Sequence alignment for CL0509

PF13656

B9PKF9_TOXGO/35-110SQLTFTLTGEDHTLGNTIRSILVRK.PGVEFAGYSV.PH-----------------------------------------
A8NBI2_COPC7/19-86SAATYQLHDESHTIGNSLRWMLMKN.N..........PH-----------------------------------------
C3YRU6_BRAFL/9-84SCQTFVLHDEDHTLGNALRYMIMKN.PDVDFCGYSV.PH-----------------------------------------
C7YQM9_NECH7/57-132TAASFEFVDEGHTLGNALRYIVMKN.PDVEFCAYSI.PH-----------------------------------------
RPAC2_DANRE/21-97GCVTFVLNEEDHTLGNSLRYMIMKS.QDVEFCGYSI.TH-----------------------------------------
Q22RW2_TETTS/59-134TCATYTFYDEDHTLGNTVRYMLVKR.KDVEFCGYTI.PH-----------------------------------------
B8BNJ8_ORYSI/10-85TASTFSIVEEDHTLANSVRFVLNQD.PRVAFCGYSI.PH-----------------------------------------
Q4U9J3_THEAN/9-84PNITFCIENEDHTLGNTLRALLVER.DDVVFAGYSV.PH-----------------------------------------
D3S449_METSF/11-95NLVEIELINEDHSLPNLLKDILLTK.EGVKMASYSI.DH-----------------------------------------
Q7PM95_ANOGA/16-92SSRTFVFEDEGHTLGNVLKSIICKY.PDVNFCGYTV.PH-----------------------------------------
D0N5U8_PHYIT/17-93YSKTYVFHEEDHTLGNAVRYVLMRN.PDVDFCGYTI.PH-----------------------------------------
B2BXR4_9ROSI/10-85SHATFSLTEEDHTLANAVRFVLNQD.PRVTFCGYSI.PH-----------------------------------------
RPAC2_CAEEL/59-135SNLTLIMYEEDHTIGNSIKHILSRM.DEVEFCGYNV.PH-----------------------------------------
D2VMS3_NAEGR/71-148SVSTFIFHKESHTMGNSVRHMLMKN.KKVSFCGYTV.PH-----------------------------------------
B3MNN6_DROAN/16-91GSRTFVFMNEGHTLGNALKTIISRY.PEVDFCGYTI.PH-----------------------------------------
A4RTY9_OSTLU/11-89NEATFTLAGEDHTLANALRHALNGN.ADVALCGYSV.PH-----------------------------------------
A7AT13_BABBO/9-84PNITFSIENEDHTLGNAVRTLLVER.EDVFFAGYSV.PH-----------------------------------------
D2A0K7_TRICA/15-90SCRTFILQGEGHTLGNALRCVISGY.PDVEFCAYTV.PH-----------------------------------------
Q01D46_OSTTA/1918-1996AEATFTLEGEDHTLGNALRYVLNAN.PSVTLCGYSA.PH-----------------------------------------
A8QGH1_BRUMA/24-100SNLTVILYEEDHTIGNSLKHVLCKM.RDVEFCGYNV.PH-----------------------------------------
D3BMK8_POLPA/46-122NACLFTILKEDHTVGNLIRMQLVGD.PDIKFAGYRM.PH-----------------------------------------
RPOL_KORCO/11-87NEIRVLIRGETHTLLSPLVEELNSL.DEVEFAGYDV.PH-----------------------------------------
D0A874_TRYB9/45-119SAATVTFSHEDHTLGNPLRHVIMED.PSVTSAGYAI.PH-----------------------------------------
E2RTX5_GIAIC/30-114NALEFQIPYQDYTIGHILRKELLSM.PQVTFAGMKT.PH-----------------------------------------
B5X6K5_SALSA/29-105NTSDFVLNKEDHTLGNLLAEHLKAH.PNVYMAGYKL.GH-----------------------------------------
Q4DBQ7_TRYCC/45-119STVTIAFSHEDHTLGNPLRHVLMQN.REVTSAGYAI.PH-----------------------------------------
C6LR48_GIAIB/4-79KNATFVIVNEDHTLGNCIRYCLNCN.PDVSFAGYSV.PH-----------------------------------------
RPOL_METAC/11-86NELEVELRGETHTLLNLLKDLLIKD.ERVEAAFYDM.KH-----------------------------------------
B3LBL0_PLAKH/34-109DCNIFTIKLEDHTIGNLIKQALCQD.PQVTFAAYRQ.PH-----------------------------------------
D7DAV2_STAHD/17-93TEIIIEIIGEDDTLGNLIAKEAMKH.PKVVYASYRI.PH-----------------------------------------
A2DKG2_TRIVA/16-92SSGSMLFTGETYTMGNALRQTILQN.PKVNFCGYTV.PH-----------------------------------------
RPOL_THEAC/19-94NSITVEMINYDNTLLRTLVEEILKD.DQVDEARYYI.KH-----------------------------------------
B8D6L1_DESK1/11-87RELVLEIYDEDHTLGNLLAKEAIRH.PGVEYAAYRV.PH-----------------------------------------
Q98SA6_GUITH/28-104NTKEFLFENEDATMGEILVYKLENH.KNVLFCGYKK.LH-----------------------------------------
D1JBI3_9ARCH/16-91TEVKLEIAGEDHTLLVPLTSKLLEN.RQVDIATYTI.KH-----------------------------------------
B5IB51_ACIB4/14-89NEMILEVINADRTLLIPLVEELNKD.EMVEQAIYHY.DH-----------------------------------------
RPOL_HALLT/11-89TELRIEIAGEDHTFMNVLKGVLLET.DDVAAATYDMNPE-----------------------------------------
A8M9E3_CALMQ/14-89DYMEVTVEGEDYTVMSPLLTYILQD.PEVEFATFDM.DH-----------------------------------------
A1RVG9_PYRIL/12-87KYLEVKVRGETYTLFSPLVEYLSND.PDVEYVQFDV.DH-----------------------------------------
B8GF45_METPE/11-86DKARLLIAGEGNTFMNALTEEILTD.PEVDVARYRI.KY-----------------------------------------
Q8SS03_ENCCU/17-93NTIELRIEDETHTLGNLLSEELLED.KRCLFSAYRV.EH-----------------------------------------
D2EFV6_9EURY/12-87SSIKFRVQGGTQSVLNLIKEEADSF.DNVTFAGFVM.EH-----------------------------------------
RPOL_PICTO/14-89NSITVEMINYDNTLLRPLVEEISRD.DSVDEIHYYI.KH-----------------------------------------
D1JHV8_9ARCH/33-108NELRLEIEGEGNTLLAPLTSKLLEN.ENVDLATNSM.TH-----------------------------------------
B1YD94_THENV/12-87KYLELKVKGETYTLFSPLVEYLSSD.PDVEYIQFDV.DH-----------------------------------------
C7DHU9_9EURY/17-92KELQIEFEDGDITIPDLIVNAVIND.KDVEFAGVEK.DH-----------------------------------------
RPOL_AERPE/12-88GSYVIQVYGEDHTLGTLLVEAIKRV.SNPKLAYYEA.VH-----------------------------------------
A9A3V3_NITMS/11-85KEINLSITETDIGILYLIQHELLKE.SNIDFAGVIV.KH-----------------------------------------
A0RXH5_CENSY/11-86KEANLSIRESDIGILYIVQHELLKK.SGIEFAGVIL.KH-----------------------------------------
C4V9M5_NOSCE/13-89NTIELKVEKETHSLGSSLSDKLCKD.KRCIFSSYKV.CH-----------------------------------------
RPB3_ASFK5/277-354TKAIITIKDETHTIGNLLKTCIYEMIPDISFVGYQCIPH-----------------------------------------
A3CXJ1_METMJ/11-86DKARILFEGEGNTYIDALATELIRD.PQVDVAQRKQ.AF-----------------------------------------
B3TAR1_9ARCH/50-123KEANLTILGGDIGVMYIIQDEILKS.SSTQFAGVIA.RH-----------------------------------------

PF01193

RPOA_BORBU/32-240--IYPFERGFGITIGNTLRRVLLSSIEGYAITAMRV-QSNNKDSSSKVVSSEFDLIPGVSEDTLEIIANIKNIHLKLGEG
B9PKF9_TOXGO/37-104--LTFTLTGEDHTLGNTIRSILVRK.PGVEFAG...-...........................................
A8NBI2_COPC7/21-80--ATYQLHDESHTIGNSLRWMLMKN.NPHPSEN...-...........................................
Q4U9J3_THEAN/11-78--ITFCIENEDHTLGNTLRALLVER.DDVVFAGYSV-PH.........................................
A0D420_PARTE/43-311--IVFEIINIDAPIANSLRRIMIAEIPTMAIHKVQV-IQNTSVIPDEVLAHRLGLIPIIADPLQFIEKDDQEEYNELNSI
RPOA_SPIMX/36-226--ASPLLAGQATTLGVAIRRTLLESIQGTAIVAAKI-YGAAHEYSTLEGIQESIHDILLNLKQVIIKNKICEFQKCLISI
RPOA_CHAVU/31-225--IAPLKKGQANTLGITLRRTLLSDLDGICITSVKI-DNIKHEYCTLTGVRESIQDILLNLKEIVFKGVCDKTQKGFIFV
Q6J225_9STRA/27-223--IDSLSSGQGITIGNLLRRVLLGDLKGTAITGVRI-AGVKDEFSLIPGVREDILEILLNLKGIVLKSKNSTRQFARLRL
E2RTY7_GIAIC/15-297--LELEISGVDISYVNGLRRAIYADVPTLAIDIVKF-LDNSTTLTEEFIAHRLGLIPLRTAGSLSAISYWYTCDEEHSTE
Q98S79_GUITH/62-321--CKINLKGISSLIINSIRRTIMADVKTLSIEKVYI-YKNSTVFGDEIISHRLGLVPIFISTELLRIYENRAKNDPNIII
A9A5C5_NITMS/23-210--IALKLKGVPLQYANALRRVCLNGVPVFAVDTVDI-IENSSVLPDEGLAHRLGLIPLKTDLSRFNEPSKCECQSETGCS
RPOD_METS3/13-263--IVFIVRDAEVPFINAIRRCAMVNVPKIAIEDVNI-MRNDSAMFNEVLAHRLGLTPLVSNMDAIEGLPLPGDDDYEENN
A2ER03_TRIVA/46-329--LVFDLTNAPASHANALRRTLLASVPSIAIELVGM-LDNTGVMPDEVLCHRLGLIPINADPSLLDYPKQKIEDKSSDPN
A5K332_PLAVS/442-665--IGPLNITDGHTFGTLLKYVCQTQLYGYAIVAIKI-HNMNEDTRIDNVQEDLLEIALNLSDVCIYSKEVNIETNIRLIF
RPOA_AZOSB/26-225--MEPFERGFGHTLGNALRRILLSSLPGHAPTEVSI-EGVLHEYSTLDGMREDIVDLLLNLKGVVLKLHNRSEAMLTLSK
A3DMQ6_STAMF/13-267--LRLYIKDIPLHVLNSIRRAIIAEVPTMAIDSVVF-TMNSSVFYDEYIAHRLGLIPLTSEAALDKYKSPEECREAGDRG
Q2FNB5_METHJ/13-80--VRISLAGQGHTFMNALKTEILTD.PTVDVANYVI-E..........................................
RPOA_BIGNA/25-238--IGPFLKNQAFLYSNVLRRVLLSDSSNIVITAVNI-VGAKHEYSLLPGVRESSLDLLLNLKELVFVKDIYTKFNKSYFA
A1CD73_ASPCL/67-135--AIFTFNKEDHTLGNLLRSRLLQS.PHVLFAGYKI-PH.........................................
Q1ZJF9_PHOAS/28-229--LEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DGVLHEYSTKEGVQEDILEILLNLKGLAVKVEGKDEVILTLNK
A7SGE2_NEMVE/31-99--AHFVVNKEDHTLGNLLREQLLKD.PQVIFAGYKV-SH.........................................
D3S449_METSF/13-89--VEIELINEDHSLPNLLKDILLTK.EGVKMASYSI-DHPLLH.....................................
A4RTY9_OSTLU/13-83--ATFTLAGEDHTLANALRHALNGN.ADVALCGYSV-PH.........................................
A4EA86_9ACTN/23-221--VEPLERGYGDTLGNSLRRVLLSSLEGAAVEAIQI-DGAQHEFMTIPNMVEDVTDIVLNVKGLVFRALGTTDEATATIS
RPOA_MYCMO/26-240--VQPLEKGLATTLGTAIRRVLLSSISSVAPFAVKI-KGVEHEFMAINKVTEDVPQILLRLRDIKIAYNPEIFEDGKIYK
A8A8W5_IGNH4/13-272--IRLLAKGYPLAVLNAIRRAALELAPKMAVDFIAV-DRNDSTLFNEVLAHRLAMIPLRSEEALERYAPPEACMECTPEE
A8B9C8_GIAIC/43-336--FSFDVINLSPVIANTIRRIILDEVPTMAIDTVVV-HENSSIIADEIFSHRLGLVPMNIDPRLFEYHEDGDKIHERNTV
RPAC2_CAEBR/62-130--LTLILYEEDHTIGNSIKHILSRM.DEVEFCGYNV-PH.........................................
CNJC_TETTH/16-291--CEFTLENCDISLANSLRRILLAEIETIAIHNVKV-YENTSSLPDEYIAHRLGLIPLNSAKVDDYNYIWNCNCQGECDR
C6LR48_GIAIB/6-73--ATFVIVNEDHTLGNCIRYCLNCN.PDVSFAGYSV-PH.........................................
RPOA_STIHE/40-484--IGPLEVGQGITLANALRRALLSELNGLAITTVEI-EGVSHEYSTLMGVRESVLDILLNLKQIVLKSKKSVKRAQTAYI
D2A0K7_TRICA/17-84--RTFILQGEGHTLGNALRCVISGY.PDVEFCAYTV-PH.........................................
Q8SS03_ENCCU/19-87--IELRIEDETHTLGNLLSEELLED.KRCLFSAYRV-EH.........................................
B8BNJ8_ORYSI/12-79--STFSIVEEDHTLANSVRFVLNQD.PRVAFCGYSI-PH.........................................
RPOL_HALWD/13-86--LRIEVAGEDHTFMNVIKGALLQT.DGVAAATYDV-NPE........................................
A4I451_LEIIN/19-288--LTFQLSEVDSSFANALRRVMLAEIPTLAIEYVTI-RQNTSVLPDEMIAHRLGLVPLFSEKAKRLNFPQDCGCGGSGCP
A8MDY7_CALMQ/17-259--LKFVVEGVKPSLINSLRRILITDVPVLAIDRVIV-LDNTTVMYDEVLAHRLSMIPLKTNLEKLPKIEECEDELVDPSL
D2VMS3_NAEGR/73-142--STFIFHKESHTMGNSVRHMLMKN.KKVSFCGYTV-PH.........................................
RPB11_SCHPO/30-98--AVVTLEKEDHTLANMLANQLLSD.ERVLFAGYKV-PH.........................................
RPOD_SULSO/13-254--IDLVFEGYPLEFVNAIRRASMLYVPIMAVDDVYF-IENNSPLYDEILAHRLALIPFMSEEALDTYRWPEECIECTENC
Q0YR47_9CHLB/27-225--AQPLERGYGVTLGNVMRRVLLASLPGTAITGLKI-DGVFHEFAAVDGVREDVPEIVLNLKRVRFKSTCKRNCKTTLAI
RPOL_KORCO/13-81--IRVLIRGETHTLLSPLVEELNSL.DEVEFAGYDV-PH.........................................
RPOL_METBF/13-80--LEVKLKGETHTLLNILKDLLIKD.QRVEIAFYDM-KY.........................................
Q26D46_FLABB/26-226--FRPLEPGYGLTVGNALRRVLLSSLEGFAITSIRI-EGVDHEFSTIEGVVEDVTEIILNFKQIRFRRQIDEVDSEVVNV
B3LBL0_PLAKH/36-103--NIFTIKLEDHTIGNLIKQALCQD.PQVTFAAYRQ-PH.........................................
Q014V0_OSTTA/83-376--VVFEMEGCSAAFANAFRRIIISEVPTMAIEKVYM-INNTSVVPDEVFAHRLGLVPIKADPARFEYRGPNDLANETNTI
RPAC2_DROME/18-85--RTFVFTNEGHTLGNALKTIIARY.PEVDFCGYTI-PH.........................................
RPOL_THEAC/21-88--ITVEMINYDNTLLRTLVEEILKD.DQVDEARYYI-KH.........................................
RPOA_RICB8/33-231--VEPLERGFGLTLGNAMRRVLLSSLQGAAVTSIKI-PGIEHEFSSIPGVKEDISEIILNVKGIEIKMHVAEKRVIRLKA
RPOA1_FRATF/29-222--LSPVEKGMAHILGNSIRRVLLSSLSGASIIKVNI-ANVLHEYSTLEDVKEDVVEIVSNLKKVAIKLDTGIDRLDLELS
RPOA_NEOSM/34-233--VEPLRVGFGLTIGNAMRRVLLSSLSGFAISAVGI-KGLTHEFSCIPGVREDFADLALNLKKVVLKSISGATCGNLHLS
Q9UAY9_CAEEL/68-355--LEFDITRIEAPIANALRRVLIAEVPTMALEKIYL-YQNTSVIQDEVLCHRLGLLPLRVDPRGFQFPKEKVVGINEKGV
Q16XU4_AEDAE/19-258--VKFVVEDTDLSVTNSLRRVFIAETPTLAIDWVQL-ESNTTVLADEFLAHRVGLIPLISDEVVERMQYSRDCTCLDFCT
Q2FTA0_METHJ/13-261--ASFVLSDAPIAFANALRRAMVSEVMTFAIEDVKI-YDNTSALFDEILTHRLGLIPLVTDPDSFVPRSQCSCNGAGCPR
Q4N473_THEPA/45-294--SVVEIVGLDVSLANALRRILISEVPTLAVETVQI-YQNTGVIQDELLAHRLGLIPFAIDPDLFNFKSNFKTNCEEIND
RPOL_ARCFU/13-80--VRLVIKGEGHTYLNLLQHYLVED.EDVIVARYNI-PH.........................................
RPOD_PICTO/12-263--IKFSISGITPAIANSIRRTLINDIPKLAIENVVF-HHGEIRDSEGNVYDSSLPLFDEVVALRLGLIPLKTDLKMNFRD
RPAC2_DANRE/23-91--VTFVLNEEDHTLGNSLRYMIMKS.QDVEFCGYSI-TH.........................................
RPOA_EUGMY/25-202--EKNLIKLELLSFSNLIRRILLKEIYNFKVSTISI-FLFNSNKFCYKIHEFTKVEEVKNNLVSFLILLKEIKFRSYYKL
C7DHU9_9EURY/19-86--LQIEFEDGDITIPDLIVNAVIND.KDVEFAGVEK-DH.........................................
Q6Z5L9_ORYSJ/82-293--MEFDMIGIDASIANAFRRILIAELPTMAIEKVLM-VDNTSVIADEVLSHRLGLIPLDADPRHFEYMSENDVPNERNTI
A2BNA1_HYPBU/17-85--IEVELEGEDQTIANLIAKYAIRK.PGVVYASYII-SH.........................................
RPOA_THEP1/28-228--LSPLERGYAITIGNALRRVLLSSIPSLAIVGVRF-IKPEKYHEYDYIEGVKEDILDIILNLKKVQFRVNVTVKGTIKM
RPOL_NANEQ/18-86--IKVQFKGETHTLFNALKEIAYTI.NGVKKAAYFI-EH.........................................
Q98SA6_GUITH/30-98--KEFLFENEDATMGEILVYKLENH.KNVLFCGYKK-LH.........................................
A3FPR0_CRYPI/30-98--GSFMIMLEDHTLGNLITTQLLRD.PNVIFAGYKV-PH.........................................
A8QGH1_BRUMA/26-94--LTVILYEEDHTIGNSLKHVLCKM.RDVEFCGYNV-PH.........................................
RPAC1_YEAST/52-326--ANFDLINIDTSIANAFRRIMISEVPSVAAEYVYF-FNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTD
A3CXJ1_METMJ/13-80--ARILFEGEGNTYIDALATELIRD.PQVDVAQRKQ-A..........................................
Q2GXS9_CHAGB/5-73--SDFLMLKEDHTLGNLLSVYLKMA.PHVMMAAYKI-GH.........................................
RPOA_MYCSP/26-239--IEPLARGYANTMGTVLRRTLLSSITSVAPFAIKI-NNVEHEFQTISGLKEDAITLVRNIRNIRFVYNEEIFEKENLAK
RPOA_ARCB4/28-224--AYPFEDGFAITLAHPLRRLLLSSSVGCAPIAVKI-EGASHEFDSLRGMLEDVAIFVINLKNIKFKINGDKEQVVVEYS
A3ZKW4_9PLAN/30-227--AEPFERGFGVTIGNSLRRILLSSLEGAAVTQIKV-RGAQHEFTSIPGVVEDMTEIVLNTKAIVVKKHSEMTKVVTIEK
D1N9H1_9BACT/29-225--AAPFQSGFGHTLGNSLRRVLLSSLEGAAICSVRI-DGAKHEFDSLDNVVEDVTEIVLNLKCVRLNLHAEGPKTLEIRK
RPOA_DEHE1/23-219--VEPLEKGFGTTMGNSLRRILLSYLDGVAITRVRI-DGIQHEFSALPKAKEDTLDFLLNLKNIRVESLSGLEGILYLKA
Q42483_ARATH/12-79--ASFTLSEEDHTLANAVRFVLNQD.PRVTVAAYTI-PH.........................................
RPOA_VESOH/28-226--LEPLERGFGHTLGNAIRRTLLSSMTGFAVTEVVI-DGVMHEFSTIDGVQEDVLDILLNLKEVSVVLNTVETAQVVIDK
RPOA_DEIRA/21-217--LEPLARGYGVTIGNPIRRILMSSIPGTAVTSVYI-EDVLHEFSTIPGVREDVIRLILNLKELVVKFHAPGPKTLTLRA
RPOD_PYRKO/14-248--IKFIVSGVDVPFANALRRTILSEVPTFAVDEVEF-LENDSALFDEIIAHRLAMIPLTTPHERFSLDALELDDYTVTLS
Q4N0T0_THEPA/38-105--GTFIVHLEDHTFGSLIRSKLSKD.DRVTFVGYRM-PH.........................................
Q6XYW3_SPIKU/25-227--VEPLERGFGVTLGNAIRRTLLSATPGAAVFAVRI-KGSSHEFTAIPGVVEHVTKIILNIKNLVLKINQDIIPDGESVI
RPOA_MYCTU/23-220--IEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRI-DGVLHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRK
Q6C2S4_YARLI/11-249--RRKLPVCLGITLANSLRRVMLAEIPTLAIDLVEI-STNTSVLADEFISHRLGLIPLDSQDVNDLEYSRDCVCDEYCDK
A2YIL5_ORYSI/46-114--GSFTIEREDHTIGNILRMQLHRD.PNVLFAGYKL-PH.........................................
D3BMK8_POLPA/48-116--CLFTILKEDHTVGNLIRMQLVGD.PDIKFAGYRM-PH.........................................
D1JHV8_9ARCH/35-102--LRLEIEGEGNTLLAPLTSKLLEN.ENVDLATNSM-TH.........................................
Q2NE51_METST/11-76--LVLEITGESHTICNILRKRLMDY.DEVDAAAYDI-TH.........................................
E2RTX5_GIAIC/32-108--LEFQIPYQDYTIGHILRKELLSM.PQVTFAGMKT-PH.........................................
Q7PM95_ANOGA/18-86--RTFVFEDEGHTLGNVLKSIICKY.PDVNFCGYTV-PH.........................................
C7YQM9_NECH7/59-126--ASFEFVDEGHTLGNALRYIVMKN.PDVEFCAYSI-PH.........................................
RPOL_UNCMA/13-81--IQVEIKGESHTMMNALKSCLLED.KAVKVATYDI-EF.........................................
B3TAR1_9ARCH/52-117--ANLTILGGDIGVMYIIQDEILKS.SSTQFAGVIA-RH.........................................
Q4DBQ7_TRYCC/47-113--VTIAFSHEDHTLGNPLRHVLMQN.REVTSAGYAI-PH.........................................
RPOA_EUGST/26-212--LQDFSNCDRVAWGNLLRRTLLKDLEGLRFGNSSI-FISRSFSKIPYYHRVNEYSDIEQVNPSLLQVFSNFRNLHIFSS
RPOL_PICTO/16-83--ITVEMINYDNTLLRPLVEEISRD.DSVDEIHYYI-KH.........................................
A3ZCU7_CAMJU/28-225--AWPFEIGYGITLAHPLRRLLYTSTIGYAPTAIHI-DGVAHEFDSMRGMLEDVALFIINLKKLRFKIKGESNKEIVEFS
RPOA_CHLVU/28-268--IGTFFRGQALTFGNSIRRALLSEMPGFLMTDVRI-QGATHEFAVLPDVEETVLEILLNLKKTVFVPRIPKNQKFETFQ
RPOA_CYAME/31-227--LQPLSYTQALTMGNSLRRVLLSELESISITAVRI-AGASHELATLKGVREDVLQIMLNLKQIVWRGQLKKQPTITRLK
RPOA_CHLAT/30-226--IAPLEIGQGITVGNVFRRVLLGDLEGACITSVQI-PGVNHEFSTIHGVREAVLDILLNLKEIVLKTQSQETQRGHLSV
A4KQH4_FRATU/26-221--FEALERGVGYTLGFALKQTMLYSIAGACVTSIKI-NDGKVTSLEDVIPCDETVADIILNVKSLSVTLAEDVETGTITF
B8D6L1_DESK1/13-81--LVLEIYDEDHTLGNLLAKEAIRH.PGVEYAAYRV-PH.........................................
A3CWH9_METMJ/13-261--AKFTLSGVSMSFANMLRRAMISEVPTLAIEDVRI-YDNTSVLFDEMLAHRLGLIPLRTDLKRYKPRSECTCEDAGCPV
A2DKG2_TRIVA/18-86--GSMLFTGETYTMGNALRQTILQN.PKVNFCGYTV-PH.........................................
Q5CJZ9_CRYHO/67-332--INFDISGIDASIANALRRILLVEIPTVAIETVQI-YQNNGVIQDEVLAHRLGLIPMLIDPNTIEFRNEDEDLNEKNSV
RPB3_DICDI/24-291--IIFILSNTDISVANALRRVMIAEVPTMCIDLVEF-ESNNSVLCDEFIAHRLGLIPLVSDNIDKFCYTRDCSCSDRCDQ
A5IYV9_MYCAP/28-244--LKPLERGFANTVAVALRRVLLSNITSLALFAIKI-SGVSHEFQTIPGIVEDVTAIIMNLRKVKFKYNPEFVKDGEIIK
Q5KIG6_CRYNJ/59-333--IEFDLVGVDASIANALRRTLIAEVPTVAIEEVYV-WNNTSIMQDEVLCHRVGLVPLKIDPRSLRYRPSANSQPHEHDT
RPOA_LEGPC/28-231--LEPLERGFGHTLGNALRRILLSSMPGSAITEASI-DGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
A5UMY3_METS3/18-86--LEFIVHGESHGVCNALRHILMQD.SDVEYAVYNI-DH.........................................
RPOA_MYCGA/25-233--VKPLEKGFGITLGNALRRVMLSHLPGSSVFALKI-KGISHEFGFIPGVKEDVTQIILNIKNLVVWISDNMITDETLSE
Q0UL31_PHANO/22-263--ANFIVQNFNLETANSLRRVMLAEIPTLAIDVVEV-LDNTSVLADEFVCHRLGLIPLSSRGVDDLLYARDCDCEGYCDN
RPOA_LEPBJ/32-232--AEPFERGFATTIGNSLRRTLMSSIEGAAISAIRI-EGVNHEFSFIEGVAEDVTRIILNLKQVRIKYEPEEKDQSKIIH
Q4C148_CROWT/25-222--LEPLERGQGTTVGNSLRRVLLANLEGAAVTAIRI-GGVNHEFATIPGVREDVLEIMLNMKEIVLKSYTEQPQIGRLVA
A8AA05_IGNH4/21-88--VRIRIPNESHTLGNLITKLASRK.KGVT.ALYMV-EH.........................................
Q0EW63_9PROT/24-221--FEPLERGYGTTIGNSLRRMLLSSLPGAAVTSVLM-DGVAHEYDSIKGVREDVMDIILSLKELDLRMEGDEAATISLEI
RPOL_METBU/13-80--MKMEIAGESHTLLNMLKIILLED.ERVHTASYDM-KH.........................................
A1RVG9_PYRIL/14-81--LEVKVRGETYTLFSPLVEYLSND.PDVEYVQFDV-DH.........................................
Q01D46_OSTTA/1920-1990--ATFTLEGEDHTLGNALRYVLNAN.PSVTLCGYSA-PH.........................................
RPOA_CYACA/29-224--IEPLSYGQAITVGNALRRVLLSDVPGVTIVSVRI-AGINHEFSTVKGVKEDVLEILLNLKNIVLKGNVLKNQIGRLKV
A0DID7_PARTE/24-293--CKFSFEG.DLSIANAIRRVMIAEVPVMAIHFVDI-IENTSPLSDEFLAQRLGLIPLVSYAADSKMYDWEADADSIDDQ
D0A874_TRYB9/47-113--ATVTFSHEDHTLGNPLRHVIMED.PSVTSAGYAI-PH.........................................
RPB11_DICDI/31-99--SMFTILKEDHTIGNLIRMQLIAD.QDIIFAGYRM-PH.........................................
A0E1A2_PARTE/42-109--GTFVFFDEDHTLGNSLRYILANQ.PNVEFCGYSL-PH.........................................
A1RWW0_THEPD/9-261--LVFMLRNTTPAFANALRRALISEVPILAIDEVIV-TENTSALWDEMIAHRLALVPLKIDPETYDALRDLYEQGKDPQV
RPOD_ARCFU/15-254--IKFILKNASPALANSFRRAMKAEVPAMAVDYVDI-YLNSSYFYDEVIAHRLAMLPIKTYLDRFNMQSECSCGGEGCPN
D1JBI3_9ARCH/18-85--VKLEIAGEDHTLLVPLTSKLLEN.RQVDIATYTI-KH.........................................
RPAC1_DICDI/71-334--LVFEMIGIDAPIANALRRIMISEIPTMAIEKVYI-INNTSILQDEVLAHRLGMIPIKVDPRKFNFKLPNKEYTAEDTL
RPOA_NEPOL/23-295--VLPLPAGQGITLGNALRRILLGDLVGFAATSANL-AGASHEFDTLPGIRESVLEILLNIKQLVFKQISSRPKDTNRFA
RPOD_PYRIL/14-244--LKAVIEGAYPSLVNSIRRVIISELPVMAIDYVVI-VSNTSVMYDEMLAHRLGLVPLTTPLQALPPIEDCETGLVDPSE
A2SSW1_METLZ/17-86--IRVTLEGEGHTIVNALVDEILAD.PEVDVAKYVI-K..........................................
RPOA_EHRRG/61-264--IEPLESGFALTLGNALRRVMMSSLRGFAVYGVEI-ENVLHEFTSISGVREDVTDILLNISMIRLKLSGMDNKVLSLKV
RPOD_AERPE/19-272--VRLRIRGYPVVFVNAIRRTVLSDVPTMAVDYAYI-FDNTTAVYDEMVAHRLGLVVLDSNEAVEKYRRPEECAGKEPSE
RPOA_WOLTR/37-242--LEPLESGFALTLGNALRRVMLSSLIGSAVYGIKI-DGITHEFTSIQGVREDVTDIVLNMGMLRCKLNGTSNKCLSLSA
RPOA_STAPU/34-234--LSPLLVDQAMTIGVAIRRALLSEVEGISIISANI-VGAVHEYSTLDGVRESVDEILLNLKQIVIKGAKGASITPLDHK
A3LQW8_PICST/31-99--ASFQILEEDHTLGNALRYMIMKN.PEVEFCGYSI-PH.........................................
RPOA_AYWBP/26-223--IKPLERGYGITVGNALRRVLLSSLPGAAIVNVKI-QGVEQEFTTIPGVYEDVMTIILNLKKIVFAVDDESDDFEEKLE
RPOA_OLTVI/25-374--LGPFDLGQGLTVGNAFRRTLLSELSGVGITLIEI-DGVCHEYSTLPGVRESVLDILLNLKQLVLTSDTTFTVPQVGYL
RPOL_METKA/18-97--VLLELPGEDHTLCNLLRWALNRQ.DGIIATYRIE-HPILGKE....................................
RPB3_ASFM2/279-348--AIITIKDETHTIGNLLKTCIYEMIPDISFVGYQC-V..........................................
A7SL38_NEMVE/58-330--MEFDMIGIDASVANAFRRILLAEVPTMAIEKVFL-YNNTSIIQDEVLAHRLGLIPIHADPRLFNYKKQGDEEAQDDTT
Q4DRD4_TRYCC/103-370--MTFDVERISPPIANMFRRLMMTEVPVLAFDRMLI-EENDSVVPDELLAHRIGLVPIAGPVLKMQFVTESNQVGFDALD
Q8LD68_ARATH/86-370--MEFDMIGIDAAFANAFRRILIAEVPSMAIEKVFI-AYNTSVIIDEVLAHRMGLIPIAADPRLFEYLSEHDQANEKNTI
A7AT13_BABBO/11-78--ITFSIENEDHTLGNAVRTLLVER.EDVFFAGYSV-PH.........................................
B8GF45_METPE/13-80--ARLLIAGEGNTFMNALTEEILTD.PEVDVARYRI-K..........................................
RPOA_DESVH/40-237--CEPLERGYATTIGNAMRRVLLSSLQGAAFVAVKI-SGVQHEFTTIPGVLEDVTDVVLNLKQVRLAMDTEEPQYLELKV
A6DLN7_9BACT/30-227--AEPFEKGFGHTLGNGLRRVLLHSLEGVAVTWIKI-DGVLHEYAQAADVVEDVTEIVLNFKNVRFTAEGDLPRKLELRA
Q4DI42_TRYCC/41-115--SLFKLDKEDHTLANLLRMKLHED.ALVHIAGYRV-PH.........................................
A1RX43_THEPD/24-91--LELRIRGEGHTLLNLLVDELNRI.PDVE.ATYRV-DH.........................................
A3DM82_STAMF/13-81--IIIEIIGEDDTLGNLIAKEAMKH.PKVVYASYRI-PH.........................................
Q4UFZ3_THEAN/22-315--MDFILLNSDVSTANAIRRVILSEIPSLAIEIVTV-LENTSVLHDEYISHRLGLLPIDSTLASEFEFRDRCQCTDKCAK
Q9AW23_GUITH/11-287--IKINFNNFPIVYANSIRRIMMNEIPTLAIDKVYI-EKNTSSFKDEFIAHRLGLIPIFSENADLIKYSRECDCENECEK
RPOA_MYCS5/28-245--IKGLERGFGNTLAVALRRILLSNITGIAPFCVRI-EGVEHEFTALEKVSEDIVTILSNLKKVVLNYDEDYVKDNQIIK
D0N5U8_PHYIT/19-87--KTYVFHEEDHTLGNAVRYVLMRN.PDVDFCGYTI-PH.........................................
Q96HT3_HUMAN/53-326--LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLV-YNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDT
Q8SSL9_ENCCU/42-293--LEFDLINVDCSIANALRRILSSEVPTMAVRDIFL-KENESVFPDEFIAHRLGLVPLEVDPEMFEFAGEELDERNSLRF
RPOA_RECAM/26-219--IGPLEKNFSGSFANLLRKIIFRYTSGVSIIGLKI-NGIDSLHSYSLIPGVKEDVLNVLNNLKHLLIQIDDYDYKPILL
RPOL_SULSO/13-81--LELEIEGEDHTLGNLIAGTLRRI.SGVSFASYYQ-PH.........................................
RPOA_SCEOB/29-330--LGPFKNSQSLTVANALRRTLLAELSNIAITHLEI-EGVTHEYSTLVGVRESVLDLLLNFKGIALKNTSPVTKPLFGYL
RPOA_MYCPU/26-240--IEPLERGFGSTIGTALRRTLLSSITSVVPFAIKI-KDVDQEFDTISDIVEDVQMIMLNVKNIHLVYDENIFEDNKIYR
RPOA_ROSDO/31-228--AEPLERGFGLTMGNALRRVLMSSLQGAAITSVQI-DNVLHEFSSVAGVREDVTDIILNLKGVSIRMEVEGPKRLSISA
RPOA_OSTTA/27-253--FGPVNPGQGLTIGNTLRRILLNDLPGIGVIGAEI-NGVQSEFSTLPGIRESVIEIFLNLRELIFTPTATCAQKVKQTK
D2EFV6_9EURY/14-81--IKFRVQGGTQSVLNLIKEEADSF.DNVTFAGFVM-EH.........................................
A6BM49_BRANA/34-230--LSPLLKGQANTIAIAIRRTLLGEVEGTSITYAKI-EKTTVHDYSTMSGIKESVHDILLNLKEIVLKSELYGIHKASIC
RPOA_CHLRE/40-320--LGPFDESLSQTLANDLRRTLLSELTGLAITSIEI-EGVLHKFSTLTGMKEPVLDLICNLQNIVLRKETISSTNMNYRA
Q48981_MYCCA/25-228--VSPLERGFGITLGNAIRRTLLAATPGASVYAIKI-AGATHEFTSIPGIIENVTKIILNIKQLVLRIDTSIYSDDEVVQ
RPOL_AERPE/14-82--YVIQVYGEDHTLGTLLVEAIKRV.SNPKLAYYEA-VH.........................................
Q7RLX3_PLAYO/25-300--MEFTLYNSNSALANALRRIMLSEVPTLAIDIVNV-YENTSPFHDEFIAHRIGLIPIDSRNIKNYEFRERCKCKETCSR
A2F4R6_TRIVA/25-309--IEFRLMNVSRHFANALRRVMIAEVPTLAVDTVEF-FQNTSPLPDEYIAHRLALIPFVSEDADKFFYHSQCNCDGSQLG
A9A3V3_NITMS/13-79--INLSITETDIGILYLIQHELLKE.SNIDFAGVIV-KH.........................................
B1YD94_THENV/14-81--LELKVKGETYTLFSPLVEYLSSD.PDVEYIQFDV-DH.........................................
A7AQ72_BABBO/46-305--AIAEIEGLNVAIANAIRRILLAEVPTLAIESVHI-YQNTGVIQDEVLAHRLGLVPFDCNPDLIPYRDNEDLSDKNSVC
RPOL_METTP/13-80--LRIEFEGERHTLLNLLRSELLED.ERVVIATYDA-KF.........................................
RPOA_MYCH7/26-238--IKPLERGLGNTLGNALRRTVLSSIPSCAVFGVKI-EGIKHEFTVLDDVIEDVVTILNNLKRVRFFYNPSVFSQNSIHV
RPOA_ZYGCR/31-224--VYPLFPGQAITIGTAIRRALLGEVHSTCITSAYV-VGASHEYSTLKGIRESIHDILLNLKDIVFKSDTLERQEGILLF
C4V9M5_NOSCE/15-83--IELKVEKETHSLGSSLSDKLCKD.KRCIFSSYKV-CH.........................................
RPOA_CHLAB/39-253--AEPLERGMGHTLGNALRRALLIGLEAPAIISFSM-TGVLHEYMAINGIIEDVTNIILNLKGALLKKYPFQDSENGRCT
RPOA_BDEBA/34-230--IRPLERGFGVTLGNSLRRILLSSMMGSAITAVKF-EGVLHEFTTIPDVLEDVTDIILNLKEVRFKQYTADSLTLKISK
Q2UF63_ASPOR/24-263--VDFKLSSVDLAFANSLRRAMLAEVPTIAIDLVEV-EKNTSVLPDEFLAHRLGLIPLNSKNCDQDVEYTRDCECEDHCA
RPOA_CHAGL/34-227--ISPLWKGQANTIGLALRRTLLSEVEGTCITSVKI-KNAIHEYSSLSGVQESVHDILINLKKIILSSSFSGIFEGFLSV
C3YRU6_BRAFL/11-78--QTFVLHDEDHTLGNALRYMIMKN.PDVDFCGYSV-PH.........................................
RPOD_METKA/19-262--ATFIIEETSAEFVNTIRRALYTLVPTLRIEEVII-YENDTPMYDEMLAHRLGLIPLRVDDIDQFELPDLCDCGGKGCE
RPOA_HELPY/28-232--LAPFEFGYAVTLAHPIRRLLLLSSVGYAPVGLKI-EGVHHEFDSLRGVTEDVSLFIMNLKNIRFIAKALVGQDSSLEN
RPOA_AQUAE/25-223--VEPLERGFGTTVGNSLRRVLLSSISGTAITAVKI-YGIYHEFSAIEGVQEDAIELIANLKKIKFLMKGDSDVEILYLQ
Q12ZR3_METBU/13-258--AKFILSNTTAAFANGVRRAMLADVPTLAIDDVNI-YNNTSVLYDEQLALRLGLIPLTTSFDDFVPQDKCTCDGAGCPA
Q8SRR5_ENCCU/14-230--IRFTLSNTTVGYANALRRILISEVPTIAIDMVEI-ERNNTVLPDEVLAHRLGLIPIYSKRELKYKEECSCSGFCSECS
B5X6K5_SALSA/31-99--SDFVLNKEDHTLGNLLAEHLKAH.PNVYMAGYKL-GH.........................................
RPOA_MYCGE/28-238--VAPLESGFGITIGNAMRRVLLSCIPGASVFAIAI-SGVKQEFSNVEGVLEDVTEMVLNFKQLVVRISDLLFEDGEMIE
A8M9E3_CALMQ/16-83--MEVTVEGEDYTVMSPLLTYILQD.PEVEFATFDM-DH.........................................
A9BFZ0_PETMO/28-233--LFPLEKGYAITLGNALRRVLLSSIPSLAITGLRI-PGKLHEYDTVEGIKEDIIEITLNLKKVQLKVDDIEKINEIDYP
RPOA_TREDE/32-239--ASPFETGFGTTIGNCLRRILLSSIQGYAISAVLI-TSHDADGVPHTISSEFENIPNVSEDTLEILNKLKQIRLRLSDE
A7VR24_9CLOT/25-224--VEPLERGFGTTLGNSLRRVLLSSLPGVAVTSIKI-DGVLHEFSTIPGVKEDVTEIVLNMKGLTAKLHCDGAKTVEISA
A0BUX3_PARTE/39-107--CCVKLYLEDHTIGNLTRMNLLKQ.KEVTFSGYRQ-IH.........................................
RPOA_CUSJA/34-225--LSPLMKGQADTIGIALRRALLAEIEGTRITRVKF-ANASHEYSTIAGIQESVHEILMNLKEIVLRSNLYGTCDASISF
Q235X0_TETTS/58-330--LEFDLMGVDAPIANALRRIMIAEVPTMAIHKVYI-YQNTSIIPDEVLAHRLGLIPIYADPRLFEEKQEEDEYNEKNSL
RPOD_HALMA/17-251--ARILVRGITPAFANGIRRAMVADVPTFSIDTVRV-IENTSVMFNEQIGLRLGLVPLTTDLDDFEIGDEVTLSLSVDGP
RPOD_METST/13-260--AVFVVEGVDDTFINTIRRICLVEIPTLAIEDVNI-YKNDAKMFDEVLAHRLGLIPIVTDLDSYVMPSECDCESGCQHC
A4RSP9_OSTLU/21-304--IIFDLKGVDVSLANALRRLMIADVPTVSIDLVEV-IENSSVLCDEFLAHRLGLIPLDSTKASELVKPYEYTGDDDTAT
RPOA_FUSNN/27-224--VEPLYRGYGNTLGNALRRVLLSSIPGAAIKGMRI-EGVLSEFTVMDGVKEAVTEIILNVKEIVVKAESSGERRMSLSI
B5IB51_ACIB4/16-83--MILEVINADRTLLIPLVEELNKD.EMVEQAIYHY-DH.........................................
RPOL_METMP/14-90--IELELVNDDHSLSNLVKEILLAK.DGVILASYGV-EHPVLD.....................................
RPOA_UREPA/26-236--IAPLEIGFGDTLGNALRRICLSSIPGASMFAVKF-GGYSHEFQPYEGVKEDITHIILNLKNLAIKIDELIYSEDYFNN
Q6J224_9STRA/25-221--IDKLKLGQGITIGNQLRRVLLGEIGGTAISAVRI-VGIRHEFATIPGVREDILEILLNLKGIVIKSDTTEIKFGRLKV
RPB3_SCHPO/17-257--VDFVLTNTSLAVANSLRRVVLAEIPTVAIDLVEI-NVNTSVMPDEFLAHRLGMIPLDSSNIDEPPPVGLEYTRNCDCD
RPOL_HALLT/13-83--LRIEIAGEDHTFMNVLKGVLLET.DDVAAATYDM-NPE........................................
A2BK79_HYPBU/14-267--IRLYVEGFGLPLVNAIRRAAYSDVPVMAVDVVEV-FENNTVLYDEIIAHRLGLIPLTSKEALQKYKRPEECEKAELGD
Q4P8L3_USTMA/24-280--ANFILENVDLSFANSLRRIMIADIPTVAIDMVEI-RNNTTVLPDEMLAHRLGMVPLLSMDCAKALVDHRDCACEDGCD
A0RXH5_CENSY/13-80--ANLSIRESDIGILYIVQHELLKK.SGIEFAGVIL-KH.........................................
RPOL_PYRAB/13-83--LEFYLEGEDHTFANLLTETLREN.PHVKFVAYTI-EHP........................................
Q5KMB4_CRYNJ/31-99--STIVIRRQDHTLGNMLRAQLMLD.PTVLFAGYKV-PH.........................................
Q22RW2_TETTS/61-128--ATYTFYDEDHTLGNTVRYMLVKR.KDVEFCGYTI-PH.........................................
Q5CSH3_CRYPI/22-315--IRFTLSNTDLSMANTLRRIILAEIPTLAIDLVTM-IDNTSVLHDEFIVHRMGLIPLDSTNIRDFNFKDRCECQERCNK
Q5KG24_CRYNJ/37-305--ATFHLSGVELAYANSLRRVMMADVPTIAIDQVLF-MQNTTPLADEMIAHRLGLIPLISRNVSKGLRYTRDCDCDEGCY
RPOL_METTH/11-76--MEIVFEGETHTLCNVLRSILMED.EKVKAAAYSI-DH.........................................
A2DQ63_TRIVA/36-105--YTFTVQKEDHTLGNLLTDQLLTE.NRILFAGYRI-EH.........................................
RPB3B_ARATH/22-294--AKFELRETDVSMANALRRVMISEVPTMAIHLVKI-EVNSSVLNDEFIAQRLSLIPLTSERAMSMRFCQDCEDCNGDEH
RPOA_PSEAK/61-455--LGPFAPGQALTVANALRRSLLSQLPGTSITLVEV-RGASNEYEIITGVRESILDILLNLKQIVLTSDFEIFSPQIGFL
A6YGD4_LEPTE/31-529--IGPFAHGQGITVANMLRRTLLSELSGLAITAVEI-KEASHEYMTLPGISESVQDIILNLKQLIFRSNFDLKQPEFGFL
RPOA_HERA2/23-219--IEPLDPGYGHTLGNALRRVLLSSIPGAAVIKIKI-DGIFHEFSPIQGVREDATEIVLNVKGIRLRSYAERPVKMILSK

PF13656

B9PKF9_TOXGO/35-110--------------------------------------------------------------------------------
A8NBI2_COPC7/19-86--------------------------------------------------------------------------------
C3YRU6_BRAFL/9-84--------------------------------------------------------------------------------
C7YQM9_NECH7/57-132--------------------------------------------------------------------------------
RPAC2_DANRE/21-97--------------------------------------------------------------------------------
Q22RW2_TETTS/59-134--------------------------------------------------------------------------------
B8BNJ8_ORYSI/10-85--------------------------------------------------------------------------------
Q4U9J3_THEAN/9-84--------------------------------------------------------------------------------
D3S449_METSF/11-95--------------------------------------------------------------------------------
Q7PM95_ANOGA/16-92--------------------------------------------------------------------------------
D0N5U8_PHYIT/17-93--------------------------------------------------------------------------------
B2BXR4_9ROSI/10-85--------------------------------------------------------------------------------
RPAC2_CAEEL/59-135--------------------------------------------------------------------------------
D2VMS3_NAEGR/71-148--------------------------------------------------------------------------------
B3MNN6_DROAN/16-91--------------------------------------------------------------------------------
A4RTY9_OSTLU/11-89--------------------------------------------------------------------------------
A7AT13_BABBO/9-84--------------------------------------------------------------------------------
D2A0K7_TRICA/15-90--------------------------------------------------------------------------------
Q01D46_OSTTA/1918-1996--------------------------------------------------------------------------------
A8QGH1_BRUMA/24-100--------------------------------------------------------------------------------
D3BMK8_POLPA/46-122--------------------------------------------------------------------------------
RPOL_KORCO/11-87--------------------------------------------------------------------------------
D0A874_TRYB9/45-119--------------------------------------------------------------------------------
E2RTX5_GIAIC/30-114--------------------------------------------------------------------------------
B5X6K5_SALSA/29-105--------------------------------------------------------------------------------
Q4DBQ7_TRYCC/45-119--------------------------------------------------------------------------------
C6LR48_GIAIB/4-79--------------------------------------------------------------------------------
RPOL_METAC/11-86--------------------------------------------------------------------------------
B3LBL0_PLAKH/34-109--------------------------------------------------------------------------------
D7DAV2_STAHD/17-93--------------------------------------------------------------------------------
A2DKG2_TRIVA/16-92--------------------------------------------------------------------------------
RPOL_THEAC/19-94--------------------------------------------------------------------------------
B8D6L1_DESK1/11-87--------------------------------------------------------------------------------
Q98SA6_GUITH/28-104--------------------------------------------------------------------------------
D1JBI3_9ARCH/16-91--------------------------------------------------------------------------------
B5IB51_ACIB4/14-89--------------------------------------------------------------------------------
RPOL_HALLT/11-89--------------------------------------------------------------------------------
A8M9E3_CALMQ/14-89--------------------------------------------------------------------------------
A1RVG9_PYRIL/12-87--------------------------------------------------------------------------------
B8GF45_METPE/11-86--------------------------------------------------------------------------------
Q8SS03_ENCCU/17-93--------------------------------------------------------------------------------
D2EFV6_9EURY/12-87--------------------------------------------------------------------------------
RPOL_PICTO/14-89--------------------------------------------------------------------------------
D1JHV8_9ARCH/33-108--------------------------------------------------------------------------------
B1YD94_THENV/12-87--------------------------------------------------------------------------------
C7DHU9_9EURY/17-92--------------------------------------------------------------------------------
RPOL_AERPE/12-88--------------------------------------------------------------------------------
A9A3V3_NITMS/11-85--------------------------------------------------------------------------------
A0RXH5_CENSY/11-86--------------------------------------------------------------------------------
C4V9M5_NOSCE/13-89--------------------------------------------------------------------------------
RPB3_ASFK5/277-354--------------------------------------------------------------------------------
A3CXJ1_METMJ/11-86--------------------------------------------------------------------------------
B3TAR1_9ARCH/50-123--------------------------------------------------------------------------------

PF01193

RPOA_BORBU/32-240EQRKTISFSVSGKDTNV...............................................................
B9PKF9_TOXGO/37-104................................................................................
A8NBI2_COPC7/21-80................................................................................
Q4U9J3_THEAN/11-78................................................................................
A0D420_PARTE/43-311DFTLVAKCEKKPNSKHDDPIEQQYTNTTVHSSS...............................................
RPOA_SPIMX/36-226IGPKKVTAADIELSQN................................................................
RPOA_CHAVU/31-225KGPKKITASDIQIEPCI...............................................................
Q6J225_9STRA/27-223HGPAVITASSIQLPPDVE..............................................................
E2RTY7_GIAIC/15-297IECRECTFKGTLNISNDSTKIRVVTDKDIKFDHG..............................................
Q98S79_GUITH/62-321NLDINNNIYNKTKISIFSEMLNLMYKS.....................................................
A9A5C5_NITMS/23-210NCKVMLVLDSGDS...................................................................
RPOD_METS3/13-263SVMFSLKEEGPKVVYSKDLISS..........................................................
A2ER03_TRIVA/46-329EVLLFGLHVIGGRGPTPDLSNVDASMEENLPPTYIDGSIE........................................
A5K332_PLAVS/442-665KGPLMLVAGMIPLPSHLQVVNKEQYICTL...................................................
RPOA_AZOSB/26-225SGEGVVTARDIEGGHDVEII............................................................
A3DMQ6_STAMF/13-267LFTEDCFVKLDLEGKGEEGKLVTLHS......................................................
Q2FNB5_METHJ/13-80................................................................................
RPOA_BIGNA/25-238YLKSNGPKIIRCSDIILPNTIYAVDST.....................................................
A1CD73_ASPCL/67-135................................................................................
Q1ZJF9_PHOAS/28-229SGAGPVVAGDITHDGDVEIAN...........................................................
A7SGE2_NEMVE/31-99................................................................................
D3S449_METSF/13-89................................................................................
A4RTY9_OSTLU/13-83................................................................................
A4EA86_9ACTN/23-221VDGPCEVTGADFFIPSEFE.............................................................
RPOA_MYCMO/26-240LSLKSNKEAGDIYAKDFILPIGAEIVN.....................................................
A8A8W5_IGNH4/13-272AEADKCVVDGKPCYVRLYLDASAEGKQI....................................................
A8B9C8_GIAIC/43-336VFKLDVTAPATYSSSFNDEEPGWFYVYSRDIYWVPIGG..........................................
RPAC2_CAEBR/62-130................................................................................
CNJC_TETTH/16-291CTIHFDLRVSNFTNEVLEVTSLDLKQRQDHTDED..............................................
C6LR48_GIAIB/6-73................................................................................
RPOA_STIHE/40-484YCQGPGVIRAGDIILPSSIQCVDPEQYIATLSSDGILKMKVIIRQGKNYLVQTPNSLFFDEVSEFVLDKNNLAEKRSEKQ
D2A0K7_TRICA/17-84................................................................................
Q8SS03_ENCCU/19-87................................................................................
B8BNJ8_ORYSI/12-79................................................................................
RPOL_HALWD/13-86................................................................................
A4I451_LEIIN/19-288DCQITGSLKVQCPPNQHSKQVFIGDSLQ....................................................
A8MDY7_CALMQ/17-259CQVRYQLSIKANDQVVSVYAKD..........................................................
D2VMS3_NAEGR/73-142................................................................................
RPB11_SCHPO/30-98................................................................................
RPOD_SULSO/13-254EKCYTKIYIEAEAPNEPRMIYSK.........................................................
Q0YR47_9CHLB/27-225VGPKEFTAGDIIAQEGEFE.............................................................
RPOL_KORCO/13-81................................................................................
RPOL_METBF/13-80................................................................................
Q26D46_FLABB/26-226SFSGKDTFTAGDMQKYISGF............................................................
B3LBL0_PLAKH/36-103................................................................................
Q014V0_OSTTA/83-376VLSLHARCHRERLDDGSLGEVVNRSVYSNALQWCPDGSQLP.......................................
RPAC2_DROME/18-85................................................................................
RPOL_THEAC/21-88................................................................................
RPOA_RICB8/33-231TGPGAITAGMIEAGHDVEI.............................................................
RPOA1_FRATF/29-222VNKSGVVSAGDFKTTQG...............................................................
RPOA_NEOSM/34-233VTDGGAVFSNMISPSHDFEV............................................................
Q9UAY9_CAEEL/68-355DCDEEPEGDPAKNLIFKINVSCTKNRNAVPTATDPKQLYHNS......................................
Q16XU4_AEDAE/19-258ECSVEFTLDVKCNDEHTRHVTTADLKSS....................................................
Q2FTA0_METHJ/13-261CTVTLTMSVEGPGVVMSGDLIS..........................................................
Q4N473_THEPA/45-294KNSVCFKLKVKYNKFDQSDYLSSN........................................................
RPOL_ARCFU/13-80................................................................................
RPOD_PICTO/12-263QCSCNGEGCDLCTVKYSINKLGPADVF.....................................................
RPAC2_DANRE/23-91................................................................................
RPOA_EUGMY/25-202KTKRTFALLKIKQF..................................................................
C7DHU9_9EURY/19-86................................................................................
Q6Z5L9_ORYSJ/82-293VYKLHVSCKKGSPRLTVKS.............................................................
A2BNA1_HYPBU/17-85................................................................................
RPOA_THEP1/28-228EVEKKGPGELVAGDIKTPAG............................................................
RPOL_NANEQ/18-86................................................................................
Q98SA6_GUITH/30-98................................................................................
A3FPR0_CRYPI/30-98................................................................................
A8QGH1_BRUMA/26-94................................................................................
RPAC1_YEAST/52-326ENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYA............................................
A3CXJ1_METMJ/13-80................................................................................
Q2GXS9_CHAGB/5-73................................................................................
RPOA_MYCSP/26-239ISFKTNKEGEIFASDIPEVSGLEIVNK.....................................................
RPOA_ARCB4/28-224FNGPRDIKGEDLINSEVD..............................................................
A3ZKW4_9PLAN/30-227QGPCTITGADIQCDPEVDI.............................................................
D1N9H1_9BACT/29-225DKAGKVTAADIVCDSTVE..............................................................
RPOA_DEHE1/23-219SGAKVVTAADIEPSNDFE..............................................................
Q42483_ARATH/12-79................................................................................
RPOA_VESOH/28-226KGPCEITVADIETNGIDIT.............................................................
RPOA_DEIRA/21-217QGEGEVRASAFEVPTDAE..............................................................
RPOD_PYRKO/14-248LEAEGPGMVYSGDLKSS...............................................................
Q4N0T0_THEPA/38-105................................................................................
Q6XYW3_SPIKU/25-227LKVFSSKEGEIYARDLVVPTG...........................................................
RPOA_MYCTU/23-220QGPGEVTAGDIVPPAGVTV.............................................................
Q6C2S4_YARLI/11-249CSVVLMLDATCTGDDTMDIYSRDLMV......................................................
A2YIL5_ORYSI/46-114................................................................................
D3BMK8_POLPA/48-116................................................................................
D1JHV8_9ARCH/35-102................................................................................
Q2NE51_METST/11-76................................................................................
E2RTX5_GIAIC/32-108................................................................................
Q7PM95_ANOGA/18-86................................................................................
C7YQM9_NECH7/59-126................................................................................
RPOL_UNCMA/13-81................................................................................
B3TAR1_9ARCH/52-117................................................................................
Q4DBQ7_TRYCC/47-113................................................................................
RPOA_EUGST/26-212KPFYRKTSYSMIKVLT................................................................
RPOL_PICTO/16-83................................................................................
A3ZCU7_CAMJU/28-225FKGSKEIYGKDLNNDQVEV.............................................................
RPOA_CHLVU/28-268GFGFLKNNGPGKVRAADIRLPETVQCVSPEVHIATLTSGAE.......................................
RPOA_CYAME/31-227VQGPAIVTAAAFQSEANS..............................................................
RPOA_CHLAT/30-226QGPSTVLARDLQLPSSIEL.............................................................
A4KQH4_FRATU/26-221ELSGSEEEIFSEEAKLSE..............................................................
B8D6L1_DESK1/13-81................................................................................
A3CWH9_METMJ/13-261CTATYTLSVEGPKTVYSSDLIP..........................................................
A2DKG2_TRIVA/18-86................................................................................
Q5CJZ9_CRYHO/67-332CFKLNVKCTKDDINHEKGITSKAIYSKDLVW.................................................
RPB3_DICDI/24-291CSVELRLNVKCTENRPRDVTSSDLLSQNS...................................................
A5IYV9_MYCAP/28-244ATIKAEQPGVVTSKSIEISNPSVEIINK....................................................
Q5KIG6_CRYNJ/59-333VVFDLRVRCDRRPNVDRSETDPKKMYFDSNVYSGM.............................................
RPOA_LEGPC/28-231EGPCQVTAGDIQLTHGQEIINP..........................................................
A5UMY3_METS3/18-86................................................................................
RPOA_MYCGA/25-233TPIEKWPVMTIRANKAGIIKAGDIE.......................................................
Q0UL31_PHANO/22-263CAVVLSLNAKCTGSEIMKVFARDLVIE.....................................................
RPOA_LEPBJ/32-232LELKGAGYFRAGDLAVDSSI............................................................
Q4C148_CROWT/25-222TGAAHVTAGQFELPSEVEV.............................................................
A8AA05_IGNH4/21-88................................................................................
Q0EW63_9PROT/24-221KGSAIVTAADIKCPAGLSV.............................................................
RPOL_METBU/13-80................................................................................
A1RVG9_PYRIL/14-81................................................................................
Q01D46_OSTTA/1920-1990................................................................................
RPOA_CYACA/29-224QGPAIVTSGQIEFPLDIT..............................................................
A0DID7_PARTE/24-293KTKVVFTLRQKNLNDAPLEITSQHLEPEFGQV................................................
D0A874_TRYB9/47-113................................................................................
RPB11_DICDI/31-99................................................................................
A0E1A2_PARTE/42-109................................................................................
A1RWW0_THEPD/9-261IFSLEEEAGERPRTVLSGHLRFEGIE......................................................
RPOD_ARCFU/15-254CQISFRLNVEGPKVVYSGDFI...........................................................
D1JBI3_9ARCH/18-85................................................................................
RPAC1_DICDI/71-334IFQLKVKCEKDSVTGKIINETALSKHLIWVP.................................................
RPOA_NEPOL/23-295MRASLNLTGPATVTAKDLVLPSWMKVVDPSQYIATLASGASLEFEIQLSQGSGYRLR.......................
RPOD_PYRIL/14-244CTVRLMLQINAESDKIVYSG............................................................
A2SSW1_METLZ/17-86................................................................................
RPOA_EHRRG/61-264KGPCEVRSGMIADTPDCTILNK..........................................................
RPOD_AERPE/19-272EDCFVEVSLEAEVDAEGETGRYITA.......................................................
RPOA_WOLTR/37-242KGPCQVLAGMIETDDQCSIVNKD.........................................................
RPOA_STAPU/34-234EYRASIFAQGPGVVTAEHIKF...........................................................
A3LQW8_PICST/31-99................................................................................
RPOA_AYWBP/26-223LIAKGPQRLTAASFELPAG.............................................................
RPOA_OLTVI/25-374NFTGPGVVTAKDLKLPVSVYCVDPDQPIATLSADATLNFKFLVCQGKNYIIQTPVDKFHEYQKKILNSKLNLPLSSRTTL
RPOL_METKA/18-97................................................................................
RPB3_ASFM2/279-348................................................................................
A7SL38_NEMVE/58-330LVFELKVKCIKNKNAPKDATDPDELYINSKVTTD..............................................
Q4DRD4_TRYCC/103-370PQRVLVFELAAEGRRDAKSTSVYSGDLKWKPL................................................
Q8LD68_ARATH/86-370VFKLHVKCPKNRPRLKVLTSDLKWLPNGSELLRESENKTS........................................
A7AT13_BABBO/11-78................................................................................
B8GF45_METPE/13-80................................................................................
RPOA_DESVH/40-237DKRGAITAGDVRTNQHVMV.............................................................
A6DLN7_9BACT/30-227NTKGPVTAADIVTDGVTQV.............................................................
Q4DI42_TRYCC/41-115................................................................................
A1RX43_THEPD/24-91................................................................................
A3DM82_STAMF/13-81................................................................................
Q4UFZ3_THEAN/22-315CTVDYTLDVSCNDSNSRLVTHFDIVPDDTHSKSIYG............................................
Q9AW23_GUITH/11-287CSILFTLDVHANETEKTITSSMVKCSTACYPL................................................
RPOA_MYCS5/28-245LSLNANEDNRITSNHLTVTNAPRVEVQNK...................................................
D0N5U8_PHYIT/19-87................................................................................
Q96HT3_HUMAN/53-326LQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRH.............................................
Q8SSL9_ENCCU/42-293TLDVRNESEGVLNVYSDDIRWNPVG.......................................................
RPOA_RECAM/26-219TIQKKGPYIIKSKDIIC...............................................................
RPOL_SULSO/13-81................................................................................
RPOA_SCEOB/29-330QVRGPGVVRASDLKFPPMIQCVDPDQYIATLNENGKLILKFRISDFKNSQENLNFEVSKTFLNIPNFGHF..........
RPOA_MYCPU/26-240GVIETKNEKITSSDLKFPENPEIEIVN.....................................................
RPOA_ROSDO/31-228KGPGVVTAGDISESAGIEI.............................................................
RPOA_OSTTA/27-253PFVYAKLNSELKIDNFPYVVTAKDLHIPEYEFVD..............................................
D2EFV6_9EURY/14-81................................................................................
A6BM49_BRANA/34-230TVGPRNVTAQDIILPSSIK.............................................................
RPOA_CHLRE/40-320TKKTYIGFLSVNGPRVIKAADLKLPAGLQCVDPNQYIATLAEDGFLNMKFNINEGKNYI.....................
Q48981_MYCCA/25-228LKIRSDIQGPVYAGDLELPAGV..........................................................
RPOL_AERPE/14-82................................................................................
Q7RLX3_PLAYO/25-300CTVQYIIEVKCNNANKIDVSHYDIEALDHEPN................................................
A2F4R6_TRIVA/25-309YCPNCTVIYTIDAHCEPESDSVVEVTSNDLKLIAPHKWA.........................................
A9A3V3_NITMS/13-79................................................................................
B1YD94_THENV/14-81................................................................................
A7AQ72_BABBO/46-305FHLKVECKKESLAGRTNLPVYAGDMKWVP...................................................
RPOL_METTP/13-80................................................................................
RPOA_MYCH7/26-238ASFLGQKAGQIYARDIESHSGLKIVN......................................................
RPOA_ZYGCR/31-224NGPGIVTAQHIKLPPVV...............................................................
C4V9M5_NOSCE/15-83................................................................................
RPOA_CHLAB/39-253QLLKSKVSIDASDLAACGGQKAVTLAD.....................................................
RPOA_BDEBA/34-230KGPGKVTAADIQTTDKIE..............................................................
Q2UF63_ASPOR/24-263RCSVTLTLHARCTGDDIMRVYARDLV......................................................
RPOA_CHAGL/34-227VGPKTVLASDLNLPSFI...............................................................
C3YRU6_BRAFL/11-78................................................................................
RPOD_METKA/19-262KCQVRAELEVEGPTKVYARDLK..........................................................
RPOA_HELPY/28-232QSVVVDYSFKGPMELRARDLNS..........................................................
RPOA_AQUAE/25-223KKGEGEVKASDIKTPPNVE.............................................................
Q12ZR3_METBU/13-258CTVSLTLSVETDESGQTIVHSGD.........................................................
Q8SRR5_ENCCU/14-230VVFEIDVVHTDDTLRTVS..............................................................
B5X6K5_SALSA/31-99................................................................................
RPOA_MYCGE/28-238PPLERWPVLKVTAEKKGAVYAKDLE.......................................................
A8M9E3_CALMQ/16-83................................................................................
A9BFZ0_PETMO/28-233ILLSLRKKYKAGQVIKSGDIKTP.........................................................
RPOA_TREDE/32-239SEQGDFHFEFKGPASITSKDFAVE........................................................
A7VR24_9CLOT/25-224EGPCEVTADSIKCDSEVEIL............................................................
A0BUX3_PARTE/39-107................................................................................
RPOA_CUSJA/34-225KGPGYVTAEDIILPPH................................................................
Q235X0_TETTS/58-330KFTLKIKCSKKEQYKNYSEADLENLTPETYLENAIVY...........................................
RPOD_HALMA/17-251STAYSSDLVSSDPMVE................................................................
RPOD_METST/13-260RVSFLLKEKCEEGNDSKIVYSKD.........................................................
A4RSP9_OSTLU/21-304DVHLELNVRCQSDQTRDVTSDDLISHDERVK.................................................
RPOA_FUSNN/27-224KGPKVVKAADIVADIGLEI.............................................................
B5IB51_ACIB4/16-83................................................................................
RPOL_METMP/14-90................................................................................
RPOA_UREPA/26-236LLIDKWPKMKINFKGPGVITAKDIV.......................................................
Q6J224_9STRA/25-221QGPLVLTADSIDLPSGIK..............................................................
RPB3_SCHPO/17-257QYCPKCSVELFLNAKCTGEGTMEIYAR.....................................................
RPOL_HALLT/13-83................................................................................
A2BK79_HYPBU/14-267PSCYVVLRLEVETGPREERIVYSGD.......................................................
Q4P8L3_USTMA/24-280RCSVELTLRARCTTRGNLEVTSRDLIRSDTIENAT.............................................
A0RXH5_CENSY/13-80................................................................................
RPOL_PYRAB/13-83................................................................................
Q5KMB4_CRYNJ/31-99................................................................................
Q22RW2_TETTS/61-128................................................................................
Q5CSH3_CRYPI/22-315CSVEYLLDVTCEGGATRNVTHYDIQPVATSTLV...............................................
Q5KG24_CRYNJ/37-305YCMVTLRLKVTFSGNDGEQFMRVTSDMLEVVPSPGGPPPPN.......................................
RPOL_METTH/11-76................................................................................
A2DQ63_TRIVA/36-105................................................................................
RPB3B_ARATH/22-294CEFCSVEFPLSAKCVTDQTLDVTSRDLYSADP................................................
RPOA_PSEAK/61-455SVEGPGVIRANDLKLPSFIYAVDPNQYIATLSNSGRLNMKFLICCGKNYITYNPNDSQYFEWLSLLKKSKPLIKSNSPKL
A6YGD4_LEPTE/31-529SIQGPAIIKASHFRLPSFIKCVDPNQYIATLAFNGQLNLKVQICQGKNYKFQTPLDLNWPGSGFLSSIHNSNSKQKSFYI
RPOA_HERA2/23-219TGPGVVRASDIECPSNVE..............................................................

PF13656

B9PKF9_TOXGO/35-110--------------------------------------------------------------------------------
A8NBI2_COPC7/19-86--------------------------------------------------------------------------------
C3YRU6_BRAFL/9-84--------------------------------------------------------------------------------
C7YQM9_NECH7/57-132--------------------------------------------------------------------------------
RPAC2_DANRE/21-97--------------------------------------------------------------------------------
Q22RW2_TETTS/59-134--------------------------------------------------------------------------------
B8BNJ8_ORYSI/10-85--------------------------------------------------------------------------------
Q4U9J3_THEAN/9-84--------------------------------------------------------------------------------
D3S449_METSF/11-95--------------------------------------------------------------------------------
Q7PM95_ANOGA/16-92--------------------------------------------------------------------------------
D0N5U8_PHYIT/17-93--------------------------------------------------------------------------------
B2BXR4_9ROSI/10-85--------------------------------------------------------------------------------
RPAC2_CAEEL/59-135--------------------------------------------------------------------------------
D2VMS3_NAEGR/71-148--------------------------------------------------------------------------------
B3MNN6_DROAN/16-91--------------------------------------------------------------------------------
A4RTY9_OSTLU/11-89--------------------------------------------------------------------------------
A7AT13_BABBO/9-84--------------------------------------------------------------------------------
D2A0K7_TRICA/15-90--------------------------------------------------------------------------------
Q01D46_OSTTA/1918-1996--------------------------------------------------------------------------------
A8QGH1_BRUMA/24-100--------------------------------------------------------------------------------
D3BMK8_POLPA/46-122--------------------------------------------------------------------------------
RPOL_KORCO/11-87--------------------------------------------------------------------------------
D0A874_TRYB9/45-119--------------------------------------------------------------------------------
E2RTX5_GIAIC/30-114--------------------------------------------------------------------------------
B5X6K5_SALSA/29-105--------------------------------------------------------------------------------
Q4DBQ7_TRYCC/45-119--------------------------------------------------------------------------------
C6LR48_GIAIB/4-79--------------------------------------------------------------------------------
RPOL_METAC/11-86--------------------------------------------------------------------------------
B3LBL0_PLAKH/34-109--------------------------------------------------------------------------------
D7DAV2_STAHD/17-93--------------------------------------------------------------------------------
A2DKG2_TRIVA/16-92--------------------------------------------------------------------------------
RPOL_THEAC/19-94--------------------------------------------------------------------------------
B8D6L1_DESK1/11-87--------------------------------------------------------------------------------
Q98SA6_GUITH/28-104--------------------------------------------------------------------------------
D1JBI3_9ARCH/16-91--------------------------------------------------------------------------------
B5IB51_ACIB4/14-89--------------------------------------------------------------------------------
RPOL_HALLT/11-89--------------------------------------------------------------------------------
A8M9E3_CALMQ/14-89--------------------------------------------------------------------------------
A1RVG9_PYRIL/12-87--------------------------------------------------------------------------------
B8GF45_METPE/11-86--------------------------------------------------------------------------------
Q8SS03_ENCCU/17-93--------------------------------------------------------------------------------
D2EFV6_9EURY/12-87--------------------------------------------------------------------------------
RPOL_PICTO/14-89--------------------------------------------------------------------------------
D1JHV8_9ARCH/33-108--------------------------------------------------------------------------------
B1YD94_THENV/12-87--------------------------------------------------------------------------------
C7DHU9_9EURY/17-92--------------------------------------------------------------------------------
RPOL_AERPE/12-88--------------------------------------------------------------------------------
A9A3V3_NITMS/11-85--------------------------------------------------------------------------------
A0RXH5_CENSY/11-86--------------------------------------------------------------------------------
C4V9M5_NOSCE/13-89--------------------------------------------------------------------------------
RPB3_ASFK5/277-354--------------------------------------------------------------------------------
A3CXJ1_METMJ/11-86--------------------------------------------------------------------------------
B3TAR1_9ARCH/50-123--------------------------------------------------------------------------------

PF01193

RPOA_BORBU/32-240................................................................................
B9PKF9_TOXGO/37-104................................................................................
A8NBI2_COPC7/21-80................................................................................
Q4U9J3_THEAN/11-78................................................................................
A0D420_PARTE/43-311................................................................................
RPOA_SPIMX/36-226................................................................................
RPOA_CHAVU/31-225................................................................................
Q6J225_9STRA/27-223................................................................................
E2RTY7_GIAIC/15-297................................................................................
Q98S79_GUITH/62-321................................................................................
A9A5C5_NITMS/23-210................................................................................
RPOD_METS3/13-263................................................................................
A2ER03_TRIVA/46-329................................................................................
A5K332_PLAVS/442-665................................................................................
RPOA_AZOSB/26-225................................................................................
A3DMQ6_STAMF/13-267................................................................................
Q2FNB5_METHJ/13-80................................................................................
RPOA_BIGNA/25-238................................................................................
A1CD73_ASPCL/67-135................................................................................
Q1ZJF9_PHOAS/28-229................................................................................
A7SGE2_NEMVE/31-99................................................................................
D3S449_METSF/13-89................................................................................
A4RTY9_OSTLU/13-83................................................................................
A4EA86_9ACTN/23-221................................................................................
RPOA_MYCMO/26-240................................................................................
A8A8W5_IGNH4/13-272................................................................................
A8B9C8_GIAIC/43-336................................................................................
RPAC2_CAEBR/62-130................................................................................
CNJC_TETTH/16-291................................................................................
C6LR48_GIAIB/6-73................................................................................
RPOA_STIHE/40-484SFQHKIFLQNSVNKKKWGK.............................................................
D2A0K7_TRICA/17-84................................................................................
Q8SS03_ENCCU/19-87................................................................................
B8BNJ8_ORYSI/12-79................................................................................
RPOL_HALWD/13-86................................................................................
A4I451_LEIIN/19-288................................................................................
A8MDY7_CALMQ/17-259................................................................................
D2VMS3_NAEGR/73-142................................................................................
RPB11_SCHPO/30-98................................................................................
RPOD_SULSO/13-254................................................................................
Q0YR47_9CHLB/27-225................................................................................
RPOL_KORCO/13-81................................................................................
RPOL_METBF/13-80................................................................................
Q26D46_FLABB/26-226................................................................................
B3LBL0_PLAKH/36-103................................................................................
Q014V0_OSTTA/83-376................................................................................
RPAC2_DROME/18-85................................................................................
RPOL_THEAC/21-88................................................................................
RPOA_RICB8/33-231................................................................................
RPOA1_FRATF/29-222................................................................................
RPOA_NEOSM/34-233................................................................................
Q9UAY9_CAEEL/68-355................................................................................
Q16XU4_AEDAE/19-258................................................................................
Q2FTA0_METHJ/13-261................................................................................
Q4N473_THEPA/45-294................................................................................
RPOL_ARCFU/13-80................................................................................
RPOD_PICTO/12-263................................................................................
RPAC2_DANRE/23-91................................................................................
RPOA_EUGMY/25-202................................................................................
C7DHU9_9EURY/19-86................................................................................
Q6Z5L9_ORYSJ/82-293................................................................................
A2BNA1_HYPBU/17-85................................................................................
RPOA_THEP1/28-228................................................................................
RPOL_NANEQ/18-86................................................................................
Q98SA6_GUITH/30-98................................................................................
A3FPR0_CRYPI/30-98................................................................................
A8QGH1_BRUMA/26-94................................................................................
RPAC1_YEAST/52-326................................................................................
A3CXJ1_METMJ/13-80................................................................................
Q2GXS9_CHAGB/5-73................................................................................
RPOA_MYCSP/26-239................................................................................
RPOA_ARCB4/28-224................................................................................
A3ZKW4_9PLAN/30-227................................................................................
D1N9H1_9BACT/29-225................................................................................
RPOA_DEHE1/23-219................................................................................
Q42483_ARATH/12-79................................................................................
RPOA_VESOH/28-226................................................................................
RPOA_DEIRA/21-217................................................................................
RPOD_PYRKO/14-248................................................................................
Q4N0T0_THEPA/38-105................................................................................
Q6XYW3_SPIKU/25-227................................................................................
RPOA_MYCTU/23-220................................................................................
Q6C2S4_YARLI/11-249................................................................................
A2YIL5_ORYSI/46-114................................................................................
D3BMK8_POLPA/48-116................................................................................
D1JHV8_9ARCH/35-102................................................................................
Q2NE51_METST/11-76................................................................................
E2RTX5_GIAIC/32-108................................................................................
Q7PM95_ANOGA/18-86................................................................................
C7YQM9_NECH7/59-126................................................................................
RPOL_UNCMA/13-81................................................................................
B3TAR1_9ARCH/52-117................................................................................
Q4DBQ7_TRYCC/47-113................................................................................
RPOA_EUGST/26-212................................................................................
RPOL_PICTO/16-83................................................................................
A3ZCU7_CAMJU/28-225................................................................................
RPOA_CHLVU/28-268................................................................................
RPOA_CYAME/31-227................................................................................
RPOA_CHLAT/30-226................................................................................
A4KQH4_FRATU/26-221................................................................................
B8D6L1_DESK1/13-81................................................................................
A3CWH9_METMJ/13-261................................................................................
A2DKG2_TRIVA/18-86................................................................................
Q5CJZ9_CRYHO/67-332................................................................................
RPB3_DICDI/24-291................................................................................
A5IYV9_MYCAP/28-244................................................................................
Q5KIG6_CRYNJ/59-333................................................................................
RPOA_LEGPC/28-231................................................................................
A5UMY3_METS3/18-86................................................................................
RPOA_MYCGA/25-233................................................................................
Q0UL31_PHANO/22-263................................................................................
RPOA_LEPBJ/32-232................................................................................
Q4C148_CROWT/25-222................................................................................
A8AA05_IGNH4/21-88................................................................................
Q0EW63_9PROT/24-221................................................................................
RPOL_METBU/13-80................................................................................
A1RVG9_PYRIL/14-81................................................................................
Q01D46_OSTTA/1920-1990................................................................................
RPOA_CYACA/29-224................................................................................
A0DID7_PARTE/24-293................................................................................
D0A874_TRYB9/47-113................................................................................
RPB11_DICDI/31-99................................................................................
A0E1A2_PARTE/42-109................................................................................
A1RWW0_THEPD/9-261................................................................................
RPOD_ARCFU/15-254................................................................................
D1JBI3_9ARCH/18-85................................................................................
RPAC1_DICDI/71-334................................................................................
RPOA_NEPOL/23-295................................................................................
RPOD_PYRIL/14-244................................................................................
A2SSW1_METLZ/17-86................................................................................
RPOA_EHRRG/61-264................................................................................
RPOD_AERPE/19-272................................................................................
RPOA_WOLTR/37-242................................................................................
RPOA_STAPU/34-234................................................................................
A3LQW8_PICST/31-99................................................................................
RPOA_AYWBP/26-223................................................................................
RPOA_OLTVI/25-374NSTFERPNQDSLVGT.................................................................
RPOL_METKA/18-97................................................................................
RPB3_ASFM2/279-348................................................................................
A7SL38_NEMVE/58-330................................................................................
Q4DRD4_TRYCC/103-370................................................................................
Q8LD68_ARATH/86-370................................................................................
A7AT13_BABBO/11-78................................................................................
B8GF45_METPE/13-80................................................................................
RPOA_DESVH/40-237................................................................................
A6DLN7_9BACT/30-227................................................................................
Q4DI42_TRYCC/41-115................................................................................
A1RX43_THEPD/24-91................................................................................
A3DM82_STAMF/13-81................................................................................
Q4UFZ3_THEAN/22-315................................................................................
Q9AW23_GUITH/11-287................................................................................
RPOA_MYCS5/28-245................................................................................
D0N5U8_PHYIT/19-87................................................................................
Q96HT3_HUMAN/53-326................................................................................
Q8SSL9_ENCCU/42-293................................................................................
RPOA_RECAM/26-219................................................................................
RPOL_SULSO/13-81................................................................................
RPOA_SCEOB/29-330................................................................................
RPOA_MYCPU/26-240................................................................................
RPOA_ROSDO/31-228................................................................................
RPOA_OSTTA/27-253................................................................................
D2EFV6_9EURY/14-81................................................................................
A6BM49_BRANA/34-230................................................................................
RPOA_CHLRE/40-320................................................................................
Q48981_MYCCA/25-228................................................................................
RPOL_AERPE/14-82................................................................................
Q7RLX3_PLAYO/25-300................................................................................
A2F4R6_TRIVA/25-309................................................................................
A9A3V3_NITMS/13-79................................................................................
B1YD94_THENV/14-81................................................................................
A7AQ72_BABBO/46-305................................................................................
RPOL_METTP/13-80................................................................................
RPOA_MYCH7/26-238................................................................................
RPOA_ZYGCR/31-224................................................................................
C4V9M5_NOSCE/15-83................................................................................
RPOA_CHLAB/39-253................................................................................
RPOA_BDEBA/34-230................................................................................
Q2UF63_ASPOR/24-263................................................................................
RPOA_CHAGL/34-227................................................................................
C3YRU6_BRAFL/11-78................................................................................
RPOD_METKA/19-262................................................................................
RPOA_HELPY/28-232................................................................................
RPOA_AQUAE/25-223................................................................................
Q12ZR3_METBU/13-258................................................................................
Q8SRR5_ENCCU/14-230................................................................................
B5X6K5_SALSA/31-99................................................................................
RPOA_MYCGE/28-238................................................................................
A8M9E3_CALMQ/16-83................................................................................
A9BFZ0_PETMO/28-233................................................................................
RPOA_TREDE/32-239................................................................................
A7VR24_9CLOT/25-224................................................................................
A0BUX3_PARTE/39-107................................................................................
RPOA_CUSJA/34-225................................................................................
Q235X0_TETTS/58-330................................................................................
RPOD_HALMA/17-251................................................................................
RPOD_METST/13-260................................................................................
A4RSP9_OSTLU/21-304................................................................................
RPOA_FUSNN/27-224................................................................................
B5IB51_ACIB4/16-83................................................................................
RPOL_METMP/14-90................................................................................
RPOA_UREPA/26-236................................................................................
Q6J224_9STRA/25-221................................................................................
RPB3_SCHPO/17-257................................................................................
RPOL_HALLT/13-83................................................................................
A2BK79_HYPBU/14-267................................................................................
Q4P8L3_USTMA/24-280................................................................................
A0RXH5_CENSY/13-80................................................................................
RPOL_PYRAB/13-83................................................................................
Q5KMB4_CRYNJ/31-99................................................................................
Q22RW2_TETTS/61-128................................................................................
Q5CSH3_CRYPI/22-315................................................................................
Q5KG24_CRYNJ/37-305................................................................................
RPOL_METTH/11-76................................................................................
A2DQ63_TRIVA/36-105................................................................................
RPB3B_ARATH/22-294................................................................................
RPOA_PSEAK/61-455NKGNINSEIDSDISIDKKNDEVIFFQNANTRVVDSQT...........................................
A6YGD4_LEPTE/31-529KNNTRLSLTDNSKVASSQVFSQQPFVKEPDQGFNHQSEYVQQKYEVFLKHNEIKNKPLISKPINQKFNVSEYVANKSIRF
RPOA_HERA2/23-219................................................................................

PF13656

B9PKF9_TOXGO/35-110--------------------------------------------------------------------------------
A8NBI2_COPC7/19-86--------------------------------------------------------------------------------
C3YRU6_BRAFL/9-84--------------------------------------------------------------------------------
C7YQM9_NECH7/57-132--------------------------------------------------------------------------------
RPAC2_DANRE/21-97--------------------------------------------------------------------------------
Q22RW2_TETTS/59-134--------------------------------------------------------------------------------
B8BNJ8_ORYSI/10-85--------------------------------------------------------------------------------
Q4U9J3_THEAN/9-84--------------------------------------------------------------------------------
D3S449_METSF/11-95--------------------------------------------------------------------------------
Q7PM95_ANOGA/16-92--------------------------------------------------------------------------------
D0N5U8_PHYIT/17-93--------------------------------------------------------------------------------
B2BXR4_9ROSI/10-85--------------------------------------------------------------------------------
RPAC2_CAEEL/59-135--------------------------------------------------------------------------------
D2VMS3_NAEGR/71-148--------------------------------------------------------------------------------
B3MNN6_DROAN/16-91--------------------------------------------------------------------------------
A4RTY9_OSTLU/11-89--------------------------------------------------------------------------------
A7AT13_BABBO/9-84--------------------------------------------------------------------------------
D2A0K7_TRICA/15-90--------------------------------------------------------------------------------
Q01D46_OSTTA/1918-1996--------------------------------------------------------------------------------
A8QGH1_BRUMA/24-100--------------------------------------------------------------------------------
D3BMK8_POLPA/46-122--------------------------------------------------------------------------------
RPOL_KORCO/11-87--------------------------------------------------------------------------------
D0A874_TRYB9/45-119--------------------------------------------------------------------------------
E2RTX5_GIAIC/30-114--------------------------------------------------------------------------------
B5X6K5_SALSA/29-105--------------------------------------------------------------------------------
Q4DBQ7_TRYCC/45-119--------------------------------------------------------------------------------
C6LR48_GIAIB/4-79--------------------------------------------------------------------------------
RPOL_METAC/11-86--------------------------------------------------------------------------------
B3LBL0_PLAKH/34-109--------------------------------------------------------------------------------
D7DAV2_STAHD/17-93--------------------------------------------------------------------------------
A2DKG2_TRIVA/16-92--------------------------------------------------------------------------------
RPOL_THEAC/19-94--------------------------------------------------------------------------------
B8D6L1_DESK1/11-87--------------------------------------------------------------------------------
Q98SA6_GUITH/28-104--------------------------------------------------------------------------------
D1JBI3_9ARCH/16-91--------------------------------------------------------------------------------
B5IB51_ACIB4/14-89--------------------------------------------------------------------------------
RPOL_HALLT/11-89--------------------------------------------------------------------------------
A8M9E3_CALMQ/14-89--------------------------------------------------------------------------------
A1RVG9_PYRIL/12-87--------------------------------------------------------------------------------
B8GF45_METPE/11-86--------------------------------------------------------------------------------
Q8SS03_ENCCU/17-93--------------------------------------------------------------------------------
D2EFV6_9EURY/12-87--------------------------------------------------------------------------------
RPOL_PICTO/14-89--------------------------------------------------------------------------------
D1JHV8_9ARCH/33-108--------------------------------------------------------------------------------
B1YD94_THENV/12-87--------------------------------------------------------------------------------
C7DHU9_9EURY/17-92--------------------------------------------------------------------------------
RPOL_AERPE/12-88--------------------------------------------------------------------------------
A9A3V3_NITMS/11-85--------------------------------------------------------------------------------
A0RXH5_CENSY/11-86--------------------------------------------------------------------------------
C4V9M5_NOSCE/13-89--------------------------------------------------------------------------------
RPB3_ASFK5/277-354--------------------------------------------------------------------------------
A3CXJ1_METMJ/11-86--------------------------------------------------------------------------------
B3TAR1_9ARCH/50-123--------------------------------------------------------------------------------

PF01193

RPOA_BORBU/32-240................................................................................
B9PKF9_TOXGO/37-104................................................................................
A8NBI2_COPC7/21-80................................................................................
Q4U9J3_THEAN/11-78................................................................................
A0D420_PARTE/43-311................................................................................
RPOA_SPIMX/36-226................................................................................
RPOA_CHAVU/31-225................................................................................
Q6J225_9STRA/27-223................................................................................
E2RTY7_GIAIC/15-297................................................................................
Q98S79_GUITH/62-321................................................................................
A9A5C5_NITMS/23-210................................................................................
RPOD_METS3/13-263................................................................................
A2ER03_TRIVA/46-329................................................................................
A5K332_PLAVS/442-665................................................................................
RPOA_AZOSB/26-225................................................................................
A3DMQ6_STAMF/13-267................................................................................
Q2FNB5_METHJ/13-80................................................................................
RPOA_BIGNA/25-238................................................................................
A1CD73_ASPCL/67-135................................................................................
Q1ZJF9_PHOAS/28-229................................................................................
A7SGE2_NEMVE/31-99................................................................................
D3S449_METSF/13-89................................................................................
A4RTY9_OSTLU/13-83................................................................................
A4EA86_9ACTN/23-221................................................................................
RPOA_MYCMO/26-240................................................................................
A8A8W5_IGNH4/13-272................................................................................
A8B9C8_GIAIC/43-336................................................................................
RPAC2_CAEBR/62-130................................................................................
CNJC_TETTH/16-291................................................................................
C6LR48_GIAIB/6-73................................................................................
RPOA_STIHE/40-484................................................................................
D2A0K7_TRICA/17-84................................................................................
Q8SS03_ENCCU/19-87................................................................................
B8BNJ8_ORYSI/12-79................................................................................
RPOL_HALWD/13-86................................................................................
A4I451_LEIIN/19-288................................................................................
A8MDY7_CALMQ/17-259................................................................................
D2VMS3_NAEGR/73-142................................................................................
RPB11_SCHPO/30-98................................................................................
RPOD_SULSO/13-254................................................................................
Q0YR47_9CHLB/27-225................................................................................
RPOL_KORCO/13-81................................................................................
RPOL_METBF/13-80................................................................................
Q26D46_FLABB/26-226................................................................................
B3LBL0_PLAKH/36-103................................................................................
Q014V0_OSTTA/83-376................................................................................
RPAC2_DROME/18-85................................................................................
RPOL_THEAC/21-88................................................................................
RPOA_RICB8/33-231................................................................................
RPOA1_FRATF/29-222................................................................................
RPOA_NEOSM/34-233................................................................................
Q9UAY9_CAEEL/68-355................................................................................
Q16XU4_AEDAE/19-258................................................................................
Q2FTA0_METHJ/13-261................................................................................
Q4N473_THEPA/45-294................................................................................
RPOL_ARCFU/13-80................................................................................
RPOD_PICTO/12-263................................................................................
RPAC2_DANRE/23-91................................................................................
RPOA_EUGMY/25-202................................................................................
C7DHU9_9EURY/19-86................................................................................
Q6Z5L9_ORYSJ/82-293................................................................................
A2BNA1_HYPBU/17-85................................................................................
RPOA_THEP1/28-228................................................................................
RPOL_NANEQ/18-86................................................................................
Q98SA6_GUITH/30-98................................................................................
A3FPR0_CRYPI/30-98................................................................................
A8QGH1_BRUMA/26-94................................................................................
RPAC1_YEAST/52-326................................................................................
A3CXJ1_METMJ/13-80................................................................................
Q2GXS9_CHAGB/5-73................................................................................
RPOA_MYCSP/26-239................................................................................
RPOA_ARCB4/28-224................................................................................
A3ZKW4_9PLAN/30-227................................................................................
D1N9H1_9BACT/29-225................................................................................
RPOA_DEHE1/23-219................................................................................
Q42483_ARATH/12-79................................................................................
RPOA_VESOH/28-226................................................................................
RPOA_DEIRA/21-217................................................................................
RPOD_PYRKO/14-248................................................................................
Q4N0T0_THEPA/38-105................................................................................
Q6XYW3_SPIKU/25-227................................................................................
RPOA_MYCTU/23-220................................................................................
Q6C2S4_YARLI/11-249................................................................................
A2YIL5_ORYSI/46-114................................................................................
D3BMK8_POLPA/48-116................................................................................
D1JHV8_9ARCH/35-102................................................................................
Q2NE51_METST/11-76................................................................................
E2RTX5_GIAIC/32-108................................................................................
Q7PM95_ANOGA/18-86................................................................................
C7YQM9_NECH7/59-126................................................................................
RPOL_UNCMA/13-81................................................................................
B3TAR1_9ARCH/52-117................................................................................
Q4DBQ7_TRYCC/47-113................................................................................
RPOA_EUGST/26-212................................................................................
RPOL_PICTO/16-83................................................................................
A3ZCU7_CAMJU/28-225................................................................................
RPOA_CHLVU/28-268................................................................................
RPOA_CYAME/31-227................................................................................
RPOA_CHLAT/30-226................................................................................
A4KQH4_FRATU/26-221................................................................................
B8D6L1_DESK1/13-81................................................................................
A3CWH9_METMJ/13-261................................................................................
A2DKG2_TRIVA/18-86................................................................................
Q5CJZ9_CRYHO/67-332................................................................................
RPB3_DICDI/24-291................................................................................
A5IYV9_MYCAP/28-244................................................................................
Q5KIG6_CRYNJ/59-333................................................................................
RPOA_LEGPC/28-231................................................................................
A5UMY3_METS3/18-86................................................................................
RPOA_MYCGA/25-233................................................................................
Q0UL31_PHANO/22-263................................................................................
RPOA_LEPBJ/32-232................................................................................
Q4C148_CROWT/25-222................................................................................
A8AA05_IGNH4/21-88................................................................................
Q0EW63_9PROT/24-221................................................................................
RPOL_METBU/13-80................................................................................
A1RVG9_PYRIL/14-81................................................................................
Q01D46_OSTTA/1920-1990................................................................................
RPOA_CYACA/29-224................................................................................
A0DID7_PARTE/24-293................................................................................
D0A874_TRYB9/47-113................................................................................
RPB11_DICDI/31-99................................................................................
A0E1A2_PARTE/42-109................................................................................
A1RWW0_THEPD/9-261................................................................................
RPOD_ARCFU/15-254................................................................................
D1JBI3_9ARCH/18-85................................................................................
RPAC1_DICDI/71-334................................................................................
RPOA_NEPOL/23-295................................................................................
RPOD_PYRIL/14-244................................................................................
A2SSW1_METLZ/17-86................................................................................
RPOA_EHRRG/61-264................................................................................
RPOD_AERPE/19-272................................................................................
RPOA_WOLTR/37-242................................................................................
RPOA_STAPU/34-234................................................................................
A3LQW8_PICST/31-99................................................................................
RPOA_AYWBP/26-223................................................................................
RPOA_OLTVI/25-374................................................................................
RPOL_METKA/18-97................................................................................
RPB3_ASFM2/279-348................................................................................
A7SL38_NEMVE/58-330................................................................................
Q4DRD4_TRYCC/103-370................................................................................
Q8LD68_ARATH/86-370................................................................................
A7AT13_BABBO/11-78................................................................................
B8GF45_METPE/13-80................................................................................
RPOA_DESVH/40-237................................................................................
A6DLN7_9BACT/30-227................................................................................
Q4DI42_TRYCC/41-115................................................................................
A1RX43_THEPD/24-91................................................................................
A3DM82_STAMF/13-81................................................................................
Q4UFZ3_THEAN/22-315................................................................................
Q9AW23_GUITH/11-287................................................................................
RPOA_MYCS5/28-245................................................................................
D0N5U8_PHYIT/19-87................................................................................
Q96HT3_HUMAN/53-326................................................................................
Q8SSL9_ENCCU/42-293................................................................................
RPOA_RECAM/26-219................................................................................
RPOL_SULSO/13-81................................................................................
RPOA_SCEOB/29-330................................................................................
RPOA_MYCPU/26-240................................................................................
RPOA_ROSDO/31-228................................................................................
RPOA_OSTTA/27-253................................................................................
D2EFV6_9EURY/14-81................................................................................
A6BM49_BRANA/34-230................................................................................
RPOA_CHLRE/40-320................................................................................
Q48981_MYCCA/25-228................................................................................
RPOL_AERPE/14-82................................................................................
Q7RLX3_PLAYO/25-300................................................................................
A2F4R6_TRIVA/25-309................................................................................
A9A3V3_NITMS/13-79................................................................................
B1YD94_THENV/14-81................................................................................
A7AQ72_BABBO/46-305................................................................................
RPOL_METTP/13-80................................................................................
RPOA_MYCH7/26-238................................................................................
RPOA_ZYGCR/31-224................................................................................
C4V9M5_NOSCE/15-83................................................................................
RPOA_CHLAB/39-253................................................................................
RPOA_BDEBA/34-230................................................................................
Q2UF63_ASPOR/24-263................................................................................
RPOA_CHAGL/34-227................................................................................
C3YRU6_BRAFL/11-78................................................................................
RPOD_METKA/19-262................................................................................
RPOA_HELPY/28-232................................................................................
RPOA_AQUAE/25-223................................................................................
Q12ZR3_METBU/13-258................................................................................
Q8SRR5_ENCCU/14-230................................................................................
B5X6K5_SALSA/31-99................................................................................
RPOA_MYCGE/28-238................................................................................
A8M9E3_CALMQ/16-83................................................................................
A9BFZ0_PETMO/28-233................................................................................
RPOA_TREDE/32-239................................................................................
A7VR24_9CLOT/25-224................................................................................
A0BUX3_PARTE/39-107................................................................................
RPOA_CUSJA/34-225................................................................................
Q235X0_TETTS/58-330................................................................................
RPOD_HALMA/17-251................................................................................
RPOD_METST/13-260................................................................................
A4RSP9_OSTLU/21-304................................................................................
RPOA_FUSNN/27-224................................................................................
B5IB51_ACIB4/16-83................................................................................
RPOL_METMP/14-90................................................................................
RPOA_UREPA/26-236................................................................................
Q6J224_9STRA/25-221................................................................................
RPB3_SCHPO/17-257................................................................................
RPOL_HALLT/13-83................................................................................
A2BK79_HYPBU/14-267................................................................................
Q4P8L3_USTMA/24-280................................................................................
A0RXH5_CENSY/13-80................................................................................
RPOL_PYRAB/13-83................................................................................
Q5KMB4_CRYNJ/31-99................................................................................
Q22RW2_TETTS/61-128................................................................................
Q5CSH3_CRYPI/22-315................................................................................
Q5KG24_CRYNJ/37-305................................................................................
RPOL_METTH/11-76................................................................................
A2DQ63_TRIVA/36-105................................................................................
RPB3B_ARATH/22-294................................................................................
RPOA_PSEAK/61-455..............................................................ALKKGLVLKNTLRINKSS
A6YGD4_LEPTE/31-529EPDSIKQEKSVEKFINMNFLTMQRFANEGINTLYTVNPTTKNGSQLNKNFTNPTHIKNKSGLVKTEHVLNNLTVDLFPFF
RPOA_HERA2/23-219................................................................................

PF13656

B9PKF9_TOXGO/35-110--------------------------------------------------------------------------------
A8NBI2_COPC7/19-86--------------------------------------------------------------------------------
C3YRU6_BRAFL/9-84--------------------------------------------------------------------------------
C7YQM9_NECH7/57-132--------------------------------------------------------------------------------
RPAC2_DANRE/21-97--------------------------------------------------------------------------------
Q22RW2_TETTS/59-134--------------------------------------------------------------------------------
B8BNJ8_ORYSI/10-85--------------------------------------------------------------------------------
Q4U9J3_THEAN/9-84--------------------------------------------------------------------------------
D3S449_METSF/11-95--------------------------------------------------------------------------------
Q7PM95_ANOGA/16-92--------------------------------------------------------------------------------
D0N5U8_PHYIT/17-93--------------------------------------------------------------------------------
B2BXR4_9ROSI/10-85--------------------------------------------------------------------------------
RPAC2_CAEEL/59-135--------------------------------------------------------------------------------
D2VMS3_NAEGR/71-148--------------------------------------------------------------------------------
B3MNN6_DROAN/16-91--------------------------------------------------------------------------------
A4RTY9_OSTLU/11-89--------------------------------------------------------------------------------
A7AT13_BABBO/9-84--------------------------------------------------------------------------------
D2A0K7_TRICA/15-90--------------------------------------------------------------------------------
Q01D46_OSTTA/1918-1996--------------------------------------------------------------------------------
A8QGH1_BRUMA/24-100--------------------------------------------------------------------------------
D3BMK8_POLPA/46-122--------------------------------------------------------------------------------
RPOL_KORCO/11-87--------------------------------------------------------------------------------
D0A874_TRYB9/45-119--------------------------------------------------------------------------------
E2RTX5_GIAIC/30-114--------------------------------------------------------------------------------
B5X6K5_SALSA/29-105--------------------------------------------------------------------------------
Q4DBQ7_TRYCC/45-119--------------------------------------------------------------------------------
C6LR48_GIAIB/4-79--------------------------------------------------------------------------------
RPOL_METAC/11-86--------------------------------------------------------------------------------
B3LBL0_PLAKH/34-109--------------------------------------------------------------------------------
D7DAV2_STAHD/17-93--------------------------------------------------------------------------------
A2DKG2_TRIVA/16-92--------------------------------------------------------------------------------
RPOL_THEAC/19-94--------------------------------------------------------------------------------
B8D6L1_DESK1/11-87--------------------------------------------------------------------------------
Q98SA6_GUITH/28-104--------------------------------------------------------------------------------
D1JBI3_9ARCH/16-91--------------------------------------------------------------------------------
B5IB51_ACIB4/14-89--------------------------------------------------------------------------------
RPOL_HALLT/11-89--------------------------------------------------------------------------------
A8M9E3_CALMQ/14-89--------------------------------------------------------------------------------
A1RVG9_PYRIL/12-87--------------------------------------------------------------------------------
B8GF45_METPE/11-86--------------------------------------------------------------------------------
Q8SS03_ENCCU/17-93--------------------------------------------------------------------------------
D2EFV6_9EURY/12-87--------------------------------------------------------------------------------
RPOL_PICTO/14-89--------------------------------------------------------------------------------
D1JHV8_9ARCH/33-108--------------------------------------------------------------------------------
B1YD94_THENV/12-87--------------------------------------------------------------------------------
C7DHU9_9EURY/17-92--------------------------------------------------------------------------------
RPOL_AERPE/12-88--------------------------------------------------------------------------------
A9A3V3_NITMS/11-85--------------------------------------------------------------------------------
A0RXH5_CENSY/11-86--------------------------------------------------------------------------------
C4V9M5_NOSCE/13-89--------------------------------------------------------------------------------
RPB3_ASFK5/277-354--------------------------------------------------------------------------------
A3CXJ1_METMJ/11-86--------------------------------------------------------------------------------
B3TAR1_9ARCH/50-123--------------------------------------------------------------------------------

PF01193

RPOA_BORBU/32-240................................................................................
B9PKF9_TOXGO/37-104................................................................................
A8NBI2_COPC7/21-80................................................................................
Q4U9J3_THEAN/11-78................................................................................
A0D420_PARTE/43-311..................................................................LIWQPKGQQAKLFA
RPOA_SPIMX/36-226................................................................................
RPOA_CHAVU/31-225................................................................................
Q6J225_9STRA/27-223................................................................................
E2RTY7_GIAIC/15-297..................................................................GISTLSNYLESSFG
Q98S79_GUITH/62-321........................................................................IEFDLYKN
A9A5C5_NITMS/23-210................................................................................
RPOD_METS3/13-263..............................................................................DS
A2ER03_TRIVA/46-329...........................................................NPGEILSSHLVWMPYEGQREK
A5K332_PLAVS/442-665.......................................................................KEDGHLDIS
RPOA_AZOSB/26-225................................................................................
A3DMQ6_STAMF/13-267..........................................................................GDLKTS
Q2FNB5_METHJ/13-80................................................................................
RPOA_BIGNA/25-238........................................................................QYIATISN
A1CD73_ASPCL/67-135................................................................................
Q1ZJF9_PHOAS/28-229...............................................................................P
A7SGE2_NEMVE/31-99................................................................................
D3S449_METSF/13-89................................................................................
A4RTY9_OSTLU/13-83................................................................................
A4EA86_9ACTN/23-221................................................................................
RPOA_MYCMO/26-240........................................................................PGLLIATT
A8A8W5_IGNH4/13-272.......................................................................IVYSKDLKS
A8B9C8_GIAIC/43-336.............................................................QKDWLLKQEVRADMSSLPA
RPAC2_CAEBR/62-130................................................................................
CNJC_TETTH/16-291..................................................................AVRPIKVYSILRDE
C6LR48_GIAIB/6-73................................................................................
RPOA_STIHE/40-484.VEEKKEPKLSFFSHSGSRPSFLFKTKVGLKSKALTFSFQNSRSLYTISQNSKNKELFINLFKKQIYSILALKVSITKSQ
D2A0K7_TRICA/17-84................................................................................
Q8SS03_ENCCU/19-87................................................................................
B8BNJ8_ORYSI/12-79................................................................................
RPOL_HALWD/13-86................................................................................
A4I451_LEIIN/19-288........................................................................IDDAEVYP
A8MDY7_CALMQ/17-259..............................................................................LI
D2VMS3_NAEGR/73-142................................................................................
RPB11_SCHPO/30-98................................................................................
RPOD_SULSO/13-254.............................................................................DIK
Q0YR47_9CHLB/27-225................................................................................
RPOL_KORCO/13-81................................................................................
RPOL_METBF/13-80................................................................................
Q26D46_FLABB/26-226...............................................................................Q
B3LBL0_PLAKH/36-103................................................................................
Q014V0_OSTTA/83-376..........................................................EEERAKYSDFKRSQRESFGEEE
RPAC2_DROME/18-85................................................................................
RPOL_THEAC/21-88................................................................................
RPOA_RICB8/33-231................................................................................
RPOA1_FRATF/29-222................................................................................
RPOA_NEOSM/34-233................................................................................
Q9UAY9_CAEEL/68-355..........................................................SVYSRAFEWVPIADQKTQFTEE
Q16XU4_AEDAE/19-258.......................................................................DPRVLPVTS
Q2FTA0_METHJ/13-261..............................................................................QD
Q4N473_THEPA/45-294...........................................................................SLMFK
RPOL_ARCFU/13-80................................................................................
RPOD_PICTO/12-263.........................................................................SSDLIPI
RPAC2_DANRE/23-91................................................................................
RPOA_EUGMY/25-202................................................................................
C7DHU9_9EURY/19-86................................................................................
Q6Z5L9_ORYSJ/82-293................................................................................
A2BNA1_HYPBU/17-85................................................................................
RPOA_THEP1/28-228...............................................................................I
RPOL_NANEQ/18-86................................................................................
Q98SA6_GUITH/30-98................................................................................
A3FPR0_CRYPI/30-98................................................................................
A8QGH1_BRUMA/26-94................................................................................
RPAC1_YEAST/52-326................................................................RDLKFEPQGRQSTTFA
A3CXJ1_METMJ/13-80................................................................................
Q2GXS9_CHAGB/5-73................................................................................
RPOA_MYCSP/26-239.........................................................................DQYIANI
RPOA_ARCB4/28-224................................................................................
A3ZKW4_9PLAN/30-227................................................................................
D1N9H1_9BACT/29-225................................................................................
RPOA_DEHE1/23-219................................................................................
Q42483_ARATH/12-79................................................................................
RPOA_VESOH/28-226................................................................................
RPOA_DEIRA/21-217................................................................................
RPOD_PYRKO/14-248................................................................................
Q4N0T0_THEPA/38-105................................................................................
Q6XYW3_SPIKU/25-227..............................................................................VE
RPOA_MYCTU/23-220................................................................................
Q6C2S4_YARLI/11-249..........................................................................HTTPER
A2YIL5_ORYSI/46-114................................................................................
D3BMK8_POLPA/48-116................................................................................
D1JHV8_9ARCH/35-102................................................................................
Q2NE51_METST/11-76................................................................................
E2RTX5_GIAIC/32-108................................................................................
Q7PM95_ANOGA/18-86................................................................................
C7YQM9_NECH7/59-126................................................................................
RPOL_UNCMA/13-81................................................................................
B3TAR1_9ARCH/52-117................................................................................
Q4DBQ7_TRYCC/47-113................................................................................
RPOA_EUGST/26-212................................................................................
RPOL_PICTO/16-83................................................................................
A3ZCU7_CAMJU/28-225................................................................................
RPOA_CHLVU/28-268...........................................................LSLRFNLQFRNFSQLEKREGT
RPOA_CYAME/31-227................................................................................
RPOA_CHLAT/30-226................................................................................
A4KQH4_FRATU/26-221................................................................................
B8D6L1_DESK1/13-81................................................................................
A3CWH9_METMJ/13-261..............................................................................QD
A2DKG2_TRIVA/18-86................................................................................
Q5CJZ9_CRYHO/67-332....................................................................IPLSDNQRKKFG
RPB3_DICDI/24-291......................................................................AVIPVSSQVT
A5IYV9_MYCAP/28-244.......................................................................SQEIANIQK
Q5KIG6_CRYNJ/59-333.................................................................LKWVPSGDQKKKFKG
RPOA_LEGPC/28-231..............................................................................EL
A5UMY3_METS3/18-86................................................................................
RPOA_MYCGA/25-233...........................................................................CPLGF
Q0UL31_PHANO/22-263.........................................................................SNRPNDE
RPOA_LEPBJ/32-232...............................................................................E
Q4C148_CROWT/25-222................................................................................
A8AA05_IGNH4/21-88................................................................................
Q0EW63_9PROT/24-221................................................................................
RPOL_METBU/13-80................................................................................
A1RVG9_PYRIL/14-81................................................................................
Q01D46_OSTTA/1920-1990................................................................................
RPOA_CYACA/29-224................................................................................
A0DID7_PARTE/24-293....................................................................GEMAIRPVRMFS
D0A874_TRYB9/47-113................................................................................
RPB11_DICDI/31-99................................................................................
A0E1A2_PARTE/42-109................................................................................
A1RWW0_THEPD/9-261.........................................................................GAPLPPE
RPOD_ARCFU/15-254...............................................................................S
D1JBI3_9ARCH/18-85................................................................................
RPAC1_DICDI/71-334.....................................................................TQDQEEMFPNE
RPOA_NEPOL/23-295...........................................RTSLVPPGFTLPPPRDPLEPENDSKSETKSKSKGKSK
RPOD_PYRIL/14-244................................................................................
A2SSW1_METLZ/17-86................................................................................
RPOA_EHRRG/61-264..............................................................................DL
RPOD_AERPE/19-272..........................................................................GDLSIS
RPOA_WOLTR/37-242.............................................................................LLI
RPOA_STAPU/34-234...............................................................................P
A3LQW8_PICST/31-99................................................................................
RPOA_AYWBP/26-223................................................................................
RPOA_OLTVI/25-374....PLQEGVGKTKQNKRLNAHFQRQLKQLNRLKETSFKAYKTKVGEKTISDEFQTNSVNHQNLTTFDLREKKLTDVTTS
RPOL_METKA/18-97................................................................................
RPB3_ASFM2/279-348................................................................................
A7SL38_NEMVE/58-330.................................................................HLKWIPTPQQAQKFG
Q4DRD4_TRYCC/103-370....................................................................PGQEAWATGADE
Q8LD68_ARATH/86-370............................................................KLKTYTSFSCSQDSLPEFAN
A7AT13_BABBO/11-78................................................................................
B8GF45_METPE/13-80................................................................................
RPOA_DESVH/40-237................................................................................
A6DLN7_9BACT/30-227................................................................................
Q4DI42_TRYCC/41-115................................................................................
A1RX43_THEPD/24-91................................................................................
A3DM82_STAMF/13-81................................................................................
Q4UFZ3_THEAN/22-315...............................................................KNLPMPIPRADVTNFNG
Q9AW23_GUITH/11-287...................................................................KTFFIINNSGNSR
RPOA_MYCS5/28-245.......................................................................DVEIATLSK
D0N5U8_PHYIT/19-87................................................................................
Q96HT3_HUMAN/53-326.................................................................MTWIPLGNQADLFPE
Q8SSL9_ENCCU/42-293...........................................................................SQREI
RPOA_RECAM/26-219................................................................................
RPOL_SULSO/13-81................................................................................
RPOA_SCEOB/29-330.............................DTSSFQNFENSNFFSSSFFASQKMIKSKRKTKFSQLKVDYLSSFGFSTQHK
RPOA_MYCPU/26-240........................................................................KDLEIATN
RPOA_ROSDO/31-228................................................................................
RPOA_OSTTA/27-253..................................................................PNQQIATILSPTAA
D2EFV6_9EURY/14-81................................................................................
A6BM49_BRANA/34-230................................................................................
RPOA_CHLRE/40-320........................................KQKPYNLDVTTLKKRNILLQNFKNKIGLTALKNKQLMSTT
Q48981_MYCCA/25-228..............................................................................EV
RPOL_AERPE/14-82................................................................................
Q7RLX3_PLAYO/25-300....................................................................IPMPIPNDNKNN
A2F4R6_TRIVA/25-309.............................................................DKSTMGSIHIGVKPATLFA
A9A3V3_NITMS/13-79................................................................................
B1YD94_THENV/14-81................................................................................
A7AQ72_BABBO/46-305......................................................................LSDEQAELFK
RPOL_METTP/13-80................................................................................
RPOA_MYCH7/26-238.........................................................................PDLYIAD
RPOA_ZYGCR/31-224................................................................................
C4V9M5_NOSCE/15-83................................................................................
RPOA_CHLAB/39-253........................................................................LLQEGGFE
RPOA_BDEBA/34-230................................................................................
Q2UF63_ASPOR/24-263.........................................................................VSGERAN
RPOA_CHAGL/34-227................................................................................
C3YRU6_BRAFL/11-78................................................................................
RPOD_METKA/19-262..............................................................................FD
RPOA_HELPY/28-232.............................................................................EQI
RPOA_AQUAE/25-223................................................................................
Q12ZR3_METBU/13-258.............................................................................IVS
Q8SRR5_ENCCU/14-230................................................................................
B5X6K5_SALSA/31-99................................................................................
RPOA_MYCGE/28-238..........................................................................CPAGFE
A8M9E3_CALMQ/16-83................................................................................
A9BFZ0_PETMO/28-233.............................................................................AEL
RPOA_TREDE/32-239............................................................................GQLE
A7VR24_9CLOT/25-224................................................................................
A0BUX3_PARTE/39-107................................................................................
RPOA_CUSJA/34-225................................................................................
Q235X0_TETTS/58-330...............................................................SGDFKWVSQGEQNKKFE
RPOD_HALMA/17-251................................................................................
RPOD_METST/13-260............................................................................LKSD
A4RSP9_OSTLU/21-304....................................................................PVSFGGTGGGSA
RPOA_FUSNN/27-224................................................................................
B5IB51_ACIB4/16-83................................................................................
RPOL_METMP/14-90................................................................................
RPOA_UREPA/26-236..........................................................................CPVGFE
Q6J224_9STRA/25-221................................................................................
RPB3_SCHPO/17-257.........................................................................DLVVSSN
RPOL_HALLT/13-83................................................................................
A2BK79_HYPBU/14-267...........................................................................LETSD
Q4P8L3_USTMA/24-280.................................................................IYDDDAMAEPAAPKH
A0RXH5_CENSY/13-80................................................................................
RPOL_PYRAB/13-83................................................................................
Q5KMB4_CRYNJ/31-99................................................................................
Q22RW2_TETTS/61-128................................................................................
Q5CSH3_CRYPI/22-315..................................................................PMPVPKKDDSVDGM
Q5KG24_CRYNJ/37-305...........................................................PYGPPPELSEEDRIIINNRDP
RPOL_METTH/11-76................................................................................
A2DQ63_TRIVA/36-105................................................................................
RPB3B_ARATH/22-294...................................................................TVTPVDFTSNSST
RPOA_PSEAK/61-455FLINSNYQSFFPKTQQKAFSIFRKNSKTFLSTMGFYKEWKKEREFLKKDLYKNQEDFNKSYDFQETKKKLQTKLIKNFET
A6YGD4_LEPTE/31-529KDNSRLNFNSLNSSQAGGEIHRPGKSDIYKLPQNAFPNKAIGLSNFAPTTIKTKVNNNSSQSLYPNVRPLKKVIDSKTSA
RPOA_HERA2/23-219................................................................................

PF13656

B9PKF9_TOXGO/35-110-------------------------------------------------------------PT........QPE------
A8NBI2_COPC7/19-86-------------------------------------------------------------PS........ENV------
C3YRU6_BRAFL/9-84-------------------------------------------------------------PS........EHK------
C7YQM9_NECH7/57-132-------------------------------------------------------------PS........EPK------
RPAC2_DANRE/21-97-------------------------------------------------------------PS........ESK------
Q22RW2_TETTS/59-134-------------------------------------------------------------PS........ENK------
B8BNJ8_ORYSI/10-85-------------------------------------------------------------PA........DNK------
Q4U9J3_THEAN/9-84-------------------------------------------------------------PM........EPE------
D3S449_METSF/11-95-------------------------------------------------------------PLLHPETGRYISN------
Q7PM95_ANOGA/16-92-------------------------------------------------------------PA........ENK------
D0N5U8_PHYIT/17-93-------------------------------------------------------------PS........EPK------
B2BXR4_9ROSI/10-85-------------------------------------------------------------PS........HAR------
RPAC2_CAEEL/59-135-------------------------------------------------------------PL........EDK------
D2VMS3_NAEGR/71-148-------------------------------------------------------------PL........EAK------
B3MNN6_DROAN/16-91-------------------------------------------------------------PT........EQK------
A4RTY9_OSTLU/11-89-------------------------------------------------------------PM........KRE------
A7AT13_BABBO/9-84-------------------------------------------------------------PM........QPE------
D2A0K7_TRICA/15-90-------------------------------------------------------------PM........ECS------
Q01D46_OSTTA/1918-1996-------------------------------------------------------------PM........ERR------
A8QGH1_BRUMA/24-100-------------------------------------------------------------PL........EDK------
D3BMK8_POLPA/46-122-------------------------------------------------------------PL........EHN------
RPOL_KORCO/11-87-------------------------------------------------------------PL........KEE------
D0A874_TRYB9/45-119-------------------------------------------------------------PL........EAK------
E2RTX5_GIAIC/30-114-------------------------------------------------------------PL........ESK------
B5X6K5_SALSA/29-105-------------------------------------------------------------PN........VPQ------
Q4DBQ7_TRYCC/45-119-------------------------------------------------------------PL........EAK------
C6LR48_GIAIB/4-79-------------------------------------------------------------PA........EPK------
RPOL_METAC/11-86-------------------------------------------------------------VS........ISD------
B3LBL0_PLAKH/34-109-------------------------------------------------------------PL........QNT------
D7DAV2_STAHD/17-93-------------------------------------------------------------PL........QNK------
A2DKG2_TRIVA/16-92-------------------------------------------------------------PA........ETK------
RPOL_THEAC/19-94-------------------------------------------------------------PV........IDN------
B8D6L1_DESK1/11-87-------------------------------------------------------------PL........KNM------
Q98SA6_GUITH/28-104-------------------------------------------------------------PL........DNN------
D1JBI3_9ARCH/16-91-------------------------------------------------------------ML........TSE------
B5IB51_ACIB4/14-89-------------------------------------------------------------PY........LEN------
RPOL_HALLT/11-89-------------------------------------------------------------QSG......GQTE------
A8M9E3_CALMQ/14-89-------------------------------------------------------------PL........LRN------
A1RVG9_PYRIL/12-87-------------------------------------------------------------PL........QEN------
B8GF45_METPE/11-86-------------------------------------------------------------QF........S.D------
Q8SS03_ENCCU/17-93-------------------------------------------------------------PA........DTH------
D2EFV6_9EURY/12-87-------------------------------------------------------------PL........EKS------
RPOL_PICTO/14-89-------------------------------------------------------------PN........LDN------
D1JHV8_9ARCH/33-108-------------------------------------------------------------SL........LGN------
B1YD94_THENV/12-87-------------------------------------------------------------PL........QEN------
C7DHU9_9EURY/17-92-------------------------------------------------------------PE........VGK------
RPOL_AERPE/12-88-------------------------------------------------------------PM........EDI------
A9A3V3_NITMS/11-85-------------------------------------------------------------PL........TNE------
A0RXH5_CENSY/11-86-------------------------------------------------------------QL........TSE------
C4V9M5_NOSCE/13-89-------------------------------------------------------------PK........DDF------
RPB3_ASFK5/277-354-------------------------------------------------------------KQ........E..------
A3CXJ1_METMJ/11-86-------------------------------------------------------------RF........T.D------
B3TAR1_9ARCH/50-123-------------------------------------------------------------PL........TDE------

PF01193

RPOA_BORBU/32-240..LKASHFERDGVEVFNKDLVIATLSHDVNLDLEFQINYGRGYVSSEQNSKYLEEVNVIALDS--------IFSPIEKVS
B9PKF9_TOXGO/37-104...............................................................--------..Y......
A8NBI2_COPC7/21-80...............................................................--------..V......
Q4U9J3_THEAN/11-78.............................................................PM--------EPE......
A0D420_PARTE/43-311ANPIRPVHSNIIIAKLRENQELNLRLICEKGVGKRHAKWSPVCTAFYKLMPSITIKNQLDAQR--------QEK......
RPOA_SPIMX/36-226....ITISNPYHHIATITKPIRFQVELIINKGRGYLIQDGNDVQDGYFPVDALFNPVRNVNFS--------IHN......
RPOA_CHAVU/31-225..EILDSNQIIAHLTEPIDFKVELTIEKSMGFRLQNATQISKDSFSIDAIFMPIRNVNYSIHP--------VEK......
Q6J225_9STRA/27-223.IINPNHYIATLSSSHILEIEFKIESGHDYRLANETFSDKLSNFIETDAIFMPDQKDDFKVEN--------VYD......
E2RTY7_GIAIC/15-297AAETPSIPILKLAPGESINALLYARKDRGKIHAKWCPAACVVLRPLARIILCDEFERLPQQHN--------DVAR.....
Q98S79_GUITH/62-321QLIFPVYRDILILKINPGQEIHCECHCLINSGLNHAKFSPVGTIFYRMEPYVKILKEIISFDS--------SSF......
A9A5C5_NITMS/23-210.......DVTRTVLSNELSSEDDSITPISDKIPIVELAPGQRIKVECYARLGRGTEHAKWNSA--------NVS......
RPOD_METS3/13-263KIKPVYDTIPLVKLKEGEKLNIEAVAKVGYGKEHAKWMPTTVCVYKQYPEITFNEDVGIDYEC--------ADA......
A2ER03_TRIVA/46-329FGNVAPLHADIPITKILPGQTIHLYCRAIKGIGSDHAKFQPVCTAFYRLVPSIQVKDEINSSE--------KKQ......
A5K332_PLAVS/442-665IKIEYGKGHWLTYEKGLYKRELGSDNECMKKRQVKEVVEKNYMPISASFGTCRMVRMAVHKIA--------TKY......
RPOA_AZOSB/26-225NPDHVIAHLAPGGKLEMQIKVEQGRGYVPGNARPVSAENKTIGRIVLDASFSPVRRVSYLVES--------ARV......
A3DMQ6_STAMF/13-267DPDVKPVYDNIPIIVLGKNQEIRLEAYARLGRGKEHAKWSPVSVAAHKYIADIYIDEKKCLGE--------NCK......
Q2FNB5_METHJ/13-80.............................................................FQ--------FSD......
RPOA_BIGNA/25-238NKSLILKMKLTANLLNNFYSNLNYELNSLLSYYTNDILEKTNFSLIIDPNFSCVNKVNSSLIS--------LDN......
A1CD73_ASPCL/67-135.............................................................PL--------VPK......
Q1ZJF9_PHOAS/28-229EHVICHITDDNAELSMRIKVERGRGYVPASARIHTEEDERPIGRLLVDATYSPVDRIAYAVEA--------ARV......
A7SGE2_NEMVE/31-99.............................................................PL--------EHK......
D3S449_METSF/13-89.........................................................PETGRY--------ISN......
A4RTY9_OSTLU/13-83.............................................................PM--------KRE......
A4EA86_9ACTN/23-221LVNPEQHIATLTEGGHLTMSMRIGYGRGYVSGEANKRDNDPIGVIHVDSLYSPVSRCAKLVEA--------CRV......
RPOA_MYCMO/26-240AAANVLEIDVFVRAGRGYVDFEENKKYIDEIKTNLTSSISNGQYIAVDSNFSPIEKVSFSSSE--------LNT......
A8A8W5_IGNH4/13-272EDEDVRPVYENIPVVPLIGDQKVKVIAYARLGRGREHAKWMPATVSIVKPLLKGISVKEGLCD--------AEC......
A8B9C8_GIAIC/43-336PLDPDILLAKLAPGQRIFCEIYCHKGIGRMHAKFQPVGTAWYKMKTQIALDKDALLQHPEVNG--------DVDK.....
RPAC2_CAEBR/62-130.............................................................PL--------EDK......
CNJC_TETTH/16-291YGNKREVGIPIIKLSKGQQIHFECEAQKGIGKMHSKWNPVCISTFSVEPEIIFDQEIQNLDIE--------QKK......
C6LR48_GIAIB/6-73.............................................................PA--------EPK......
RPOA_STIHE/40-484DPNNFSNLLCSFFLTSKNKTKPLFIDAVFMPVTKVNYTLEENKQKLFDEIYPIVSNDNLEKNW--------VKVKKSGFF
D2A0K7_TRICA/17-84.............................................................PM--------ECS......
Q8SS03_ENCCU/19-87.............................................................PA--------DTH......
B8BNJ8_ORYSI/12-79.............................................................PA--------DNK......
RPOL_HALWD/13-86...........................................................QSGG--------QTE......
A4I451_LEIIN/19-288VSAEEHGIWLVTLGRSQVLDLHVVIRKNIAKTHAKFMPVATVAMRYAPEIILNPNGFQTLGKA--------KAR......
A8MDY7_CALMQ/17-259PDDPDFAPVYPDTLIVKMSKGQVLSIEAYAKLGRARDHAKWQACLASYYYYPKVQLLNPRDER--------CAA......
D2VMS3_NAEGR/73-142.............................................................PL--------EAK......
RPB11_SCHPO/30-98.............................................................PL--------NHN......
RPOD_SULSO/13-254SEDPSVVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLSVVRYYPKVEILANCEK--------AVN......
Q0YR47_9CHLB/27-225VLNKDMHIATVNAGATLKIDLYVGRGRGYVPAEENRPEGMPIGYIAIDAIYTPIRNVRFTVEN--------TRV......
RPOL_KORCO/13-81.............................................................PL--------KEE......
RPOL_METBF/13-80.............................................................VS--------ISD......
Q26D46_FLABB/26-226VLNPEMVICNTESSVSLNLELTIEKGRGYVPAEENKNPNAAIGTIAIDSIFTPIKNVKYSIEN--------YRV......
B3LBL0_PLAKH/36-103.............................................................PL--------QNT......
Q014V0_OSTTA/83-376LGCVHDDILLVKLAPGQEIELECHCVKGIGQEHSKWSPVGTCWYRMVPEITILEPITGADADV--------FME......
RPAC2_DROME/18-85.............................................................PT--------EQK......
RPOL_THEAC/21-88.............................................................PV--------IDN......
RPOA_RICB8/33-231LNPDHVICNLAKNKQFEMELTCKVGKGYTLSTNNNEDNNLPIGEIAIDALFNPVKSVTYKVEN--------TRI......
RPOA1_FRATF/29-222..VEIINKDQPIATLTNQRAFSLTATVSVGRNVGILSAIPTELERVGDIAVDADFNPIKRVAF--------EVF......
RPOA_NEOSM/34-233VNGDLLICNVAEGVSLEMEMKVSSGFGYVSSVSVRKDEYDLEGAVPIDAIYNPVRAVNFTVKP--------TSA......
Q9UAY9_CAEEL/68-355AHPRMVSDDILVAKLRPGQEIEASCHAVKGIGRDHAKFSPVATASYRLLPTIRLNAEISGEAA--------ERL......
Q16XU4_AEDAE/19-258RHRDDEDNEYGEGTDEILIIKLRKGQELKLRAYAKKGFGKEHAKWNPTCGVCFEYDPDNSMRH--------TLF......
Q2FTA0_METHJ/13-261AVVRPAEDNIPIVKLEKNQKVVIEAQAYMERGMEHAKWSPTTVCGYKNYPIITHDERCDGCGL--------CVE......
Q4N473_THEPA/45-294DNPPKPVYDDILITKLAPGQEIDLNMYLEKGIGKVHSKWSPVSTAVYKFMPKIEFSTEHKLTA--------NEK......
RPOL_ARCFU/13-80.............................................................PL--------IGE......
RPOD_PICTO/12-263NNPDLKPVDPMIPIVKLKKGQAMLVTCEAIMGRGKDHAKWQVTSGVSYKYHREFKINKNELEN--------WSF......
RPAC2_DANRE/23-91.............................................................PS--------ESK......
RPOA_EUGMY/25-202......TQVFLTDIILPNNFKILSIDNNLIKLNSLDINLKVLLELHKSKGYNFNPVKKVNYIE--------ENN......
C7DHU9_9EURY/19-86.............................................................PE--------VGK......
Q6Z5L9_ORYSJ/82-293.GDLEWLPEGSRLPLASPAQSRYKQKTYTSFSQSQKDILEKPLGVKFKDITIARLGPGQVVFR--------KEI......
A2BNA1_HYPBU/17-85.............................................................PL--------VSN......
RPOA_THEP1/28-228EVANPDLHIATLNSKADLFFEVYAEVGKGFVPVSEREERPDVGWIPIDGVFSPVIKVNFLTEN--------VRV......
RPOL_NANEQ/18-86.............................................................PL--------KDN......
Q98SA6_GUITH/30-98.............................................................PL--------DNN......
A3FPR0_CRYPI/30-98.............................................................PL--------EPL......
A8QGH1_BRUMA/26-94.............................................................PL--------EDK......
RPAC1_YEAST/52-326DCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIKGES--------ARR......
A3CXJ1_METMJ/13-80.............................................................FR--------FTD......
Q2GXS9_CHAGB/5-73.............................................................PN--------VPE......
RPOA_MYCSP/26-239AKGGSLEFDLFLRKGRGFIDFEENKNVISQYGSRLESSIKNGQFLAMDSDFSPVKKCAISFEE--------LNS......
RPOA_ARCB4/28-224.VVSKDAHLATINSDCNLTFSVILQKGIGYMPSEDIRDIVGADYIPIDAFFTPVKKVVYDIEK--------MLV......
A3ZKW4_9PLAN/30-227.INKDIHICTITGDIPFMMEMVVESGRGYIPATEHSTAEHEIGIIPVDAVYSPVTRVRYEVEE--------TRV......
D1N9H1_9BACT/29-225.VLNPDQVICTLDKSLPFRAEIEVIKGKGYLPAEKNTAPRSIGTIPVDCLFSPVTRVNYQVGA--------ARV......
RPOA_DEHE1/23-219.VVNPELYLLTLDSDDAVLNVELEVELGRGYRAPESTENTPIGTIPVDAIFTPIRKVNFTTEP--------MHV......
Q42483_ARATH/12-79.............................................................PS--------LEQ......
RPOA_VESOH/28-226TFNPDKVIATINDEGHMRMTLKITAGIGYDAAASRTDEASSIGGMQLDASFSPIKRVSFTVDA--------ARV......
RPOA_DEIRA/21-217.IVNPDLVIANLAEDGKLVMEVRVEEGEGYVSADKHATKDRINSIPVDAMFSPVRRVAYHVEN--------TRV......
RPOD_PYRKO/14-248...DGDVKPANPNIPIVKLAEGQRLTFNAYARLGRGKDHAKWQPGFVYYKYLTKIHVSKDVPD--------WEE......
Q4N0T0_THEPA/38-105.............................................................PL--------ENK......
Q6XYW3_SPIKU/25-227VINGDLLLATIAKGGELDLELHARNSRGYKSFTDNKKEKKYADLIVIDSNYCPIQRVAYNVEP--------TKV......
RPOA_MYCTU/23-220.HNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDA--------TRV......
Q6C2S4_YARLI/11-249PELGKPIYTDPAKKGILICKLRKNQSLRIKCIAKKGIAKEHAKWSPCAAIGFEYDPWNKLKHT--------DYW......
A2YIL5_ORYSI/46-114.............................................................PL--------QYK......
D3BMK8_POLPA/48-116.............................................................PL--------EHN......
D1JHV8_9ARCH/35-102.............................................................SL--------LGN......
Q2NE51_METST/11-76.............................................................PL--------IGQ......
E2RTX5_GIAIC/32-108.............................................................PL--------ESK......
Q7PM95_ANOGA/18-86.............................................................PA--------ENK......
C7YQM9_NECH7/59-126.............................................................PS--------EPK......
RPOL_UNCMA/13-81.............................................................PG--------ISD......
B3TAR1_9ARCH/52-117.............................................................PL--------TDE......
Q4DBQ7_TRYCC/47-113.............................................................PL--------EAK......
RPOA_EUGST/26-212...SRSYFSKDILLPNNLYVVNPDVQLFEFLSKRYKLRIISEICKGSGKSFSPIKKVNYVVEG--------IPY......
RPOL_PICTO/16-83.............................................................PN--------LDN......
A3ZCU7_CAMJU/28-225.VNKDAYLATINEDAELKFTLIVEKGIGYVPSEEIKELINDPKFIALDAFFTPVREATYDIEK--------VLF......
RPOA_CHLVU/28-268FKSKTVAQAKTEDGNVQDTTNELPTLEKNSLFFQQLQNKRNSKDQLFLDTVPMPVQKVNYVIK--------SLN......
RPOA_CYAME/31-227.SANIIDTCQYIATIDTQDILEMECQLEQSSGYRLAKPSEMIDWLPIDGVFMPVKRVNFWVDK--------ALV......
RPOA_CHLAT/30-226.VDPDQYIATISGRVSLNMEFTVEVGKGYQLPDYEKKKTFQVDVLPIDAVFMPVTKVNYTVEE--------NYG......
A4KQH4_FRATU/26-221..GLAITEEVFICSYNGGKKLKIEAKVEKGVGFRPAQDNFKDGEFLLDATFSPVVFCDFEIKD--------ARV......
B8D6L1_DESK1/13-81.............................................................PL--------KNM......
A3CWH9_METMJ/13-261PDAAPADEKIPIIELARDQKLVLEAQAIVGTGKEHAKWQATTACGYKNYPVIAIDERCDGCGM--------CID......
A2DKG2_TRIVA/18-86.............................................................PA--------ETK......
Q5CJZ9_CRYHO/67-332KSPPKVVTDDILITKLRPGQSIEAILYCEKNIGRVHAKWSPVCTASYRLLPEFGFPNGPISGS--------DAL......
RPB3_DICDI/24-291SSNSEQEIPIVKLRRGQEIKLRAIAKKGVGKEHAKWSPSCVATYQFQPIIVLNQNRIDELTDQ--------QKE......
A5IYV9_MYCAP/28-244GALVIELFLRPGRGFISNESNKKFIQNDSLFASKIESNIKKGLFIAVDSNFSPVEKCSYTVKE--------LNT......
Q5KIG6_CRYNJ/59-333KAPRPVNDDILLVKLRPGQQVDLHCFARKGVGADHAKFSPVATASYRLLPHIILRGPIPKEHQ--------QKF......
RPOA_LEGPC/28-231VIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHEDEIEKKTVGKLKIDNSFSPVKKVAYFVDS--------ARV......
A5UMY3_METS3/18-86.............................................................PL--------TGE......
RPOA_MYCGA/25-233EVFNKDLEICTLSEDAEVAIDIYATRGRGFKTAAENRSEIGSLSIIPIDSNFNPIIKVGYHVE--------EET......
Q0UL31_PHANO/22-263VGRPVITDSEGTGSCIVKLRRGQAINMRCIAKKGIAKEHAKWAPSASAIGFEYDPANKLHHLD--------YWF......
RPOA_LEPBJ/32-232IMNPDLHIATLNEDANLVMDLEIQRGRGYVPAEEKKKDIEVLGTIPVDSIFSPVQKVVFEVSE--------TRV......
Q4C148_CROWT/25-222.VNPTQPIATLTEGAKLEMEFRIEKGVGYVPVERSSEEPAALDFLQIDAVFMPVTKVNYSVES--------IRG......
A8AA05_IGNH4/21-88.............................................................PL--------RQV......
Q0EW63_9PROT/24-221.LNPELILAHLNDDAHLKIEAVVEKGRGYEPATDREVDERAVGSLLVDASYSPIRRVSTRVEA--------ARV......
RPOL_METBU/13-80.............................................................VT--------ISE......
A1RVG9_PYRIL/14-81.............................................................PL--------QEN......
Q01D46_OSTTA/1920-1990.............................................................PM--------ERR......
RPOA_CYACA/29-224.VVDPCQYIATISGNDYLEMELKVEKSSGYKLVETFSKKSPLDFLPIDSIFMPVKKVNYYVEE--------ILD......
A0DID7_PARTE/24-293PINGKEVGIPITRLGKNQSVHVRCHALKGFGKMHAKWTPINIATFRHEAELNFDHSQTQSLSL--------FEK......
D0A874_TRYB9/47-113.............................................................PL--------EAK......
RPB11_DICDI/31-99.............................................................PL--------EHN......
A0E1A2_PARTE/42-109.............................................................PS--------ENK......
A1RWW0_THEPD/9-261SAGIEPVSKNIPILKLGKGQKISLTAIARMGTGRQHAKWQPVGPVGYKYKPVVRILREDLPED--------EAL......
RPOD_ARCFU/15-254DDPDVVFAIDNIPVLELFEGQQLMLEAVARLGTGREHAKFQPVSVCVYKIIPEIVVNENCNGC--------GDC......
D1JBI3_9ARCH/18-85.............................................................ML--------TSE......
RPAC1_DICDI/71-334EDRPRPMEDDIPIMKLRPGQVIDIQCYCEKNIGREHIKWSPVCTASYRLQPVISVDKSIKGDK--------ANQ......
RPOA_NEPOL/23-295NTSTSDVQLADTDVNAQIIDTDSNSTETEKEAPHIPSMRDDHMTLHIDAVFFPVTRVNYRVEE--------EVI......
RPOD_PYRIL/14-244DLVSERPDVVPVYKDIPIVKLVKGQSIILEAYAKLGRAKEHAKWQAALASYYYYPRIKVLDEK--------CKE......
A2SSW1_METLZ/17-86.............................................................YQ--------FSD......
RPOA_EHRRG/61-264LICTLDQDVDFNIKMYVNSGKGYVPAVKRKSINKFGLSDVPVNFIATNALYSPIKKASFRVES--------SRI......
RPOD_AERPE/19-272DPQVKPVYPETPLIYVAPGQRIHVQAFARLGRGKEHTKWSPASLSVLRYTPILIYDSSKAGDE--------CLE......
RPOA_WOLTR/37-242CTLGQDVELNMTIYVASGKGYLPVTKYKENEFLKPMNEQDLISFIPVNALYSPINRVSYRVEN--------SRV......
RPOA_STAPU/34-234SSILAVDPDQSIATLLNETQLCIELFIRQGIAKQLTRTKKNHQGFFIDANFTPVQKANFSIHS--------VGD......
A3LQW8_PICST/31-99.............................................................PS--------ENK......
RPOA_AYWBP/26-223VKIINPDHYITTLSDDVCFHMTVTIKKGIGYVGAKENKVHIENQVGVIAIDSLFTPVVNVSYQ--------VEK......
RPOA_OLTVI/25-374LQHGEEATLLKEEGLNKLDNSSPQLENKLKGGRDFSGGSQLASQALPVDTLFMPIKKVNYMID--------IDP......
RPOL_METKA/18-97........................................................HKVDEER--------YVP......
RPB3_ASFM2/279-348.............................................................PH--------KQE......
A7SL38_NEMVE/58-330PQDIRPLSNVVFFFTLQELDIKMHAVKGVGKDHAKFSPVGKSTASYRLLPEITLLKPCEDELA--------DKL......
Q4DRD4_TRYCC/103-370DRVFLVHPDIILTKLGPGQRLKLRAIALKGIGGVHAKWTPVSVCFYELKTSIYLREPIRGDCA--------TKL......
Q8LD68_ARATH/86-370NPITPCDLDILIAKLAPGQEIELEAHAVKGIGKTHAKWSPVGTAWYRMHPEVVLRGEVEDELA--------ERL......
A7AT13_BABBO/11-78.............................................................PM--------QPE......
B8GF45_METPE/13-80.............................................................YQ--------FSD......
RPOA_DESVH/40-237.LNPDQHIATLTEDIELTFELEVRMGKGYVPADMHEGLSEEIGLIKLDASFSPVRKVAYTVEQ--------ARV......
A6DLN7_9BACT/30-227.VNPEQYICTLDKDTPLRIEFEVASGRGWKSADDNKPSEAPIGLIPVDSLFSPIERVSYDVSD--------TRV......
Q4DI42_TRYCC/41-115.............................................................PT--------QHR......
A1RX43_THEPD/24-91.............................................................PL--------LNV......
A3DM82_STAMF/13-81.............................................................PL--------QNR......
Q4UFZ3_THEAN/22-315ATDGIPIVKLKRGQSINMKLTASKGLGKFHAKWIVANVNYKMEPRFSFNSALMEQLSSDEKAG--------IAASC....
Q9AW23_GUITH/11-287NYDDYAIIIAKLNPGQNIKLKAYVKKGIGKEHSKWNPISSIKFRFYPIYQVNIFEMKKNLRPD--------ILN......
RPOA_MYCS5/28-245PGVLKLEMFLRAGRGYVDFEDNKKFIEEKEKELKELSSLSKGAFIAMDSVFSPVVNVAWKVTE--------LNT......
D0N5U8_PHYIT/19-87.............................................................PS--------EPK......
Q96HT3_HUMAN/53-326GTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAA--------EEL......
Q8SSL9_ENCCU/42-293FRDVKFSSRVLMFRLARGQKISAELVCTKNVGKVHAKWSPVCPATYRLMPLIEIGDIFDEDAY--------KLQ......
RPOA_RECAM/26-219..PSNIKILNDDLYICTLENDSQIDLTLIGDIGCGYVLSTYFGNRKSIVYSDTNFCPIKHVSY--------YVR......
RPOL_SULSO/13-81.............................................................PL--------SDK......
RPOA_SCEOB/29-330RSGLNQTQKFAMQHQNPFRIEKNQQDFNKNKNGNFDSQKNKTNSLWVDPLFNPILKVNYIIET--------IEP......
RPOA_MYCPU/26-240NGQKPFVMEVYFHVGRGYISFEDNKKLIEEKVALLNSTIKRGKFLAIDSDFSPVEKVKVKVQE--------INS......
RPOA_ROSDO/31-228.LNRDHVICHLDDGADVYMELTVNQGKGYVSAEKNKPEDAPIGLIPIDAIYSPVKKVSYDVQP--------TRE......
RPOA_OSTTA/27-253ENFKLTLLIGQGRGYQSWKKLPGVPQLMDQRFFEQFDSTQTNSKSVTFPIDAIFMPIRQVNFT--------VQE......
D2EFV6_9EURY/14-81.............................................................PL--------EKS......
A6BM49_BRANA/34-230.IIDGTQHIASLTKSVPFNVMLTIERNQGYAIPSQSSRRHKNGLFPIDAPCMPVRNVNFSIHS--------YKS......
RPOA_CHLRE/40-320MEGKPLLSNSDNLRFKKSFKRMLTSPNQSLKNKTSLGHDTVSNPIPLDAVFMPVTKINCIIEE--------NNV......
Q48981_MYCCA/25-228LNQDLLIATISEGGILDLVLYAKNSRGYKTFKDNKNEKNVEPGMITIDSNYSPIIKVAYSVDS--------AKI......
RPOL_AERPE/14-82.............................................................PM--------EDI......
Q7RLX3_PLAYO/25-300NIEKMENAIPILTLSKNQTIHMKLTATKGIGKMHAKWIPANVSYIIDHKIIINNHEVDKMSKE--------HKL......
A2F4R6_TRIVA/25-309NGDSNPQPVTITKLAPGQTLRLAAYIRKGIGRNHAKWSPVCVSTYHQVASIDFREAYKQIMDQ--------KEK......
A9A3V3_NITMS/13-79.............................................................PL--------TNE......
B1YD94_THENV/14-81.............................................................PL--------QEN......
A7AQ72_BABBO/46-305DNPPKPIHKDILLTKLSPGQEIDLKAYLEKGIGKTHAKWSPVCTAVYRFKPDITFSEDEPLTN--------DEV......
RPOL_METTP/13-80.............................................................PI--------MDN......
RPOA_MYCH7/26-238VSKVGALKFELFITNGKGFVDFETNKKYVNEVISRLESQIEGSVLAVDSDFSPVLNANYQAVE--------INS......
RPOA_ZYGCR/31-224..QVVDNTQYIARLEMPTSIEIHITLENTKTCTSLNTMPTTKGRFILDAALKPVRNMNYSIHS--------LGE......
C4V9M5_NOSCE/15-83.............................................................PK--------DDF......
RPOA_CHLAB/39-253SVNPDYVIFTVTQPMQLDITLRVAFGRGYTTSERIVLEDKGVNEIVLDAAFSPVVLVNYFVED--------TRV......
RPOA_BDEBA/34-230.VLNPDLPIATLGANANFNAEIVVSFGRGYVPVENRETDLPVGFIGVDALYSPIRKVNYNVSN--------ARV......
Q2UF63_ASPOR/24-263EWVGNPVITDPEGNGPLICKLRRGQELKMTCIAKKGIAKEHAKWMPTAAVGFEYDPHNNLKHV--------DYW......
RPOA_CHAGL/34-227..KIVNPDQYIATVNKPINFNLQIYIQKGKGYSLKNPISIKQGFFLVDPVFIPIRSVNYSIHS--------FED......
C3YRU6_BRAFL/11-78.............................................................PS--------EHK......
RPOD_METKA/19-262HPDVEPAFPDTLITEVGEDQRIRLEVIAVPGLGLEHAKWKPVSAVGYKGLPELEIDEDKLKEK--------KIT......
RPOA_HELPY/28-232EIVNPEMPLATINEDAQLNFSLIIYKGMGYVPSENTRELMPEGYMPLDGSFTPIKKVVYEIEN--------VLV......
RPOA_AQUAE/25-223ILNPDQYIATITDPNKELNIEIRVERGRGYVPVEEMEAIGEVGWILVDADFSPVKKVGFRVDN--------VRV......
Q12ZR3_METBU/13-258SDPNVQPADKNIPIIDLRVGQKVVLEAIAHMGYGNKHAKWQAGVACGYKIMPIVTFEGCDGCG--------ICI......
Q8SRR5_ENCCU/14-230.TRDIVCDEEDVIIKSGPVITKLARDQGLKARCIGRKGVGKTHAKWSPVSAISFEYDKDNVRR--------ETN......
B5X6K5_SALSA/31-99.............................................................PN--------VPQ......
RPOA_MYCGE/28-238VINKDLYLFSLQKDMKLTVSVYVKQGRGFTSFLENRELINSLGIIATDANFSPVLHCGYEVQE--------VKT......
A8M9E3_CALMQ/16-83.............................................................PL--------LRN......
A9BFZ0_PETMO/28-233EVANPDFVIAHVNKDMEVDFELYAQAGKGFIPAQELTFQSDIEYIFIDGVFSPVLKVNYLTEN--------IRV......
RPOA_TREDE/32-239ILGEPFYVMELMKGANVSFDVQVDFGRGYVPAEVNEKYIEIVGTIPMDAIYGPVLKVSYAIEP--------CRV......
A7VR24_9CLOT/25-224NPEMHIATLGDGARLYMEITLDKGRGYISAERNKANMQNNVIGILPIDSIYTPVLKVNFGVEN--------TRV......
A0BUX3_PARTE/39-107.............................................................PL--------QHT......
RPOA_CUSJA/34-225...VEIVDSTQHIAWLTEPIDLCIGLKIERNRGYFIKTHANFEDGSYPIDAVFMPVQNANHSI--------HSY......
Q235X0_TETTS/58-330ENPIRMVHDNIIVAKLRENQEIICEVICQKGIGKTHAKWSPVCTAYYRLMPEININSDITGAK--------AQE......
RPOD_HALMA/17-251....AADDNIPIIDLKEGQRLEVEADAVLDTGREHAKHQGGVAVGYRHLQQVEVVGDLGEFED--------DDP......
RPOD_METST/13-260DPAVKPVYDTIPIVRLREGEEVELEAIAELGLGSEHAKWQATTTCGYKYYPKIEIDTEKVNDL--------EEY......
A4RSP9_OSTLU/21-304KSGGILIAKLRKNQQLSLKCIARKGTGKDHAKWSPVATAVFKYTPLIDINHGLLNSLNGKSQT--------RILYH....
RPOA_FUSNN/27-224.VNPEQVICTVTTDRTLDIEFIVDTGEGFVVSEEIDKKDWPVDYIAVDAIYTPIRKVSYEIQD--------TMF......
B5IB51_ACIB4/16-83.............................................................PY--------LEN......
RPOL_METMP/14-90.........................................................PDTGRY--------ISN......
RPOA_UREPA/26-236IVNQDLYIAEVTKPIDVEIEIFAKTGRGRVDFNTNKDFVSTLHIIATDSNYSPVLHYAYNVEM--------IKD......
Q6J224_9STRA/25-221.IVNPNHYIATISTSINLELEFKIEHGIGYKLASQLFNDENKNFLQIDSIFMPVQKVNFKIEN--------LYD......
RPB3_SCHPO/17-257SSLGHPILADPKSRGPLICKLRKEQEISLRCIAKKGIAKEHAKWSPTSAVAFEYDPWNKLQHT--------DYW......
RPOL_HALLT/13-83...........................................................QSGG--------QTE......
A2BK79_HYPBU/14-267PDVRPVYDNMPIVVMAPDQRLRLQAYARLGYGREHAKWMPVSVAAHRYLPILEFNLDEMSDEC--------IRC......
Q4P8L3_USTMA/24-280PDFGRPVGHDGSIAPIMLVKMSKGQELDIRCIARKGFAKEHAKWSPCSAVGFEYDPHNALRHT--------TYW......
A0RXH5_CENSY/13-80.............................................................QL--------TSE......
RPOL_PYRAB/13-83............................................................ILM--------ARK......
Q5KMB4_CRYNJ/31-99.............................................................PL--------END......
Q22RW2_TETTS/61-128.............................................................PS--------ENK......
Q5CSH3_CRYPI/22-315NNGILIAKLGPGQRIAMRMTACKGIGKFHAKWIPVSVATFTNEADVRINYSLSSNLTLKQRKE--------IVNCCP...
Q5KG24_CRYNJ/37-305EMGQPIGKGNPTVPPILIAKMGKGQEIDVLCKAYKGIAKHHAKWSPLSTVAFEYDPYNKLRHT--------THW......
RPOL_METTH/11-76.............................................................PI--------VGE......
A2DQ63_TRIVA/36-105.............................................................PT--------KDL......
RPB3B_ARATH/22-294SDSSEHKGIIIAKLRRGQELKLKALARKGIGKDHAKWSPAATVTYMYEPDIIINEEMMNTLTD--------EEK......
RPOA_PSEAK/61-455PKKKLFKVQNSANPFNKAFIPLTEEKVDYDSDFNLDHKSTKIGYFPIDAIFMPINRVNYLIES--------TED......
A6YGD4_LEPTE/31-529LNDLNLMKNSNSEFPKEALLLNLDKKQALSIKEIENKLIKTDNILPVDAIFTPVTKVNYLICL--------DEK......
RPOA_HERA2/23-219.IVNPDHYIATLDSSDARLDMELTVERHRGYLPAENRDPVPIGEIPVDAIFTPVHKVNYVVEH--------TRI......

PF13656

B9PKF9_TOXGO/35-110--------------------------------------------------------------------------------
A8NBI2_COPC7/19-86--------------------------------------------------------------------------------
C3YRU6_BRAFL/9-84--------------------------------------------------------------------------------
C7YQM9_NECH7/57-132--------------------------------------------------------------------------------
RPAC2_DANRE/21-97--------------------------------------------------------------------------------
Q22RW2_TETTS/59-134--------------------------------------------------------------------------------
B8BNJ8_ORYSI/10-85--------------------------------------------------------------------------------
Q4U9J3_THEAN/9-84--------------------------------------------------------------------------------
D3S449_METSF/11-95--------------------------------------------------------------------------------
Q7PM95_ANOGA/16-92--------------------------------------------------------------------------------
D0N5U8_PHYIT/17-93--------------------------------------------------------------------------------
B2BXR4_9ROSI/10-85--------------------------------------------------------------------------------
RPAC2_CAEEL/59-135--------------------------------------------------------------------------------
D2VMS3_NAEGR/71-148--------------------------------------------------------------------------------
B3MNN6_DROAN/16-91--------------------------------------------------------------------------------
A4RTY9_OSTLU/11-89--------------------------------------------------------------------------------
A7AT13_BABBO/9-84--------------------------------------------------------------------------------
D2A0K7_TRICA/15-90--------------------------------------------------------------------------------
Q01D46_OSTTA/1918-1996--------------------------------------------------------------------------------
A8QGH1_BRUMA/24-100--------------------------------------------------------------------------------
D3BMK8_POLPA/46-122--------------------------------------------------------------------------------
RPOL_KORCO/11-87--------------------------------------------------------------------------------
D0A874_TRYB9/45-119--------------------------------------------------------------------------------
E2RTX5_GIAIC/30-114--------------------------------------------------------------------------------
B5X6K5_SALSA/29-105--------------------------------------------------------------------------------
Q4DBQ7_TRYCC/45-119--------------------------------------------------------------------------------
C6LR48_GIAIB/4-79--------------------------------------------------------------------------------
RPOL_METAC/11-86--------------------------------------------------------------------------------
B3LBL0_PLAKH/34-109--------------------------------------------------------------------------------
D7DAV2_STAHD/17-93--------------------------------------------------------------------------------
A2DKG2_TRIVA/16-92--------------------------------------------------------------------------------
RPOL_THEAC/19-94--------------------------------------------------------------------------------
B8D6L1_DESK1/11-87--------------------------------------------------------------------------------
Q98SA6_GUITH/28-104--------------------------------------------------------------------------------
D1JBI3_9ARCH/16-91--------------------------------------------------------------------------------
B5IB51_ACIB4/14-89--------------------------------------------------------------------------------
RPOL_HALLT/11-89--------------------------------------------------------------------------------
A8M9E3_CALMQ/14-89--------------------------------------------------------------------------------
A1RVG9_PYRIL/12-87--------------------------------------------------------------------------------
B8GF45_METPE/11-86--------------------------------------------------------------------------------
Q8SS03_ENCCU/17-93--------------------------------------------------------------------------------
D2EFV6_9EURY/12-87--------------------------------------------------------------------------------
RPOL_PICTO/14-89--------------------------------------------------------------------------------
D1JHV8_9ARCH/33-108--------------------------------------------------------------------------------
B1YD94_THENV/12-87--------------------------------------------------------------------------------
C7DHU9_9EURY/17-92--------------------------------------------------------------------------------
RPOL_AERPE/12-88--------------------------------------------------------------------------------
A9A3V3_NITMS/11-85--------------------------------------------------------------------------------
A0RXH5_CENSY/11-86--------------------------------------------------------------------------------
C4V9M5_NOSCE/13-89--------------------------------------------------------------------------------
RPB3_ASFK5/277-354--------------------------------------------------------------------------------
A3CXJ1_METMJ/11-86--------------------------------------------------------------------------------
B3TAR1_9ARCH/50-123--------------------------------------------------------------------------------

PF01193

RPOA_BORBU/32-240....YSVEDTRV..............................................GQ....................
B9PKF9_TOXGO/37-104..........SV..............................................PH....................
A8NBI2_COPC7/21-80................................................................................
Q4U9J3_THEAN/11-78................................................................................
A0D420_PARTE/43-311...........LASLCPMKVFGVKGNQ...............IKVVNPRNCTTCRECVREANGFE.............KD
RPOA_SPIMX/36-226...........L.............................................AE.....................
RPOA_CHAVU/31-225...........AG............................................DW.....................
Q6J225_9STRA/27-223...........NS............................................NN.....................
E2RTY7_GIAIC/15-297..........TYISETCPRNVFTIENRRVV.........VKDSNSCIFCNDCFNIPISLGEQGDNANT........IWHP
Q98S79_GUITH/62-321...........LKICPTGVFEVEKLGNL.............SRIYVKNSKFCTFCKECIKMNFKSK............CI
A9A5C5_NITMS/23-210...........MLT..........................................ETD.....................
RPOD_METS3/13-263...........CPRGVLKSDKRSKEIKIL............DIEDCAMCKSCVRASIRNAQSEGKD...........ESY
A2ER03_TRIVA/46-329...........QKLISKCPMGVFDIED...............SKLVVRSPRKCTTCRECIRNPSLA............HY
A5K332_PLAVS/442-665...........WCED........................................RCEFT....................
RPOA_AZOSB/26-225...........EQ............................................RT.....................
A3DMQ6_STAMF/13-267...........KCIEVCPRNILSFENG...............KIIVNTNKIFDCSLCRICEEYCPT............DA
Q2FNB5_METHJ/13-80................................................................................
RPOA_BIGNA/25-238...........L.............................................EN.....................
A1CD73_ASPCL/67-135................................................................................
Q1ZJF9_PHOAS/28-229...........EQ............................................RT.....................
A7SGE2_NEMVE/31-99................................................................................
D3S449_METSF/13-89................................................................................
A4RTY9_OSTLU/13-83................................................................................
A4EA86_9ACTN/23-221...........GQ............................................HT.....................
RPOA_MYCMO/26-240...........SS............................................VI.....................
A8A8W5_IGNH4/13-272...........QKECAEKCKEAFVMKD...............GKLTLKEGTTLSMVMYCIEYVCEG............KG
A8B9C8_GIAIC/43-336.........LVTKLHKVCPVNVFADVTRQLD........IEDFSVHHPDRTEACTLCRECIAAFTDEQ........NQCG
RPAC2_CAEBR/62-130................................................................................
CNJC_TETTH/16-291...........ALVNACPTKVFGINPHTN...........TLEVQDHMKCMYCEECVYKCAEDFQK...........PKL
C6LR48_GIAIB/6-73................................................................................
RPOA_STIHE/40-484LSNQQLSFEKNSLFEESKLQQNTNNEAKHKNNGNGKFVDSKLLKQSTTSNFDYNYWSLFSAELNNNSSSWTTLNSNIFFE
D2A0K7_TRICA/17-84................................................................................
Q8SS03_ENCCU/19-87................................................................................
B8BNJ8_ORYSI/12-79................................................................................
RPOL_HALWD/13-86................................................................................
A4I451_LEIIN/19-288...........EWVARCPRNVFRFVERTGQV........EVQDEDACIFCRECTSQEPPFDRLPEPLV........FVRQ
A8MDY7_CALMQ/17-259...........CLESCKGITRKNDEY.................VITDPLQCTFDNWKTCEEACSG..............S
D2VMS3_NAEGR/73-142................................................................................
RPB11_SCHPO/30-98................................................................................
RPOD_SULSO/13-254...........VCPEGVFELKDGKL...................SVKNELSCTLCEECLRYCNG...............S
Q0YR47_9CHLB/27-225...........GQ............................................RT.....................
RPOL_KORCO/13-81................................................................................
RPOL_METBF/13-80................................................................................
Q26D46_FLABB/26-226...........EQ............................................KT.....................
B3LBL0_PLAKH/36-103................................................................................
Q014V0_OSTTA/83-376..........RCANFNDTHACYACEGKGDK..........KTVKVVETRGCDLCVERVRELTGEPGW..........DEK
RPAC2_DROME/18-85................................................................................
RPOL_THEAC/21-88................................................................................
RPOA_RICB8/33-231...........GQ............................................VT.....................
RPOA1_FRATF/29-222...........D.............................................NG.....................
RPOA_NEOSM/34-233...........GS............................................FA.....................
Q9UAY9_CAEEL/68-355...........KSVFSEGVIAIEKKGAK..............RIAVVKDARKDTCSRNVFRHEDLS............KV
Q16XU4_AEDAE/19-258...........PKPDEWPKSE............................HTELEDDKYEADF..................
Q2FTA0_METHJ/13-261...........VCPKEILEVKGSAVGVK.............DGGLESCSLCRLCEQACLNSGIGDE............PA
Q4N473_THEPA/45-294...........KMLPKICPMNVFSFSK................GEVNIENPLNCTSCRRCLELYP.............KK
RPOL_ARCFU/13-80................................................................................
RPOD_PICTO/12-263...........YKDKCPKSVISENEN..................EITFTDDVECRYLQQLFDEKS..............G
RPAC2_DANRE/23-91................................................................................
RPOA_EUGMY/25-202................................................................................
C7DHU9_9EURY/19-86................................................................................
Q6Z5L9_ORYSJ/82-293...........KGDNAEK.................................LVKKCPVNVF...................
A2BNA1_HYPBU/17-85................................................................................
RPOA_THEP1/28-228...........GK............................................RT.....................
RPOL_NANEQ/18-86................................................................................
Q98SA6_GUITH/30-98................................................................................
A3FPR0_CRYPI/30-98................................................................................
A8QGH1_BRUMA/26-94................................................................................
RPAC1_YEAST/52-326...........FQKCFPPGVIGIDEGS...............DEAYVKDARKDTVSREVLRYEEFA............DK
A3CXJ1_METMJ/13-80................................................................................
Q2GXS9_CHAGB/5-73................................................................................
RPOA_MYCSP/26-239...........SS............................................KL.....................
RPOA_ARCB4/28-224...........ED............................................NP.....................
A3ZKW4_9PLAN/30-227...........GQ............................................KT.....................
D1N9H1_9BACT/29-225...........GE............................................ET.....................
RPOA_DEHE1/23-219...........GR............................................ET.....................
Q42483_ARATH/12-79................................................................................
RPOA_VESOH/28-226...........KQ............................................KV.....................
RPOA_DEIRA/21-217...........GQ............................................QT.....................
RPOD_PYRKO/14-248...........LKELAERRGLPVEES.................DEEIVITTIKAFYLPRKFEEHMG............KG
Q4N0T0_THEPA/38-105................................................................................
Q6XYW3_SPIKU/25-227...........GK............................................NA.....................
RPOA_MYCTU/23-220...........EQ............................................RT.....................
Q6C2S4_YARLI/11-249...........YEENAEEEWPL.........................SKNADWEEPPKENEPF.................
A2YIL5_ORYSI/46-114................................................................................
D3BMK8_POLPA/48-116................................................................................
D1JHV8_9ARCH/35-102................................................................................
Q2NE51_METST/11-76................................................................................
E2RTX5_GIAIC/32-108................................................................................
Q7PM95_ANOGA/18-86................................................................................
C7YQM9_NECH7/59-126................................................................................
RPOL_UNCMA/13-81................................................................................
B3TAR1_9ARCH/52-117................................................................................
Q4DBQ7_TRYCC/47-113................................................................................
RPOA_EUGST/26-212..........................................................A.....................
RPOL_PICTO/16-83................................................................................
A3ZCU7_CAMJU/28-225...........ED............................................NP.....................
RPOA_CHLVU/28-268...........A.............................................KN.....................
RPOA_CYAME/31-227...........DK............................................VL.....................
RPOA_CHLAT/30-226...........G.............................................DR.....................
A4KQH4_FRATU/26-221...........GR............................................RT.....................
B8D6L1_DESK1/13-81................................................................................
A3CWH9_METMJ/13-261...........ECPRSVLETAQGKIRVV.............EERQELCSLCRLCERACLAGGIGTE............PA
A2DKG2_TRIVA/18-86................................................................................
Q5CJZ9_CRYHO/67-332...........KLRDTVCPMKVFDIED...............VTGNAVPTNPRNCTTCRACIEKFP............NK
RPB3_DICDI/24-291...........EWVGSCPTKVYSYSPHQS...........TQQVTIEDPLRCVYCLECKKKAESFGK..........PDL
A5IYV9_MYCAP/28-244...........SS............................................NK.....................
Q5KIG6_CRYNJ/59-333...........KGCFPPGVIEIEKDENG.............EDQCVVKNPRKDTVSREVLRHPEFQ............DL
RPOA_LEGPC/28-231...........EN............................................RT.....................
A5UMY3_METS3/18-86................................................................................
RPOA_MYCGA/25-233...........S.............................................DV.....................
Q0UL31_PHANO/22-263...........EENAAAEWPKD.........................EERINLDGGPELPDTE.................
RPOA_LEPBJ/32-232...........AQ............................................RS.....................
Q4C148_CROWT/25-222...........EE............................................GE.....................
A8AA05_IGNH4/21-88................................................................................
Q0EW63_9PROT/24-221...........GQ............................................RT.....................
RPOL_METBU/13-80................................................................................
A1RVG9_PYRIL/14-81................................................................................
Q01D46_OSTTA/1920-1990................................................................................
RPOA_CYACA/29-224...........S.............................................KV.....................
A0DID7_PARTE/24-293...........QSIRDSCPMNVFAMDANQ............DLIVNAIEKCVFCEECIRCAESMKK...........PRL
D0A874_TRYB9/47-113................................................................................
RPB11_DICDI/31-99................................................................................
A0E1A2_PARTE/42-109................................................................................
A1RWW0_THEPD/9-261...........KIISTCPRRVFGYVD.................GKLTVINEMQCSLCRECEEKFP.............GI
RPOD_ARCFU/15-254...........IEACPRNVFEKDGDK..................VRVKNVMACSMCGECVEVCEM..............N
D1JBI3_9ARCH/18-85................................................................................
RPAC1_DICDI/71-334...........LLEKCPKKVFDIEDSG...............QVVAARPLDCTMCRECIRDPEFE.............QN
RPOA_NEPOL/23-295...........N.............................................GR.....................
RPOD_PYRIL/14-244...........ECKDICKELTNP.......................FECTFNKAWTCRDICGDR................
A2SSW1_METLZ/17-86................................................................................
RPOA_EHRRG/61-264...........GQ............................................FT.....................
RPOD_AERPE/19-272...........CLSAYPQVVEALKSGG...............KGSLVLEGLRRTSGLRYCAETACR............GA
RPOA_WOLTR/37-242...........GQ............................................VT.....................
RPOA_STAPU/34-234...........P.............................................KG.....................
A3LQW8_PICST/31-99................................................................................
RPOA_AYWBP/26-223...........K.............................................LG.....................
RPOA_OLTVI/25-374...........A.............................................EP.....................
RPOL_METKA/18-97................................................................................
RPB3_ASFM2/279-348................................................................................
A7SL38_NEMVE/58-330...........AACFSPGVIKVKTVNEK..............NHTNDQNVGLRSLCNIISVYISEN............II
Q4DRD4_TRYCC/103-370...........QRICPVGVFGVNEEGES..............EVAEVENCTLCRECLRRDVYPEIA............DK
Q8LD68_ARATH/86-370...........VNVCPQNVFDIEDMGKG.............KKRATVAQPRKCTLCKECVRDDDLV............DH
A7AT13_BABBO/11-78................................................................................
B8GF45_METPE/13-80................................................................................
RPOA_DESVH/40-237...........GQ............................................MT.....................
A6DLN7_9BACT/30-227...........GQ............................................MT.....................
Q4DI42_TRYCC/41-115................................................................................
A1RX43_THEPD/24-91................................................................................
A3DM82_STAMF/13-81................................................................................
Q4UFZ3_THEAN/22-315.........PRNVFKYTGVRSENPSFLGHSD.......KTFKLDAGGLQVVNKLDCIYCDECINYCREL......GHKDL
Q9AW23_GUITH/11-287..........KLENFIKDGIKNSDLCYNEK..........NSDYKCINLDNERKIELLSIFEKNYLN.........LEEY
RPOA_MYCS5/28-245...........AS............................................LK.....................
D0N5U8_PHYIT/19-87................................................................................
Q96HT3_HUMAN/53-326...........SRCFSPGVIEVQEVQGK..............KVARVANPRLDTFSREIFRNEKLK............KV
Q8SSL9_ENCCU/42-293...........KCFSEGVIDVRPSDGR...............MKAYVSNPRLDSMSREALRHEEFK............DK
RPOA_RECAM/26-219...........S.............................................YT.....................
RPOL_SULSO/13-81................................................................................
RPOA_SCEOB/29-330...........MQ............................................KN.....................
RPOA_MYCPU/26-240...........SS............................................LN.....................
RPOA_ROSDO/31-228...........GQ............................................VL.....................
RPOA_OSTTA/27-253...........H.............................................SV.....................
D2EFV6_9EURY/14-81................................................................................
A6BM49_BRANA/34-230...........E.............................................ND.....................
RPOA_CHLRE/40-320...........YS............................................DF.....................
Q48981_MYCCA/25-228...........GR............................................AI.....................
RPOL_AERPE/14-82................................................................................
Q7RLX3_PLAYO/25-300..........LIANNLNSDCYILKELDDDR..........DVELRLSENMSVVMAESCRDTLNELGY.........NKDI
A2F4R6_TRIVA/25-309...........EEVVASCPKKCLKMGLDD............NIQVANFEDCTFCNQCIRTAEVHGH...........KDA
A9A3V3_NITMS/13-79................................................................................
B1YD94_THENV/14-81................................................................................
A7AQ72_BABBO/46-305...........EELVQICPMGVFSADK................GRITTIRPYNCTSCRACLERFP.............KR
RPOL_METTP/13-80................................................................................
RPOA_MYCH7/26-238...........AS............................................PI.....................
RPOA_ZYGCR/31-224...........G.............................................DM.....................
C4V9M5_NOSCE/15-83................................................................................
RPOA_CHLAB/39-253...........GQ............................................DT.....................
RPOA_BDEBA/34-230...........GQ............................................RT.....................
Q2UF63_ASPOR/24-263...........YEEDPIKEWPV.........................SHNAAWEHAAPPDQPF.................
RPOA_CHAGL/34-227...........E.............................................KA.....................
C3YRU6_BRAFL/11-78................................................................................
RPOD_METKA/19-262...........YECPQGIIRIENGEV.................VHIDEDRLPECRMYKEYERETD.............GA
RPOA_HELPY/28-232...........EG............................................DP.....................
RPOA_AQUAE/25-223...........GK............................................KS.....................
Q12ZR3_METBU/13-258...........NSCPRNIIQLIDGSA.................MVADEDLLKCSLCRLCQDSCDI.............NA
Q8SRR5_ENCCU/14-230...........YWFEESIE...............................EEWPGVRQGEAN..................
B5X6K5_SALSA/31-99................................................................................
RPOA_MYCGE/28-238...........SK............................................QK.....................
A8M9E3_CALMQ/16-83................................................................................
A9BFZ0_PETMO/28-233...........GR............................................RT.....................
RPOA_TREDE/32-239...........GQ............................................RN.....................
A7VR24_9CLOT/25-224...........GQ............................................IT.....................
A0BUX3_PARTE/39-107................................................................................
RPOA_CUSJA/34-225...........G.............................................NE.....................
Q235X0_TETTS/58-330...........LKERCPLKVYDVQNNK...............AIVSNERACTMCRECIREDEEFN.............SK
RPOD_HALMA/17-251...........NILRGVIEEQAAEHAA...............GDATNGELVATDEFDNDLRNRYPG............KD
RPOD_METST/13-260...........VEECPRNVLQIEDDTL................VVGNIENCSTCRTCQRLSEKDD.............NA
A4RSP9_OSTLU/21-304.........NFKRHNAGPEKAAIVESDPSKM.......FKYDADTDTFTLTSPESCTYDGEVMKKVNEL......GKPGL
RPOA_FUSNN/27-224...........GR............................................MT.....................
B5IB51_ACIB4/16-83................................................................................
RPOL_METMP/14-90................................................................................
RPOA_UREPA/26-236...........SK............................................SS.....................
Q6J224_9STRA/25-221...........AD............................................NS.....................
RPB3_SCHPO/17-257...........FENDADAEWPK.........................SKNADWEEPPREGEPF.................
RPOL_HALLT/13-83................................................................................
A2BK79_HYPBU/14-267...........IESGYPELAAKIREMRS..............GSIAVVEDVNTSGLYWCVQRRCGG............KG
Q4P8L3_USTMA/24-280...........YEFDAKQEWPE.........................GPNAECEEPPQEGAPF.................
A0RXH5_CENSY/13-80................................................................................
RPOL_PYRAB/13-83................................................................................
Q5KMB4_CRYNJ/31-99................................................................................
Q22RW2_TETTS/61-128................................................................................
Q5CSH3_CRYPI/22-315.......KDVFALGGSTSKTEYALNKNSAYST.....KTKTEELPDLEVVSSKSCIFCNECVNLTKNYG.....YINPVL
Q5KG24_CRYNJ/37-305...........FETDERAEWPL.........................SSNAAFEPPPNPAEPF.................
RPOL_METTH/11-76................................................................................
A2DQ63_TRIVA/36-105................................................................................
RPB3B_ARATH/22-294...........IDLIESSPTKVFGIDPVT...........GQVVVVDPEAYTYDEEVIKKAEAMGK...........PGL
RPOA_PSEAK/61-455...........IK............................................LK.....................
A6YGD4_LEPTE/31-529...........V.............................................KP.....................
RPOA_HERA2/23-219...........GG............................................MT.....................

PF13656

B9PKF9_TOXGO/35-110---------MNIRLQTT..GE.........SAMQLLRE-SFDDLASICDHLDTLY
A8NBI2_COPC7/19-86---------INVRIQMY..DGL........SSLDALLK-ALSDLDNLCEAVEDAY
C3YRU6_BRAFL/9-84---------INLRIQSR..GP.........PAADILRR-GLTELNALCEHVQNTF
C7YQM9_NECH7/57-132---------MNIRIQTY..SG.........TAVDALKK-GLTDLQDVCDVVADEF
RPAC2_DANRE/21-97---------INFRIQTR..DGV........PASEPLRN-GLNNLTDVCKHVLQTF
Q22RW2_TETTS/59-134---------MNLRLQTI..KK.........NSNEVLKE-GLDSLAGLCDVLNDKF
B8BNJ8_ORYSI/10-85---------VNIRVQTT..GD.........PAKDVLKD-SLQDLMVMCQHVRGTF
Q4U9J3_THEAN/9-84---------MNIRIQTT..GQ.........PAVEVFLD-CLDDMVKICDILREKF
D3S449_METSF/11-95---------PKITIITE..EGT........DPIEVLKE-GLRDIIKMCDTLLDEL
Q7PM95_ANOGA/16-92---------MHFRIQAA..KSV........RAIDVLRR-GLEDLERVCDHTIDTF
D0N5U8_PHYIT/17-93---------MHIRLQTR..QGA........LADEALRS-GLTDLRKVSTQIGDAY
B2BXR4_9ROSI/10-85---------VNIRVQTT..GD.........PAREVLKD-ACQDLMLMNRHVRGVF
RPAC2_CAEEL/59-135---------ILFRVQTK..DGI........NALEVLAK-AFESVEQIFSTIRGKF
D2VMS3_NAEGR/71-148---------MNLRLQTV.GEKY........TAKETLEE-GLVNLQQVTETVMSKF
B3MNN6_DROAN/16-91---------LHFRIQSH..RD.........RAVDILKR-GLEDLEALCDHTIVTF
A4RTY9_OSTLU/11-89---------ARVRVQTTGANGT........TAQGAMRD-ALLDVISVCDRVREAY
A7AT13_BABBO/9-84---------VNIRIQTT..GK.........PAVKIFVE-CLDDLVEVCNVLTKAF
D2A0K7_TRICA/15-90---------MHLRIQMR..SG.........RAVDALKR-GLEDLAALSDHILDEF
Q01D46_OSTTA/1918-1996---------VNVRVQTHGREGA........TARGAMRD-ALLDVISVCDHVHESY
A8QGH1_BRUMA/24-100---------ILIRLQTK..RGV........SAASMLMK-GFEELECIFASIRQKF
D3BMK8_POLPA/46-122---------IAIKIQTY..PHS........TPIQALEG-SIHCLIDEFQKIELQF
RPOL_KORCO/11-87---------SVLFLRVK..EGM........NPREVLKG-AIRRLMEKYEIIGNSF
D0A874_TRYB9/45-119---------MQLHVQSS..E..........YAVETVAK-GLERLAAICDETLKSF
E2RTX5_GIAIC/30-114---------IVIRLQTN..PSGFLSDTIQATPENCFQS-ALTKITESMELIKKTF
B5X6K5_SALSA/29-105---------LFIRLQTD..GTK........TPRDVFTS-VCEKLINQLESLHQEF
Q4DBQ7_TRYCC/45-119---------MLLHVQST..DY..........AVEAVAE-GLERLASICDETLQSF
C6LR48_GIAIB/4-79---------LNLRIQSD..IR.........SATDCLLQ-AADLMYNIASVLRQRL
RPOL_METAC/11-86---------PILYIKTD..G.T........DPILVLKE-TAAIIIAQCDEFIDVF
B3LBL0_PLAKH/34-109---------IEITIKPK...GY........AGVKLLSD-NVNSLLSDVSQLRETF
D7DAV2_STAHD/17-93---------LEIMIDVE..PGA........DINEVLLE-ITENIRKFLREFKKEV
A2DKG2_TRIVA/16-92---------VALRVQAD..DDE........KITDIVLS-GISDFKQWCNNTETEF
RPOL_THEAC/19-94---------PQIYVRVK..SG.........KPQSAIKR-AVRKLSKLYEDLGTQF
B8D6L1_DESK1/11-87---------FEFTIIVK..PGY........TVESILRD-IVNGLKNSLAELRRLV
Q98SA6_GUITH/28-104---------IFLKIKTN..SFT........DPVLELEW-AIKEIYVDLSYIQTNL
D1JBI3_9ARCH/16-91---------PVLYVKMK..EG.........DPLTAIVS-AATSLASEFDDFEALY
B5IB51_ACIB4/14-89---------PTLKIRVK..SG.........KPQAAIKR-AAKRLEKVFEEMEKEF
RPOL_HALLT/11-89---------PVLTVKSE..SG.........DPLDVLAE-GAESITDRTGALRDAV
A8M9E3_CALMQ/14-89---------ITLKLRTK..GK.........DPLKVLED-AVNRILNDIGELEGKL
A1RVG9_PYRIL/12-87---------VYFKVKVR..RG.........NPIEVVQR-AVNAIISDLEELEKSF
B8GF45_METPE/11-86---------PELFITTK..GEK........SPIAVIRE-ACGRLSGFCDELLKDL
Q8SS03_ENCCU/17-93---------VFLRLTAD..RDC........QVRDLLLE-TLKRVEEETTSLMNQL
D2EFV6_9EURY/12-87---------SIFVIKTD..GK.........DAEKTLKK-IIEKTESDLKEAKKEL
RPOL_PICTO/14-89---------PQIHVKVK..SG.........KPQSAIKK-SIRRIDRIYNSLIDDL
D1JHV8_9ARCH/33-108---------SILYVKMK..KG.........DALEAVES-AATSLASDFEEFGRKY
B1YD94_THENV/12-87---------AHFKLKVR..RG.........TPLEAVER-AVKAVLADIEELERGF
C7DHU9_9EURY/17-92---------PRLVIKTL..KK.........HPAKIVEE-AIESIEKDTETIKKMI
RPOL_AERPE/12-88---------IQVYVKYE..DDV........DIKEVLRK-ASDYLLEVIGDFRRRY
A9A3V3_NITMS/11-85---------CWMRINSS..S..........KPLGEIKK-ATDSAIKMADEFKQLF
A0RXH5_CENSY/11-86---------IWMRVNTS..SG.........SPVKAITD-AADASVSTFGDLEKLF
C4V9M5_NOSCE/13-89---------MFLRVSCD..DAI........SVKDCIVE-NLVDLENITQDLINQI
RPB3_ASFK5/277-354---------MVLTIIHK.ASQE........DLITLLEK-SIQNIIQIFQTLEKNI
A3CXJ1_METMJ/11-86---------PELVVTTV..GGR........PPLLAITD-AAKRLSGYAGEILSQM
B3TAR1_9ARCH/50-123---------LYMRVVSN.............NPLKDIIK-ATNTVIEGAAELKKLL

PF01193

RPOA_BORBU/32-240...RSDYDKLVMEIWTT-.GVI........SAKDAIKK.AASIVREFLF------
B9PKF9_TOXGO/37-104....PTQPEMNIRLQTT-.GE.........SAMQLLRE.SFDDLASICD------
A8NBI2_COPC7/21-80.........INVRIQMY-.DGL........SSLDALLK.ALSDLDNLCE------
Q4U9J3_THEAN/11-78.........MNIRIQTT-.GQ.........PAVEVFLD.CLDDMVKICD------
A0D420_PARTE/43-311VELNKIDNHFIFSIESV-.GQY........EAKDIMLQ.AIEVFRSKVQ------
RPOA_SPIMX/36-226.....QQEALILEIWTN-.GAI........TPLDALRQ.GSENLIHLFL------
RPOA_CHAVU/31-225.....KSELLILEIWTN-.GSI........TPKEAFHQ.ASEKIMNIFL------
Q6J225_9STRA/27-223.....VKERVFLDVWTN-.GSI........SPEQAIFS.ASNLIIDLFK------
E2RTY7_GIAIC/15-297ALVTQQPNAFYFSIESN-.GSI........SAYDIFLM.ACDEISARAD------
Q98S79_GUITH/62-321IKIGRNKIKINLIIEST-.GVS........SPENLFKR.AIDLLIGKSE------
A9A5C5_NITMS/23-210.....KDDERILTVEST-.GAL........NPEQIILS.GVEEVGHRLA------
RPOD_METS3/13-263INVGYHENDFIFRIETD-.GSM........PPKEVLLQ.ACDELGEKAD------
A2ER03_TRIVA/46-329VSLGKEANHYEFTVESV-.GVR........PAYVLVKE.ALQILQNRCD------
A5K332_PLAVS/442-665....DPKQMLVMEIWTD-.CRM........LPKNVLLY.GIKNIKKILR------
RPOA_AZOSB/26-225.....DLDRLVIDIETN-.GAV........DPEEAIRY.AARVLMDQLS------
A3DMQ6_STAMF/13-267IRVGWRENEYILTIEST-.GSL........PPKRILIE.AVKILENKID------
Q2FNB5_METHJ/13-80.........PVLTVTTH-.NKA........DPVKPVLD.ACRRLSGQCE------
RPOA_BIGNA/25-238.....YNDSISLEVWTN-.SSY........SPRIIIQN.SIKSMVNLFL------
A1CD73_ASPCL/67-135.........FELRIQTD-.GEV........TPKDALLA.ACHDLVKDLG------
Q1ZJF9_PHOAS/28-229.....DLDKLVIDMETN-.GTL........DPEEAIRR.AATILAEQLD------
A7SGE2_NEMVE/31-99.........FVLRVQTT-.SDY........SPQEAFTH.AITDLISEVS------
D3S449_METSF/13-89.........PKITIITE-.EGT........DPIEVLKE.GLRDIIKMCD------
A4RTY9_OSTLU/13-83.........ARVRVQTT-.GANG......TTAQGAMRD.ALLDVISVCD------
A4EA86_9ACTN/23-221.....DYDRLVLEIETN-.GSI........APRDAVVQ.AANIINQHMA------
RPOA_MYCMO/26-240.....VQEKLEMEIVTK-.GTI........DAKNAIAQ.AAKILVAHLN------
A8A8W5_IGNH4/13-272IRPVFEEDTYLFELESD-.GSL........SARRTLVE.AAKAVVEKLS------
A8B9C8_GIAIC/43-336IRLELVKTHLVFTIESC-.SWY........RARDIYLE.ALTVMQQKAA------
RPAC2_CAEBR/62-130.........ILFRVQTK-.DGI........NALEVLVK.AFESVEQVFS------
CNJC_TETTH/16-291IKIDHKKDKFFFKVETT-.GVM........KPVEVLRR.GFSTLRQKLD------
C6LR48_GIAIB/6-73.........LNLRIQSD-IR..........SATDCLLQ.AADLMYNIAS------
RPOA_STIHE/40-484HFNQSPKDIIILEIWTN-.GSI........LPRTALKH.ATQNLSNLFI------
D2A0K7_TRICA/17-84.........MHLRIQMR-.SG.........RAVDALKR.GLEDLAALSD------
Q8SS03_ENCCU/19-87.........VFLRLTAD-.RDC........QVRDLLLE.TLKRVEEETT------
B8BNJ8_ORYSI/12-79.........VNIRVQTT-.GD.........PAKDVLKD.SLQDLMVMCQ------
RPOL_HALWD/13-86.........PVLSIQTE-.PDAD......VDPLDALGD.ASRQVQTTVD------
A4I451_LEIIN/19-288KKNKMGYFDFTFTVEST-.GVL........PVLQIVYD.AVTVVRRKLQ------
A8MDY7_CALMQ/17-259LVVDWDEDKYVFWVENY-.GNM........SMVNLLKE.AFRVWKWRFT------
D2VMS3_NAEGR/73-142.........MNLRLQTV-.GEK.......YTAKETLEE.GLVNLQQVTE------
RPB11_SCHPO/30-98.........FILRVQTV-.EDC........SPKQVIVD.AAKSLITHLE------
RPOD_SULSO/13-254IRISFVEDKYILEIESV-.GSL........KPERILLE.AGKSIIRKIE------
Q0YR47_9CHLB/27-225.....DYEKMILDVETD-.GSV........TPDDSISL.AGKIITDHVT------
RPOL_KORCO/13-81.........SVLFLRVK-.EGM........NPREVLKG.AIRRLMEKYE------
RPOL_METBF/13-80.........PILYIKTD-.GT.........NPIEVLKD.AASQIISQCD------
Q26D46_FLABB/26-226.....DYEKLVFEISTD-.GSI........HPKQALTE.AAKTLIHHFM------
B3LBL0_PLAKH/36-103.........IEITIKPK-.GY.........AGVKLLSD.NVNSLLSDVS------
Q014V0_OSTTA/83-376IAVRKHKNHFIFTIESV-.GQM........KPGTIFKE.AVKILASKCQ------
RPAC2_DROME/18-85.........LHFRIQSR-.RD.........RAIDILKR.GLEDLEGLCD------
RPOL_THEAC/21-88.........PQIYVRVK-.SG.........KPQSAIKR.AVRKLSKLYE------
RPOA_RICB8/33-231.....DYDKLIMFVETN-.GDI........LPEMAVGL.AARILQEQLQ------
RPOA1_FRATF/29-222.....DSETLEVFVKTN-.GTI........EPLAAVTK.ALEYFCEQIS------
RPOA_NEOSM/34-233.....GHDKLILYVETN-.GAM........DPKTAVLE.ASKILSTQAR------
Q9UAY9_CAEEL/68-355VQLGKNKQHFIFSVEST-.GAL........KSSELVVE.ACKVMEIKCR------
Q16XU4_AEDAE/19-258.NWEAKPNKFFFNVESS-.GAL........KPENIVMM.GVQVLKNKLS------
Q2FTA0_METHJ/13-261IHIGMDDRRFLFTVESA-.GSL........PTVRIIKH.GLLFLKKQSD------
Q4N473_THEPA/45-294IIISKLTNHIIFSIESS-.GSV........SSYNLLLK.AVEILKNKSL------
RPOL_ARCFU/13-80.........PEIYIKTS-.GV.........DPLEAVKR.ANEKIIAACN------
RPOD_PICTO/12-263VTITEDDTKFIFQFETD-.GSL........TAIETLDY.ALKRLKERFN------
RPAC2_DANRE/23-91.........INFRIQTR-.DGV........PASEPLRN.GLNNLTDVCK------
RPOA_EUGMY/25-202.........VYFEIYTN-.QTS........TPLEVLVK.SLKII..KLE------
C7DHU9_9EURY/19-86.........PRLVIKTL-.KK.........HPAKIVEE.AIESIEKDTE------
Q6Z5L9_ORYSJ/82-293..DIEDLGN..VTIEST-.GGL........PPEALFTE.AVRILEEKCE------
A2BNA1_HYPBU/17-85.........PVIVLSTD-.GSR........DPLDVLEE.VLKDIITDAK------
RPOA_THEP1/28-228.....DYDKLILEIWTK-.KSI........RPEEALRK.AADILINHFK------
RPOL_NANEQ/18-86.........NYFIIETD-.GSI........KARDALIQ.ALKKLKEELL------
Q98SA6_GUITH/30-98.........IFLKIKTN-.SFT........DPVLELEW.AIKEIYVDLS------
A3FPR0_CRYPI/30-98.........VQIRIQTR-.ENT........TPFVAIQN.AIKSIQMESQ------
A8QGH1_BRUMA/26-94.........ILIRLQTK-.RGV........SAASMLMK.GFEELECIFA------
RPAC1_YEAST/52-326VKLGRVRNHFIFNVESA-.GAM........TPEEIFFK.SVRILKNKAE------
A3CXJ1_METMJ/13-80.........PELVVTTV-.GGR........PPLLAITD.AAKRLSGYAG------
Q2GXS9_CHAGB/5-73.........VQLRVQTD-.GTI........TPREALMT.VCKQLVAMYG------
RPOA_MYCSP/26-239.....IEERLKIKIETD-.CTV........SAKEAIEQ.AAKIIVAHFQ------
RPOA_ARCB4/28-224.....NYEKAVFRVQTN-.GQI........SPVTAFKE.AVSVMYSQMS------
A3ZKW4_9PLAN/30-227.....NYDKLTLEIWTD-.GSI........HPEYSLVE.AAKILRKHLN------
D1N9H1_9BACT/29-225.....EMDSLELEIWTD-.GRI........SPQNALEE.AARILRDHLQ------
RPOA_DEHE1/23-219.....SLERLVLEVWTD-.GTI........EPATAVSR.SADILVKQFA------
Q42483_ARATH/12-79.........VNIRVQTT-.GD.........PAREVFKD.ACQELMQMNR------
RPOA_VESOH/28-226.....NLDKLNIMIETN-.GSV........NAEVAIKR.VATILQEQLS------
RPOA_DEIRA/21-217.....DLDRLILRVWTD-.GSA........GPQEALDK.AVEILRDELS------
RPOD_PYRKO/14-248IREEIVPGSFVFTVETN-.GEL........PVEEIVSI.ALKILMRKSD------
Q4N0T0_THEPA/38-105.........LEIRIRTK-.TD.........NPFTVILS.AITNLRTNLS------
Q6XYW3_SPIKU/25-227.....DLEKLELEIQTD-.SSI........TPVNAVAM.AAKVITEHLE------
RPOA_MYCTU/23-220.....DFDKLILDVETK-.NSI........SPRDALAS.AGKTLVELFG------
Q6C2S4_YARLI/11-249.DYNAKPNKFYINVEAT-.GAL........TQYEVVLR.GMQVLQKKLA------
A2YIL5_ORYSI/46-114.........ILVRVHTA-.NQS........TPTQAYTQ.AINDLDKELE------
D3BMK8_POLPA/48-116.........IAIKIQTY-.PHS........TPIQALEG.SIHCLIDEFQ------
D1JHV8_9ARCH/35-102.........SILYVKMK-.KG.........DALEAVES.AATSLASDFE------
Q2NE51_METST/11-76.........PEFEIRSS-............NPRKSMTN.AAKEVKEEAL------
E2RTX5_GIAIC/32-108.........IVIRLQTN-.PSGFLSDTIQATPENCFQS.ALTKITESME------
Q7PM95_ANOGA/18-86.........MHFRIQAA-.KSV........RAIDVLRR.GLEDLERVCD------
C7YQM9_NECH7/59-126.........MNIRIQTY-.SG.........TAVDALKK.GLTDLQDVCD------
RPOL_UNCMA/13-81.........PVLYVRTD-.KSE........DPIDAIKV.AAKKLADECD------
B3TAR1_9ARCH/52-117.........LYMRVVSN-.N...........PLKDIIK.ATNTVIEGAA------
Q4DBQ7_TRYCC/47-113.........MLLHVQST-.D..........YAVEAVAE.GLERLASICD------
RPOA_EUGST/26-212........SLLLEIYTD-.LRA........NALSSLLA.TLRLINPKFA------
RPOL_PICTO/16-83.........PQIHVKVK-.SG.........KPQSAIKK.SIRRIDRIYN------
A3ZCU7_CAMJU/28-225.....DYEKVVLTVTTD-.GQI........TPNEAFQN.ALEAMYKQLS------
RPOA_CHLVU/28-268.....GSEYIILEIWTD-.GSL........YPQESVEF.ALRNLTDLFF------
RPOA_CYAME/31-227.....VDKALHLEIWTN-.GSI........SPQEALHQ.AARILTHWFN------
RPOA_CHLAT/30-226.....SQERVIIEVWTN-.GSI........NSRQAIDL.SVNKIINLFS------
A4KQH4_FRATU/26-221.....DLDKLELNIKTN-.GNV........NCEEALRL.AATKIQNQLR------
B8D6L1_DESK1/13-81.........FEFTIIVK-.PGY........TVESILRD.IVNGLKNSLA------
A3CWH9_METMJ/13-261IHIGTDAERFIFVVEGD-.GSI........PVREIIER.ALQYIQKSSD------
A2DKG2_TRIVA/18-86.........VALRVQAD-.DDE........KITDIVLS.GISDFKQWCN------
Q5CJZ9_CRYHO/67-332IKLLKDKFHFIFSIETT-.GCI........PPVELVKT.AIDILRKKGE------
RPB3_DICDI/24-291VHLEQKQDKFIFTVESS-.GAL........KPEDIVLY.AIQIIKRKLT------
A5IYV9_MYCAP/28-244.....IEEELLFTIKTD-.GTV........DAKSAINQ.ACKILVAHFM------
Q5KIG6_CRYNJ/59-333VQLARIRDHFIFNVESA-.GQY........SPEELVPE.AIKILLGKIK------
RPOA_LEGPC/28-231.....DLDKLTIELETN-.GTI........DAEEAIRI.SASILQRQLH------
A5UMY3_METS3/18-86.........PNMTIKTK-.RGK........RPRKVLKK.AASQLKDDAA------
RPOA_MYCGA/25-233.....ITDKLIIEVGTN-.GLI........KSGDAIAI.ASKILSDHLK------
Q0UL31_PHANO/22-263FDHKAVPERFFYDVETV-.GGL........DPDQIVTK.GIETLQQKLA------
RPOA_LEPBJ/32-232.....DYEKLTLEVWTD-.GSV........SPDDAVAQ.AAKILKEHLT------
Q4C148_CROWT/25-222.....AKDRLMLEIWTN-.GSF........NPKEALSK.AADILVDLFN------
A8AA05_IGNH4/21-88.........LWITIRTD-.GSV........DPYEVLLE.TIDEAINYLN------
Q0EW63_9PROT/24-221.....NYDKLIMEIETN-.GSL........SPEEALNS.AAKILEAQLA------
RPOL_METBU/13-80.........PVLFIKTE-.NA.........DPIDVVKA.AVAKLITECE------
A1RVG9_PYRIL/14-81.........VYFKVKVR-.RG.........NPIEVVQR.AVNAIISDLE------
Q01D46_OSTTA/1920-1990.........VNVRVQTH-.GREG......ATARGAMRD.ALLDVISVCD------
RPOA_CYACA/29-224.....AYEKLILELWTN-.GSL........SPQQSINY.ASDNLVKLFN------
A0DID7_PARTE/24-293IKMQHKKNKYIFTVESA-.GQL........KAADIVQK.ALIVLRKKVD------
D0A874_TRYB9/47-113.........MQLHVQSS-.E..........YAVETVAK.GLERLAAICD------
RPB11_DICDI/31-99.........VNIRIQTN-.NNT........NPLECVQK.SMECLSREFT------
A0E1A2_PARTE/42-109.........MNMRLQTV-.NE.........TKEKIMND.GLKCLSQICD------
A1RWW0_THEPD/9-261VEVDGDPSNIILTVESI-.GCL........PPEKLLAV.AADVLSKKLD------
RPOD_ARCFU/15-254AISVNETNNFLFTVEGT-.GAL........PVREVMKK.ALEILRSKAE------
D1JBI3_9ARCH/18-85.........PVLYVKMK-.EG.........DPLTAIVS.AATSLASEFD------
RPAC1_DICDI/71-334VKIERVRDHFIFSIEST-.GAL........KSREIFQE.AIKIFIEKCN------
RPOA_NEPOL/23-295.....RREELVIDIWTN-.GSL........SPRKALDQ.AAVILIRMLA------
RPOD_PYRIL/14-244LIVEWDRYKYVFWVESF-.GNY........DVETALRE.AFRILKKKFS------
A2SSW1_METLZ/17-86.........PEVFITMK-.PGST......KEPLTVMRE.AAQHMIDRCD------
RPOA_EHRRG/61-264.....DYDRLIMSVETD-.HSI........LPDEAVAL.AARILQDQFQ------
RPOD_AERPE/19-272VEVRYDSSNLDLEVEST-.GAL........RPEKIVEL.AIRELEEKVK------
RPOA_WOLTR/37-242.....DKDKLILSVETD-.GTI........SPSQAVDS.AARILQEQLQ------
RPOA_STAPU/34-234.....LQQLLLLEIWTN-.KTL........TPAEALYQ.AHASLLNLFH------
A3LQW8_PICST/31-99.........LNIRIQTY-.GNI........TAVEALHQ.GLDNLAELCT------
RPOA_AYWBP/26-223.....NKDELTIEITTN-.GAL........LAKEALAT.AASILVDHFN------
RPOA_OLTVI/25-374.....DRESVVLEIWTN-.GSI........HPRQAVHE.AAKQLIHLFS------
RPOL_METKA/18-97.........PKMRIRAV-DEDA........DAREALER.AIEELLELVE------
RPB3_ASFM2/279-348.........MVLTIIHK-ASQE........DLITLLEK.SIQNIIQMFQ------
A7SL38_NEMVE/58-330RNEFVEKNYTNVSVESI-.GAL........RPEVLVCE.AIKVLISKCR------
Q4DRD4_TRYCC/103-370IVVEKDKTRMRFTIESI-.GQL........HASQIFRY.ALALFAERVR------
Q8LD68_ARATH/86-370VDLGSVKNHFIFNIEST-.GSL........PPEVLFTE.AVKILEAKCE------
A7AT13_BABBO/11-78.........VNIRIQTT-.GK.........PAVKIFVE.CLDDLVEVCN------
B8GF45_METPE/13-80.........PELFITTK-.GEK........SPIAVIRE.ACGRLSGFCD------
RPOA_DESVH/40-237.....NYDKLILEVWTD-.GSV........SPEDAIAY.SAKIIKDQIS------
A6DLN7_9BACT/30-227.....DYDKLELEIWTD-.GRI........SPEDALRK.SAIILRDHLC------
Q4DI42_TRYCC/41-115.........VELRVQTS-SDGSGR...PIPSPKDALLK.AIDACMQDLQ------
A1RX43_THEPD/24-91.........AHLLVRTK-.GSK........QPLEAIRE.AVESLRAKLK------
A3DM82_STAMF/13-81.........LEIIINVE-.PGA........NISEVLLE.ITENIRKFLR------
Q4UFZ3_THEAN/22-315IRIQPDESKFHFTIEST-.GSI........PPEKILEI.ALIVLEKKLQ------
Q9AW23_GUITH/11-287IYISENDANVEFFIETT-.GVI........NPLNLINK.SLIYLKQKLN------
RPOA_MYCS5/28-245.....IEEQLELELETK-.LGV........TPESAIKL.ACKILVAHFQ------
D0N5U8_PHYIT/19-87.........MHIRLQTR-.QGA........LADEALRS.GLTDLRKVST------
Q96HT3_HUMAN/53-326VRLARVRDHYIFSVEST-.GVL........PPDVLVSE.AIKVLMGKCR------
Q8SSL9_ENCCU/42-293IFIGRRSDYFLFTINTV-..FL........DPLYLLEK.AVSVLIEKSR------
RPOA_RECAM/26-219.....TYEELIFYIKTN-.GTC........NPLFVMKN.AFSFLKDKIN------
RPOL_SULSO/13-81.........IIVKILTD-.GSI........TPKDALLK.AIENIRGMTS------
RPOA_SCEOB/29-330....IPNEIVFIELWTN-.GSI........HPRKAFYT.ALLYLKTMFD------
RPOA_MYCPU/26-240.....IEEELEIEIKTK-.GTI........DTKNILSQ.AAQILIAHLQ------
RPOA_ROSDO/31-228.....DYDKLTMKVETD-.GSL........TPDDAVAF.AARILQDQLG------
RPOA_OSTTA/27-253.....DGEYIYFEVWTN-.GSI........NPFDAVKS.AAKVGMKLMT------
D2EFV6_9EURY/14-81.........SIFVIKTD-.GK.........DAEKTLKK.IIEKTESDLK------
A6BM49_BRANA/34-230.....IREMLIFEIWTN-.GGL........TPREAFYE.ACWKLIDLIV------
RPOA_CHLRE/40-320....STDPSLEFSTHLV-.PSL........TTQTNLRQESTHKFVNKAN------
Q48981_MYCCA/25-228.....DLEKLELEVTTD-.GSI........TAIDAISI.ASKILVAHLE------
RPOL_AERPE/14-82.........IQVYVKYE-.DDV........DIKEVLRK.ASDYLLEVIG------
Q7RLX3_PLAYO/25-300VKIIYDETKFHFKIESV-.GSM........PPEQIVEM.AIEILENKLK------
A2F4R6_TRIVA/25-309IVIQSKRGLFVFNVETI-.GSL........SPENVVTR.GFQALTNKLD------
A9A3V3_NITMS/13-79.........CWMRINSS-.S..........KPLGEIKK.ATDSAIKMAD------
B1YD94_THENV/14-81.........AHFKLKVR-.RG.........TPLEAVER.AVKAVLADIE------
A7AQ72_BABBO/46-305VIIKKLSNHFIFSVEST-.GAI........PSGQLFLK.AIGVLKEKSQ------
RPOL_METTP/13-80.........PVFRLKTR-.GV.........DPLDVIRD.ASARIADLCD------
RPOA_MYCH7/26-238.....IEEKLNFSIKTD-.GSI........FAKDALSQ.GAKILIAHLN------
RPOA_ZYGCR/31-224.....RQEMLVLEVWTN-.GSL........TPQEVISQ.ASQNLNDLLK------
C4V9M5_NOSCE/15-83.........MFLRVSCD-.DAI........SVKDCIVE.NLVDLENITQ------
RPOA_CHLAB/39-253.....DFDRLILHVETD-.GRV........SPKEALAF.STQILTKHFS------
RPOA_BDEBA/34-230.....DYDALTLEVWTD-.GSL........KPEEAVAL.SSKIMKEQLQ------
Q2UF63_ASPOR/24-263.DYDAQPNNFYIDVESV-.GVL........EPDMIIQQ.GITVLQRKLA------
RPOA_CHAGL/34-227.....TKEFLIVEVWTN-.GSI........EPKEAIKE.ASYNLVNLFT------
C3YRU6_BRAFL/11-78.........INLRIQSR-.GP.........PAADILRR.GLTELNALCE------
RPOD_METKA/19-262VRVRLRDDAFVFNVETD-.GSM........SLDTAILK.ALDAIEHKLE------
RPOA_HELPY/28-232.....NYEKIIFDIETD-.GQI........DPYKAFLS.AVKVMSKQLG------
RPOA_AQUAE/25-223.....TYERLTLEIFTN-.GIK........TPDQCMQE.AIEILKKHYE------
Q12ZR3_METBU/13-258ITVSADEKSFIFTMESD-.GSY........TAQQLILN.AVNTIKGKAS------
Q8SRR5_ENCCU/14-230..LMQKIDKIHMCVEVV-EGGA........GPLAVVLE.GLRILKEKVA------
B5X6K5_SALSA/31-99.........LFIRLQTD-.GTK........TPRDVFTS.VCEKLINQLE------
RPOA_MYCGE/28-238.....LTDHLTFKIATN-.GAI........KAVDAFAM.AAKILIEHLN------
A8M9E3_CALMQ/16-83.........ITLKLRTK-.GK.........DPLKVLED.AVNRILNDIG------
A9BFZ0_PETMO/28-233.....DYDKLILEIWTK-.KNI........TPTEALKE.ATKILMEHFD------
RPOA_TREDE/32-239.....DYDKLILEIWTD-.STV........RPEDVLGE.AAKIAKDHFS------
A7VR24_9CLOT/25-224.....DYDKLTLEVWTN-.GVI........NAQEAVSL.AAKVLTEHLN------
A0BUX3_PARTE/39-107.........IEIKVQTN-.GSI........KPYDAIQK.TFQDLSDEFK------
RPOA_CUSJA/34-225.....KQEILFLEIWTN-.GSL........TPKEALHE.ASRNLIDLFI------
Q235X0_TETTS/58-330IELAKKKEHF...IQSV-.GIY........EPHEIVKE.AIQILKQKAS------
RPOD_HALMA/17-251VEVSDVPNAFVFHVETD-.GSF........TTEELVLR.AVETLRDRAT------
RPOD_METST/13-260IVVDFEESKYIFKIETD-.GSL........KPFDVLTI.ACDILSEKAD------
A4RSP9_OSTLU/21-304IDVRPGLDCFTFIVEST-.GVL........KVEEVVLQ.AVHILQSKLD------
RPOA_FUSNN/27-224.....DFDKLTLNVETD-.GSI........EIRDALSY.AVELLKLHLD------
B5IB51_ACIB4/16-83.........PTLKIRVK-.SG.........KPQAAIKR.AAKRLEKVFE------
RPOL_METMP/14-90.........PTIMLKTD-.EKT........DAETVLKE.ALKDIVDLCN------
RPOA_UREPA/26-236.....MSEILTIDIATN-.GTI........SGSEAIAI.AAKIMQAHLE------
Q6J224_9STRA/25-221.....ISERLILEIWTN-.GSI........EPIEALKK.ACKIIINCFN------
RPB3_SCHPO/17-257.NFQEEPRRFYMDVESV-.GSI........PPNEIMVQ.GLRILQEKLA------
RPOL_HALLT/13-83.........PVLTVKSE-.SG.........DPLDVLAE.GAESITDRTG------
A2BK79_HYPBU/14-267VKLVYDDKRFILKIEST-.GAL........PPEDIVRE.AARAIVRKAE------
Q4P8L3_USTMA/24-280.DYNKKASKFYFDVEAS-.GSM........HPAEIVET.GLGLLEYRVA------
A0RXH5_CENSY/13-80.........IWMRVNTS-.SG.........SPVKAITD.AADASVSTFG------
RPOL_PYRAB/13-83.........PRFRVVTD-.GKI........TPEKALEE.AAKKIFDRAK------
Q5KMB4_CRYNJ/31-99.........ILLKIQTD-.ERS........NPAEALKR.ACHELIRQTV------
Q22RW2_TETTS/61-128.........MNLRLQTI-.KK.........NSNEVLKE.GLDSLAGLCD------
Q5CSH3_CRYPI/22-315IRVDTKPDKFHFLVEST-.GAL........PVESIVEL.AFEILQEKLN------
Q5KG24_CRYNJ/37-305.DYNAVPSTFYFSAESV-.GSI........PVRSVVEQ.GLDLLIEGLA------
RPOL_METTH/11-76.........PQLYIRAG-............SPKKSLKA.AAETLRDRCD------
A2DQ63_TRIVA/36-105.........IKIRVKAS-QNVN........HPKELIDP.AIEALKTKIA------
RPB3B_ARATH/22-294IEIHPKHDSFVFTVEST-.GAL........KASQLVLN.AIDILKQKLD------
RPOA_PSEAK/61-455.....IKDRVILEVWTN-.GSI........HPRHAIHK.AAKALIQLFL------
A6YGD4_LEPTE/31-529.....FKEQILLEIWTN-.GSI........TPKTAIYK.AADCILDLLL------
RPOA_HERA2/23-219.....DFDRLLLEIWTD-.GTV........KPGDALSY.AAQVLVQYSS------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window