/1-372----------------------------------DY--TDPPK------------MYT-A---------------KNNGD
GP16_BPLP2/1-372----------------------------------DY--TDPPK------------MYI-A---------------KNNGD
C7T1V4_9CAUD/1-372----------------------------------DY--KDPPK------------MYT-A---------------KNNGD
O80118_9CAUD/1-372----------------------------------DY--TDPPK------------MYT-A---------------KNNGD
C7T205_9CAUD/1-372----------------------------------DY--ADPPK------------MYT-A---------------KNNGD
C7T2B2_9CAUD/1-372----------------------------------DY--ADPPK------------MYT-A---------------KNNGD

PF05954

Q1LDW8_CUPMC/39-340----------------------------------QS..YVFG.............TNH-LD.............FDEAKW
C5AP32_BURGB/40-351----------------------------------ED..YLYVGS.........QAWSD-S...............GMGEQ
A8IB09_AZOC5/33-335----------------------------------EL..YDYPG...........DYDT-K...............DKGTP
A9G446_SORC5/24-329----------------------------------EVSLYGER.............FFT-P...............AAGDR
B1M1X9_METRJ/41-344----------------------------------EM..YDYPG...........RYKA-D...............AVGRA
A9GQF5_SORC5/30-340----------------------------------TT..YDHH............DHDE-R..............IDAGAE
A9EVZ6_SORC5/26-317----------------------------------QH..YAYPG...........GYAD-P...............DAGGD
Q98IK7_RHILO/26-327----------------------------------EN..YRQPG...........AHLD-V...............GRGDT
A9FA22_SORC5/24-354----------------------------------EH..FDYQPGAF.....LVASAGP-ADTPAADDKGSYRHDQPSGKA
A9GAG1_SORC5/23-352----------------------------------EQ..YRYEPGA......FLAAGAG-GGAPVGDAKGVYRHDPKHGAD
C1AEJ4_GEMAT/29-353----------------------------------SG..FNHSGGET.....ASDVAKF-Q...............PDTKV
Q2L040_BORA1/29-322----------------------------------RL..YCYPG...........RYTQ-E...............GEGKR
B2U7V1_RALPJ/41-362----------------------------------ER..YEYEP..........GLYDS-R...............DVGNL
A9FDZ6_SORC5/23-354----------------------------------EQ..YHYQPGAF.....LIEGQRG-GGTPAADDKGVARHDQSYGKA
B4E682_BURCJ/41-356----------------------------------ED..RDVAGP.........YAFQT-A...............AIGDQ
B1XWY3_LEPCP/24-338----------------------------------EV..FDFQG...........DYIQ-A...............ADGSH
B4E676_BURCJ/37-356----------------------------------EL..YDDVGP.........EAFDS-L...............REAED
A1KB80_AZOSB/48-380----------------------------------ED..YDPQTL.........YYAAG-M...............HEAER
Q47E10_DECAR/36-349----------------------------------EI..HDASRP.........YRFED-S...............AAAQL
Q8XUG6_RALSO/40-368----------------------------------ARLMTDAAVDR.......PHAGNS-R...............EDYQR
C5AKJ1_BURGB/40-354----------------------------------EV..YDYTGA.........YTWGA-D...............SDGER
Q0K251_CUPNH/36-365----------------------------------EL..YSWPG...........DYVQ-PKSG........NDARKEGDM
C5BAE3_EDWI9/29-331----------------------------------AV..YDFTD...........GYTQ-T...............REGER
Q747T8_GEOSL/38-336----------------------------------EV..YDFPG...........NYFN-E...............ERGTY
A5G0B1_ACICJ/27-330----------------------------------KF..YRYPS...........ENPV-K...............EAIGQ
Q6LUC9_PHOPR/30-341----------------------------------EL..YQYQGES......GFNPRVN-F...............SSGN.
A1KCD6_AZOSB/26-329----------------------------------EV..FDYPG...........EFDQ-V...............ADGRH
C5AHV1_BURGB/44-356----------------------------------EV..YEYTGA.........YAYAE-H...............ERGES
Q8XRR3_RALSO/37-355----------------------------------DT......................-................ANAQR
C6XDI4_METGS/47-391----------------------------------EV..YQWRTDH.......GSDYSQ-PNAGMDR...EANQTEPQGEL
A9C0N9_DELAS/23-326----------------------------------EI..YEWPG...........GYTQ-L...............SDGED
Q87HD9_VIBPA/30-349----------------------------------AS..EYF...............EY-LGE...........TESDDQY
A6TAS8_KLEP7/34-358----------------------------------EV..YHYK.............LRH-RERGDK.....IDPQTETANF
Q0JYG5_CUPNH/32-330----------------------------------QQ..YVFPG...........RHKD-A...............ADASR
B4E680_BURCJ/35-341----------------------------------EI..YDGQRA.........GRFDT-S...............GDAQR
C5A958_BURGB/38-352----------------------------------EV..YDYLGE.........HGFPD-S...............DRGEA
Q0JZD4_CUPNH/35-364----------------------------------EI..YEFPG...........DHSQ-PATG........NDPWKEGDQ
B4EUE4_PROMH/79-373----------------------------------ES..Y..G............RFQE-D...............AQGQP
Q7MDQ8_VIBVY/30-349----------------------------------SS..EHY...............EY-LGE...........AESGDQY
C5AA20_BURGB/41-355----------------------------------EV..YHYTGA.........YTYLD-Q...............DRGDH
A9FYV0_SORC5/370-667----------------------------------GV..IEYGG...........HYKT-P...............AEGKA
Q88I93_PSEPK/38-347----------------------------------EI..YDFPGQ.........YTHGS-Y...............EDGEA
Q3A0Q0_PELCD/27-339----------------------------------SA..VNFGSG........LANE..-................EEAKH
C5AMP3_BURGB/41-355----------------------------------EV..YEYTGA.........YTYDR-Q...............DRGEH
C5ALD6_BURGB/39-369----------------------------------ER..YEWPG...........DYSD-SS.............H..GEL
Q8XS52_RALSO/44-358----------------------------------EV..YEYTGA.........YTFGQ-Q...............AQGDR
Q080W0_SHEFN/30-339----------------------------------EV..YDYLGE........SEFN..-................KRAQP
Q2SGF0_HAHCH/101-403----------------------------------ER..FDYPG...........AFGD-Q...............DRGRR
D2QZK3_PIRSD/24-327----------------------------------EV..FTYPG...........SYTV-V...............ADGTG
B4EH48_BURCJ/40-354----------------------------------EV..YEYTGG.........YTYPE-Q...............ERGDH
C5AMI6_BURGB/41-362----------------------------------SI..EHF...............HS-A...............EEGQV
Q28MX5_JANSC/33-346----------------------------------EM..YEYPAVSGYGTGTRASEGIA-D...............AEVAR
Q47J31_DECAR/32-356----------------------------------ES..HDHPGL.........YAWAN-A...............AEAER
C5A8I9_BURGB/40-354----------------------------------EV..YDYTGA.........YTFGE-Q...............SHGDR
Q6FFL7_ACIAD/42-385----------------------------------SAWTTDLTGAD.......QATASS-S...............QQIEK
A1B4U8_PARDP/26-330----------------------------------EA..YLYPG...........RHLE-L...............GRGDR
Q8XQT0_RALSO/113-430----------------------------------ER..YEYHS...........MYDL-A...............DDGRR
A1K519_AZOSB/50-375----------------------------------ED..FRPQTL.........HYAPT-V...............DGLAA
Q3A0Q1_PELCD/40-341----------------------------------AV..YGDH.............FKT-I...............EEGQR
Q6F782_ACIAD/42-387----------------------------------PAWMTDLNGED.......QATASD-S...............RQLEK
Q1QVA4_CHRSD/41-355----------------------------------EV..YDYAGE.........YYYHG-F...............ERGER
A7MMD4_CROS8/36-364----------------------------------ND..YHYT.............DGF-LSEGEQYA.TAGNQSAESGYF
A9BLL4_DELAS/23-327----------------------------------EI..YEWPG...........GYTE-T...............GDGED
A0KJD1_AERHH/29-325----------------------------------QH..FDFPG...........RYKQ-D...............PSGKA
A1TTP1_ACIAC/24-327----------------------------------ER..YEWPG...........GYTE-Y...............ADGET
B4F002_PROMH/27-319----------------------------------EI....FESY.........GRFEE-D...............AQGQP
B9JVA0_AGRVS/37-346----------------------------------EL..YEYPT...........RISD-V...............KEAEV
G3XCU8_PSEAE/32-313----------------------------------DR..HLY...............TS-R...............GEAEQ
I1SBE4_PECAS/30-328----------------------------------QH..YDYPG...........RYKQ-E...............PSGKA
I2BBZ6_SHIBC/54-354----------------------------------EI..TRYRPKI.......LVNEDS-L...............TVGGA
BPD_BPP2/42-365----------------------------------LT..TVY...............AT-K...............AQAMR
Q0KDW7_CUPNH/38-356----------------------------------ER..YEHPG...........DYVD-P...............AVGEM
Q3IWJ2_RHOS4/27-325----------------------------------EH..YRWPG...........DYRT-L...............PAGDR
Q5DYX3_VIBF1/29-334----------------------------------EH..YQYPI...........NQTS-S...............EKATK
Q63II0_BURPS/23-325----------------------------------AS..FEWPG...........GYRD-D...............EPGAH
Q63K62_BURPS/46-349----------------------------------SD..EHF...............HT-K...............DEGQR
Q63LB9_BURPS/58-337----------------------------------LP..EDY...............AT-E...............AEARA
Q63LQ5_BURPS/38-351----------------------------------EI..YDYVGL.........HGFDS-T...............DRGEE
Q63P68_BURPS/44-375----------------------------------.....DIAIDI.......AHAGDS-W...............RDHER
Q63TB7_BURPS/37-356----------------------------------SR..ELYDDVG.......PEAFDS-L...............READA
Q7CGL8_YERPE/58-356----------------------------------EH..FDFPG...........RFKD-E...............QHGKD
Q7CHB6_YERPE/23-325----------------------------------LP..DRYRNR........IVIVEN-T...............MDSPQ
Q8ZRL1_SALTY/121-429----------------------------------EH..YEWPG...........DYFD-K...............SEGEM
Q9I1A6_PSEAE/30-322----------------------------------HP..GGY...............TA-K...............AQGDS
Q9I3K1_PSEAE/27-327----------------------------------ER..YDYPG...........RYKR-S...............GAGRP
Q9I737_PSEAE/29-329----------------------------------PL..YDYPG...........EYVQ-S...............QDGEQ
Q9PAL7_XYLFA/37-321----------------------------------RI..KQY..............LPD-A...............AAAIA

PF09096

BP27_BPT4/203-375----------------------------------VK--IIFND------------SKN-Q---------------FKTEF

PF06763

Q2SI49_HAHCH/7-189----------------------------------KGAAKLIRG-----------GFVT-T---------------LKAGN
K7A372_9ALTE/15-199----------------------------------....KTYDG-----------TFIG-T---------------GKNGA
COMPL_BPN15/3-184----------------------------------P...FRFPG-----------GFIQ-Q---------------LKNGR
Q8ZN01_SALTY/1-192----------------------------------P...YLFRD-----------AFIQ-Q---------------LANGR
Q8ZQG7_SALTY/3-194----------------------------------P...YLFRD-----------AFIQ-Q---------------LANGR
Q8ZQ91_SALTY/3-188----------------------------------K...YRFDR-----------GFIA-Q---------------APNGW
COMPL_LAMBD/3-192----------------------------------N...RRIPG-----------AFIQ-Q---------------LKNGR

PF09097

BP27_BPT4/5-200----------------------------------TIHSIENLK------------FGR-P-------------FFPDAGE

PF05354

Q8ZN00_SALTY/1-117--PDT----LTI--LGDTFWVDR-ITP--------------------------------A-G--GD--SSIILLG-----
FII_LAMBD/1-117--GDT----LTI--GEENFWVDR-VSP--------------------------------D-D--GG--SCHLWLG-----
FII_BPN15/1-117--MDT----LTI--NGRQFWVDR-VGP--------------------------------D-D--CG--SCHIWLG-----

PF13856

D4K5F6_9FIRM/1-108--GNP----IQV--DGADLTIQN-FDE--------------------------------Q-Q--GL--YVITI-------
A3MZN0_ACTP2/1-99--GDE----AVR--EGKVFFVKS-YYH--------------------------------Q-D--NL--LILRL-------
B8F4K5_HAEPS/1-99--DHK----VVQ--GEKKYLVKS-YHY--------------------------------V-D--QM--IVLQL-------
M9X5I9_MANHA/1-99--DDR----VSG--NGKKYLVKS-YHF--------------------------------V-D--QL--IVLQL-------
Q8ZQ92_SALTY/1-90--GDR----VVL--RGSEFTVTR-IRR--------------------------------F-N--GK--PQLTL-------

PF09393

F6DLR2_DESRL/1-131..HER----VRL--KNVMVDELQ-LAN--------------------------------W-T--SG..EEVKEEI-----
R7FA15_9CLOT/4-145..VCT----MVF--SGCNVDGGV-LAS--------------------------------F-D--VDG.DFLEQEI-----
A9KPP0_CLOPH/4-148..RQT----MVF--IDCNIDGGI-LAK--------------------------------F-D--ADG.EYLDEDM-----
A5I2K4_CLOBH/3-146..KQT----TVL--KDCNLDEVS-MAM--------------------------------F-D--VES.EVLEEDM-----
R6NS73_9FIRM/11-143..TER----VQL--MSCWLDELT-LQA--------------------------------F-E--NG..KITEDEF-----
F2F2L4_SOLSS/3-140..TER----VSV--TDVTFNEFL-LSK--------------------------------I-E--QR..ALLSEEL-----
C4Z5U0_EUBE2/2-139..AER----VSI--TGVQMDDLT-LFD--------------------------------W-E--AQ..KPLETEA-----
R5BEH1_9FIRM/6-141..AER----VEL--IDVTFDEAT-LLQ--------------------------------F-E--NK..KVSEESV-----
R5AL39_9FIRM/3-146..RQT----VLL--KDVNIEEML-IGK--------------------------------I-D--VEE.AAMEEEM-----
Q65L22_BACLD/1-141..TER----VTL--YDVNFDSAK-IAG--------------------------------L-D--VDS.EALEEEV-----
R6M2J8_9FIRM/6-141..YET----IQL--DNCWYNDVS-LMN--------------------------------F-E--TG..KIVEEEF-----
R6QFB0_9FIRM/2-146..KQT----VLL--KDVNIDEMV-IGK--------------------------------L-D--VDQ.FALEEDM-----
R5H4V3_9FIRM/3-147..KQT----VLL--RDCCPDGIT-LAK--------------------------------L-D--GDTDDPLEDEI-----
D1AHR6_SEBTE/5-149..RQT----VVL--LDCNIDKTL-LAK--------------------------------F-D--ADA.DYIEEDV-----
C0Z6Z9_BREBN/3-140..AER----VAL--YDTTFSEFM-LLK--------------------------------F-A--QK..TVGSEDI-----
C6D1T3_PAESJ/3-147..KQS----VVL--KGCNLDSII-ATK--------------------------------F-D--ATSDDMLDEEM-----
A3DIA9_CLOTH/4-148..KQE----IVL--LGVLLNTIP-VAA--------------------------------L-D--DQSDDPITVDT-----
D3EHB9_GEOS4/2-143..RQT----VIL--EGVNLDSVI-MAS--------------------------------L-D--TEA.EALEEEV-----
F9VIU9_ARTSS/5-149..RQT----VIL--YDCNLDNGI-LGK--------------------------------F-D--ASG.EYLDEDM-----
Q18BM9_PEPD6/2-140..AER----IAV--KNIAFDDLT-LAD--------------------------------W-E--VG..VKGEIEA-----
D4MVP4_ANAHA/2-140..NER----VKL--TNCTFDEVK-LVD--------------------------------W-E--AN..KLGEESI-----
A6TQV7_ALKMQ/4-142..AER----VSM--EEVTFNEFT-LAK--------------------------------F-A--QK..ELQTEEL-----
Q24LI3_BPPCD/3-141..VER----ISL--TGVSFDGLS-IID--------------------------------W-E--NG..KEGEIEA-----
D3EHD6_GEOS4/2-130..HER----VRL--IRCMPDKIQ-LAN--------------------------------W-T--AG..EEVQEET-----
I4D3G0_DESAJ/2-140..AER----IVL--KGVMFDELT-LVD--------------------------------W-E--AK..KNGEESI-----
Q892H5_CLOTE/3-141..VER----VCI--KDATFEELT-LAD--------------------------------W-E--GK..KNGEESV-----
Q184A4_PEPD6/3-147..RQT----VVL--KDCNMDSGI-ITK--------------------------------F-D--ADG.EYLDEDM-----
R6UQ00_9FIRM/3-141..NQR----ISV--TGVSFDDLT-LAD--------------------------------W-E--AA..KLGQIEA-----
R5TBQ4_9FIRM/10-152..KHT----VIL--TGCNIDKGT-VAG--------------------------------F-D--AEG.KWLEDEI-----
M1MSJ7_9CLOT/3-147..KQT----VVL--KKCNFDKVS-MAM--------------------------------F-N--VDD.EVLEEEM-----
R6PBH3_9FIRM/5-148..SQT----VIL--YDCNTDGGI-LAK--------------------------------F-D--ADG.EYIDEEI-----
A6TRA1_ALKMQ/2-131..HER----VRL--KNCMADSIQ-LAN--------------------------------V-T--SG..EIIEEET-----
R6PLB1_9FIRM/3-147..RQS----VIL--IDCNIDGGV-LAK--------------------------------F-D--AEG.EYLEEDM-----
A5N9B6_CLOK5/3-133..YES----IRL--KNCMATKLQ-LIN--------------------------------L-K--AG..DLVEEET-----
R5BLA9_9FIRM/2-140..SER----IVI--KDATFDSLI-LAD--------------------------------W-E--VD..KMGEESY-----
L7VLA7_CLOSH/4-149..RQE----VVL--LNVILATIP-VTT--------------------------------L-D--DQSDDPITFDT-----
I0GWR6_SELRL/2-140..TER----VVL--RNCQIDSVD-LIN--------------------------------W-K--LG..ALSEESY-----
R5BQR6_9FIRM/9-143.QAER----VSV--DNVWFNELT-LLA--------------------------------F-E--KG..KVVEKEF-----
Q24QE7_DESHY/2-147..KQT----IVL--KGCNLDSVT-AAS--------------------------------F-D--ITSDDPLEEEM-----
D9R927_CLOSW/3-146..KRT----VVM--RNCILSKVP-VAY--------------------------------L-E--DGSEDLNTTDT-----
R6HTP3_9FIRM/3-147..RQT----IIH--HDCLCDTFT-LAK--------------------------------F-Q--AGE.ELLEEDL-----
R6Q009_9FIRM/2-140..AER----VEF--LEVTIDELM-LLK--------------------------------F-E--NK..AILELEV-----
A9KKK2_CLOPH/4-149..RQT----IVF--KNCNMDDGI-LAK--------------------------------F-D--ASSDDTLTEEV-----
W8T695_EUBAC/3-142KQEES----WSI--GNVWFNDFP-IAV--------------------------------F-E--SK..QVMNEEW-----
R6ST47_9CLOT/2-146..TQT----VVF--YNVKLQKLP-VAI--------------------------------L-D--AEA.DYLEMEV-----
C8VZG4_DESAS/2-142..FER----VRL--KNVIFDLLQ-LVE--------------------------------W-E--AG..NVCPEEL-----
D4M0Z1_9FIRM/4-148..RQT----IIF--YDCNTDGGV-LAK--------------------------------F-D--ADG.EYLDEEI-----
G4L1J2_OSCVS/6-136..AER----ISV--YGVSYDEVT-VMD--------------------------------W-A--AA..KEGSITI-----
U5MV98_CLOSA/3-133..YER----IRL--IGCMADKIS-LVN--------------------------------F-K--GG..DLIEQET-----
F2JK33_CELLD/10-154..RQT----IIL--KDCNLDGGI-LTK--------------------------------F-D--ADA.EYLDEDI-----
A5N2B8_CLOK5/3-131..YES----IRL--LNCMADEVN-LID--------------------------------L-K--VG..DLVMEES-----
B2TNV8_CLOBB/5-135..AER----IRL--KNCQFTKIN-LVN--------------------------------F-K--PG..EVIEEEM-----
C0ZFE9_BREBN/2-132..KYR----VAV--TGFCPDSLS-LAK--------------------------------W-S--HG...ELDEDT-----
F3ZZH5_MAHA5/2-128..YER----VRF--RSCRVSQRQ-WAN--------------------------------W-T--SG..EQVTEEV-----
M1MI16_9CLOT/3-138..AER----VVL--KDVTFDELT-IAD--------------------------------W-E--VK..KNVEESL-----
X2GJE7_9BACI/3-140..TER----IAI--GEVTFSEFM-LMQ--------------------------------F-A--QK..TIGTEEL-----
A5I4B2_CLOBH/1-131..FER----IRL--MNCMADKLN-LIN--------------------------------L-K--AN..ELVEEET-----
A6LTZ2_CLOB8/3-133..AER----IRL--KNCKASKVS-LVN--------------------------------F-K--AG..DICETET-----
A6LRW9_CLOB8/3-141..SEK----ASI--EGVVITEFL-LAG--------------------------------F-E--SK..KIIEEEF-----

PF06605

A4J7Q0_DESRM/62-404--KTW----DEL--QQR..KTPR-VTY--KLTVIELERLT....GYEHEK---------V-R--LGDTVRVIDRK-----
A5D093_PELTS/222-567--KTW----DAL--QKA..KVPL-VEF--QMDVVDLEQTA....GYSSEK---------V-R--LGDTVTAIDRE-----
A5VJT7_LACRD/39-685--YAE----NTV--QY....NPD-TTL--TIS.............DFTGE---------A-E--LGEVIRLIVPE-----
A5VKI8_LACRD/34-537--YAL----KQF--HP....NPD-MSI--TCTM............MNNER---------P-I--PGDIVHFEIKQ-----
B2TMG9_CLOBB/35-355--LAK----TYF--KENNCDIPS-LNY--NVEFVLLSQTEEFKNILKDEN---------I-E--LFDKVIIRHDL-----
B8I7P6_CLOCE/418-720--FTN----MRL--AEY..SKPR-VSY--VLSAMDLSVLT....GYEHER---------W-S--LGDIVTVDDRD-----
C4Z844_AGARV/33-364--KAE----EWL--KSN..QYET-MTL--EITAVDMSMLN.....ADIDT---------Y-E--VGDVVRTLANP-----
D9SSG9_CLOC7/29-338--DAI----AKL--KEL..SKPV-KAY--SVEIIDLASISD..KYKNILD---------Y-D--LGDVITLISKD-----
F3YBF3_MELPT/27-330--YLK----SQI--QD....YPK-VQY--TVESSTFDQAN....AWQTKK---------Y-Q--VGDY.GFLRDR-----
F9UQU7_LACPL/38-346--YAR----QTV--QA....QPI-ATL--TTT.............AWNVT---------I-K--QCETVKLVMPN-----
G8M053_CLOCD/417-718--YAK----MRL--AEY..SKPR-VSY--VLSAMDLSALT....GYEHEE---------W-K--LGDIVTVDDKE-----
I6T7G9_ENTHA/33-340--RLK----NDL--QD....YPS-ISG--SVTL............KWKIN---------P-Q--KGDYVPFIYEP-----
Q5WE58_BACSK/33-341--EAK----RRA--NG....VPS-YHL--EVEYEELVKNG.....LKLHD---------F-Q--LGDYIWVIHEG-----
Q5WIB8_BACSK/8-317--KLI----SEM--KD....VPD-YSI--TITLAELRKNG.....ALLHP---------F-N--LFDYVWIIYEP-----
Q65ET7_BACLD/226-551--ALK----RHV--NP....YPE-MTV--EADFQKIYEPKL...LEIEQD---------F-W--KGDTIHVLADT-----
Q65KF3_BACLD/29-328--AMK----KQL--ND....NID-ISL--TFTAIELES.......MGLRD---------I-K--KGDYVWCVIEP-----
Q835T2_ENTFA/29-351--NAL----RML--EEW..TKPQ-VSW--VVTAADLIKLTD..QPLAIDR---------L-R--LGTVIMINTNE-----
Q8Y4Z4_LISMO/34-333--RLK----LEL--QD....YPA-TTG--SVIL............KNDYE---------C-E--KGDYVLFIYEP-----
Q8YAK1_LISMO/33-338--FAK----KQI--LD....VPE-TAL--TISY............KGKEP---------V-S--ERDVWYFIHEP-----
Q9K758_BACHD/67-370--RGE----EAL--KVL..ARPR-SSY--VLRAADLSALS....GMSHEE---------F-F--LGDEVLVYDKE-----
Q9KGP3_BACHD/67-375--MAE----EAL--KVL..SQPR-TSY--HIKAADLSEMA....GMSHEQ---------F-F--LGDEVRVYDKE-----
R4K6I2_CLOPA/41-361--AGQ----EYL--DNA..KKAK-IKL--QITALNLSVLN.....LNIDD---------F-V--IGNDYKVINEV-----
V5XMR9_ENTMU/31-336--RLR----NEL--QD....TPN-ISG--VVKL............KWKSP---------I-Q--KGDHVPFIYEP-----
W6S0H7_9CLOT/417-718--YTA----MRL--AEY..CKPT-VSY--VLNAMDLSVLT....GYEHEA---------W-N--LGDYVRVEDKD-----
X5A593_9BACL/39-378--AAR----LRL--AER..EVPA-LEV--NVSAADLFKID.....KDEAR---------P-G--LGDTVTLVDPA-----

PF13550

A1AYP0_PARDP/820-985--RCQ----RAL--QEAWVSRER.ATF--SLPP------------SR.LA---------L-D..PTDVLT.LEHD-----
A1B627_PARDP/791-955--LAE----RWL--SEAAVARDA.VRF--ALPP------------SL.GH---------L-G..PGDVVR.LVEP-----
E0THS4_PARBH/770-933--RAA----SLL--AEAQAATVQ.IRF--ALPA------------HR.LE---------I-E..PADCLE.LVDG-----
A7HRK9_PARL1/775-940--IAD----VWL--QKAWSERER.ATL--SLPP------------SL.IA---------L-D..PGDMVA.LELP-----
A7IK58_XANP2/791-954--AAD----IWL--QDLWAGRET.FTF--SLPP------------SL.RA---------L-T..PGDLVR.LTLD-----
A8LQN2_DINSH/795-960--IVE----RWL--AESRVARET.ARF--ALPP------------SR.SD---------I-K..AGETLQ.LPHG-----
A9CJN3_AGRFC/756-923--AVE----ALL--RDNRQARRS.LRF--ALPP------------SD.IT---------L-E..PGDCIR.LSEG-----
B0SVY2_CAUSK/777-933--VAE----RLL--GTGDGREVT.AHL--S.PL------------AA.LR---------L-E..PGDRLA.LG..-----
B0UJ15_METS4/791-954--LAQ----ALL--YQAVVEREA.VTA--TLPP------------SA.LA---------L-E..VGDVVA.LDLA-----
B1LTZ4_METRJ/785-952--LAE----ALL--DRLIAARDG.AVF--TVSP------------RR.VE---------L-E..PGDLVA.VPAD-----
B6JDQ1_OLICO/759-925--IGQ----RAL--REMWQGREA.VDL--RLPT------------RA.IR---------C-D..PTDIVA.VPID-----
B9JU38_AGRVS/757-919--VVE----TQL--RDHRIGRRS.LTL--SLSP------------SQ.LA---------L-Q..PGDVLT.LP.D-----
Q0AR61_MARMM/759-917--WCG----DRL--LAVHAQAER.LDL--VLPP------------EF.LA---------V-E..VGDRIA.VD..-----
Q28RU9_JANSC/978-1139--MAE----RWL--AEGRVAQDT.LRF--ALPP------------SE.RA---------L-G..AGAVIE.TE..-----
Q3SUI4_NITWN/802-967--IAD----RAL--VEAWIERET.AGF--ALPP------------AR.IA---------L-D..PGDVVD.LVIN-----
C6XID3_HIRBI/772-930--LVS----NLN--QKLVASNKS.AQV--STSL------------SF.AN---------I-E..VGDILH.FTND-----
A8HR63_AZOC5/794-957--AAD----MLL--QDTWAGREE.ARF--TLPP------------SL.RA---------L-Q..PGDVVD.LTCD-----
D9QF99_BRESC/731-889--LAG----RIL--AADGADRLT.LAI--G.PL------------EA.LR---------L-E..PGDTVA.VE..-----
B2JUI8_PARP8/529-699--RAQ----TML--WSAWISRKS.FSF--TTRI------------AY.LP---------F-E..PGDVLT.LQGA-----
D0J488_COMT2/383-550--VVD----ALL--FDMAASMHS.TTL--SVPL------------RY.AY---------L-E..PGDVIEAVALD-----
A9BYF1_DELAS/314-478--KAA----MLH--KVSWSEAEGEVKF--SLPD------------SW.LR---------L-V..PGDCVV.LKPR-----
Q2G3K6_NOVAD/231-396--IAE----RSA--RRLTVPGDT.MRY--RITE------------LD.RT---------F-E..PGAFVK.AQ..-----
Q1GRM1_SPHAL/243-405--LAA----RLA--GAAADGRET.MAL--RADL------------AA.AA---------L-T..VGQVVM.LADG-----
Q2N607_ERYLH/223-386--LSE----KAT--QRARWRRDR.LAW--RLAE------------LD.PA---------I-G..PGSVVR.VP..-----
B8EKU0_METSB/229-420--VAQ----LTL--QRGLYVRNT.FTF--KLSF------------EY.CL---------L-E..PMDLVE.LNDA-----
B2IJD4_BEII9/227-411--CAQ----MIL--QRGLYIRNT.YTF--KLSY------------EY.CL---------L-D..PMDIVT.LTDT-----
Q2WA44_MAGSA/316-506--LSA----QLL--LQRQAARNK.WQG--TVGE------------EH.VL---------L-D..VGDTGF.ISNA-----
C9R735_AGGAD/265-435--LAQ----RDL--EMIASGLTR.LKI--TFDM------------RG.SE---------L-R..PGDVIR.LNLP-----
Q2W6E0_MAGSA/315-503--VSA----QLQ--LQRAAILGT.WAG--SIGS------------EH.VA---------I-E..LGDVGY.ISSV-----
Q2SAL7_HAHCH/191-365--VAM----RDL--TAVSTPLAK.VRL--KVNR------------NG.WR---------L-A..PGDVFI.LTWP-----
A7I049_CAMHC/190-363--VLN----RTM--RKMSYPYAS.VKM--QVSA------------ELFKD---------L-C..VGDVVL.FSNE-----
B2FM10_STRMK/213-385--LAL----RDL--RALGSPLAR.MSL--TVAP------------DT.LE---------E-APLPGDVFL.LNWP-----
E6WEJ9_PANSA/332-495--AGK----WLI--ESCKREYRK.VSF--QMAR------------DA.IA---------F-M..PGDIIE.VADN-----
A6VNR7_ACTSZ/335-501--WGK----WVL--ATSLLEQCT.ITF--AVGR------------QG.LM---------H-L..PGDIIE.IADS-----
Q8XYR0_RALSO/340-503--VGQ----WIL--LTSRLETET.VSF--KVGL------------DA.AV---------V-M..PGAIIE.VADP-----
B2JL07_PARP8/351-514--VGR----WAL--LTERYLSES.VTF--KTGV------------NA.AF---------V-R..PGDVFL.TTDP-----
Q2W829_MAGSA/500-665--EGL----YIA--ANNRYRRRM.VTF--RTEL------------EG.MI---------P-T..YGDLVA.ITHD-----
A5CF56_ORITB/744-904--ICQ----TIL--KNANAENIV.FSF--ILPI------------SY.AY---------L-E..VSDIIT.LIIE-----
B9KI53_ANAMF/694-848--IVD----DLQ--HLTASQNCF.FRI--SLPI------------KY.AS---------L-N..VGDVIS.VEWE-----
C5AYQ3_METEA/784-949--LAE----AVL--DAALAGRDT.AAF--GVSP------------RR.ID---------L-E..PGDVVA.LPDA-----
D5AU04_RHOCB/799-959--IVG----RWL--AEARVARDT.ARF--ALPP------------SR.GH---------L-G..TGDVVR.LDLP-----
G8PN64_PSEUV/767-937--LVD----KMH--QSLWLDRET.LQF--KLAM------------NN.ID---------L-K..PGDIIE.LPGE-----
N0B519_9RHIZ/827-991--LVE----SWL--YETWAARER.ASF--KL