Sequence alignment for CL0509

PF13656

H2M356_ORYLA/23-97CVTFVMHDED-HTLGNSLRYMIM-KN---------PDVDFC-GYT-ITHP----SE-------SK---------------
H2R0V0_PANTR/30-104ACLFTINKED-HTLGNIIKTQLL-KD---------PQVLFA-GYK-VPHP----LE-------HK---------------
RPOL_SACS2/12-86YLELEIEGED-HTLGNLIAGTLR-RI---------SGVSFA-SYY-QPHP----LS-------DK---------------
Q0UWS5_PHANO/103-177TGIFTFNKED-HTLGNLISQRLL-KY---------PYITFS-AYK-VPHP----LF-------AT---------------
B8GF45_METPE/12-85KARLLIAGEG-NTFMNALTEEIL-TD---------PEVDVA-RYR-IKYQ----FS------DPE---------------
A7I5J1_METB6/12-86KARLVIQGEG-HTFMNALVEEIL-TD---------PDVDVA-KYT-IEFQ----FS------DPE---------------
S9VSU8_SCHCR/29-103AAVITIEKED-HTLANMLAQQLL-TD---------ERVLFA-GYK-VPHP----LN-------HN---------------
L0ACU8_CALLD/16-88--KVEIEGED-HTIGNLLSTVLQ-TL---------KGVNIA-YYE-VPHP----LE-------NR---------------
RPOL_SULTO/12-86YLELQIDGEE-HTVGNLLKGYLL-KV---------PGVKFA-SYS-KPHP----LI-------DS---------------
A0A384KHM4_PLAKH/36-108-NIFTIKLED-HTIGNLIKQALC-QD---------PQVTFA-AYR-QPHP----LQ-------NT---------------
F0ZJT3_DICPU/35-109CATFIFTDED-HTLGNSLHYVLM-KN---------PKVDFS-GYS-IPHP----SD-------NR---------------
V5IL63_NEUCR/30-104TSDFKILKED-HTLGNLLAEHLK-QA---------PHVLMA-GYK-IAHP----NV-------PE---------------
G2XWM6_BOTF4/61-134AASFEFKKED-HTLGNALRYIIM-KN---------PDVEFC-GYS-IPHP----SE-------EL---------------
C1EAB7_MICCC/30-99AGTYVVQKED-HTLGNIVRMQLH-RD---------PNVVFA-GYQ-VPHP----SD-------NR---------------
J1AN07_9EURY/12-85KVRMVLKGQG-HTFMNALTEEIL-SD---------PAVDVA-KYV-IKYQ----FS------DPE---------------
U5D302_AMBTC/21-94SSTFSLTDED-HTLGNAVRFVLN-QD---------PRTSFC-GYS-IPHP----SE-------NR---------------
B6AD73_CRYMR/32-146NLTFQINGED-HTLGNIMRHLAM-LN---------PSTTFA-GYA-IPHP----SI-------SS---------------
K1V9X0_TRIAC/34-108AATFVLRAQD-HTLGNMLRAQLL-LD---------PTVLFA-GYK-LPHP----LE-------NV---------------
A0A068YHT2_ECHMU/30-104AAIFTLNRED-HTLGNMITRQLL-KD---------PRVLFA-GYK-VPHP----LE-------HR---------------
RPOL_METBU/12-83EMKMEIAGES-HTLLNMLKIILL-ED---------ERVHTA-SYD-MKHVT--ISE-------PV---------------
A0A068Y929_ECHMU/386-458-ATFRFTGED-HTLGAPLRYCIL-RS---------EAVKLC-GYC-QPHP----LE-------DS---------------
G1XT40_ARTOA/53-127CASFQFENED-HTLGNALRWIIM-KN---------PQVEFC-GYS-IPHP----SE-------TK---------------
F8PIR5_SERL3/20-94AATYQIFDES-HTMGNALRWMLM-KN---------PKVEFC-GYS-VPHP----SE-------NL---------------
A0A015L6K0_RHIIW/30-104AATFEIFRED-HTMGNVIRHKLL-QE---------PQVIFA-GYK-IPHP----LE-------HN---------------
RPOL_PICTO/15-88SITVEMINYD-NTLLRPLVEEIS-RD---------DSVDEI-HYY-IKHP----NLD-----NPQ---------------
K4MG73_9EURY/12-84EMHLEIKGET-HTLLNMLKSVLL-DD---------SRVQIA-TYD-MKHVS--ISD-------PI---------------
I4Y8T6_WALMC/32-106TATFCLFNED-HTIGNALRYILM-KN---------GNVEFC-GYS-IPHP----SE-------PK---------------
M7PEH0_PNEMU/31-106AANITVLNED-HTLGNILREQLL-QD---------ERVLFA-GYR-VPHP---ILE-------HK---------------
RPOL_METS5/12-86YLELRIQGED-HTLGNLIAGRLR-SV---------KGVILA-TYY-LPHP----LK-------DE---------------
U7Q4U5_SPOS1/37-111TSDFLMKKED-HTLGNLLAEHLK-MH---------PKVLMA-GYK-IAHP----NV-------AE---------------
M2MYP9_BAUPA/30-104AALFTFNKED-HTLGNLLRAKLT-KS---------PHVLFA-AYQ-VPHP----LF-------AV---------------
K1WMN3_MARBU/31-104-SVFTFNKED-HTLANILRAHLV-KD---------PHVLFA-GYK-IPHP----LF-------AK---------------
F2KQH2_ARCVS/13-85-VRLLVKGED-HTFLNLLQHYLL-ED---------EDVVVA-KYH-ISHPL--VGE-------PE---------------
M2SYV1_COCSN/30-104TAVFTFNKED-HTLGNLLSQRLL-KN---------PAVMFA-AYK-VPHP----LF-------AT---------------
G7E8P6_MIXOS/27-101SATFCILEED-HTLGNALRYMIM-KN---------PQVQFC-GYS-QPHP----SE-------DK---------------
T1JXZ6_TETUR/15-91CVTLEMLDED-HTLGNSLRYIIM-KN---------QCVKFC-GYS-IPHP----TE-------RR---------------
L0L0D7_METHD/12-85EMHLEIKGET-HTLLNMLKSVLL-ED---------IRIHTA-SYD-MKHVS--ISE-------PI---------------
R4XFR4_TAPDE/31-121ASSFQLANED-HTLGNALRYMIM-KN---------PLVEFC-GYS-IPHP----SE-------PL---------------
YR470_MIMIV/277-352QIDIELYGED-HTLGTILENVLQ-QC---------EYVEKA-GYC-MPHL----LI-------DK---------------
D8RRF0_SELML/32-104A--FTIQRED-HTVGNVVRMQLH-RD---------PNVLFA-GYK-LPHP----LQ-------YK---------------
C6HHU3_AJECH/49-123AASFQFDKED-HTLGNALRYVIM-KN---------PEVEFC-GYT-MPHP----SE-------AK---------------
N1RT61_FUSC4/58-131AASFEFTDEG-HTLGNALRYIIM-KN---------PDVEFC-AYS-IPHP----SE-------PK---------------
M1B174_SOLTU/11-84KATFSLTDED-HTLANAVRFTLN-QD---------PRVTFC-GYS-IPHP----SD-------AR---------------
T1JU99_TETUR/30-104AAIFTVNKED-HTLGNLIRHQLL-KD---------PNVIFA-GYK-VPHP----LE-------HK---------------
E0SNS0_IGNAA/14-87ELRFILYDEDKHSLPNLITKIAL-SK---------PSVTYA-AYI-LQHP----IT-------SY---------------
F2U1F2_SALR5/30-104AGTFRINRED-HTLGNMLASQLR-RD---------PRVLFS-GYR-CPHP----LE-------HH---------------
M9SCC2_METAX/7-77TLRLGLKNHS-TTIIEPLIQELN-QN---------EDVEYC-RYI-VDHP----DLD-----DPY---------------
D8QE38_SCHCM/21-95AATYQIYDES-HTLGNALRWMIM-KN---------PNVEFC-GYS-APHP----SE-------NV---------------
A4I2U7_LEIIN/39-119SSLFKMEKED-HTLANLLRMKLH-ES---------PFVQIA-GYR-VPHP----TK-------HN---------------
U5H732_USTV1/35-109AVTYCINDED-HTLGNLLRWMLM-KN---------PDVEFC-GYS-APHP----SE-------AK---------------
V2XV85_MONRO/10-84AATYQIHDES-HTIGNALRWMLM-KN---------PKVEFC-GYS-VPHP----SE-------PN---------------
D7LLA3_ARALL/11-84HASFTLSEED-HTLANAVRFVLN-QD---------PRVTVA-AYT-IPHP----SL-------EQ---------------
D9Q2R4_ACIS3/13-87SYVIEIENED-HTLGNLLSSTLA-GV---------KGVVDA-YYE-LEHP----LF-------RR---------------
RPAC2_DANRE/22-96CVTFVLNEED-HTLGNSLRYMIM-KS---------QDVEFC-GYS-ITHP----SE-------SK---------------
RPOL_AERPE/15-87--VIQVYGED-HTLGTLLVEAIK-RV---------SNPKLA-YYE-AVHP----ME-------DI---------------
R4XLF1_TAPDE/31-105CATIKFEKED-HTLGNLLRAQLL-KD---------ERVLFA-AYK-VEHP----LD-------HS---------------
E3GW45_METFV/12-82ELEIILKGEN-HTFCNLLRKKLL-ED---------KDVEVA-AYT-IDHPI--VGE-------PR---------------
Q75CF1_ASHGO/30-104AVIITFEKED-HTLGNIIRAELL-ED---------ERVLFA-AYK-VEHP----LF-------AR---------------
K0IDG9_NITGG/12-80AIELKIREED-ISILYIIQHELL-KE---------KSVDFA-GVI-QKHP----LT-------KE---------------
N1JCQ0_BLUG1/30-104SSVFTVNKED-HTIANILRAHLL-KD---------PHVLFA-GYK-TPHP----LF-------AT---------------
E1RHP8_METP4/13-82-ARIMFVGEG-HTFMNVLVDEIL-KN---------PEVDVA-NYS-SEFH----FT------DPV---------------
Q4UD30_THEAN/39-109--TFIVHLED-HTFGSLIRTKLS-KD---------DRVTFV-GYR-MPHP----LE-------NK---------------
A7SGE2_NEMVE/30-104AAHFVVNKED-HTLGNLLREQLL-KD---------PQVIFA-GYK-VSHP----LE-------HK---------------
I1H2S9_BRADI/30-104AASFTIERED-HTIGNILRMQLH-RD---------PNVLFA-GYK-LPHP----LQ-------YK---------------
C5DEP5_LACTC/30-104AVIVTFEKED-HTLANLIRGELL-ED---------KGVLFA-AYK-VEHP----LF-------AQ---------------
K3YB14_SETIT/11-84ASSFSIMEED-HTLANSVRFVLN-QD---------PRVAFC-GYS-IPHP----AE-------NK---------------
H6BY80_EXODN/40-116AASFQIEKED-HTLGNALRYFVT-KN---------PDVEFC-GYT-IPHP----SE-------TK---------------
C1N3U7_MICPC/5-79EKTFTLKDED-HTMGNAIRYMLN-KN---------PQVALA-GYS-VPHP----ME-------RS---------------
A7ELB7_SCLS1/31-105SSIFTFNKED-HTLANMLRAHLL-KD---------PHVIFS-GYK-IPHP----LF-------SK---------------
A3DM82_STAMF/12-86EIIIEIIGED-DTLGNLIAKEAM-KH---------PKVVYA-SYR-IPHP----LQ-------NR---------------
T0N787_9EURY/16-89SITFEIMNYD-NTLLRPLVEEIQ-KD---------EQVTES-RYY-IKHP----VID-----NPR---------------
K0KAE3_WICCF/30-104AAIVTFEKED-HTLGNLLRAQLL-KD---------ERVVFA-AYK-VEHP----LF-------AN---------------
B7G3C7_PHATC/32-107AGTFRLNKED-HTVLNLLRMQLL-RD---------PGVRFA-GYI-HPHP----LI-------NY---------------
T1FV14_HELRO/24-100CQTYVITGED-HTLAGALNLMLH-KN---------PDVRSA-GYS-IPHP----LE-------NK---------------
RPOL_HALMA/12-89ELSIEIAGED-HTFMNVIKGALL-ET---------EGVTAA-TYD-VNPE----QSGG--QTDPV---------------
RPOL_PYRAE/16-89YLELKAKGET-YTLFSPLVEYLS-ND---------PDVEYV-QFD-VDHP----LQ-------EN---------------
D5E7V1_METMS/12-83EIQVEIKGES-HTLLNMLKHFLL-ED---------EHVDIA-SYD-MLHVS--ISE-------PV---------------
B8P7Q9_POSPM/10-85AATIKVLKQD-HTLGNLIRAYTT-VV---------DAANFVCRYK-VPHP----LQ-------PH---------------
I1CQ65_RHIO9/65-139ALTFCFKNED-HTLGNSLRHVIN-KN---------RDVDFC-GYS-IPHP----SE-------AK---------------
A3FPR0_CRYPI/32-103---FMIMLED-HTLGNLITTQLL-RD---------PNVIFA-GYK-VPHP----LE-------PL---------------
Q4E3C1_TRYCC/40-120SSLFKLDKED-HTLANLLRMKLH-ED---------ALVHIA-GYR-VPHP----TQ-------HR---------------
A1CD73_ASPCL/66-140TAIFTFNKED-HTLGNLLRSRLL-QS---------PHVLFA-GYK-IPHP----LV-------PK---------------
R4G2Y7_RHOPR/16-87SRTFVFYDEG-HTLGNALHFIIS-NY---------PEVNFC-GYT-IPHP----AE-------AK---------------
N1JCX8_BLUG1/50-124AASFEFKNED-HTLGNALRYIIM-KN---------PMVEFC-GYS-IAHP----TE-------PF---------------
K1W3H6_TRIAC/50-124ACTFCLWEED-HTLGNALRWMIM-KD---------PDVEYC-GYS-APHP----SE-------PK---------------
C3YRU6_BRAFL/10-83CQTFVLHDED-HTLGNALRYMIM-KN---------PDVDFC-GYS-VPHP----SE-------HK---------------
V5FS87_BYSSN/46-120AASFQFEGED-HTLGNALRYVIM-KN---------PSVEFC-GYT-IPHP----SE-------AK---------------
H3GWJ9_PHYRM/21-94-KTYEFFEED-HTLGNALRYVLM-RN---------PDVDFC-GYT-IPHP----SE-------PK---------------
A4S056_OSTLU/30-104AGTFVLQRED-HTIGNLLRMELH-KN---------PDVVFA-GYK-NPHP----TD-------HR---------------
J3K3I0_COCIM/30-104TAIFTFNKED-HTLGNLIRAQLL-KS---------QHVQFA-GYK-VPHP----LV-------HK---------------
F4P6Q6_BATDJ/4-78SATFCISNED-HTLGNALRYIIM-KN---------PAVSFC-GYS-VPHP----SE-------YQ---------------
M7SKI7_EUTLA/74-148AASFEFTKEG-HTLGNALRYIIM-KN---------PDVEFC-AYS-IPHP----SE-------DK---------------
I3EF49_NEMP3/8-90SFTIELLKTN-HTILNVIRWAIN-EFESV------YDVELI-GYT-IPHP----ME-------ER---------------
R9T596_METII/12-84SIRIQLLDAD-MTLVQPIINELI-KD---------EGVDEV-RHI-TGHP----ELD-----LPV---------------
J9DLV1_EDHAE/73-147TVELEIHGET-HTLGNILADRLL-QD---------TRCVFA-AYK-VPHP----LE-------EK---------------
G7WNR7_METH6/12-85ELHLEFFGES-HTLLNLLRTELL-ED---------DRVLIA-TYD-AKFPM--MTN-------PI---------------
J9DRQ7_EDHAE/17-93DSTVEVIDED-HTLLNPLRYMIT-KN---------DHVELV-GYS-IPHP----SE-------RK---------------
R0KLQ1_NOSB1/56-130TIEIRVDGET-HTLGSSLTDEIS-RD---------NRCKFS-TYK-VEHP----MD-------NH---------------
G4TQB3_SERID/33-107AATFRIYKQD-HTLANMIRTQLL-ED---------KNVIFA-GYK-VPHP----LE-------PY---------------
E6N524_CALS0/14-87--AISVYDVD-QSILNLFTETLN-SI---------EGVSYA-GYR-VEHP----LT-------GE---------------
S2JHT7_MUCC1/30-104AATFAIERED-HTLGNILRGQLL-KD---------PRVLFA-GYK-VPHP----LE-------HN---------------
C7YU34_NECH7/39-113TSDFVLKKED-HTLGNLLSEHLK-MH---------PNVYMA-GYK-IAHP----NV-------PE---------------
S7W7N8_SPRLO/17-90TINITLDGET-HTLANLVVDRML-ND---------KNCIFG-AYK-QPHP----LE-------EK---------------
F4BTP0_METSG/12-85EAVIEFVGEG-HTILNLLRTELL-KD---------KRVLMA-TYD-TKFPV--MDN-------PV---------------
T1H6G1_MEGSC/11-83CRTFVITDEG-HTLGNALKCIIC-RY---------PEVDFC-GYT-IPHP----VE-------NK---------------
B5IB51_ACIB4/15-88EMILEVINAD-RTLLIPLVEELN-KD---------EMVEQA-IYH-YDHP----YLE-----NPT---------------
E2C409_HARSA/11-83-KTFVFMDEG-HTLGNALKYVIS-QY---------PEVIMC-GYT-LQHP----AE-------SK---------------
Q7PM95_ANOGA/17-91SRTFVFEDEG-HTLGNVLKSIIC-KY---------PDVNFC-GYT-VPHP----AE-------NK---------------
D4GVL8_HALVD/12-89ELRIEIGGED-HTFMNVLKGELL-QT---------DTVTAA-TYD-VNPE----QSGG--QTDPV---------------
Q6C7Q3_YARLI/30-104CANIKFEKED-HTLGNLLRSQLL-HD---------SRVIFA-AYK-VEHP----LF-------AN---------------
D3BVK7_POLPP/27-100CATFIFVDED-HTLGNALHYVLM-KN---------PKVDFS-GYS-IPHP----SD-------NK---------------
L7K018_TRAHO/20-92TVELHINGES-HTLGNLIAEKIL-SD---------PRCTFS-AYK-VNHP----LD-------EE---------------
E4NQ40_HALBP/12-89ELRLEIAGED-HTFMNVIKGALL-ET---------PGVAAA-TYD-VNPE----QSGG--QTDPI---------------
A0RXH5_CENSY/12-85EANLSIRESD-IGILYIVQHELL-KK---------SGIEFA-GVI-LKHQ----LT-------SE---------------
H6BMI7_EXODN/175-249TMIFVYNKED-HTLGNALVDQLH-KN---------SHVTYA-AYR-VPHP----LF-------AR---------------
B9GIX0_POPTR/11-84SATFCFVDED-HTLANSVRFALN-QD---------PRVSFC-GYS-IPHP----SD-------AK---------------
L0JP64_NATP1/12-89ELSIEIAGED-HTFMNVLKGALL-EH---------DDVSAA-TYD-VNPE----QSGG--QTEPI---------------
B6AF09_CRYMR/38-109---FMIMLED-HTLGNLLRTQLL-RD---------PSVIFA-AYK-VPHP----LE-------PM---------------
S7ZBA7_PENO1/30-104AAIFTFHKED-HTLGNMIRSRLL-KT---------AHVTFA-AYK-VPHP----LT-------PN---------------
W7WXG3_TETTS/100-173SKTIHMNLED-HTIGNLMRMHLL-KN---------KEVKFA-GYK-VPHP----LE-------PK---------------
F8QFM3_SERL3/30-104AATFKIMKQD-HTLGNMVRAYVL-AM---------PQVLFA-GYK-VPHP----LH-------PY---------------
Q2FNB5_METHJ/12-85KVRISLAGQG-HTFMNALKTEIL-TD---------PTVDVA-NYV-IEFQ----FS------DPV---------------
U5H4K1_USTV1/30-104AATVTINKQD-HTLANMLRAQLL-SF---------SYVTFA-GYR-VPHP----LE-------PK---------------
I2FXZ1_USTH4/31-103AATFWFNKED-HTLGNMLRHAVL-AN---------PAVLFC-GYK-VPHP----LE-------PK---------------
RPOL_METJA/12-94LVEIELINED-HSLPNLLKDILL-TK---------EGVKMA-SYS-IDHP---LLHPETGRYISN---------------
R9SMX5_9EURY/16-89ELEIVLHGEK-HALCNALRKILM-ED---------DDVQYA-VYG-IDHPL--IGE-------PI---------------
E1QRF2_VULDI/13-86YLEAVVQGET-YTLFAPLIEYLL-KR---------PDVEYA-MYD-VDHP----LT-------QN---------------
M1XQZ1_NATM8/12-86ELSIEVQGED-HTFMNVLKGALL-EV---------EGVTTA-TYD-MNPE----QSGG--QTDPV---------------
E2AMR2_CAMFO/8-79--TFVFVDEG-HTLGNALSYVIN-QY---------PGIKIC-AYT-VPHP----AE-------NK---------------
B4JPA4_DROGR/18-90-RTFVFNNEG-HTLGNALKTIIA-RY---------PEVDFC-GYT-IPHP----TE-------QK---------------
I0A279_FERFK/18-92ELEIVLYDED-HTFGNLMAKTLM-KI---------DGVVMS-YYR-IDHP----LK-------NE---------------
D8J3W9_HALJB/12-89ELALEIAGED-HTFMNVLKGSLL-ET---------EGVTAA-TYD-VNPE----QSGG--QTDPV---------------
M7P2B5_PNEMU/30-104SVTFQIIKED-HTLANALRYIIM-KN---------PDVEFC-GYS-IPHP----SE-------PK---------------
T1IFN7_RHOPR/30-104AAIFTINKED-HTLGNMIRNQLL-KD---------PKVLFA-GYK-VPHP----LD-------PK---------------
W1QG67_OGAPD/30-104CVLIKFERED-HTLGNLLKQELA-ND---------PQVLFV-AYK-VEHP----LF-------AN---------------
H1VZW5_COLHI/30-104TSDFVIKKED-HTLGNLLSEHLK-AH---------KNVLMA-GYK-IAHP----NV-------PE---------------
Q22RW2_TETTS/60-133CATYTFYDED-HTLGNTVRYMLV-KR---------KDVEFC-GYT-IPHP----SE-------NK---------------
B7P8Y3_IXOSC/17-90CRTYLLDDQD-HTLGNSLRYMIM-KN---------PQVKFC-GYA-IPHP----SE-------RK---------------
A0A087ZQW2_APIME/16-89CKTFVFMGEG-YTLGNSLVSVIS-QN---------PNVEFC-ACF-VNHP----AE-------GN---------------
R0KJ67_SETT2/43-117AASFQFDGED-HTLGNALRYIIH-KN---------PDVEFC-GYS-IPHP----SE-------AK---------------
RPOL_METKA/17-102EVLLELPGED-HTLCNLLRWALN-RQ---------DGIIAT--YR-IEHP----ILGKEHKVDEE---------------
A0DTF6_PARTE/43-114--TFVFFDED-HTLGNSLRYILA-NQ---------PNVEFC-GYS-LPHP----SE-------NK---------------
Q2NE51_METST/10-81KLVLEITGES-HTICNILRKRLM-DY---------DEVDAA-AYD-ITHPL--IGQ-------PE---------------
R0MC98_NOSB1/13-94EISLSIKNED-HTIMNPIKYAIQ-SDFAK------MGVEFC-GYT-IPHP----SE-------ST---------------
R4WAG4_9EURY/12-87ELSIEIAGED-HTFMNVLKGTLL-ET---------DGVEAA-TYD-MNPE----QSGG--QTDPI---------------
F4Q1X1_CAVFA/30-102ACMFTILKED-HTLGNLIRMQLV-GD---------PDVKFA-GYR-MPHP----LE-------HN---------------
D3DYV1_METRM/12-87ELEMIIHGEN-HSLCNVLRKYLM-ED---------DDVEYA-VYG-IDHPLTGAGK-------PV---------------
D3S1Z5_FERPA/13-85-VKLVIKGED-HTYLNLLQHELL-KD---------DDVILA-KYH-IPHPY--VGE-------PE---------------
F4B3S3_ACIHW/12-83YAEIEIEGEE-HTLGNLLAGSLR-KV---------EGVIYA-SYY-QPHP----LV-------NS---------------
T0MN48_9EURY/13-85-IVYEVLNND-NTILRPLMEEIE-ND---------SMVDNV-RYY-FEHP----YLS-----NPK---------------
Q5KMK6_CRYNJ/39-113ACTFALWQED-HTLGNALRWIIM-KD---------PEVEFC-GYT-APHP----SE-------PK---------------
A8NBN7_COPC7/30-104AATIKVVKQD-HTLGNMLRSQLL-AM---------PEVLFA-GYK-VPHP----LH-------PY---------------
F1A1H8_DICPU/30-104ASMFVILKED-HTVGNLVRMQLV-AD---------PDIIFA-GYR-MPHP----LE-------HN---------------
A0BUX3_PARTE/39-112-CCVKLYLED-HTIGNLTRMNLL-KQ---------KEVTFS-GYR-QIHP----LQ-------HT---------------
H8ZDJ1_NEMS1/30-105SIELSIRDED-HTIGNALASELQ-KN---------EDVAFA-AYK-IPHP----LQ-------NI---------------
B7FZW0_PHATC/2-83SRTFCIGDED-HTLGNAVRHVLI-RN---------NSIGFA-GYS-VPHP----SE-------PV---------------
I2H4R7_TETBL/30-104TVVITFEKED-HTLGNLIKSELL-HD---------PKVLFA-AYK-VEHP----LF-------AR---------------
RPOL_HALWD/12-91ELRIEVAGED-HTFMNVIKGALL-QT---------DGVAAA-TYD-VNPE----QSGG--QTEPV---------------
C4V9M5_NOSCE/14-88TIELKVEKET-HSLGSSLSDKLC-KD---------KRCIFS-SYK-VCHP----KD-------DF---------------
B6Q8P4_TALMQ/30-104TSIFTINKED-HSVGNLLRGRLL-QN---------RHVTFA-AYK-IPHP----LV-------HK---------------
G8BPN3_TETPH/48-122SASFQISEED-HTLGNALRHIIM-KN---------PEVEFC-GYS-IPHP----SE-------TL---------------
D5G8A7_TUBMM/30-104AAIFTFNKED-HTLGNLLRATLL-HN---------EHVVFS-AYK-VPHP----LF-------PK---------------
RPB3_ASFB7/278-353KAIITIKDET-HTIGNLLKTCIYEMI---------PDISFV-GYQCVPHK-------------QE---------------
A7SBE9_NEMVE/4-77CMTFVLHDED-HTLGNSLRYIIM-KN---------PDVKFC-GYS-IPHP----SE-------SK---------------
S3D3J4_GLAL2/36-110SSVFTFHKED-HTLANMIRAHLL-KD---------QHILFA-GYK-IPHP----LF-------AK---------------
R7YXM0_CONA1/57-131TAIFTFNKED-HTLGNLLASRLH-KY---------PHVQFS-AYK-VPHP----LF-------AT---------------
K1QKY4_CRAGI/25-98CKTFVFHNED-HTLGNSLRYMVM-KN---------PEVQFC-GYS-VPHP----SE-------SK---------------
L2GWA5_VAVCU/33-104--TIRIAHED-HTLMNVIQYFLM-QH---------PFVVA--GYV-IPHL----SE-------DV---------------
RPOL_SULAC/12-86YLELQIDGEE-HTIGNLLKGMLL-KV---------PGVKFA-AYS-LPHP----LI-------TS---------------
D8T4E7_SELML/4-76-STFCFNGED-HTLGNSLRFLLN-KD---------PRVVFC-GYS-VPHP----SE-------NK---------------
M2R9T6_CERS8/30-104AATIKVVKQD-HTLGNMLRAQLL-QM---------PEVLFA-GYK-VPHP----LQ-------PY---------------
C4LXS9_ENTHI/28-101-CKFTLVKED-HTAGNILRVMLL-RN---------PHVLFA-GYR-QPHP----LN-------YV---------------
G2MGD7_9EURY/12-89ELRIEIAGEG-HTFMNVLKGTLL-ES---------DDVAAA-TYD-VNPE----QSGG--QTEPI---------------
A2DKG2_TRIVA/20-91---MLFTGET-YTMGNALRQTIL-QN---------PKVNFC-GYT-VPHP----AE-------TK---------------
W5J6V9_ANODA/30-104AAIFTVNKED-HTLGNMIRNQLL-KD---------PNVLFA-GYK-LPHP----LE-------HK---------------
G4RLB3_THETK/13-85-LELKTKGET-YTLFSPLVEYLS-ED---------PDVEYV-TFD-VGHP----LI-------ED---------------
Q6CIV1_KLULA/45-119SASFRITDED-HTLGNTLRYMIM-KN---------PEVEFC-GYS-IPHP----SE-------NF---------------
RPAC2_CAEEL/60-134NLTLIMYEED-HTIGNSIKHILS-RM---------DEVEFC-GYN-VPHP----LE-------DK---------------
E2LXE8_MONPE/30-104AGTIKIVKQD-HTLAGMLRAQLL-SM---------PQVLFA-GYK-VPHP----LH-------PY---------------
Q8SS03_ENCCU/18-92TIELRIEDET-HTLGNLLSEELL-ED---------KRCLFS-AYR-VEHP----AD-------TH---------------
RPOL_NATPD/12-89ELAIEIEGED-HTFMNVLKGALL-EL---------DGVTAA-TYD-VNPE----QSGG--QTEPI---------------
F4RFP0_MELLP/30-104ACTVTINKED-HTLGNMLRAQLL-QM---------EYVIFA-GYK-VPHP----LE-------PR---------------
L2FWL1_COLFN/54-127AASFEFIDEG-HTLGNALRYIIM-KN---------PDVEFC-AYA-IPHP----SE-------AK---------------
A8M9E3_CALMQ/15-88YMEVTVEGED-YTVMSPLLTYIL-QD---------PEVEFA-TFD-MDHP----LL-------RN---------------
R1GQM6_BOTPV/30-104TAIFTFNKED-HTLANLLTARLH-KY---------KYVTFA-GYK-VPHP----LF-------AK---------------
W0JQG4_9EURY/12-89ELSIEIGGED-HTFMNVLKGTLL-EQ---------ENIAAA-TYD-VNPE----QSGG--QTDPI---------------
M5EBF3_MALS4/31-105AATFVFNKED-HTLGNMLRHAVL-AQ---------PGVLFC-GYK-VPHP----LE-------PR---------------
RPB11_DICDI/30-104ASMFTILKED-HTIGNLIRMQLI-AD---------QDIIFA-GYR-MPHP----LE-------HN---------------
B8C8G2_THAPS/2-77SRTFVLGDED-HTLGNALRHVLI-ND---------ARVDFA-GYC-VPHP----SE-------PV---------------
A5DL81_PICGU/34-108AATFQIIDED-HTLGNTLRYVIM-KN---------PEVEFC-GYS-IPHP----SE-------NK---------------
A4RTY9_OSTLU/12-88EATFTLAGED-HTLANALRHALN-GN---------ADVALC-GYS-VPHP----MK-------RE---------------
D8T102_SELML/13-86SSTFCINDED-HTFGNSIRYVLN-GD---------PRVTFC-GYS-VPHP----SD-------NR---------------
A9A3V3_NITMS/12-84EINLSITETD-IGILYLIQHELL-KE---------SNIDFA-GVI-VKHP----LT-------NE---------------
G2XE43_VERDV/55-129TSDFVIKKED-HTVGNLISEHLK-MH---------QHVLMA-GYK-IPHP----NV-------SE---------------
U7PQ43_SPOS1/69-142AASFEFLEEN-HTMGNALRFVIM-KN---------PNVEFC-AYA-IPHP----SE-------AK---------------
D8QD48_SCHCM/30-104AVTVKIVKQD-HTLANMLRSQLL-NN---------PQVLFA-GYK-VPHP----LE-------PY---------------
RPOL_ARCFU/12-85YVRLVIKGEG-HTYLNLLQHYLV-ED---------EDVIVA-RYN-IPHPL--IGE-------PE---------------
B6JWF5_SCHJY/34-108SVTFQIQKED-HTLGNALRYMIM-KN---------PDVEFC-GYS-IPHP----SE-------AK---------------
B8D6L1_DESA1/12-85ELVLEIYDED-HTLGNLLAKEAI-RH---------PGVEYA-AYR-VPHP----LK-------NM---------------
Q5KMB4_CRYNJ/30-104ASTIVIRRQD-HTLGNMLRAQLM-LD---------PTVLFA-GYK-VPHP----LE-------ND---------------
RPOL_THEKO/12-86LLEFYLEGED-HTFANLLTETLH-EN---------EHVTFA-GYT-IEHPI--TMA-------RK---------------
E1Z8C1_CHLVA/21-94-IVLALGDET-HTLGNALRDVMW-AH---------PHVQLA-SYT-QEHP----SL-------NE---------------
W0K2F8_9EURY/12-86ELTIEIAGEN-HTFMNVLKGALL-ET---------DGVEAA-SYD-VNPE----QSGG--QTEPL---------------
K0K8C5_WICCF/41-115AASFQILDED-HTLGNALRYIIM-KN---------PDVEFC-GYS-IPHP----SE-------TK---------------
C5DRN5_ZYGRC/48-122CASFQIAEED-HTLGNALRYMIM-KN---------PDVEFC-GYS-IPHP----SE-------NL---------------
D2VMS3_NAEGR/73-147-STFIFHKES-HTMGNSVRHMLM-KN---------KKVSFC-GYT-VPHP----LE-------AK---------------
B3S6B1_TRIAD/30-104ACHFTIAKED-HTLGNIIRAQLL-KD---------PQVIFA-GYK-VPHP----LE-------YD---------------
Q4D7H8_TRYCC/46-118TVTIAFSHED-HTLGNPLRHVLM-QN---------REVTSA-GYA-IPHP----LE-------AK---------------
B8C993_THAPS/30-105AGTFTFNKED-HTVANLLRMQLL-RD---------PAVKFA-GYM-HPHP----LI-------HK---------------
F4R4H4_MELLP/28-101AATFCLKDED-HTLGNSLRYIIM-KN---------PDVEFC-GYS-LPHP----SE-------PK---------------
A0A1I7VJK8_LOALO/25-99NLTVILYEED-HTIGNSLKHILC-KM---------RDVEFC-GYN-VPHP----LE-------DK---------------
A0A3Q7JPU4_SOLLC/30-104AATFTVERED-HTIGNIVRMQLH-RD---------DNVLFA-GYK-LPHP----LQ-------YK---------------
A7AT13_BABBO/10-83NITFSIENED-HTLGNAVRTLLV-ER---------EDVFFA-GYS-VPHP----MQ-------PE---------------
A0A0D2WNY4_CAPO3/30-104AAVITVNKED-HTLGNLLRVQLL-RD---------PKVLFS-GYH-VPHP----LQ-------SK---------------
F7XMD7_METZD/12-85ELSIEIKGED-HTFLNMLKFILL-ED---------ERVNIA-SYD-MKHVS--ISD-------PI---------------
RPOL_METAC/12-85ELEVELRGET-HTLLNLLKDLLI-KD---------ERVEAA-FYD-MKHVS--ISD-------PI---------------
I3TDP2_THEC1/12-84ELVIEIQGED-HTLGNLLAKEAL-LD---------PRVEYS-AYR-IPHP----LQ-------ER---------------
L0IAW3_HALRX/12-89ELSIEIAGED-HTFMNVLKGSLL-EH---------EHVNAA-TYD-INPE----QSGG--QTDPI---------------
G4MRX6_MAGO7/30-104TSDFTFKKED-HTLGNMLTEHLK-QH---------PNVLMA-GYK-VSHP----NV-------PE---------------
I4Y841_WALMC/30-105TSTITLNRQD-HTIANLLSNEIS-KD---------KNVVFS-GYR-VPHP----LN-------PK---------------
A9V2R7_MONBE/30-104AGTFRMNRED-HTVGNLLASQLA-KD---------PRVLFA-GYK-VPHP----LE-------HY---------------
G3B1F5_CANTC/30-104AAIIKIEKED-HTLANLLRAQLL-KD---------ERVLFA-AYK-VEHP----LF-------AN---------------
D5TZM1_THEAM/12-85HLAIKIKGED-HTLGNLLMKEAL-RH---------PKVVYA-SYR-VPHP----LR-------EE---------------
G0QUQ1_ICHMG/39-110SKTIIMNLED-HTIGNLIRMYLL-KS---------KEVKFA-GYR-MPHP----LE-------TK---------------
RPOL_METTH/10-80EMEIVFEGET-HTLCNVLRSILM-ED---------EKVKAA-AYS-IDHPI--VGE-------PQ---------------
D8TM87_VOLCA/31-104-GTFSFRSED-HTMGNLLRMQLH-SD---------KAMVFA-GYR-IPHP----LE-------PV---------------
D1YYQ6_METPS/12-86EIEVEIKGED-HTLMNALKSALL-RD---------KAVKVA-TYD-IVYPG--ISN-------PI---------------
Q2GXS9_CHAGB/4-78CSDFLMLKED-HTLGNLLSVYLK-MA---------PHVMMA-AYK-IGHP----NV-------PE---------------
D5GDE1_TUBMM/9-87SASFEILGED-HTLGNALRYIIM-KN---------PEVEFC-GYS-IPHP----SE-------EK---------------
Q384D9_TRYB2/46-118AATVTFSHED-HTLGNPLRHVIM-ED---------PSVTSA-GYA-IPHP----LE-------AK---------------
A2BNA1_HYPBU/16-90TIEVELEGED-QTIANLIAKYAI-RK---------PGVVYA-SYI-ISHP----LV-------SN---------------
A0A0K3CST6_RHOTO/30-104AATLTINKED-HTLANMLRSQLL-LF---------PYVQFA-GYK-VPHP----LE-------PR---------------
A8AA05_IGNH4/20-92EVRIRIPNES-HTLGNLITKLAS-RK---------KGVTAL--YM-VEHP----LR-------QV---------------
Q386T9_TRYB2/39-119SSLFKLDRED-HTLANLLRMRLH-EN---------PLVHIA-GYR-VPHP----TQ-------HR---------------
RPOL_THEAC/20-93SITVEMINYD-NTLLRTLVEEIL-KD---------DQVDEA-RYY-IKHP----VID-----NPQ---------------
F9XIJ4_ZYMTI/8-82AASFAFEKED-HTLGNALRYMIM-KN---------PDVEFC-GYS-IPHP----SE-------AV---------------
C4R3Z5_KOMPG/30-104CIIIKFERED-HTLANLLREELA-LY---------PDVTFV-AYK-VEHP----LF-------AN---------------
S7W9T0_SPRLO/10-89EYTFSITDED-HTLMNPLQWSIS-QD---------KSVDIC-GYT-IPHP----SE-------NI---------------
J3NY74_GAGT3/30-104CSDFTFMKED-HTLGNLLCEHLK-QQ---------PNVLMA-GYK-VGHP----NV-------PE---------------
L8FLZ9_PSED2/92-166SSIFTILKED-HTLANLLRAHLL-KD---------PHVTFA-GYR-VPHP----LF-------AT---------------
G0MZ50_CAEBE/29-103AAIFTINKED-HTLGNMLKVQLL-KD---------PEVLFA-GYK-NPHP----LE-------HK---------------

PF01193

H3E9U3_PRIPA/103-278--KFSLEDTD-LSVANSLRRVFI-AEA--------PVMTID-WIQ-IESNTSVLHDEFVSHRMGLIPLTSEISSKKWSAL
RPOD_HALSA/19-239--RFVVRNIT-PAFANGIRRAIL-VDV--------PTLSID-TVR-FVENSSVMFDEQLGLRLGLVPLTTPEDYAAGEAV
A6UW03_META3/17-181--KFTIGGAP-ISFSSALRRIMV-SSV--------PTYAIE-NVY-FYENSSSMYDEILAHRLALIPITGKPVISDEVVR
K4MD35_9EURY/16-255--KFVLSDVS-AAFANGIRRAAL-SDV--------PTLAIT-YVN-IYNNTSVLFDEQLGLRLALIPLAANIEEFVPVEE
RPOD_METAC/16-256--KFVLSNVS-TAFANGIRRAMV-ADV--------PTLAIE-YVN-LYDNTSVLYDEQLALRLSLIPLATDIETYLPQAE
F7XMN5_METZD/16-254--SFVLSDAS-VAFANGIRRAML-ADV--------PTLAID-EVN-VYNNTSVLYDEQLGLRLALIPLTANMDDYIPKDE
D5EC45_METMS/14-256--RFILSDVD-AAFANGLRRAML-ADV--------PTLAID-EVN-IYNNTSVLYDEQIALRLALVPLVTIFNEFTPHEE
A0B9L4_METTP/14-253--RFLLTGVT-PAFANAIRRSCI-AEV--------PKLAID-EIS-IYENTSVLFDEQIALRLGLVPIRADDLSVYSTPD
RPOD_ARCFU/16-253--KFILKNAS-PALANSFRRAMK-AEV--------PAMAVD-YVD-IYLNSSYFYDEVIAHRLAMLPIKTYLDRFNMQSE
D2RD94_ARCPA/14-250--RFILHNAP-IALANSFRRAMK-SLV--------PTMAVD-YVV-FYMNTSFLYDEIIAHRIGLIPIKTDLERFNMPDK
E1RIT7_METP4/14-260--RFTLKDAT-PAFANTFRRTMI-GEV--------PTLAIE-DVL-IYDNNSALFDEMLAHRLGLIPIKTDLSEYVKKSE
L0HCN0_METFS/14-260--RFTLSGAS-PAFANAFRRAMI-GEV--------PTLAIE-DVR-IYDNTSALFDEMLAHRLGLIPLKTDLSVYSTQDT
U6EDP0_9EURY/14-254--VFTVEGVD-VSLVNALRRISM-VEV--------PTLAIE-TVE-FLKNDARIFDEALAHRLGLVPLKTDLEALVLASE
RPOD_METTH/14-254--VFVVSGVT-VPFINAIRRICM-MEV--------PKLAIE-YVN-MYRNDAKMFDEVLAHRLGLVPLAADPEFAESLKM
R9SN57_9EURY/14-256--VFIIRDAE-VPFVNAIRRIAM-MGV--------PKLAIE-DVN-IVKNESAMFDEVLAHRLGLTPLVSDLESIEGLVL
E3GZF2_METFV/14-254--KFTIDGVD-TSFVNALRRASM-TEV--------PKLAIE-YIR-IVTNTSRMYDEMLAHRLGLIPLRSNEKIVGNLLM
RPOD_METKA/20-261--TFIIEETS-AEFVNTIRRALY-TLV--------PTLRIE-EVI-IYENDTPMYDEMLAHRLGLIPLRVDDIDQFELPD
RPOD_PICTO/13-262--KFSISGIT-PAIANSIRRTLI-NDI--------PKLAIE-NVV-FHHGEIRDSEGNVYDSSLPLFDEVVALRLGLIPL
T0M5U1_9EURY/14-262--KFSIDGID-SGIANSIRRTLI-NDI--------PKLAIE-KVT-FHHGQIRDGEGNVYDSSLPLFDEIVAHRLGLIPL
T0LUK9_9EURY/20-279--RFEITNIT-EGTANALRRTLI-NDI--------PKLAID-KVI-FRHGQIRDSMGNVFDSSLPLFDEIVAHRIGLVPI
B5ID28_ACIB4/14-263--KFEIKGIT-PSVANALRRTLI-NDI--------PKLAIH-KVI-FHHGQIRDMEGNVYDSSTPLFDEIIAHRLGLIPL
T0LNF0_9EURY/16-263--RFEVSDVT-PAYANMLRRTLI-NDI--------PKLAIS-KVN-FHHGEIRQGEDKVYSSLTSLFDEVIASRLGMVPL
R9T5Y4_METII/14-266--RFVVSNAS-PSLVNSLRRCLM-TEI--------PKMAIE-LVE-FHLGPIMDEEGNEYESVSPLFDEIIAHRLGLVPV
G0NUY4_CAEBE/20-263--KFVLWDTD-LSVANSLRRVFM-AEV--------PTIAID-WVQ-IETNTSVLHDEFIAHRMGLIPFISDYHVEKMQYT
A0A1P6BJD5_BRUMA/20-256--RFVLEDTD-LSVANSLRRIFM-AEV--------PTMAID-WVQ-IESNSSVLHDEFIAHRLGLIPLTSDSVVDQMQFS
B7QL55_IXOSC/20-255--KFFVEDTD-LSVANSLRRVFI-AEV--------ATLAID-WVQ-LEANSTVLHDEFIAHRLGLIPLTSDEIVDKMQYS
H2XZ54_CIOIN/23-282--KFVVEDTD-LSTANSVRRVFI-AEV--------PTLAID-WIQ-IEENSSVLNDEFLSHRIGLIPLTSGINLFKIFIQ
T1G647_HELRO/20-255--KFVLENTD-LSVANSIRRVCI-AET--------PTLAID-WIQ-IESNSTVLCDEFIAQRIGLIPLTSDDVVDKMQYP
F6YKL2_XENTR/20-256--KFIVENTD-LAIANSIRRVFI-AEV--------PTIAID-WVQ-IDANSSVLHDEFIAHRVGLIPLTSDDIVDKLQYS
G4LUY0_SCHMA/20-254--KFVLEETD-LSVANAIRRVCI-AEV--------PTLAID-WVQ-IEDNNTMLNDEFIAQRVGLIPLTCDNVVDKMTYF
B3RV95_TRIAD/20-256--KFILENTD-LSVANSLRRIFI-ANV--------PTLAID-WVQ-FVNNTSVLSDEFIAHRLGLIPLTCDEVIDRLQYS
A9URC4_MONBE/24-258--TFVLKSCD-LALANSFRRVMI-AEV--------PTMAID-AVH-IAKNTSVLHDEFLAHRLGLIPLTSEAADKFYYPR
A0A0D2U3Z5_CAPO3/20-246--RFVLSKTE-LSVANSLRRVCI-AEV--------PTMAID-LVQ-FDENSSVLHDEFVAHRLGLLPLASETAGEFDYLA
U7PPH9_SPOS1/29-265--KFELTNVD-LSFANSVRRIVL-AEV--------PTIAID-IVE-VEENTSVLADEFIAHRLGLVPLNSKNADDVVYSR
Q0CYF6_ASPTN/26-254--DFKLSSVD-LAFANSLRRTML-AEV--------PTVAID-LVE-VEKNTSVLPDEFLAHRLGLIPLNSKNCDQDLEYT
R1EC75_BOTPV/27-264--DFVLKNVD-LAFANSLRRVML-AEI--------PTMAID-LVE-VEKNTSVLADEFICHRLGLIPLNSKGCEDVAYTR
G2QN84_MYCTT/29-265--KFELQNAD-LSFANSLRRVML-AEI--------PTIAID-LVE-IEENSSVLADEFISHRLGLIPLNAEGVDNLLYAR
A0A0C4DLK5_MAGP6/28-267--NFELSNVD-LSLANAIRRVML-AEI--------PTIAID-NCE-IKENTSVLADEFIAHRLGLVPLDARGVADLNYSR
Q0UL31_PHANO/23-262--NFIVQNFN-LETANSLRRVML-AEI--------PTLAID-VVE-VLDNTSVLADEFVCHRLGLIPLSSRGVDDLLYAR
S8BIG5_DACHA/27-261--DFVLSNVD-LSFANSIRRIIL-AEV--------PTLAID-LVE-VIANSSVLPDELLSHRLGLIPLESSNIDDKLLYT
R4X6D5_TAPDE/21-255--EFVLSNVD-LAFANSIRRIMM-AEI--------PTIAID-IVE-VKNNTSVLADEFLAHRMGLLALHSEGIDSQLVYT
M2MTP9_BAUPA/30-292--SFVLQHTS-LALANSLRRTIL-AEI--------PTIAID-LVE-IESNTSVLPDEFLAHRMGLIPLSTRDVEDMFYTR
F9WWV9_ZYMTI/30-284--KFALSNTS-LAFANSIRRTML-AEI--------PTIAID-LVE-VEANTSVLADEFLAHRLGLIPLSTKGVEEMVDWR
B6K2N9_SCHJY/18-256--EFVLSNTD-LSLANSLRRVVL-GEI--------PTVAID-LVE-ISVNTSVMPDEFLAHRLGMIPLNSNNIDEPPPVG
L0PEQ4_PNEJ8/20-247--DFVLSNVD-LAFANSLRRVIL-AEV--------PTVAID-LVE-IEINTSVLADEFITHRLGMIPLDSANVDDKLVYT
C5MDV1_CANTT/22-257--DFILRNVD-LSVANSIRRTML-AEV--------PTLSID-LVE-IEKNTSVLADEFLSHRLGLIPLVSEGIKDLTYSR
K0KH51_WICCF/17-253--DFVLSNVD-LSLANSIRRVMI-SEI--------PTLAID-SVE-IETNTSVLADEFIAHRLGLIPLQSLDVDKLSYSR
G8BQU0_TETPH/19-255--DFIVSNVD-LAMANAFRRVMI-AEI--------PTLAID-SVE-VISNTTVLADEFIAHRLGLVPLQSADIEQLEYSR
S2K833_MUCC1/25-255--TFILSDTD-LSVANSLRRVMI-AEV--------PTVAID-MVE-IETNTTVLADEFLAHRLGMVAIDSRDVDKLRYTR
F8PUU9_SERL3/22-274--NFVLENVD-LAFANSVRRAVM-ADI--------PTIAID-IVE-IEANTTVLPDEFIAHRLGMVPLVSANCEEGIRYT
K1VZJ3_TRIAC/39-304--TFHLSGVD-MAYANSLRRTMM-ADV--------PTLAID-QVS-FYQNTSPIPDEMLAHRLGMVPLISRDVGKGLRYT
I4YBL8_WALMC/14-265--NFVLEDVD-LALANALRRILI-ADL--------PTMAID-IVN-IEENSSVLVDEFIAHRLGMVPLISTACDKLINYN
S7W9P7_SPRLO/40-267--TF--SQTS-ISFINALRRILL-SEI--------PVLSID-IVE-IEKNYTVLPDEILCHRLGLIPLYSADIIKDDNIE
I3EI10_NEMP3/15-244--KFTLEGCT-LGMANALRRVIM-TEI--------PTLAID-IVQ-FDKNYTVIPEEMTTDRLGLIPIESSLVEKYLYPK
Q8SRR5_ENCCU/15-229--RFTLSNTT-VGYANALRRILI-SEV--------PTIAID-MVE-IERNNTVLPDEVLAHRLGLIPIYSKRELKYKEEC
A9SHD1_PHYPA/23-296--KFELRDTD-ASIANALRRIMI-AEV--------PTLAID-LVE-IESNSSVLNDEFLAHRLGLIPIVSDRAMEMRLSR
M7ZTZ3_TRIUA/27-283--KFELKDTD-ASMANALRRVMI-AEV--------PTVAID-LVE-IESNSSVLNDEFLAHRLGLIPLTSSAAMSMRFSR
B8BWN8_THAPS/17-296--QFILSETD-TSMANTLRRIMI-AEV--------PTLAID-LVE-YSENSSVLNDEYIAHRLGLVPIRFMAEGSLKECV
H3GMV0_PHYRM/20-302--RFELSETD-ASVANAIRRVMI-SEV--------PTLAID-LVS-VEINTSVMTDEFLAHRLGMIPLNFDGGLENFRQR
Q4DWU1_TRYCC/46-312--EFQLAEVD-NSFANGLRRVML-AEV--------PVLGIE-SVT-IIQNTSVLPDEMIAHRIGLVPLYSMKARRMQYAR
Q580S5_TRYB2/20-286--VFKLNEVD-NSFANGLRRVLL-AEV--------PVLGVE-SVT-IIQNTSVLPDEMIAHRIGLVPLYSKRAKQMQFFH
A5K6U4_PLAVS/25-297--TFVLHNSN-TGMANALRRIML-SEI--------PTLAID-VVN-VYENTSPFHDEFLAHRLGLIPIDSTNVKNFEFRE
Q4UFZ3_THEAN/23-314--DFILLNSD-VSTANAIRRVIL-SEI--------PSLAIE-IVT-VLENTSVLHDEYISHRLGLLPIDSTLASEFEFRD
B6AI35_CRYMR/22-307--KFILSNTD-VSMANALRRIML-AEI--------PTLAID-LVT-IIDNTSVLHDEFIVHRLGLLPIDSRQIRDFNFKD
A2F4R6_TRIVA/26-308--EFRLMNVS-RHFANALRRVMI-AEV--------PTLAVD-TVE-FFQNTSPLPDEYIAHRLALIPFVSEDADKFFYHS
F4Q3D5_CAVFA/22-285--TFVLSNTD-ISVANALRRIMI-AEV--------PTMAID-LVE-FQTNTSVLCDEFIAHRLGLIPLTSHKVESFNYTR
F0ZT58_DICPU/25-291--VFTLSNTD-ISVANALRRVMI-AEV--------PTMSID-LVE-FEANNSVLCDEFIAHRLGLIPLVSDNVDKFNYTR
D2W3Y1_NAEGR/24-310--KFKLSNVD-TSIANALRRIMI-AEV--------PTLAID-LVE-FEMNSSVLHDEFIAHRLGLIPLTCLNINSFSYTS
G0QT24_ICHMG/17-295--DFILENCE-VALANSLRRILL-AEV--------ETIAIQ-NVK-VYENTSCLPDEYIAHRVGLIPLISANVDNFNYIW
A4VDR4_TETTS/17-290--EFTLENCD-ISLANSLRRILL-AEI--------ETIAIH-NVK-VYENTSSLPDEYIAHRLGLIPLNSAKVDDYNYIW
C9LTF6_SELS3/26-221--EPLERGYG-TTLGNSLRRILL-SSL--------PGAAIT-SIR-IDGVLHEFSTIPGVRDDVTNIVLNLKSLCFKMYS
R7CMC0_9FIRM/26-223--EPLERGYG-ITLGNSLRRVLL-SSL--------DGVAIT-SIK-IDGVLHEFSTINGVREDVTDMILNLKKIRFIAHD
G0VNJ6_MEGEL/26-223--EPLDRGYG-ITLGNSLRRVLL-ASL--------DGVAIT-SIK-IDGVLHEFSTIPGVREDVSEIILNLKQVRMKFLD
G4Q722_ACIIR/26-226--EPLERGYG-ITLGNSLRRVLL-SSL--------SGMAVT-GIK-IDGVLHEFSTIEGVREDVADIVLNIKALCFKVNL
H6LGS3_ACEWD/26-221--EPLERGYG-TTLGNSLRRIML-SSL--------PGVAVT-SVK-IEGVLHEFSTIPGVKEDVIEILLNLKGLAAEIYT
R7JZW8_9CLOT/26-225--EPLERGYG-TTLGNSLRRIML-SSL--------PGTAVS-HIK-IDGVVHEFSSIPGVKEDVTEIIMNIKSLAIKNNS
F2JSG3_CELLD/26-227--EPLERGYG-ITLGNSLRRILS-SSL--------PGSAIS-SVK-VDGVLHEFSSIPGVKEDVVEIILNLKGLAIRDTS
C6D4L1_PAESJ/26-221--EPLERGYG-TTLGNSLRRILL-SSL--------PGAAVT-SVQ-IDGVLHEFSTVPGVIEDVTEIILNLKGLSLKIHS
C9R8G2_AMMDK/26-220--EPLVRGYG-ITLGNALRRVLL-SSI--------PGAAVT-MVK-IEGVLHEFSTLPGVREDVVEIILNLRGLKIRMHT
K4LIA3_THEPS/27-222--EPLERGYG-TTLGNSLRRVLL-SSL--------PGAAVT-SVR-IEGVLHEFSTIPGVREDTTDIILNLKGLALRMYG
RPOA_DESAP/26-221--DPLERGYG-ITLGNSLRRVLL-ASL--------PGAAVT-AVK-IDGVLHEFSSIPGVREDVTELILNLKSLRLKLYG
K0AZL2_CLOA9/26-221--EPLERGYG-TTLGNSLRRILL-SSL--------PGVAVS-SIK-IQGVLHEFSTVPGVLEDVSEIILNIKELAAVMHT
R6EZR6_9FIRM/25-220--EPLERGYG-TTLGNALRRILL-SSL--------PGAAVT-SVK-IDGILHEFSTIPGVKEDVTEIILNLKKLAVRLEG
E3PTT6_ACESD/24-219--EPLERGFG-ITVGNSLRRVLL-SSL--------PGVAVT-SIK-VDGVLHEFSTIPGVKEDVTELILTLKELSMKMDS
R5JIV4_9FIRM/26-221--EPLERGFG-ITVGNALRRILL-SSL--------PGVAVY-AIR-IDGVLHEFSTVPGVKEDVTEIILSLKELSATIDD
R6AIY4_9CLOT/24-220--EPLERGFG-TTLGNCLRRVLL-SSM--------PGAAAS-SVK-IDGVLHEFSTIPGVKEDVTEIILNIKELRVRLLG
R5B3L1_9CLOT/24-219--EPLERGFG-TTLGNSLRRVLL-SSL--------PGVAAS-AIR-IDGVLHEFTTIEGVREDVTEIVLNIKELCVKLHS
R7FCM6_9FIRM/27-223--APLERGYG-ITLGNSLRRVLL-SSL--------PGVAVN-SVK-IDGVHHELSTIPGVKEDVSEIILNLKGLTAKLYG
D4JY85_9FIRM/26-224--EPLERGFG-ITLGNSLRRVLL-SSL--------PGVAVT-SVK-IDGVVHEFSTIEGVKEDVTEIVLNLKGIAAKLYT
R6TUA7_9FIRM/26-222--EPLERGYG-TTLGNSLRRVLL-SSL--------PGVAVT-CIK-IDGVLHEISTIPGVKEDVPEIVLNVKGITAKLHS
R5SMX9_9FIRM/26-222--EPLERGYG-ITLGNALRRIML-SSL--------PGTAAT-AIK-IAGVQHEFSTIPGVKEDVTEIVLNVKSLITKLHN
R5KMS2_9CLOT/28-224--EPLERGFG-TTLGNSMRRVLL-SSL--------PGYAIT-SVK-IDGVLHEFSTIPHVKEDVTEIVLNLKNVVLKIHD
R7IEB4_9FIRM/25-223--EPLERGFG-HTLGNSLRRVLL-SSL--------PGAAAS-AVH-IEGVQHEFSTIPGVKEDVTEIILNLKGLAVKMYS
R6MU37_9FIRM/26-222--SPLERGYG-TTLGNSLRRILL-SSL--------PGAAAT-SIK-IEGVQHEFSTVPGVTEDVTELILNIKKLALKIHG
D3QZ73_MAGIU/26-223--EPLDRGYG-VTLGNSLRRVLL-SSL--------PGAAVT-AIR-VEGAFHEFSTVEGVIEDMTEIILNVKCIRVKLNA
B0RZT5_FINM2/26-221--MPLERGYG-TTLGNSLRRVLL-SSL--------PGAAIS-KIN-IQGVAHEMSTIKGVKEDVPEIILNLKGIAVKKYN
RPOA_STRMU/24-219--EPLERGYG-TTLGNSLRRVLL-SSL--------PGAAVT-SIK-IDGVLHEFDTIPGVREDVMQIILNIKGLAVKSYV
RPOA_LACDA/24-219--EPLERGFG-TTLGNSLRRVLL-TSV--------PGTGLV-KVK-IDGILHEFTTVPGVKEDVTKIILNLKKLELRAYT
F8HYY1_WEIKK/24-221--EPLERGYG-TTLGNSLRRVLL-SSL--------PGAAIN-SVQ-IDSVLHEFSTIEGVVEDVTQIILNLKKVSLQIES
F2I816_AERUA/26-221--EPLERGYG-TTLGNSLRRVLL-SSL--------PGTAVT-SIK-IENVLHEFSTIPGVREDVTQIVLNIKQLALKLYD
R6B5I3_9CLOT/26-221--EPLERGYG-ITIGNSLRRILL-SSL--------PGAAIT-SVK-IDGAAHEFTTIPNVVEDVPEIIVNLKMVRIKIVD
RPOA_SYNWW/26-222--EPLERGYG-TTLGNSLRRVLL-SSL--------PGAAVT-SIK-IDGVLHEFSTIPGVLEDTTEIILNIKKLVLSYTG
RPOA_CLOBH/26-221--EPLERGYG-ITLGNALRRILL-SSL--------PGVAAD-HIK-IDSVLHEFSTVQGVKEDVTELILNIKCLALTMNG
F3YWQ5_DESAF/40-235--EPLERGFG-TTIGNALRRVLL-SSL--------QGAAII-SVR-IQGVQHEFTTIPGVQEDVTDLILNLKLVRFSMTT
E6W737_DESIS/31-227--EPLERGFG-ITLGNALRRVLL-SSL--------EGAAVT-AIR-IDNVLHEFSTVSGVVEDVTDIILNVKQLRFKLLS
D4H3B5_DENA2/31-227--EPYEKGFG-ITIGNALRRVLL-ATI--------EGTAVV-GVK-IDGVSNEFATLEGVYEDVVDILMNIKMLDLKLHT
E4TEN1_CALNY/31-227--EPLERGFG-ITIGNSLRRILL-SSI--------EGTAVV-GVK-INDVTHEYTTIPGVLEDVVEIILNIKMLELNLNT
RPOA_SYNFM/31-226--EPLERGFG-ITLGNALRRVLL-SSL--------QGAAIT-SVK-VDGVLHEFSTIPGVLEDVTDVILNLKEVRFKMHS
E8REB6_DESPD/41-236--QPLERGFA-TTIGNSLRRIML-SSI--------RGAAIT-SVR-IGNALHEFTTIDGVHEDVAEIILNLKQVRLKLHG
RPOA_DESPS/41-236--QPLERGFA-TTIGNSLRRILL-SSI--------QGAAIT-TVK-IEGALHELTSMKDVKEDVSEIILNLKQVRLKLNC
D6Z3J5_DESAT/38-233--QPLERGFA-TTIGNSLRRILL-SSI--------RGAAIT-SVK-IEGVLHELSTIPGIKEDATEIILNLKEVRLRLHS
F2NJB1_DESAR/31-226--EPLERGFG-ATLGNALRRVLL-SSL--------RGTAIT-SVK-IKGIHHEFSPIPGVIEDVTEVILNLKAVRFKMHS
F8AA62_THEID/38-231--EPLERGFG-VTLGNALRRVLL-SSL--------QGAAIT-WVK-IDGTTHEFSSLPGVMEDVIDIILNLKGVRFRLHD
F8C4H0_THEGP/30-223--EPLERGYG-ITLGNALRRILL-SSI--------PGYAIT-EVK-IEGAPHEFVSLPGIIEDVPEIILNLKGVRFKLNG
B3E857_GEOLS/31-226--EPFERGFG-TTLGNSLRRVLL-SSL--------QGAAIT-SVR-IKGVQHEFSSIPGVTEDVTDIILNLKSVRLRFHG
E1QKQ5_DESB2/31-226--EPLERGFG-HTIGNALRRILI-SSL--------QGAAVT-NLR-MEGVLHEFSTIPGVLEDVTDIILNLKGIQLRYLG
RPOA_DESOH/34-230--EPLGRGFG-ITIGNALRRIII-SSL--------HGAAIT-SVK-IDNVMHEYSTVEGVLEDVSEIILNLKEVRLKTST
B8FEQ9_DESAL/34-230--EPLERGFG-LTLGNALRRIIL-SSL--------HGAAIV-SVK-FDNVMHEFSAIPGVLEDVSELILNLKEVRLTMTE
I5B4C3_9DELT/34-230--EPLERGYG-ITIGNSLRRIIL-SSI--------YGAAIV-SVK-FDDALHEYSVISDIREDVSEIILNLKELKLKVDD
RPOA_SYNAS/31-226--QPLERGFG-ITLGNALRRVLL-SSI--------QGAAIV-SVK-IDNVLHEFSTVPGVKEDITDIILNLKGVRLKLLS
I4CE87_DESTA/39-234--EPLERGFG-ITLGNSLRRVLL-SSL--------QGAAIT-SVK-IDGVLHEFSTIPGVKEDVTDVILNLKRIQLKMHT
E1X0J6_HALMS/35-231--KPLERGYG-QTLGNSLRRALL-SSL--------QGAGIV-AIR-IEGVEHEFGTINNVKEEVSEIILNLKEVFFKLKG
D0LI99_HALO1/46-240--EPLERGFG-TTLGNSLRRVLL-SSL--------QGAAFT-HVK-IEHALHEFSSLPGVVEDVTDIILNLKETMLKVEE
RPOA_SORC5/41-236--EPLERGFG-ITIGNSLRRVLL-SSL--------QGAAAT-AIR-IEGALHEFTTVPDVVEDVSDIILNVKEVVFKAAT
Q08ZH0_STIAD/36-231--EPLERGFG-TTLGNSLRRVLL-SSL--------QGSAIT-SVK-IENVDHEFTTLPEVAEDVTDIVLNLKEVLLRMHT
RPOA_KORVE/29-224--QPFERGFG-TTIGNALRRVLL-SSI--------EGAAIT-AVK-IEGVLHEFQSIPGVVEDATDIILNLKQIPFRLNG
RPOA_MAGMM/32-228--EPLERGFG-TTLGNALRRVLL-SSL--------QGAAVS-TVR-IEGVLHEFSSVPGVIEDVTDIILNIKGLALRMES
I0IMW4_LEPFC/30-225--EPFERGYG-TTLGNSLRRVLL-SSI--------PGAAIT-AIR-HRGIFHEFSNIPGVLEDVSDIVLNLKEVRVKSHH
E3DPU4_HALPG/24-221--SPLERGYG-TTLGNSLRRILL-SSL--------PGAALT-SVK-VEGVKHEFSAIPGVVEDMTDLILNLKEVVVKYSG
L0K7Y4_HALHC/24-219--TPLERGYG-VTLGNSLRRIML-SSI--------PGAAIT-SIK-IDGVHHEFSTVPGVVEDVADIILNLKELVIKMDD
D9QTH6_ACEAZ/24-220--TPLERGYG-ITLGNSLRRIML-SSL--------PGTAPT-SVK-IEGVEHEFSTISGVVEDVTDIVLNLKELVLRMES
S5MF87_9MOLU/26-226--EPLERGFG-TTLGNAIRRTLL-SST--------PGAAVY-AIK-IVGAAHEFTSIEGIVENVSRIILNLKQLALKIDS
RPOA_MYCMS/26-227--SPLERGFG-ITLGNAIRRTLL-AAT--------PGASVY-AIK-IAGATHEFTSIPGIIENVTKIILNIKQLVLKIDT
R4UKN9_9MOLU/26-226--EPLERGFG-ITLGNAIRRTLL-SAT--------PGAAVF-AVR-IKGASHEFTAIPGVVEHVTKIILNIKNLVLIINQ
RPOA_MYCGA/26-232--KPLEKGFG-ITLGNALRRVML-SHL--------PGSSVF-ALK-IKGISHEFGFIPGVKEDVTQIILNIKNLVVWISD
RPOA_UREPA/27-235--APLEIGFG-DTLGNALRRICL-SSI--------PGASMF-AVK-FGGYSHEFQPYEGVKEDITHIILNLKNLAIKIDE
RPOA_MYCPN/28-236--GPLESGFV-ITIGNAMRRVLL-SCI--------PGASVF-ALS-ISGAKQEFAAVEGMKEDVTEVVLNFKQLVVKISD
K7XLF5_MYCHR/27-238--QPLERGFA-NTLGNSLRRTIL-SSV--------PSVAVF-GVK-IEGVEHEFSVIDKVREDVVTILNNLKKIRFSFKK
C5J5V6_MYCCR/27-237--KPLERGLG-NTIGNALRRTIL-SSV--------SSASVF-AIK-IANIDHEFSVLDNVVEDVVSILNNLKKIRFRYHE
D5E4Y4_MYCCM/27-240--QPLERGFA-TTLGVALRRVLL-SNI--------TSLAPF-CVR-IEGVTHEFQGITGVIEDVPSLIMNLRKVRFSYDP
A5IYV9_MYCAP/29-243--KPLERGFA-NTVAVALRRVLL-SNI--------TSLALF-AIK-ISGVSHEFQTIPGIVEDVTAIIMNLRKVKFKYNP
C4XFY9_MYCFP/30-246--QPLERGMG-QTLGVALRRILL-SNI--------TSLALF-AIK-IEDVNHEFQVVDGCVEDVATIIMNLRKVKFQYNP
RPOA_MYCPU/27-239--EPLERGFG-STIGTALRRTLL-SSI--------TSVVPF-AIK-IKDVDQEFDTISDIVEDVQMIMLNVKNIHLVYDE
RPOA_MYCMO/27-239--QPLEKGLA-TTLGTAIRRVLL-SSI--------SSVAPF-AVK-IKGVEHEFMAINKVTEDVPQILLRLRDIKIAYNP
B3PMM1_MYCA5/27-238--EPLMRGYA-NTLGTVLRRTLL-SSI--------TSVAPF-AIK-INNVQHEFETLPGVKEDVVTLIANIRKIRFTYKP
D1J860_MYCHP/27-238--EPLMRGYG-NTIGTVIRRTLL-SSI--------TSVAPF-AIK-ISHVEHEFTAIEGLREDAITLVANIRKIRFAYDP
R7GIT7_9CLOT/28-225--SPLERGFG-DTLGNALRRTLL-SSL--------PGAAFV-NFK-LNGAQHEFQSVDGIVEDVITIVLNLKRVILSVDS
A9NEG0_ACHLI/27-222--KPLERGYG-LTLGNALRRVLL-SSL--------PGAAIV-NVK-IEGVEHEFSTIEGVYEDVMGIVLNLKKVVFSVDS
RPOA_ONYPE/27-222--KPLERGYG-ITVGNALRRVLL-SSL--------PGTAIV-NVK-IQGVEQEFTTIPGVYEDVMTIILNLKKIVFAVDD
R7GP82_9FIRM/26-221--EPLERGFG-TTLGNSLRRVLL-SSM--------PGAAVF-AVK-INGAIHEFSAVDGVLEDVTAIILNIKKLVFELDS
E7FW50_ERYRH/26-225--EPLERGFG-NTIGNALRRVLL-SSL--------PGAAVY-SIK-IEGVYHEFTSIAGVGEDVTGIVLNVKDLVLNVQD
A8R9G7_9FIRM/26-225--EPLERGFG-TTIGNALRRVLL-SSL--------PGAAVF-SIK-VDGVYHEFTSIPGIVEDVSAMILNIKTLVMKIQD
E2SG59_9ACTN/24-219--EPLEPGFG-YTLGNSLRRTLL-SSI--------PGAAVT-SIK-IDGVLHEFSTVPGVTEDVTEIILNLKNLVVSSEN
RPOA_TROWT/24-220--EPLEPGFG-YTLGNSLRRTLL-SSI--------PGAAVT-SIN-IQGVMHEFSTIPGVKEDVTEIVLNVKRLVISSEI
C7M300_ACIFD/25-219--GPLEPGFG-HSIGNALRRVLI-SSV--------PGAAIT-QVR-FDDALHEFTTIPGVKEDVIDIILNLKDIVWRSWS
D3EYS1_CONWI/24-220--EPLDRGFG-YTFGNSLRRVLL-SSL--------AGAAVT-SVR-IEGVAHEFSTIPGVKEDVTDIVLNLKGIVCRMHS
RPOA_RUBXD/25-220--EPLPRGLG-HTLGNALRRVML-SGL--------PGAAVT-KLR-IEGVQHEFSTIEGVREDVVDIILNVKQLKFRLER
W0RNS5_9BACT/33-230--QPLERGFG-HTLGNSMRRLLL-SSL--------RGAAVW-GFR-IDGVVHEHQTIPGVVEDVHQIIGNLKTLTLTLDD
D6YRY5_WADCW/31-243--EPFERGFG-HTLGNSLRRLML-TSL--------EAPAII-GVR-IEGVAHEYMAIDGIVEDMTNIILNIKGAKLRKLP
I4B7F9_TURPD/36-231--EPFEKGFG-VTIANSLRRVLM-SYI--------EGAAIV-AVK-IEGVSHEFSTMPGIKEDVTRLILNLKRVRLKMEG
RPOA_LEPBP/33-231--EPFERGIG-TTIGNSLRRTLM-SSI--------EGAAIS-AIR-IEGVSHEFSYIEGVAEDVTRIILNLKQVRIKYEP
RPOA_TREPA/33-238--SPFETGFG-TTVGNCLRRVLL-SSI--------QGYAVT-GVR-ITSFDADGVAHFISSEFEQIPHVREDTLEILNNF
RPOA_TREDE/33-238--SPFETGFG-TTIGNCLRRILL-SSI--------QGYAIS-AVL-ITSHDADGVPHTISSEFENIPNVSEDTLEILNKL
F5YDT8_TREAZ/33-238--APFEPGFG-TTVGNTLRRVLL-SSI--------QGYAIT-AVK-INSYGADGVAHNVSSEFETIPNIVEDTLEVINNL
G0G9S3_SPITZ/33-237--YPFERGYG-VTIGNTLRRILL-SSI--------QGYAIS-AVR-ITWYDDQGAAHVLSSEYEQIPGVVEDTLELLANL
V5WFH8_9SPIO/33-238--YPFERGYG-TTIGNTLRRILL-SSI--------QGYAIS-AIR-ITSYDAEGNAHVLSSEYESIPEVVEDTSDLISSL
E1RCN4_SEDSS/33-238--YPFERGFG-TTVGNTLRRVLL-SSI--------QGYAVS-AVK-ITCYNEEGTPHMVSSEFEMVPEVVEDTPEIIANL
H9UGN5_SPIAZ/33-238--YPFERGYG-HTIGNTLRRVLL-SSL--------QGYAIS-AIR-VTSYATDGSAHVLSNEFEAIPEVQEDTADIIYNL
E6SRZ2_BACT6/27-225--RPLEPGFG-ITVGNALRRILL-SSL--------EGFAIT-TIK-IEGVEHEFSSVPGVKEDVTNIILNLKQVRFKQVV
R7IYK3_9BACT/27-225--KPLEPGYG-ITVGNALRRVLL-SSL--------EGFAIS-SIR-IDGVKHEFDTIPGVKEDVTNIILNLKKVDLRQVV
R7F4Y6_9BACT/27-226--RPLEPGYG-QTIGNALRRILL-SSL--------GGFAIC-SIK-IDGVSHELDTIPGVTEDVTNIILNLKQVRFKQKI
F4KMP5_PORAD/27-225--KPLEPGYA-MTIGNALRRILL-SSL--------EGYAIA-SIR-IEGVEHEFATIPGVLEDVTHIILNLKQIRFKAAV
F0NYA8_WEEVC/27-225--RPLEPGYG-ITVGNALRRVLL-SSL--------EGYAIT-SIK-IEGVEHEFSTIPGVVEDVTEIILNLKKVRFKKQI
R5W600_9BACT/27-225--RPLEPGFG-MTIGNALRRILL-SSL--------EGYAIT-NVR-ITGVDHEFAAIPGVMEGVIDIILNLKQVRFIRTV
R5P2Q1_9BACT/27-225--RPLEPGYG-ITIGNPLRRILL-SSL--------EGFAIT-GIK-IHGVEHEFATIPGVIEDVTEIILNLKQVRFKRKV
C6Y0U0_PEDHD/27-225--RPLEPGFG-VTIGNALRRILL-SSL--------EGYAIT-SIR-FSGVSHEFSTIKGVVEDLTEIILNLKQVRFKKSG
R5ID85_9BACT/27-225--RPLEPGYG-ITIGNALRRVLL-SSL--------EGFAIT-SVR-IEGVSHEFDTIPGVIESVVDIILNLKQVRFKREV
A8Z691_SULMW/27-228--EPLFPGWG-VTIGNTLRRVLL-SSL--------EGYAIS-SVK-IEGVNHEFSTIKGVIEDMTEIILNLKKVRFKKNK
G0IXD0_CYCMS/27-224--KPLEKGYG-VTIGNALRRILL-SSL--------EGYAIT-AVK-LPGVVHEFSSIEGVVEDVTDIILNLKQVRFKKIH
E4TU12_MARTH/27-224--KPLEKGYG-VTVGNALRRILL-SSL--------EGYAIT-GIK-IPGVLHEFSAVEGVVEDVSELILNLKMVRFKKIA
C6W1Z7_DYAFD/20-217--KPLEKGYG-VTIGNALRRILL-SSL--------EGYAIT-SVK-FPGVLHEFSSIEGIVEDVTEIILNLKMVRFKKVS
I4AN46_BERLS/27-225--KPLEPGYG-VTVGNALRRVLL-SSL--------EGYAII-GIK-MGSVLHEFSTVEGVVEDVSEIILNLKMLRLKKLV
B3EUJ6_AMOA5/27-224--KPLERGYG-VTIGNALRRVIL-SSL--------EGYAIT-SIR-IPGIYHEFSTIEGVTEDLVEIILNLKQIRFKKIG
C7PU98_CHIPD/27-226--RPLEPGYG-VTVGNALRRVLL-SSL--------EGYAIV-GIK-IEGADHEFATLKGITEDVTEIILNLKQVRFKRIV
H6L0L7_SAPGL/27-227--KPLEPGFG-QTIGNSLRRILL-SSL--------EGFAVS-AVR-IKGAEHEFSTIEGVVEDVVDIVLNLKQLRLKYLL
F4KXU3_HALH1/27-227--KPLEPGFG-QTVGNSLRRVLL-SSL--------EGYAIS-AVR-IAGVDHEFGTIRGVVEDVVEIILNLKQVRLKKIL
RPOA_SALRD/27-223--GPLERGYG-VTIGNALRRVLL-SSL--------RGLAIT-AVK-IDGVQHEFSTIPGVTEDVADLILNLKEVRFKADE
RPOA_CHLT3/28-224--QPLERGYG-VTIGNAIRRVLL-SSL--------PGTAIT-GIK-IEGVLHEFSTIDGVKEDVPDIVLNLKQIRFRSIS
H1XVZ1_9BACT/29-225--QPLEKGYG-VTLGNMMRRVLL-SSL--------EGAAIT-AIK-VNNVQHEFSTIEGVYEDLPEIILNLKELRLKLLD
I6ZWK0_MELRP/29-225--QPLERGFG-VTLGNSLRRVLL-SSL--------PGAAIT-AVK-IEGVLHEFSTIPGVQEDVTEIILNLKKVRMRLLD
B3DVZ0_METI4/31-226--EPFESGYG-HTLGNSLRRILL-SSL--------EGAAIS-SVK-IEGVMHEFTTMEGVVEDVVDIVLNLKKVLIKMPD
D5EJT5_CORAD/31-226--EPFEAGYG-HTIGNSLRRVLL-SSI--------EGAAIS-SIK-IDGVQHEFQSIEGVVEDVTDIVLNLKKVLLVSES
B2UL53_AKKM8/43-238--EPFENGYG-HTLGNSLRRVLL-GSL--------EGAAIT-SVR-IAGAQHEFSSLPGVVEDVTEIVLNLKKVKFKHNG
D5SQ96_PLAL2/31-226--EPFERGFG-STIGNSLRRILL-SSL--------EGSSVT-SVK-IQGVQHEFTTIPGIVEDVTEIVLNLKAIIVKNHS
D2R6J4_PIRSD/31-226--EPFERGFG-TTIGNSLRRILL-SSL--------EGSAIT-QIK-IRGAQHEFTTIPGVLEDVTDIVLNVKSLVVKNHS
E8R483_ISOPI/31-226--EPFERGFG-HTVGNSLRRILL-SSL--------EGSAVT-RIK-IEGVQHEFSSIPGMVEDITDLVLNLKGLIVKNHS
I0IGZ7_PHYMF/31-230--EPFERGFG-NTIGNSLRRILL-SSL--------EGAAVT-AVK-IKGAEHEFTSLEGVMEDVTDIILKVKSMVVSCEG
B2KEJ3_ELUMP/29-224--EPYESGYG-HTVGNSLRRILL-SGL--------DGSAVT-AVR-VRGAVHEYSTIPNVKEDVINILLNLKKLRVKLEG
A9WI15_CHLAA/28-222--APLQRGHG-SSLGNALRRVLL-SSI--------PGAAVT-RIK-VSGVIHEFSSIPGVVEDGTQLVLNIKGIRLRSYS
I0HZI5_CALAS/21-215--SPLESGYG-ITLGNALRRVLL-SSL--------PGAAVT-SIR-VSGIHHEFSSIPHVREDMTRLILNVKQIRFRSHT
E8N3Q1_ANATU/27-222--GPLEGGYG-VTLGNALRRVLL-SSL--------EGAAVT-SIR-ISDVLHEFSDIPGVREDVIQVMLNIKQLRLILHD
B5YG22_THEYD/30-227--EPLERGYG-ITLGNSLRRVLL-SSL--------DGVAVY-AIR-INDALHEFSSIKGVKEDILDIILNVKKLRFKYYA
D1CFF3_THET1/45-239--SPLAPGYG-LTIGNALRRVLL-SSL--------EGAAIT-SVQ-IEGARHEFMALPGVKEDVTDIILNIKRIRVRSYS
D3DH88_HYDTT/26-221--EPLERGFG-ITLGNSLRRTLL-SSI--------QGTAIT-AVK-IYGIYHEFSPIEGVQEDVLEVIANLKKIRFNLKS
RPOA_HYDS0/25-220--EPLERGYG-TTIGNALRRVLL-SSI--------YGSAIT-AVK-IEGVQHEFSTIEGVQEDVLQIIANLKNVRFDLKD
C0QQQ1_PERMH/29-224--EPLERGYG-ITLGNALRRVLL-SSL--------EGGAVT-AVK-IHGVAHEFTTIEGVIEDVSEIILNLKQIKFKMDE
RPOA_PSELT/29-227--SPMEKGYG-TTIGNALRRVLL-SSI--------PSVAIV-GIR-FIKPEKYHEFDTLPGVKEDILEIILNLKRIQLRA
RPOA_THEMA/29-227--SPLERGYA-ITIGNALRRVLL-SSI--------PSLAIV-GVR-FIKPEKYHEYDYIEGVKEDILDIILNLKKVQFRI
C5CGH4_KOSOT/37-233--SPMERGYA-VTIGNALRRVLL-SSI--------PSMAIT-RLK-IPGKYHEYDTIDGVKEDILEIILNLKKVQLKPAL
H2J776_MARPK/30-231--SPLERGYA-VTIGNALRRVLL-SSI--------PGLAIT-SIR-IPGKLHEFDVIEGVQEDILEITVNLKKVELKVVD
RPOA_DEHM1/24-218--EPLEKGFG-TTMGNSLRRILL-SYL--------DGVAIT-RVR-IDGIQHEFSALPKAKEDTLDFLLNLKNIRVESLS
D8K192_DEHLB/24-218--EPLEKGFG-TTLGNALRRVLL-SSL--------SGAAVA-QVR-IEGVQHEFSPLPGAKEDTMDFLLNLKNLHLKPLF
B0VI04_CLOAI/30-225--GPLEPGYG-TTIGNTLRRILL-SSI--------QGAAVR-FVR-IEGLHHEFCPIPGTNSDYIDLILRLKQLVISSSS
S0EXQ0_CHTCT/23-227--EPLERGYG-VTLGNSLRRVLL-SSI--------PGAAIT-YVK-IDKVLHEFDTIPGVKEDTTELLLNLKELHIKVYH
B8E1G0_DICTD/23-218--EPLERGYG-WTIGNSLRRILL-SSI--------EGAAVV-SVK-IEGVRHELEVLPGLKEEILEILMNLKKLVVKIED
D3PN14_MEIRD/25-221--EPLERGFG-VTLGNPLRRILL-SSI--------PGTAVT-SVY-IEDVLHEFSTIPGVKEDAIQLILNLKELVVRFAN
E3H8Z9_ILYPC/28-223--EPLYRGYG-HTIGNALRRVLL-SSI--------PGAAIK-GLR-IDGVLNEFSIIEGVKEAVTDIILNVKEVIVKTET
RPOA_METNO/33-228--EPLERGFG-TTLGNALRRVLL-SSL--------QGAAVT-SVH-IDGVLHEFSSIPGVREDVTDIVLNIKTIAIRSSS
RPOA_ZYMMO/34-229--EPLERGFG-LTLGNALRRVLL-SSL--------QGAAIT-AIK-IENVLHEFSSLNGVREDVTDIVLNIKQVAIKMQG
D5AM21_RHOCB/32-227--EPLERGFG-LTLGNALRRVLM-SSL--------QGAAIT-SVQ-IDNVLHEFSSVAGVREDVTDIILNLKGISLKMDV
D5BQE0_PUNMI/32-227--GPFERGFG-VTIGNALRRVLL-SSL--------QGSAIT-AVQ-IQGVVHEFSSIPGVREDVTDLVLNLKGVAVRKDE
F2I1G2_PELSM/31-226--EPLERGFA-LTLGNALRRVLL-SSI--------QGTAVT-AIQ-IDGVLHEFSSINGVREDVTDIVLNIKSLSLKLNT
RPOA_PELUB/36-231--EPLEKGYG-LTLGNSLRRILL-SSI--------RGAAVT-SIQ-IDGVLHEFTSIKGVREDVTDIVLNVKSLALKSSS
F7XUM3_MIDMI/11-206--EPLERGFG-VTLGNALRRIML-SSL--------QGAAII-AVK-IQGVSHEFTSIPGVKEDVTDIILNIKNIVFNNAT
RPOA_ORITB/35-232--EPLERGLG-LTLGNSLRRVLL-SSL--------RGAAIT-SIK-IPGVEHELSPVSGVKEDLTDIILNIRDVIVKMDS
RPOA_ANAPZ/30-232--EPLESGFA-LTLGNALRRVMM-SSL--------RGFAVY-GIE-IEGASHELTALSGVREDVADLVLNLSMLRVKLLN
RPOA_EHRCR/62-261--EPLESGFA-LTLGNALRRVMM-SSL--------RGFAVY-GVE-IENVLHEFTSISGVREDVTDILLNISMMRVKLSG
J9Z1B3_9PROT/31-227--EPLEKGFG-TTLGNALRRVLL-SSL--------QGTAIT-SIK-INGVLHEFSTIEGVREDVTDIIMNLKNVTFNSKS
RPOA_ALKEH/29-225--EPLERGFG-HTLGNALRRVLL-SSM--------PGSAVV-QAE-IEGVEHEYSSMEGVQEDVVDILLNLKSLAVRMHD
RPOA_HALHL/29-225--EPLERGFG-HTLGNALRRLLL-SSM--------PGTAVT-EVE-IEGVQHEYTAVEGIHEDTVDILLNLKDLAVRLNE
F9ZMD2_ACICS/28-224--GPLERGFG-HTLGNALRRVLL-SSL--------KGAAVT-EVE-IEGVLHEYSSIEGVQEDVVDILLNLKQLAVRAQG
D0KXN7_HALNC/29-225--EPLERGFG-YTLGNALRRILL-SSI--------PGVAVT-EAE-IEGVVHEYTTIEGVHEDVLEILLNLKGLSVMLHG
S6BQG0_9GAMM/29-227--EPLERGFG-HTLGNALRRILL-SSM--------PGCAVT-EVE-IEGVLHEYSATEGVQEDVLEILLNLKELAIVMED
L0H1T5_9GAMM/31-229--EPLERGYG-HTLGNALRRVLL-SSM--------SGCAIT-EVE-IQGVLHEYTTLEGVQEDVLEILLNLKEVAISLSG
F6AJD1_PSEF1/29-227--EPLERGFG-HTLGNALRRILL-SSM--------PGCAVV-EAE-IDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHG
H8KYM7_FRAAD/29-227--EPLERGFG-HTLGNALRRVLL-SSI--------PGSAIV-EVE-IDGVLHEYTALEGLQEDVIEVLLNLKDVAIRQHT
RPOA_PSYA2/29-226--EPLERGFG-HTLGNALRRILL-SSL--------PGAAVI-EAE-IDGVDHEYSTLEGLQEDVLDLLLNLKGLAITLHD
D3SCR1_THISK/27-225--EPLERGFG-HTLGNALRRVLL-SSI--------PGAAIV-EAR-IEGVLHEYTAIEGVQEDVVDILLNLKGVALRMHS
RPOA_NITOC/27-225--EPLERGFG-HTLGNALRRILL-SSM--------PGCAII-EAQ-IDGVLHEYTTKEGVQEDMTEILLNLKGVAVKLHG
RPOA_BUCBP/29-230--EPLERGFG-HTLGNALRRILL-SSM--------PGFAVT-EVE-IDGILHEYSTKEGVQEDIIEILLNLKGLAIRVYG
RPOA_BUCCC/29-228--EPLERGFG-HTLGNALRRILL-SSI--------SGCAVT-EVE-IDGILHEYMHKEGVKEDILDILLNLKGLSIKLFG
RPOA1_PSYIN/29-227--EPLERGFG-HTLGNALRRILL-SSM--------PGAAIT-EVE-IDGVQNEYSIKEGVQEEILEILLNLKGLAVKLEG
F9ZWY4_METMM/29-226--EPLERGYG-HSLGNALRRVML-SSI--------PGCAVT-EVS-IAGVLHEYTTIEGVQEDVIDILLNLKKLSVILHG
U5N4B0_9BURK/26-224--EPFERGYG-HTLGNALRRILL-SSM--------TGYAPT-EVT-IAGVLHEFSAIDGVHEDVVNILLNLKGVVFKLHG
RPOA_NEIMB/29-227--QPFERGFG-HTLGNALRRILL-SSM--------NGFAPT-EVA-IAGVLHEYSTVDGIQEDVVDILLNIKGIVFKLHG
F8GHK6_NITSI/27-224--EPFERGYG-HTLGNALRRILL-SSM--------TGFAPT-EVK-IAGVVHEYSALDGVQEDIVDILLNIKGIVLKLHN
D7DLR4_METV0/29-227--EPMERGFG-YTLGNALRRVLL-SSI--------PGFAIT-EVK-IDGVVHEYSTLDGVQEDVVDILLNLKGVALKLNT
RPOA_NITEU/27-226--EPFEHGFG-YTLGNALRRVLL-SSI--------PGCAPT-KVS-ISGVVHEYSTIDGLQEDVVDLILNLKGVVLKLHN
D9SCT8_GALCS/27-224--EPFERGFG-HTLGNALRRILL-SSM--------AGAAPT-EVK-MSGVLHEYATIDGVQEDVVDILLNLKGVVLRLHG
RPOA_LEGPH/29-230--EPLERGFG-HTLGNALRRILL-SSM--------PGSAIT-EAS-IDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTV
RPOA_RUTMC/29-225--EPLERGFG-HTLGNALRRTLL-SSM--------TGSAVT-EVA-IDGVMHEFSTIEGVQEDVLDILLNLKEVSVMLNT
RPOA_METCA/29-225--EPLERGFG-HTLGNALRRVLL-SAI--------PGAAVT-DVV-IDGVLHEYSTIEGVQEDVIDVLLNLKNLAIRLNG
D3EQH5_ATETH/26-221--EPLERGQG-ITVGNALRRVLL-ANL--------EGTAVT-AIR-IGGVNHEFATIPGVREDVLEIILNMKEIVLKSHT
RPOA_NOSS1/26-221--EPLERGQG-TTVGNALRRVLL-SNL--------EGTAVT-AVR-IAGVSHEFATVPGVREDVLEIIMRMKEVILKSYS
K9YNU7_CYASC/24-218--EPLERGQG-ITVGNSLRRVLL-SNL--------EGAAVT-AVR-IAGVNHEFAVIDGVREDVLEIMLNMKELVFKSYS
B0C430_ACAM1/26-221--EPLDRGQG-TTVGNALRRVLL-ANL--------RGTAVT-AVR-IAGVNHEFATIPGVREDVLDILLNMKQVVLRSHT
K9YFL4_HALP7/30-225--EPLERGQG-ITVGNALRRVLL-SNL--------EGTAVT-ATR-IAGVTHEFATIPGVREDVLEILLNLKELVFRSYS
RPOA_THEEB/25-228--HPLAPGQG-ITVGNALRRVLL-SNL--------PGSAVT-AVR-IAGVNHEFSTIPGVREDVMDILLQMKQLVIRSHT
RPOA_SYNE7/25-220--EPLARGQG-TTVGNALRRVLL-SNL--------EGTAVT-AVR-IGGVNHEFATIPGVREDVLDILLNVRELVVHAHS
RPOA_SYNJB/46-241--GPLERGQG-ITVGNALRRVLL-SNL--------EGTAVT-AVR-IAGVTHEFSTVPGVREDVMEILLNMKELVLRSSS
RPOA_GLOVI/26-221--EPLERGQG-TTLGNALRRVLL-SNL--------EGTAVT-AVR-ITGVNHEFATMKGIREDVLDILLNMKELVLRSYT
RPOA_SYNPW/26-222--GPLERGQA-TTLGNSLRRVLM-GNL--------EGTAVT-AVR-IAGVNHEYATIPGVREDVLDILLNCKQITVNSRT
F2YGP3_CHLVA/29-231--GTFIQGQA-LTFANALRRTLL-SEI--------PGIIMT-DIL-VEGASHEFAILPGVEETVLDIILNLKKLVFAPST
M0ZUU3_SOLTU/6-197--SPFIKGQD-DTVGIAMRKALR-GEI--------DGTCIT-RVK-SEKVPHEYSTITGIQESVHEILMNLKEIVLRSNL
A0A2K1KJX0_PHYPA/147-339--SPFRSGQA-NTVGVSMQKALL-GEV--------EGAAVS-CAT-FKNVKSEYAAMKGVEETPMDILVNLKELVIRSDS
RPOA_PHATC/29-220--NP---GQG-ITIGNQLRRVLL-GDL--------GGVAIS-AVR-IAGITHEFSTIPGVREDILEILLNLKGIICTSQI
H0UL77_9BACT/20-215--GPLERGYG-VTIGNALRRVLL-SSI--------KGAGVT-AVR-VEGALHEFTTLPGVREDIIELQLNLKHIPVRSHS
I4BV50_ACEMN/23-218--EPLDRGYG-VTLGNAIRRVLL-SSI--------PGAAVS-AIR-IDGVLHEFSTVPGVMEDVLEIILNIKKLAVVSHS
RPOA_WOLSU/29-223--YPFESGYA-ITLAHPLRRLLL-GSS--------VGFAPT-ALK-IEGAAHEFDSVRGIMEDVALFIVNLKSIRFKMRG
RPOA_HELPY/29-231--APFEFGYA-VTLAHPIRRLLL-LSS--------VGYAPV-GLK-IEGVHHEFDSLRGVTEDVSLFIMNLKNIRFIAKA
B9L6T7_NAUPA/28-221--YPFEAGFG-VSVAHPIRRTLI-AST--------PGFAPI-ALK-IEGVKHEFDSLKGMLEDVASFIINLKNIRFKIKE
RPOA_CAMHC/29-223--YPFETGYA-VTLAHPLRRLLY-TST--------VGYAPT-AVK-IDGVSHEFDSMRGMLEDVAIFIINLKGIRFKIKG
RPOA_SULNB/29-223--YPFESGYA-VTLAHPLRRLIL-GSS--------IGYAPI-SVK-IEGAAHEFDNIRGMHEDVAVFIINLKNIRFKIKD
W0JDL0_DESAE/30-226--EPINEGFA-TTIGNALRRVLL-SSI--------QGIGIV-GIK-IEGVEHEFSGVNGVKEDVITIILNLKDVIFKSLS
A5K332_PLAVS/443-664--GPLNITDG-HTFGTLLKYVCQ-TQL--------YGYAIV-AIK-IHNMNEDTRIDNVQEDLLEIALNLSDVCIYSKEV
A2DQ63_TRIVA/37-104--TFTVQKED-HTLGNLLTDQLL--TE--------NRILFA-GYR-IEH-------------------------------
M0T693_MUSAM/32-98--SFTVERED-HTIGNILRMQLH--RD--------PSVLFA-GYK-LPH-------------------------------
D2UZC7_NAEGR/31-97--NFIVNKED-HTLGNIIRMRLH--ED--------KRVLFA-GYR-NPH-------------------------------
D7G4D0_ECTSI/79-145--TFEIIKED-HTLGNLLRMQLL--AD--------RQVRFA-GYM-QPH-------------------------------
G1X7Y3_ARTOA/102-168--TFTFNKED-HTLGNLLRSQLL--KD--------PKVLFA-GYK-VPH-------------------------------
L2GT01_VAVCU/22-88--ELHINGES-HTLGNMIAEKIL--SD--------PRCTFS-AYK-VSH-------------------------------
K5X3Y7_PHACS/32-98--TFKIVKED-HTLGNLLRAELL--KD--------SRCLFA-GYK-VPH-------------------------------
W5JCM8_ANODA/18-84--TFVFEDEG-HTLGNVLKTIIC--KY--------PDVNFC-GYT-VPH-------------------------------
C4WWR4_ACYPI/19-85--TFVFEDEG-HTLGSLLTYVLE--SF--------PETDFC-AYS-IRH-------------------------------
E0W436_PEDHC/18-83--TFVFDGEG-HTLGNALRSVIS--RY--------SEVTFC-GYT-IPH-------------------------------
E9FTC8_DAPPU/3-68--TFIFKGEG-HTLGNAIRTIIL--KN--------PDVIFC-GYT-IPH-------------------------------
G4VD46_SCHMA/404-469--TFTFFGED-HTLGLALRYCIL-RD---------ESVSFC-GYC-VPH-------------------------------
Q6C4D6_YARLI/56-122--SFQFTEED-HTIGNALQYIIM--KN--------PEVEFC-GYS-IPH-------------------------------
K1WJJ6_MARBU/57-123--SFEFKKED-HTLGNSLRYIIM--KN--------PNVEFC-GYS-IPH-------------------------------
Q0UFU4_PHANO/45-119--SFQIDGED-HTLGNALRYIIH--KNEVANTIYSPDVEFC-GYS-IPH-------------------------------
H9GMN1_ANOCA/27-93--TFVLHNED-HTLGNSLRYMIM--KD--------PEVEFC-GYS-ITH-------------------------------
A0A015MNU0_RHIIW/44-110--TFSISGEE-HTLGNALRYIII--QN--------PEVEYC-GYS-IPH-------------------------------
B3S798_TRIAD/12-78--TFVLHGEN-HTLGNAVRYLIM--KN--------PETKLC-GYS-VPH-------------------------------
D8U457_VOLCA/12-78--TFSIEEED-HTLANSLRFFLN--KN--------PHVSFC-GYS-MPH-------------------------------
F2UL86_SALR5/40-112--TFVIANED-HTLGNSLRWILN--RD--------PRVDFC-GYS-QPH-------------------------------
Q4U9J3_THEAN/12-77--TFCIENED-HTLGNTLRALLV--ER--------DDVVFA-GYS-VPH-------------------------------
A0A384LDW2_PLAKH/17-82--TFCFENED-HTLGNCLRCILL--QK--------EGVEFA-GYT-VPH-------------------------------
U4LH46_PYROM/41-111--SFQITDED-HTLGNALRYMIM--KN--------PKVELC-GYS-IPH-------------------------------
D7FJZ6_ECTSI/27-92--TFIFGDED-HTLGNALRHVLM--QN--------KEVDFC-GYS-VPH-------------------------------
M2WNE1_DOTSN/42-108--SFSFENED-HTLGNALRYMLT--KD--------PDVEFC-GYS-IPH-------------------------------
R9ADM4_WALI9/35-101--TFKLFNED-HTIGNSLRYIIM--KN--------PNVEFC-GYS-IPH-------------------------------
I2G5Z2_USTH4/35-101--TFCLKEED-HTLGNSLRYIIM--KD--------PRVEFC-GYS-NPH-------------------------------
I2GXX0_TETBL/22-88--SFQIRDED-HTLGNALRYLLM--RN--------PAVEFC-GYS-IPH-------------------------------
E2RTX5_GIAIC/33-107--EFQIPYQD-YTIGHILRKELL--SM--------PQVTFA-GMK-TPH-------------------------------
D7DR78_METV3/13-87--EFELTNED-HSLPNILKDILL--SK--------ENVIMA-SYN-VEHPVLDP--------------------------
RPOL_METMP/15-89--ELELVNDD-HSLSNLVKEILL--AK--------DGVILA-SYG-VEHPVLDP--------------------------
A6UTG0_META3/15-90--EVELIHDD-HSLSNLLKDMLL-DKK--------DKVVMA-SYA-LEHPVLDP--------------------------
RPOL_METAR/14-80--QVEIKGES-HTMMNALKSCLL--ED--------KAVKVA-TYD-IEFP------------------------------
D7E9E3_METEZ/14-79--NMEIQGED-HTLLNVLKSILL--ED--------SRVEIA-SYD-MKHV------------------------------
RPOL_METTP/14-79--RIEFEGER-HTLLNLLRSELL--ED--------ERVVIA-TYD-AKFP------------------------------
N0BKM3_9EURY/14-79--RLKIKGED-HTLLNLLQHNLL--ED--------ESVVIA-KYD-IPHP------------------------------
D2RHL4_ARCPA/14-79--KLEIRGED-HTYLNLLQHYLL--ED--------EDVEIA-RYY-IPHP------------------------------
G0EET7_PYRF1/15-81--EVRLRGED-HTMANLIVKLAI--RK--------PHVTYA-AYR-IDHP------------------------------
A1RX43_THEPD/25-90--ELRIRGEG-HTLLNLLVDELN--RI--------PDVE-A-TYR-VDHP------------------------------
RPOL_KORCO/14-80--RVLIRGET-HTLLSPLVEELN--SL--------DEVEFA-GYD-VPHP------------------------------
RPOL_HALSA/14-83--TIEVAGEN-HTFMNVLKGTLL--ET--------DGVTAA-SYD-MNPEQ-----------------------------
F7PHA3_9EURY/14-83--SIEISGED-HTFMNVLKGALL--ET--------DGVAAA-TYD-MNPEQ-----------------------------
H1YXQ0_9EURY/14-79--RILFVGEG-HTFMNALSDEIL--KD--------PQVDVA-NYS-SRF-------------------------------
A2SSW1_METLZ/18-85--RVTLEGEG-HTIVNALVDEIL--AD--------PEVDVA-KYV-IKY-------------------------------
RPOL_NANEQ/19-85--KVQFKGET-HTLFNALKEIAY-T------------------IN-GVKKAAY---------------------------
A1RWW0_THEPD/10-260--VFMLRNTT-PAFANALRRALI-SEV--------PILAID-EVI-VTENTSALWDEMIAHRLALVPLKIDPETYDALRD
D9Q275_ACIS3/17-268--TVSMEGFP-VAYGNALRRLAL-SEV--------PTMAVD-FVY-FYDNESSVYDEIIAHRLGLLVLRSDEALRKYGSP
A0RXU9_CENSY/15-196--SIRLRGVP-LQYANALRRICL-NGV--------PVFAVD-TVD-IVENTSVLADEGLAHRLGLIPLRTDSSEFKNLAE
G0EF28_PYRF1/10-270--RVLIEGAP-LAFVNALRRAAY-TMV--------PVMAID-YVE-FIDNNTVLYDEILAHRLGLIPLDSREAIKSYKKP
A2BK79_HYPBU/15-266--RLYVEGFG-LPLVNAIRRAAY-SDV--------PVMAVD-VVE-VFENNTVLYDEIIAHRLGLIPLTSKEALQKYKRP
I3TDW7_THEC1/14-266--RLLVRGVK-LHVLNSIRRAIL-AEV--------PTMAVD-YVV-FMENSSVFYDEYIAHRLGLIPLTSENALGKYKPP
E0SQ92_IGNAA/14-269--EIAISGVP-LPLLNALRRYAL-AKV--------PTYAVD-EVM-VVINTSHMFDEMLAHRIAMIPLRSEEALERIKGL
A8A8W5_IGNH4/14-271--RLLAKGYP-LAVLNAIRRAAL-ELA--------PKMAVD-FIA-VDRNDSTLFNEVLAHRLAMIPLRSEEALERYAPP
K7J3Y0_NASVI/1262-1538--EFDIIGCS-AALANAYRRIML-SEV--------PSMAIE-KVY-MINNTSLIQDEVLAHRLGLLPLKADPRLFEYPSK
E2ACS1_CAMFO/52-332--EFDIIGCD-ISLVNAFRRILI-SEV--------PSMAID-KVF-IINNTSLLQDEVLAHRLGLIPLRADPRLFEYPPS
T1IB98_RHOPR/49-320--EFDLIGIF-PALINAFRRILI-SEV--------PTMAIE-KVT-VHQNKTVMQDEILAHRLGLIPLKANPRLFQFRMP
E9GTW6_DAPPU/70-342--EFDLIGVD-PAIPNAFRRILL-SDI--------PTMAFD-KVF-MFNNTSIIQDEVLAHRLGLIPLKADPRLFEFRAE
H9J5X2_BOMMO/53-321--EFDLIGIQ-PAFANAFRRLML-SEV--------PSMAIE-KVM-IKNNTSIIQDEVLAHRLGLIPLKADPRLFEYKSE
B0W725_CULQU/57-325--EFDMIGVS-PAIANAFRRLML-SEV--------PSMAIE-KVH-IYNNTSIIQDEVLAHRLGLIPLKADPRLFEYKTN
D6WP50_TRICA/56-325--EFDLIGIH-PFLANTFRRLML-SDV--------PTMAIE-KVH-ILNNTSIIQDEVLAHRLGLIPLKADPRLFEMKTD
E0VYJ4_PEDHC/56-328--EFDLVGIN-CAVANAFRRILL-SEV--------PSMAIE-KVF-VSNNTTLIKDEVLAHRLGLVPLKADSRLFEYRSE
B7Q825_IXOSC/59-330--EFDMIGVN-PAIANAIRRILL-AEV--------PTMAPD-KVF-MYNNTSIVQDEVLAHRIGLVPFNIDPRMFDYREK
F6YSX7_CIOIN/63-332--QFDMLGVD-AAIANAFRRILI-AEV--------PTMAIE-KVY-IYNNTTVIQDEVLAHRLGLIPLTADAKLFEYRQG
G3ND01_GASAC/63-338--EFDMVGID-AAIANAFRRILL-AEV--------PTMAIE-KVF-IYNNTSIVQDEVLAHRLGLVPIKADPRLFEYRST
T1KCG6_TETUR/56-326--EIEFLNID-APIVNAFRRIIM-SEI--------PTMAIE-KVF-IGENTTIFQDDFLAHRLGLIPIKADPRLFEYRDE
J9K0P2_ACYPI/45-312--EFDLVGID-VAVANSLRRVII-SEV--------PSMAIE-KVH-IYQNTSYILDEILAHRLGLIPLKADPRQFKMKED
G4VD46_SCHMA/51-335--EFDMINLD-CSFANAVRRILV-SEV--------PSLAIE-RVY-VSQNTSIMPDEVMCHRLGLIPLAVDPKYFLFPTR
A0A068Y929_ECHMU/48-328--EFDMISID-CTFANSIRRILV-SEV--------PSFAID-RVY-LYQNTSVIADETFCHRLGLVPLNVDPDKMSFCST
G0MU26_CAEBE/68-353--EFDIIRIE-APIANALRRILL-AEV--------PTMALE-KIY-LYQNTSVIQDEVLCHRLGLLPLRVDPRAFQFPTE
K1RM70_CRAGI/59-328--EFDMVGID-AAIANAFRRILL-AEV--------PTMAIE-KVH-IYNNTSIIQDEVLAHRLGLIPIKADPRLFEYKSE
T1G2S8_HELRO/59-331--EFDMVGID-PALANSFRRILL-EEV--------PTMAID-RIE-IRNNTSIVSDEILAHRLGLVPIKADARLFEYRPK
B3S4F3_TRIAD/60-333--EFDMIGID-ASIANAYRRIML-SEV--------PAMAIE-KVV-IHNNTSIIQDEVLAHRLGLIPIAADPKLFDNFNP
S0DJA1_GIBF5/72-369--SFSLVGID-ASLANAFRRILL-SEI--------PTLAIE-NVY-IENNTSVIQDEVLAHRLGLIPFKGGREGLHNFLK
S3BZ54_OPHP1/66-364--SFSLIGVD-ASIANAFRRIMI-AEI--------PTVAIE-TAF-IDNNTSVVQDEVLAHRLGLIPFRGGQDGLRNFIR
V5I0T0_BYSSN/65-363--SFSLIGVD-AAVANAFRRILI-SEI--------PTLAIE-YVF-IHHNTSVIQDEVLASRMGLVPLKGSVEGLNWMSW
U4L7M8_PYROM/58-336--EFDLIHID-ASIANAFRRIMM-AEV--------HSFAIE-QCY-ILNNTSVIQDEVLAHRLGFIPIVGNHETMRNMKW
G1XAZ6_ARTOA/62-343--EFDLIGVD-ASVANAFRRILI-SEV--------PTLAIE-TVF-VHNNTSIVQDEVLAQRLGLVPLRGDKKGFQQLRW
B2WCA1_PYRTR/63-364--QFSLTGID-TSVANAFRRILL-SEI--------PTLAIE-DVY-IYQNTSIIQDEVLAHRLGLIPLCGDRATLRRMKW
M7SAL9_EUTLA/70-367--QFSLIGID-ASIANAFRRILI-AEI--------PTLAIE-TVF-VNNNTSVIQDEVLAHRLGLIPFTGSKVGIREFLT
B6JXY4_SCHJY/59-335--TFDISGID-ASIVNAFRRILI-AEI--------PTLAIE-FVY-IINNTSILQDEVLSHRLGLIPLKADPDMFKWFVR
M7PLN2_PNEMU/62-338--EFDLIGID-SSIVNSFRRILI-AEI--------PTIAVE-YVF-INNNTSIIQDEILAQRLGLIPIKANPDFFTWFIK
R4XFB4_TAPDE/65-343--EFDAVGID-ASIANAVRRILI-SEI--------PTMAIE-YVY-IMNNTSVIQDEVLAHRLGLIPISAPASEFAQFKR
C4XY85_CLAL4/52-323--NFDLRHID-TSIANAFRRIMI-AEV--------PSVAAE-TVY-VFNNTSVIQDEVLAHRIGLIPLNVDPDALVWIDP
Q6C4T2_YARLI/58-326--NFDLIGID-TSLANAFRRIMI-ADI--------PTIAVE-EVF-IHANTSIIQDEVLAHRLGLVPLVINPERINALPR
F4S444_MELLP/74-344--EFDLVGVD-ASIANALRRIMI-AEV--------PSIAIE-DVF-VWNNTSLVHDEVLAQRLGLIPLKVDPRKLDMRGP
G7E7N5_MIXOS/75-348--EFDIIGID-AAIANALRRIMI-AEV--------PTVAIE-TVF-VFNNTSIVQDEVLSQRLGLVPLKINPRQIDFKTP
R9PBB7_PSEHS/88-358--EFDLIGVD-ASVANAVRRVLM-AEV--------PTVAIE-HVY-IWNNTSIIQDEVLSHRLGLVPLVINPDKVTMRMP
L8X0D5_THACA/736-1007--DFDLVGVD-ASIANAFRRILI-AEV--------PTVAIE-NVY-IWNNTSVIQDEVLAHRLGLVPIRADPALLDFPDS
S8EGP7_FOMPI/70-342--EFDLVGVD-ASIANAFRRIMI-AEI--------PTIAIE-HVY-VWNNTSVIQDEVLSHRIGLVPLNVPPALFKYRNP
B0CTH8_LACBS/57-328--DFDLVGVD-ASIANAFRRIMI-AEV--------PTVCIE-NVY-VWDNTSVVVDEVLSQRLGLIPLNIDPDLIVMKET
V2Y1G5_MONRO/66-340--EFDLVGVD-ASIANAFRRILL-AEV--------PTVAIE-RVY-VWDNTSVIQDEVLAHRLGLIPLNIDPSLMDFRGP
I4YFV5_WALMC/58-331--EFDLIGVD-PSIANALRRVMI-AEV--------PTVAVE-NVF-VFNNTSVMHDEVMAHRLGLVPILFDAERLEEFQK
D0NVB2_PHYIT/45-311--VFDLIGVD-AAIANALRRILL-AEV--------PTMAIE-HVY-IWNNSSIIQDEVLAHRLGLIPLNVDPREFQAFPD
D7FPF8_ECTSI/59-340--VFDLVGVD-ASIANALRRILL-AEV--------ATVAIE-HVY-MFMNSSIIHDEILAHRLGLIPIMANPRMFEFVGE
B8CCH8_THAPS/58-351--VFEVVGVD-VSFANALRRIMI-AEI--------PTMALE-HVY-MWNNSSLIHDEVLSHRLGLVPLNVDPRLFDEYGV
A0A0D2X5I3_CAPO3/125-396--TFDMVGVD-AAIANAFRRILI-AEV--------PTMAIE-TVF-FTNNTSIIHDEALAHRLGLVPIRADPRYFETRDT
A9V9D0_MONBE/62-334--EFDIIGLD-AAIVNTIRRILI-ADT--------PTMAIE-SVY-IFNNTSMLPDELFAHRLGLIPIKADPRHFTYRAD
F4PDW3_BATDJ/53-324--EFDLIGLD-ASISNAFRRILI-GEV--------ATMAIE-NVY-IMNNTGVMHDEVLAQRLGLIPINSDPRLFDFREG
S2JI72_MUCC1/65-335--EFDLIGID-ASIANAFRRIMI-AEV--------PTMAIE-KVY-VMNNTSIIQDEVVAHRLGLIPIKADPLEFDYMTE
A0A015L7C0_RHIIW/2-272--EFDIIGVD-ASIANALRRIMI-AEV--------PTMAIE-KVF-IYDNTSIVQDEVLAHRLGLIPIKADPDEFDFKQS
F2UC17_SALR5/48-314--EFDMIGVD-AAIANAVRRILI-SEV--------PTMAIE-QAY-IYHNSSVLPDEMLAHRIGLIPLAVDARRFRTLEE
A7SL38_NEMVE/59-329--EFDMIGID-ASVANAFRRILL-AEV--------PTMAIE-KVF-LYNNTSIIQDEVLAHRLGLIPIHADPRLFNYKKQ
B4FAR4_MAIZE/85-364--EFDMIGID-ASIANAFRRILI-SEV--------PTMAIE-KVF-MADNNSVIADEVLSHRLGLIPLDADPRLFEYISE
I1N089_SOYBN/94-380--EFDMIGID-PAIANAFRRILI-AEV--------PTMAIE-RVY-IANNTSVVQDEVLSHRLGLIPIRADPRLFEYPEN
A9T5P0_PHYPA/74-352--EFDIVGID-AAIANAFRRILI-AEV--------PTMAIE-KVY-IANNTSVIQDEVLAHRLGLLPIKADPRLFDYKSE
C1MRA1_MICPC/92-403--EFEMQGLS-PAIANAFRRILI-AEV--------PTMAIE-KVF-MVNNTSVIQDEVFAHRLGLIPIRADPRLFDLRGE
A0D2I2_PARTE/44-310--VFEIINID-APIANSLRRIMI-AEI--------PTMAIH-KVQ-VIQNTSVIPDEVLAHRLGLIPIIADPLQFVEKDD
Q235X0_TETTS/59-332--EFDLMGVD-APIANALRRIMI-AEV--------PTMAIH-KVY-IYQNTSIIPDEVLAHRLGLIPIYADPRLFEEKQE
B6KLD3_TOXGV/72-331--VFELKGVD-AAIPNALRRILI-SEV--------PTVAIE-TVQ-IWQNTGVVQDEVLAHRLGLIPFIVDPTALNYRQP
F4Q915_CAVFA/82-344--VFEMIGVD-APIANALRRILI-AEI--------PTMAIE-KVF-IINNTSILQDEVLAHRLGLIPIKVDPRKFNFKQA
D2UXC7_NAEGR/70-352--VFEMIGID-APIANAFRRIML-SEV--------PSMAIE-KVV-YLTNTSIIQDEVLAHRIGLVPIRCDPDFFFFARD
E1ZQP2_CHLVA/92-364--EFEMKGVS-CALANSLRRIMI-SEA--------PTMAIE-HVY-IVNNTSVIQDEVLSHRLGLIPLKVDPRLFQYKAK
L2GLK3_VITCO/40-283--EFDILNCH-PSIANTLRRILI-SKV--------PTMAIH-YVS-VYENNTVFPDEYIAHRLGLIPLEANPEYFSYFKD
J8ZX59_EDHAE/40-294--EFDLKNVD-CSIANALRRILI-AEL--------PTMAIE-YVN-FYKYNGVIPEEILAHRLGLLPILIDPKVFEYKNS
R0KMW6_NOSB1/50-299--EFDLINVH-CSIANAIRRILI-SEI--------PTVSID-KIS-IIDNTSVLPDEFLAHRLGLIPLNVSPEDLDFFKS
C4V751_NOSCE/43-279--EFDLVGVD-CSVANALRRILI-NEI--------PTFAIE-NVF-IFDNTSVLPDEFLAHRLGLIPLDVCPDLEVGDFH
S7XPP5_SPRLO/33-271--EFDIIGVH-PSVANCIRRVIM-NEI--------PTLAID-TVI-VKANTGVMADEILCHRIGLIPIMIDPDTVEFRTG
H8ZEB8_NEMS1/21-261--SFRVNQIE-ASVLNALRRTII-SDT--------PSIAVH-WVY-IRENETVMADEILSHRLGLIPILADSSTLKNIVR
C4M554_ENTHI/23-272--SFHIERTD-TSMVNGLRRVIM-AET--------PTIAIQ-LVR-VYANSSYLCDEFIAHRLGLIPIDSTQIHNFEDTD
C1MVZ5_MICPC/25-313--RFALLHTD-TSVANALRRVII-AEV--------PTLAID-LVD-VIENTSCLCDEFIAHRLGLIPLLSEKAVEMEFPY
Q01F02_OSTTA/22-286--TFSLKGVD-VSLANALRRVMI-ADV--------PTLAID-LVE-VVENSSVLCDEFLAHRLGLIPLSSKKVSELFKPY

PF13656

H2M356_ORYLA/23-97--------------------------------------------------------------------------------
H2R0V0_PANTR/30-104--------------------------------------------------------------------------------
RPOL_SACS2/12-86--------------------------------------------------------------------------------
Q0UWS5_PHANO/103-177--------------------------------------------------------------------------------
B8GF45_METPE/12-85--------------------------------------------------------------------------------
A7I5J1_METB6/12-86--------------------------------------------------------------------------------
S9VSU8_SCHCR/29-103--------------------------------------------------------------------------------
L0ACU8_CALLD/16-88--------------------------------------------------------------------------------
RPOL_SULTO/12-86--------------------------------------------------------------------------------
A0A384KHM4_PLAKH/36-108--------------------------------------------------------------------------------
F0ZJT3_DICPU/35-109--------------------------------------------------------------------------------
V5IL63_NEUCR/30-104--------------------------------------------------------------------------------
G2XWM6_BOTF4/61-134--------------------------------------------------------------------------------
C1EAB7_MICCC/30-99--------------------------------------------------------------------------------
J1AN07_9EURY/12-85--------------------------------------------------------------------------------
U5D302_AMBTC/21-94--------------------------------------------------------------------------------
B6AD73_CRYMR/32-146--------------------------------------------------------------------------------
K1V9X0_TRIAC/34-108--------------------------------------------------------------------------------
A0A068YHT2_ECHMU/30-104--------------------------------------------------------------------------------
RPOL_METBU/12-83--------------------------------------------------------------------------------
A0A068Y929_ECHMU/386-458--------------------------------------------------------------------------------
G1XT40_ARTOA/53-127--------------------------------------------------------------------------------
F8PIR5_SERL3/20-94--------------------------------------------------------------------------------
A0A015L6K0_RHIIW/30-104--------------------------------------------------------------------------------
RPOL_PICTO/15-88--------------------------------------------------------------------------------
K4MG73_9EURY/12-84--------------------------------------------------------------------------------
I4Y8T6_WALMC/32-106--------------------------------------------------------------------------------
M7PEH0_PNEMU/31-106--------------------------------------------------------------------------------
RPOL_METS5/12-86--------------------------------------------------------------------------------
U7Q4U5_SPOS1/37-111--------------------------------------------------------------------------------
M2MYP9_BAUPA/30-104--------------------------------------------------------------------------------
K1WMN3_MARBU/31-104--------------------------------------------------------------------------------
F2KQH2_ARCVS/13-85--------------------------------------------------------------------------------
M2SYV1_COCSN/30-104--------------------------------------------------------------------------------
G7E8P6_MIXOS/27-101--------------------------------------------------------------------------------
T1JXZ6_TETUR/15-91--------------------------------------------------------------------------------
L0L0D7_METHD/12-85--------------------------------------------------------------------------------
R4XFR4_TAPDE/31-121--------------------------------------------------------------------------------
YR470_MIMIV/277-352--------------------------------------------------------------------------------
D8RRF0_SELML/32-104--------------------------------------------------------------------------------
C6HHU3_AJECH/49-123--------------------------------------------------------------------------------
N1RT61_FUSC4/58-131--------------------------------------------------------------------------------
M1B174_SOLTU/11-84--------------------------------------------------------------------------------
T1JU99_TETUR/30-104--------------------------------------------------------------------------------
E0SNS0_IGNAA/14-87--------------------------------------------------------------------------------
F2U1F2_SALR5/30-104--------------------------------------------------------------------------------
M9SCC2_METAX/7-77--------------------------------------------------------------------------------
D8QE38_SCHCM/21-95--------------------------------------------------------------------------------
A4I2U7_LEIIN/39-119--------------------------------------------------------------------------------
U5H732_USTV1/35-109--------------------------------------------------------------------------------
V2XV85_MONRO/10-84--------------------------------------------------------------------------------
D7LLA3_ARALL/11-84--------------------------------------------------------------------------------
D9Q2R4_ACIS3/13-87--------------------------------------------------------------------------------
RPAC2_DANRE/22-96--------------------------------------------------------------------------------
RPOL_AERPE/15-87--------------------------------------------------------------------------------
R4XLF1_TAPDE/31-105--------------------------------------------------------------------------------
E3GW45_METFV/12-82--------------------------------------------------------------------------------
Q75CF1_ASHGO/30-104--------------------------------------------------------------------------------
K0IDG9_NITGG/12-80--------------------------------------------------------------------------------
N1JCQ0_BLUG1/30-104--------------------------------------------------------------------------------
E1RHP8_METP4/13-82--------------------------------------------------------------------------------
Q4UD30_THEAN/39-109--------------------------------------------------------------------------------
A7SGE2_NEMVE/30-104--------------------------------------------------------------------------------
I1H2S9_BRADI/30-104--------------------------------------------------------------------------------
C5DEP5_LACTC/30-104--------------------------------------------------------------------------------
K3YB14_SETIT/11-84--------------------------------------------------------------------------------
H6BY80_EXODN/40-116--------------------------------------------------------------------------------
C1N3U7_MICPC/5-79--------------------------------------------------------------------------------
A7ELB7_SCLS1/31-105--------------------------------------------------------------------------------
A3DM82_STAMF/12-86--------------------------------------------------------------------------------
T0N787_9EURY/16-89--------------------------------------------------------------------------------
K0KAE3_WICCF/30-104--------------------------------------------------------------------------------
B7G3C7_PHATC/32-107--------------------------------------------------------------------------------
T1FV14_HELRO/24-100--------------------------------------------------------------------------------
RPOL_HALMA/12-89--------------------------------------------------------------------------------
RPOL_PYRAE/16-89--------------------------------------------------------------------------------
D5E7V1_METMS/12-83--------------------------------------------------------------------------------
B8P7Q9_POSPM/10-85--------------------------------------------------------------------------------
I1CQ65_RHIO9/65-139--------------------------------------------------------------------------------
A3FPR0_CRYPI/32-103--------------------------------------------------------------------------------
Q4E3C1_TRYCC/40-120--------------------------------------------------------------------------------
A1CD73_ASPCL/66-140--------------------------------------------------------------------------------
R4G2Y7_RHOPR/16-87--------------------------------------------------------------------------------
N1JCX8_BLUG1/50-124--------------------------------------------------------------------------------
K1W3H6_TRIAC/50-124--------------------------------------------------------------------------------
C3YRU6_BRAFL/10-83--------------------------------------------------------------------------------
V5FS87_BYSSN/46-120--------------------------------------------------------------------------------
H3GWJ9_PHYRM/21-94--------------------------------------------------------------------------------
A4S056_OSTLU/30-104--------------------------------------------------------------------------------
J3K3I0_COCIM/30-104--------------------------------------------------------------------------------
F4P6Q6_BATDJ/4-78--------------------------------------------------------------------------------
M7SKI7_EUTLA/74-148--------------------------------------------------------------------------------
I3EF49_NEMP3/8-90--------------------------------------------------------------------------------
R9T596_METII/12-84--------------------------------------------------------------------------------
J9DLV1_EDHAE/73-147--------------------------------------------------------------------------------
G7WNR7_METH6/12-85--------------------------------------------------------------------------------
J9DRQ7_EDHAE/17-93--------------------------------------------------------------------------------
R0KLQ1_NOSB1/56-130--------------------------------------------------------------------------------
G4TQB3_SERID/33-107--------------------------------------------------------------------------------
E6N524_CALS0/14-87--------------------------------------------------------------------------------
S2JHT7_MUCC1/30-104--------------------------------------------------------------------------------
C7YU34_NECH7/39-113--------------------------------------------------------------------------------
S7W7N8_SPRLO/17-90--------------------------------------------------------------------------------
F4BTP0_METSG/12-85--------------------------------------------------------------------------------
T1H6G1_MEGSC/11-83--------------------------------------------------------------------------------
B5IB51_ACIB4/15-88--------------------------------------------------------------------------------
E2C409_HARSA/11-83--------------------------------------------------------------------------------
Q7PM95_ANOGA/17-91--------------------------------------------------------------------------------
D4GVL8_HALVD/12-89--------------------------------------------------------------------------------
Q6C7Q3_YARLI/30-104--------------------------------------------------------------------------------
D3BVK7_POLPP/27-100--------------------------------------------------------------------------------
L7K018_TRAHO/20-92--------------------------------------------------------------------------------
E4NQ40_HALBP/12-89--------------------------------------------------------------------------------
A0RXH5_CENSY/12-85--------------------------------------------------------------------------------
H6BMI7_EXODN/175-249--------------------------------------------------------------------------------
B9GIX0_POPTR/11-84--------------------------------------------------------------------------------
L0JP64_NATP1/12-89--------------------------------------------------------------------------------
B6AF09_CRYMR/38-109--------------------------------------------------------------------------------
S7ZBA7_PENO1/30-104--------------------------------------------------------------------------------
W7WXG3_TETTS/100-173--------------------------------------------------------------------------------
F8QFM3_SERL3/30-104--------------------------------------------------------------------------------
Q2FNB5_METHJ/12-85--------------------------------------------------------------------------------
U5H4K1_USTV1/30-104--------------------------------------------------------------------------------
I2FXZ1_USTH4/31-103--------------------------------------------------------------------------------
RPOL_METJA/12-94--------------------------------------------------------------------------------
R9SMX5_9EURY/16-89--------------------------------------------------------------------------------
E1QRF2_VULDI/13-86--------------------------------------------------------------------------------
M1XQZ1_NATM8/12-86--------------------------------------------------------------------------------
E2AMR2_CAMFO/8-79--------------------------------------------------------------------------------
B4JPA4_DROGR/18-90--------------------------------------------------------------------------------
I0A279_FERFK/18-92--------------------------------------------------------------------------------
D8J3W9_HALJB/12-89--------------------------------------------------------------------------------
M7P2B5_PNEMU/30-104--------------------------------------------------------------------------------
T1IFN7_RHOPR/30-104--------------------------------------------------------------------------------
W1QG67_OGAPD/30-104--------------------------------------------------------------------------------
H1VZW5_COLHI/30-104--------------------------------------------------------------------------------
Q22RW2_TETTS/60-133--------------------------------------------------------------------------------
B7P8Y3_IXOSC/17-90--------------------------------------------------------------------------------
A0A087ZQW2_APIME/16-89--------------------------------------------------------------------------------
R0KJ67_SETT2/43-117--------------------------------------------------------------------------------
RPOL_METKA/17-102--------------------------------------------------------------------------------
A0DTF6_PARTE/43-114--------------------------------------------------------------------------------
Q2NE51_METST/10-81--------------------------------------------------------------------------------
R0MC98_NOSB1/13-94--------------------------------------------------------------------------------
R4WAG4_9EURY/12-87--------------------------------------------------------------------------------
F4Q1X1_CAVFA/30-102--------------------------------------------------------------------------------
D3DYV1_METRM/12-87--------------------------------------------------------------------------------
D3S1Z5_FERPA/13-85--------------------------------------------------------------------------------
F4B3S3_ACIHW/12-83--------------------------------------------------------------------------------
T0MN48_9EURY/13-85--------------------------------------------------------------------------------
Q5KMK6_CRYNJ/39-113--------------------------------------------------------------------------------
A8NBN7_COPC7/30-104--------------------------------------------------------------------------------
F1A1H8_DICPU/30-104--------------------------------------------------------------------------------
A0BUX3_PARTE/39-112--------------------------------------------------------------------------------
H8ZDJ1_NEMS1/30-105--------------------------------------------------------------------------------
B7FZW0_PHATC/2-83--------------------------------------------------------------------------------
I2H4R7_TETBL/30-104--------------------------------------------------------------------------------
RPOL_HALWD/12-91--------------------------------------------------------------------------------
C4V9M5_NOSCE/14-88--------------------------------------------------------------------------------
B6Q8P4_TALMQ/30-104--------------------------------------------------------------------------------
G8BPN3_TETPH/48-122--------------------------------------------------------------------------------
D5G8A7_TUBMM/30-104--------------------------------------------------------------------------------
RPB3_ASFB7/278-353--------------------------------------------------------------------------------
A7SBE9_NEMVE/4-77--------------------------------------------------------------------------------
S3D3J4_GLAL2/36-110--------------------------------------------------------------------------------
R7YXM0_CONA1/57-131--------------------------------------------------------------------------------
K1QKY4_CRAGI/25-98--------------------------------------------------------------------------------
L2GWA5_VAVCU/33-104--------------------------------------------------------------------------------
RPOL_SULAC/12-86--------------------------------------------------------------------------------
D8T4E7_SELML/4-76--------------------------------------------------------------------------------
M2R9T6_CERS8/30-104--------------------------------------------------------------------------------
C4LXS9_ENTHI/28-101--------------------------------------------------------------------------------
G2MGD7_9EURY/12-89--------------------------------------------------------------------------------
A2DKG2_TRIVA/20-91--------------------------------------------------------------------------------
W5J6V9_ANODA/30-104--------------------------------------------------------------------------------
G4RLB3_THETK/13-85--------------------------------------------------------------------------------
Q6CIV1_KLULA/45-119--------------------------------------------------------------------------------
RPAC2_CAEEL/60-134--------------------------------------------------------------------------------
E2LXE8_MONPE/30-104--------------------------------------------------------------------------------
Q8SS03_ENCCU/18-92--------------------------------------------------------------------------------
RPOL_NATPD/12-89--------------------------------------------------------------------------------
F4RFP0_MELLP/30-104--------------------------------------------------------------------------------
L2FWL1_COLFN/54-127--------------------------------------------------------------------------------
A8M9E3_CALMQ/15-88--------------------------------------------------------------------------------
R1GQM6_BOTPV/30-104--------------------------------------------------------------------------------
W0JQG4_9EURY/12-89--------------------------------------------------------------------------------
M5EBF3_MALS4/31-105--------------------------------------------------------------------------------
RPB11_DICDI/30-104--------------------------------------------------------------------------------
B8C8G2_THAPS/2-77--------------------------------------------------------------------------------
A5DL81_PICGU/34-108--------------------------------------------------------------------------------
A4RTY9_OSTLU/12-88--------------------------------------------------------------------------------
D8T102_SELML/13-86--------------------------------------------------------------------------------
A9A3V3_NITMS/12-84--------------------------------------------------------------------------------
G2XE43_VERDV/55-129--------------------------------------------------------------------------------
U7PQ43_SPOS1/69-142--------------------------------------------------------------------------------
D8QD48_SCHCM/30-104--------------------------------------------------------------------------------
RPOL_ARCFU/12-85--------------------------------------------------------------------------------
B6JWF5_SCHJY/34-108--------------------------------------------------------------------------------
B8D6L1_DESA1/12-85--------------------------------------------------------------------------------
Q5KMB4_CRYNJ/30-104--------------------------------------------------------------------------------
RPOL_THEKO/12-86--------------------------------------------------------------------------------
E1Z8C1_CHLVA/21-94--------------------------------------------------------------------------------
W0K2F8_9EURY/12-86--------------------------------------------------------------------------------
K0K8C5_WICCF/41-115--------------------------------------------------------------------------------
C5DRN5_ZYGRC/48-122--------------------------------------------------------------------------------
D2VMS3_NAEGR/73-147--------------------------------------------------------------------------------
B3S6B1_TRIAD/30-104--------------------------------------------------------------------------------
Q4D7H8_TRYCC/46-118--------------------------------------------------------------------------------
B8C993_THAPS/30-105--------------------------------------------------------------------------------
F4R4H4_MELLP/28-101--------------------------------------------------------------------------------
A0A1I7VJK8_LOALO/25-99--------------------------------------------------------------------------------
A0A3Q7JPU4_SOLLC/30-104--------------------------------------------------------------------------------
A7AT13_BABBO/10-83--------------------------------------------------------------------------------
A0A0D2WNY4_CAPO3/30-104--------------------------------------------------------------------------------
F7XMD7_METZD/12-85--------------------------------------------------------------------------------
RPOL_METAC/12-85--------------------------------------------------------------------------------
I3TDP2_THEC1/12-84--------------------------------------------------------------------------------
L0IAW3_HALRX/12-89--------------------------------------------------------------------------------
G4MRX6_MAGO7/30-104--------------------------------------------------------------------------------
I4Y841_WALMC/30-105--------------------------------------------------------------------------------
A9V2R7_MONBE/30-104--------------------------------------------------------------------------------
G3B1F5_CANTC/30-104--------------------------------------------------------------------------------
D5TZM1_THEAM/12-85--------------------------------------------------------------------------------
G0QUQ1_ICHMG/39-110--------------------------------------------------------------------------------
RPOL_METTH/10-80--------------------------------------------------------------------------------
D8TM87_VOLCA/31-104--------------------------------------------------------------------------------
D1YYQ6_METPS/12-86--------------------------------------------------------------------------------
Q2GXS9_CHAGB/4-78--------------------------------------------------------------------------------
D5GDE1_TUBMM/9-87--------------------------------------------------------------------------------
Q384D9_TRYB2/46-118--------------------------------------------------------------------------------
A2BNA1_HYPBU/16-90--------------------------------------------------------------------------------
A0A0K3CST6_RHOTO/30-104--------------------------------------------------------------------------------
A8AA05_IGNH4/20-92--------------------------------------------------------------------------------
Q386T9_TRYB2/39-119--------------------------------------------------------------------------------
RPOL_THEAC/20-93--------------------------------------------------------------------------------
F9XIJ4_ZYMTI/8-82--------------------------------------------------------------------------------
C4R3Z5_KOMPG/30-104--------------------------------------------------------------------------------
S7W9T0_SPRLO/10-89--------------------------------------------------------------------------------
J3NY74_GAGT3/30-104--------------------------------------------------------------------------------
L8FLZ9_PSED2/92-166--------------------------------------------------------------------------------
G0MZ50_CAEBE/29-103--------------------------------------------------------------------------------

PF01193

H3E9U3_PRIPA/103-278ESDVACSSQLN---------------------------------------------------------------------
RPOD_HALSA/19-239TLALDVEGPGTAYSGDLVSNDPEVEAADENIPIIELKDDQRL--------------------------------------
A6UW03_META3/17-181FSIMKEGPCTVYSAD-----------------------------------------------------------------
K4MD35_9EURY/16-255CICGGSECPACRVSLTLSAEGPRMVYSGDFVSSDETVQPAEANIPIIELKEG----------------------------
RPOD_METAC/16-256CDVCGGEGCPACEVSLTLSAEGPGTVYSRDLISSDPKIQPADPNVPIVELKK----------------------------
F7XMN5_METZD/16-254CNCEDVCPACELSLTLSVEGPKMVYSGDFVSADPEVRPADSNIPIIDLKEG-----------------------------
D5EC45_METMS/14-256CSCEEGCPACTVSLTLSVEAPMDEDKTVYSGDLVSADPKIKAADSNIAVVKLK---------------------------
A0B9L4_METTP/14-253ECQCGGIGCPGCRIDFMLTAEGPATVHSRDIKFSDPSVRAAFDNIPLVVLGE----------------------------
RPOD_ARCFU/16-253CSCGGEGCPNCQISFRLNVEGPKVVYSGDFISDDPDVVFAIDNIPVLELFE-----------------------------
D2RD94_ARCPA/14-250CVCGGEGCPNCQVSFRLNVEGPKVVYSGDLISEDPEIKPVYDNIPIVELYE-----------------------------
E1RIT7_METP4/14-260CSCGGEGCSSCQAIFTLSVEGPGTVHSSDLIPADPRATPVNMDIPVVKLEKDQKV-------------------------
L0HCN0_METFS/14-260CSCGGAGCPGCTATYTLSVEGPRMVTSSDLIPQDPGAAPVYDNIPIVKLTKGQKL-------------------------
U6EDP0_9EURY/14-254CDCDDHCPRCSVSLTLKGKGPKTLYSGDLKSEDPNLKPVLDTIPLVKLKEGE----------------------------
RPOD_METTH/14-254PEECDCEEYCSECSVSLTLRKKGPGVVYSGDLVSETPAVKPVYPDIPLVKLG----------------------------
R9SN57_9EURY/14-256PDECDCDDYCPKCSVSFTLNKKGPGVVYSKDLVSSDPKIKPVYDTIPLVKLKE---------------------------
E3GZF2_METFV/14-254PEECDCDKYCAKCSVSFTLKKQGPCVVYSGDLVPSDPEIKPVYENIPIIKLE----------------------------
RPOD_METKA/20-261LCDCGGKGCEKCQVRAELEVEGPTKVYARDLKFDHPDVEPAFPDTLITEVGED---------------------------
RPOD_PICTO/13-262KTDLKMNFRDQCSCNGEGCDLCTVKYSINKLGPADVFSSDLIPINNPDLKPVDPMIP-----------------------
T0M5U1_9EURY/14-262VTDPKMNFRNECSCGGQGCPLCTMTYSINKIGPAMVTSGDLQPVGNPELVPADRNI------------------------
T0LUK9_9EURY/20-279KTDSRMNFRNECSCEGKGCSLCTVSYNIDKTGPGEVYSGDLVPFTGNVELKPVDPLIPIVKL------------------
B5ID28_ACIB4/14-263PTDLNMKFRDECDHPPDEGCPLCTVTYTLNKHGPATVYSGDLIPVGDEKFKPVDPLI-----------------------
T0LNF0_9EURY/16-263PTDLKMNERDSCTCGGAGCSLCTVNYSLFVVGPKKVMSGDLVAIGDSKMAPTDKEI------------------------
R9T5Y4_METII/14-266PTDLSLYVPKDECVCGGEGCPNCTIMYSINKKGPCEVYSGDMEPLGPPELRIKDELIP----------------------
G0NUY4_CAEBE/20-263RECECAEFCDECSIPFILQMKCKDEATLAVTTEHLIPLKDDTTVRPACGKALRE--------------------------
A0A1P6BJD5_BRUMA/20-256RDCQCTEFCQFCAVEMRLRVRCDDEGIRAVTTADLETSNPDVAPACGVHI------------------------------
B7QL55_IXOSC/20-255RDCTCADFCTECSVEFTIDVKCLDEQTRHVTTADLKSSDPRVVPVTSRHK------------------------------
H2XZ54_CIOIN/23-282YSRDCMCDDFCQDCSVEFYLDVKCTGEGTRQVTTRDLISMNPKVVPITSRSRGDSSKSFGEQ------------------
T1G647_HELRO/20-255RDCSCEEFCPECAVEFSLDVRCTDDQTKHVHTGHLISSNPKVVPATSRHR------------------------------
F6YKL2_XENTR/20-256RGNSVTEGCRCANKFTGLLGCLPFPSFQITQVTKLVNTTFFSLQVTSRSR------------------------------
G4LUY0_SCHMA/20-254RECPCREFCEQCSVELTLDVCCTTDAPRHVTGADLISSNRDVQPVPSRD-------------------------------
B3RV95_TRIAD/20-256RDCNCVEHCPECSVEFTLDVRCNDDQTRHVTTRDLISSDSRVVPVTTRYG------------------------------
A9URC4_MONBE/24-258DCTLCEMGCDHCQVMLTLDVEGHTEEPTHVTTDDLISQAAGDFMAVKPI-------------------------------
A0A0D2U3Z5_CAPO3/20-246ECDCDGGCNRCTVSLTLEAEGPCSVVARDLRSSDESVVPISQRDA-----------------------------------
U7PPH9_SPOS1/29-265DCDCEQYCELCSIKLTLHAKCTSDEIMKVYARDLVVDPSRPNQWVGTPVI------------------------------
Q0CYF6_ASPTN/26-254RDCECEDHCARCSVTLQLHARCTGDDIMRVYARDLAVAGERANDWV----------------------------------
R1EC75_BOTPV/27-264DCDCEQYCENCSVLLSLNARCTGDEVMTVYARDLQVSAARANEWVGTPVIK-----------------------------
G2QN84_MYCTT/29-265DCDCDGCCEHCSVRLTLHAKCTGEENMHVFARDLVPTGDRINQVLGTPIV------------------------------
A0A0C4DLK5_MAGP6/28-267DCDCEQYCDNCSVTLEIHARCEVDDPGHVSKFYAKDLWVVGNPPNKYVGKPV----------------------------
Q0UL31_PHANO/23-262DCDCEGYCDNCAVVLSLNAKCTGSEIMKVFARDLVIESNRPNDEVGRPVITD----------------------------
S8BIG5_DACHA/27-261RDCDCDGYCDRCSVVLTLVAKCTGDQNVTVYARDLAVAAGAQLGNPVLT-------------------------------
R4X6D5_TAPDE/21-255RDCDCEQYCEKCAVVLRLNAKCTGDTTMNVYAKDLISDRADEFGSPVIN-------------------------------
M2MTP9_BAUPA/30-292DCACDEFCDNCSVVLQLNVANRNLDHNLKVFARDLTVTRVDGTPITDPRSTAHLTNGAAGLHS-----------------
F9WWV9_ZYMTI/30-284DCDQCDEHCDQCSVILRLNVANRSSDQNLKVFARDLFVESGANAGYNRSNGMGNSSDEL---------------------
B6K2N9_SCHJY/18-256LEYTRNCDCDQYCNKCSVELSLNAKCTGDGTMEVYARDLVVDSNSTLGQPV-----------------------------
L0PEQ4_PNEJ8/20-247RDCDCDQYCTKCSVQLTLYAKCTSDGTMDVYSKDLIVEHNSTIDPD----------------------------------
C5MDV1_CANTT/22-257DCTCDNYCTKCSVTLQLLASCTAETTMNVYASDLLKTTHTGSKLGDPVFR------------------------------
K0KH51_WICCF/17-253DCTCDDYCNKCSVELELKVRADQDSTLNVYSKDLFIVSQNTHLNIGSAII------------------------------
G8BQU0_TETPH/19-255DCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVIVSDLLGRNIGHPII------------------------------
S2K833_MUCC1/25-255DCTCSQYCPDCSVELTLHVKCTDDRTKDVTTRDLTSSNPSFMPVLQD---------------------------------
F8PUU9_SERL3/22-274RDCTCLSGCQYCSIELRLDVACHENRTMEVTSNHLDVVDSHTYADEGEAGEELTKRGE----------------------
K1VZJ3_TRIAC/39-304RDCDCDEGCYYCMVTLRLKVSAVNREYGSPMAVTSDMLEVIPSPNTPQQSPYGPPPDIGEEEREL---------------
I4YBL8_WALMC/14-265RDCVCLDHCPKCSVELELNIKCTTPETVLVTSNHLQIKGQVANDTSGNLIDPPIGLPD----------------------
S7W9P7_SPRLO/40-267NIHTLNTIFKTSLQYSAECQCDNYCNECSIIFYLDVNNNTNKTKLI----------------------------------
I3EI10_NEMP3/15-244DCSCKSFCKNCSISIVLDVKNDGQTPMTVTSKSLFVEGGDPINIGDPR--------------------------------
Q8SRR5_ENCCU/15-229SCSGFCSECSVVFEIDVVHTDDTLRTVSTRDIVCDEEDV-----------------------------------------
A9SHD1_PHYPA/23-296DCDACDGDGRCEYCSIEFHLSVKCTGDQTLDVTSLDLVSSDPSIIPVDAAGRAADMGGFESNDTRGILI-----------
M7ZTZ3_TRIUA/27-283DCDACDGDGSCEYCSVEFHLAARATDSGQTLEVTSTKDLRSTDPKVCPVDQQREYQQALG--------------------
B8BWN8_THAPS/17-296CYDRCPRCCVEFELDVNFDKVNQTRPDTERDLALTVTSRDLISNNMLVSPAHFLNEEEQDESHDEGISIVKL--------
H3GMV0_PHYRM/20-302FVYSQDCDCDENCPNCSVEFSLDVTADGGVLSVTSEALKSSDPYIRPVNFSSEEELNNTQDTGVIIAKLGPGQ-------
Q4DWU1_TRYCC/46-312DCLCGGSGCGECQINGELKVSCPSNKHSLQVFMDSLKIDDEEVYPVSSEEHGVWLLTLGRSQE-----------------
Q580S5_TRYB2/20-286DCLCGGTGCIECQITGELKVRCPSNQHSLQVFADSLKIDDEGVYPVSSEERGVWLLTLGRSQE-----------------
A5K6U4_PLAVS/25-297KCKCKETCSKCTIQYLIQVKCNNVSKIEITHHDIESVEHEPNVPMPVPLEDRNNQMAESNAIPIVTLS------------
Q4UFZ3_THEAN/23-314RCQCTDKCAKCTVDYTLDVSCNDSNSRLVTHFDIVPDDTHSKSIYGKNLPMPIPRADVTNFNGATDGIPIVKLKRGQS--
B6AI35_CRYMR/22-307RCGCQERCNKCSVDYTLDLKCEGPTVRNVTHLDIYSTLPVPNIPLPVPRKEDVTDPNNEGILIAKLGPGQSLTAR-----
A2F4R6_TRIVA/26-308QCNCDGSQLGYCPNCTVIYTIDAHCEPESDSVVEVTSNDLKLIAPHKWADKSTMGSIHIGVKPATLFANGDSN-------
F4Q3D5_CAVFA/22-285ECSCTERCTECSVEFNLNVKCLDRALEVTSSDLQSQNDNVFPVSASDNVYGNTSGAIPIVRLRK----------------
F0ZT58_DICPU/25-291DCSCSERCDQCSVEFKLNVKCSNQRPIDVTSSDLIVVSNNNNSVIPVSSQTTERTDEIPIVKLRQ---------------
D2W3Y1_NAEGR/24-310DCSCTGHCEKCSVELTLHVKCTESHRDVTSNDLISNNPSCAPCTLSATSRDNENEHNGITIVKLKRGQEIKLKAI-----
G0QT24_ICHMG/17-295NCDCKGSSEGQECDRCAVHFVLKVQNQGNTTMEVTSLDLKEKFMNSDEDAVRPVKFYSIVPDQMGRQQEVG---------
A4VDR4_TETTS/17-290NCNCQGECDRCTIHFDLRVSNFTNEVLEVTSLDLKQRQDHTDEDAVRPIKVYSILRDEYGNKREVGIPI-----------
C9LTF6_SELS3/26-221EEPRVLRLDVKGEKEITAADIITDPDV-----------------------------------------------------
R7CMC0_9FIRM/26-223EATFPITVRIDITKEGIFHAGDMELPAE----------------------------------------------------
G0VNJ6_MEGEL/26-223DDIDALDITVDISGECEFTANDLNVNSD----------------------------------------------------
G4Q722_ACIIR/26-226DDQGTYEPKTFYIKKSGEGEVTGADIITD---------------------------------------------------
H6LGS3_ACEWD/26-221DEPKVIYIEASEEGEITAGDIIADSDV-----------------------------------------------------
R7JZW8_9CLOT/26-225DSDEVKTAYIEASGEGVVTAADIQVDSDI---------------------------------------------------
F2JSG3_CELLD/26-227QGTEPKVIYIEKSGEGPVTGADIKCGPEIE--------------------------------------------------
C6D4L1_PAESJ/26-221DEEKVLEIDAEGEGIVTAGDIRADSDV-----------------------------------------------------
C9R8G2_AMMDK/26-220DEERILRIEAAGEREVRARDIIADADV-----------------------------------------------------
K4LIA3_THEPS/27-222EGPVTIRIEAQGEGVVTAGDIITGPDI-----------------------------------------------------
RPOA_DESAP/26-221EEDRLMRIEAEGEGRITAGDIITSPDV-----------------------------------------------------
K0AZL2_CLOA9/26-221DEPVILKIDAEGPGVIKAGDIDTGSEV-----------------------------------------------------
R6EZR6_9FIRM/25-220ESTKRAIINAVGPKDVTAADIICDSDM-----------------------------------------------------
E3PTT6_ACESD/24-219DGARTLKIEHTGEGVIKAGDIICPPDV-----------------------------------------------------
R5JIV4_9FIRM/26-221EEPKVLRIQAIGPCEVKGSDIICPPEV-----------------------------------------------------
R6AIY4_9CLOT/24-220ESSSVHVVIDAKGEGKVFAGDIIHDADV----------------------------------------------------
R5B3L1_9CLOT/24-219EGPKKVTISAHGECEVKAGDITADSDV-----------------------------------------------------
R7FCM6_9FIRM/27-223EGPKTIYIEKEGECEVTAADFKNDSEVC----------------------------------------------------
D4JY85_9FIRM/26-224DGPKTVRVEAVGPCEVTADNIKQGDDIE----------------------------------------------------
R6TUA7_9FIRM/26-222DGPKTVVLDVTGPCKATAGDIKQDADLE----------------------------------------------------
R5SMX9_9FIRM/26-222AEGTKTVFIEATGPCEVKAGDIKCDSEV----------------------------------------------------
R5KMS2_9CLOT/28-224ENQKTLYIKASGEGEITAGDIEHGSDVE----------------------------------------------------
R7IEB4_9FIRM/25-223DGPKSVIVDKMGPCELTAADIKVDDEIE----------------------------------------------------
R6MU37_9FIRM/26-222DLPKTVYIEAKGAQEITAGDIKRDEDVE----------------------------------------------------
D3QZ73_MAGIU/26-223DGPKTIYLNTEEGRTGVVTAGDIVTDEE----------------------------------------------------
B0RZT5_FINM2/26-221EEPISLNVDIKGPCVLTAKDILVDTDL-----------------------------------------------------
RPOA_STRMU/24-219EEEKIVELDVEGPAEITAGDILTDSDI-----------------------------------------------------
RPOA_LACDA/24-219EEVKTIELDVEGPATVTAEDLKADADV-----------------------------------------------------
F8HYY1_WEIKK/24-221DEEKTLEINVAGPATVTASDITGDSDVT----------------------------------------------------
F2I816_AERUA/26-221VDEKDIELDITGPAEVTAADITADADF-----------------------------------------------------
R6B5I3_9CLOT/26-221DEPKTLRINFQGEGEVTAANIETDGTI-----------------------------------------------------
RPOA_SYNWW/26-222SERKIIRLEQQGPKEVKASDITPDAEVE----------------------------------------------------
RPOA_CLOBH/26-221EGPKTIYIDEVGPKEVTAADIKTDGDV-----------------------------------------------------
F3YWQ5_DESAF/40-235DQPQHIVLRADKKGAVTAAAIQENQNL-----------------------------------------------------
E6W737_DESIS/31-227PGEKVLTLKASSVGPVTAASLECPPDVK----------------------------------------------------
D4H3B5_DENA2/31-227HETRRVYIKKTGEGPVTAGDITGDTMVE----------------------------------------------------
E4TEN1_CALNY/31-227HEQKRVYIKKKGEGVVKASDIFGDPLVQ----------------------------------------------------
RPOA_SYNFM/31-226DGPRLVVIEKDGEGEVAAGDIQGGPHV-----------------------------------------------------
E8REB6_DESPD/41-236PESRTVVLEKNGPGRVLAGDINGGAYV-----------------------------------------------------
RPOA_DESPS/41-236EESQTVRIEKQGPGPVVAGDIIPSAFV-----------------------------------------------------
D6Z3J5_DESAT/38-233GEAKTVRIEKKKKGVVTAGDIIGDPQV-----------------------------------------------------
F2NJB1_DESAR/31-226QEEKVIYLEAREEGEVTAGAFKTDGTI-----------------------------------------------------
F8AA62_THEID/38-231EEPKTFFLEKEGPGEVKAGDIQTDGQ------------------------------------------------------
F8C4H0_THEGP/30-223EGPFYFKLEKVGEGEVKAGDIKINKE------------------------------------------------------
B3E857_GEOLS/31-226ADQATIRIIHKGDGIIKAADIMVPHNV-----------------------------------------------------
E1QKQ5_DESB2/31-226FDSTTMTISAQGEGVVKAGDIKTPPDV-----------------------------------------------------
RPOA_DESOH/34-230AAAKTIRIDAAGPGVVTAGDIASPDGRV----------------------------------------------------
B8FEQ9_DESAL/34-230TGPCPLNLEKQGPGVVTAGDLISPNGKV----------------------------------------------------
I5B4C3_9DELT/34-230PEEKILTLNVTGEAEVTGADIVSPDGRV----------------------------------------------------
RPOA_SYNAS/31-226DGPRVIRIDTKKEGVITAADIITDGTV-----------------------------------------------------
I4CE87_DESTA/39-234SQPKVLKLEATGEGIVRAGDIITDETV-----------------------------------------------------
E1X0J6_HALMS/35-231KEDTVLTLEKSGEGPVTAGDISESASLE----------------------------------------------------
D0LI99_HALO1/46-240DRVYTVRLEKEGEGPFTAGDISTVTGV-----------------------------------------------------
RPOA_SORC5/41-236PKTYSVRIDREGPGPVYARDIQLVEGL-----------------------------------------------------
Q08ZH0_STIAD/36-231NETKTLRIEAEGPKEIKAGDIIADQDV-----------------------------------------------------
RPOA_KORVE/29-224DAPKAIYLRAEQPGIVTSGMIETDADV-----------------------------------------------------
RPOA_MAGMM/32-228TGIKNIYLRVDKEGPVTAGMIECETGIE----------------------------------------------------
I0IMW4_LEPFC/30-225TDPIWVHLKASGPGRVTAGQIETQGVI-----------------------------------------------------
E3DPU4_HALPG/24-221EEQTTIRLEAEGEGEITAGDFISAGDVE----------------------------------------------------
L0K7Y4_HALHC/24-219EEPQTIRVTKDKAGKVTGGDFQVSGNV-----------------------------------------------------
D9QTH6_ACEAZ/24-220EEPEILRLNASGEGEVTADEFTVSGNIE----------------------------------------------------
S5MF87_9MOLU/26-226KIFEDDEVVELKINSTRVGAITAGDIILP---------------------------------------------------
RPOA_MYCMS/26-227SIYSDDEVVQLRIRSDIQGPIYAGDLDIPA--------------------------------------------------
R4UKN9_9MOLU/26-226DIIPDGESVILKISSTKEGEILAKDIILP---------------------------------------------------
RPOA_MYCGA/26-232NMITDETLSETPIEKWPVMTIRANKAGIIKAGD-----------------------------------------------
RPOA_UREPA/27-235LIYSEDYFNNLLIDKWPKMKINFKGPGVITAKD-----------------------------------------------
RPOA_MYCPN/28-236LLFEDGEMVEPPLERWPLLTVTAEKAGPVYAKD-----------------------------------------------
K7XLF5_MYCHR/27-238EVFLQNEIQVASFDGRKVGKITGADILVNSALEIV---------------------------------------------
C5J5V6_MYCCR/27-237ELFDNDQIQKVSFSGDKAGNIYAKDIDNTGGLEI----------------------------------------------
D5E4Y4_MYCCM/27-240ELVKDDEIIKVELKADQIGEINSRYLEVVDNLNVEV--------------------------------------------
A5IYV9_MYCAP/29-243EFVKDGEIIKATIKAEQPGVVTSKSIEISNPSVEII--------------------------------------------
C4XFY9_MYCFP/30-246EFVKDDEIIKVTLKADQPGEVTSRLLEVNNSSIEILN-------------------------------------------
RPOA_MYCPU/27-239NIFEDNKIYRGVIETKNEKITSSDLKFPENPEIEI---------------------------------------------
RPOA_MYCMO/27-239EIFEDGKIYKLSLKSNKEAGDIYAKDFILPIGAEI---------------------------------------------
B3PMM1_MYCA5/27-238ELFEKENLARISFKATHDGDITASDINEPSGLEIV---------------------------------------------
D1J860_MYCHP/27-238ELFEKDNLAKISFKSTKEGEVHASDIETIPGLDIV---------------------------------------------
R7GIT7_9CLOT/28-225DDCDFETTVEIHKGEGEVTAADIIHGSE----------------------------------------------------
A9NEG0_ACHLI/27-222QDPQYEQQLELYAEGPAVITAGDFNLAD----------------------------------------------------
RPOA_ONYPE/27-222ESDDFEEKLELIAKGPQRLTASSFELPA----------------------------------------------------
R7GP82_9FIRM/26-221DEDVTMVIDVTGPATVTGADIQCPSEV-----------------------------------------------------
E7FW50_ERYRH/26-225EEVYTLRISQKGPKVVTAADIECPANVEI---------------------------------------------------
A8R9G7_9FIRM/26-225DEIYTLRISKQGPGEVTGADIICPEGVEV---------------------------------------------------
E2SG59_9ACTN/24-219DEPVVMYLRADTAGVVTGANIEPPAGV-----------------------------------------------------
RPOA_TROWT/24-220DEPFTVRLYKTGEGEVLAKDIEVPTGIE----------------------------------------------------
C7M300_ACIFD/25-219EEPVTVRLDVRGPKEVTAGDFMLPSDV-----------------------------------------------------
D3EYS1_CONWI/24-220DATEIEAPLVVTGPGDITAKDIDLPSGV----------------------------------------------------
RPOA_RUBXD/25-220DEPIELQISKDGPGEVRGSDIELKADV-----------------------------------------------------
W0RNS5_9BACT/33-230DVETAVLRIQKTEAGPITAGDIQGASGV----------------------------------------------------
D6YRY5_WADCW/31-243MEDTPNARNQRLLTKVLEITQEDIDNGKGQYEVRL---------------------------------------------
I4B7F9_TURPD/36-231QGPLTLEVEKKGAGVLMAGDFAVSNSV-----------------------------------------------------
RPOA_LEPBP/33-231EDKEASKVIHLELKGAGYFRAADLAVDS----------------------------------------------------
RPOA_TREPA/33-238KRLRFLLPQGAESSTFTYEFRGAVSLTGKDFA------------------------------------------------
RPOA_TREDE/33-238KQIRLRLSDESEQGDFHFEFKGPASITSKDFA------------------------------------------------
F5YDT8_TREAZ/33-238KQIRLKLPDDVEQDVLIYEWSGKGEIKSNDFA------------------------------------------------
G0G9S3_SPITZ/33-237KLLRVQLPDEMEQKTVMVEFKGPKEVTGADF-------------------------------------------------
V5WFH8_9SPIO/33-238KQLQIKLPEDTEQKNILVEVKGEGEITGASLE------------------------------------------------
E1RCN4_SEDSS/33-238KQLQIKLPEEVEQKTLLIECKGPGEITGADFE------------------------------------------------
H9UGN5_SPIAZ/33-238RQVRFSLPEDMDSKTIMVNLKGKGRITAADLE------------------------------------------------
E6SRZ2_BACT6/27-225EEFESEKVSITIENSSEFKAGDIGKYLT----------------------------------------------------
R7IYK3_9BACT/27-225EDHEDEKVTITVSGTEVFTAGDIGKALT----------------------------------------------------
R7F4Y6_9BACT/27-226EDTDTETAVLQVKGTDRVTAGDLGKVLQQ---------------------------------------------------
F4KMP5_PORAD/27-225EDPQEETITLHVTGRNTFQAGDLNQVLT----------------------------------------------------
F0NYA8_WEEVC/27-225DESDAENVTATISGQDQLTAGDLGKFIS----------------------------------------------------
R5W600_9BACT/27-225ENVDTETVTINVAGQSELTAGNISNFMT----------------------------------------------------
R5P2Q1_9BACT/27-225EDVEDEKLTVLVSGQETFTAGDINRFLT----------------------------------------------------
C6Y0U0_PEDHD/27-225DAGDSEKVFILVNGQEQFVAGDITKFSN----------------------------------------------------
R5ID85_9BACT/27-225KEEEAETVSFTVTGKQEFTAEDISKSLC----------------------------------------------------
A8Z691_SULMW/27-228KKENFESEVFNMIISNDKEEITAGDLGKYI--------------------------------------------------
G0IXD0_CYCMS/27-224DAIDNKITVEVKNQDVFTAGDIAKYTTS----------------------------------------------------
E4TU12_MARTH/27-224ETADNKINISLKNTKEFKAGDINKFTTA----------------------------------------------------
C6W1Z7_DYAFD/20-217DLSESRIVVNLKNVSVITAGDIGKFTSA----------------------------------------------------
I4AN46_BERLS/27-225EDESSQKITIQLSGKSELTGKDITDATN----------------------------------------------------
B3EUJ6_AMOA5/27-224DTTENKIFISINNKKILTAGDFAQATAA----------------------------------------------------
C7PU98_CHIPD/27-226ENEVNNEKIQISIKGKTEFRADMIEKATS---------------------------------------------------
H6L0L7_SAPGL/27-227DDPDITSEKIYLSVSGKNQLLASDINEHT---------------------------------------------------
F4KXU3_HALH1/27-227GDDDVNTEKVYLTINGKEEFRAGDIEDHT---------------------------------------------------
RPOA_SALRD/27-223MQEGHLHLNLEGPGNWTAADIDEATAEY----------------------------------------------------
RPOA_CHLT3/28-224KRNAVVTLVLRGPKDFVAGDIVSPEGDF----------------------------------------------------
H1XVZ1_9BACT/29-225KAPEKIVLRLKGPMEFTGKTIQENVANI----------------------------------------------------
I6ZWK0_MELRP/29-225KKATGCQVTVTGEGNFKAADIQKACPEV----------------------------------------------------
B3DVZ0_METI4/31-226RQTRVFRVDVFKEGAVTAGDIQVDPGV-----------------------------------------------------
D5EJT5_CORAD/31-226RESVNLIIDVTREGAITAADIQEDANI-----------------------------------------------------
B2UL53_AKKM8/43-238KEPRLLSLRVHKQGVVTAADIADDTVY-----------------------------------------------------
D5SQ96_PLAL2/31-226PSTKTLRIEKTSRGVVTAGDIITDDQV-----------------------------------------------------
D2R6J4_PIRSD/31-226ESTRVITVEKNTTGLITGADVQVDSDV-----------------------------------------------------
E8R483_ISOPI/31-226DQPKTIVIERDREGIVTAADIVHDETI-----------------------------------------------------
I0IGZ7_PHYMF/31-230DEPKTMRLQAEGPGEVTCDLIEADTSITI---------------------------------------------------
B2KEJ3_ELUMP/29-224KNREYVYLTASKPGKVTAKDIAEVSGV-----------------------------------------------------
A9WI15_CHLAA/28-222DRAVALQLIKQGPGPVFARDIDAPSTV-----------------------------------------------------
I0HZI5_CALAS/21-215DEPVRIHVEVSSEGPVTAGDLNCPPEI-----------------------------------------------------
E8N3Q1_ANATU/27-222VETTHMHLEVRGEGTVTAADIQAPAEV-----------------------------------------------------
B5YG22_THEYD/30-227QDSDKKIATIKIKGPADVTAESIQTDGT----------------------------------------------------
D1CFF3_THET1/45-239DRPVTLRLEATGPKVVTAADIRPHADV-----------------------------------------------------
D3DH88_HYDTT/26-221SDVETLYLKKKGEGTVTAKDITCPPNV-----------------------------------------------------
RPOA_HYDS0/25-220SDLEILYLEKNAPGVVLASDIKTPPNV-----------------------------------------------------
C0QQQ1_PERMH/29-224GIDSDFAILEFKGTGEVTAKDIKVPAG-----------------------------------------------------
RPOA_PSELT/29-227DVPVRERVKMTVEKRGPGNLTAADIKVP----------------------------------------------------
RPOA_THEMA/29-227NVTVKGTIKMEVEKKGPGELVAGDIKTP----------------------------------------------------
C5CGH4_KOSOT/37-233EFSDPVKLSIEKKGPAILTAGDIKAPTG----------------------------------------------------
H2J776_MARPK/30-231FDNIGNLKEPIVLRIEKMGPAEIKAGDIIT--------------------------------------------------
RPOA_DEHM1/24-218GLEGILYLKASGAKVVTAADIEPSNDF-----------------------------------------------------
D8K192_DEHLB/24-218GRPGRLILDVKGPREVTAADIEASSEY-----------------------------------------------------
B0VI04_CLOAI/30-225VEEVPLVLEHKGKGVITASMIQETAYV-----------------------------------------------------
S0EXQ0_CHTCT/23-227DGSEGRKSEPRKLRIDVHGEGVVTGADVICP-------------------------------------------------
B8E1G0_DICTD/23-218NNSHILELDVRGPKVVTAGDFIVPANV-----------------------------------------------------
D3PN14_MEIRD/25-221PGTGPKTLTLRASGPKVIYARDLECPPD----------------------------------------------------
E3H8Z9_ILYPC/28-223SGEKRMNLSVQGPKIVTAADINPDSEL-----------------------------------------------------
RPOA_METNO/33-228DTPKRMTLRKTGPGLVTAGDISTIGDI-----------------------------------------------------
RPOA_ZYMMO/34-229DGSRRLHISRTGPGVVTAGDIAVSGDI-----------------------------------------------------
D5AM21_RHOCB/32-227EGPKRLSISAKGPRVVTGADISESMGI-----------------------------------------------------
D5BQE0_PUNMI/32-227EGSKRLRLSAEGPLAVTAGMISESAGV-----------------------------------------------------
F2I1G2_PELSM/31-226NGPKKLILDAKGPGEITAKMINPNPDI-----------------------------------------------------
RPOA_PELUB/36-231ETTKKLILDAKGPGEIKASDIAPVADI-----------------------------------------------------
F7XUM3_MIDMI/11-206CDRRNLRLVAQGPCVVTAGMIEETADL-----------------------------------------------------
RPOA_ORITB/35-232VQKCNLRLEVTGPAVVTAGMITVTDKQD----------------------------------------------------
RPOA_ANAPZ/30-232SNQRVLRLVARGPGEVTAASIVDSADHVVL--------------------------------------------------
RPOA_EHRCR/62-261MNSKVLSLKVKGPCEVRSGMIPDTDDCII---------------------------------------------------
J9Z1B3_9PROT/31-227NHTQKLTLNVKGPKEVLSSDFDENPEVE----------------------------------------------------
RPOA_ALKEH/29-225RDEAELTVSVQGPGPVTAGDIQTAHDVE----------------------------------------------------
RPOA_HALHL/29-225RDSVTLSVEKQGPGSVTAADIATDHDVE----------------------------------------------------
F9ZMD2_ACICS/28-224RNEVMVTLRKRGPGLVTGADIIAEHGIE----------------------------------------------------
D0KXN7_HALNC/29-225RDEAMLSIKKTGAGAITAADIKADHAVE----------------------------------------------------
S6BQG0_9GAMM/29-227RDEAMLALNAKGPGTVTAGDLQLPHGVE----------------------------------------------------
L0H1T5_9GAMM/31-229KDEATYTLSKTGPGVVTAGDIALDHAAV----------------------------------------------------
F6AJD1_PSEF1/29-227RDEVTLTLAKKGSGVVTAADIQLDHDVE----------------------------------------------------
H8KYM7_FRAAD/29-227GDEVTLSLSKTGKGVVTAGDIVVDHSVE----------------------------------------------------
RPOA_PSYA2/29-226QNEVFLTLDKQGPGTITAADITLPHNVD----------------------------------------------------
D3SCR1_THISK/27-225REESTLSLKKKGPCVVTAGDITVDHDVE----------------------------------------------------
RPOA_NITOC/27-225RDEVTLNLSSKGPVTVTAGDIQLEHDVE----------------------------------------------------
RPOA_BUCBP/29-230KDQVYLTLVKTGIGVVTAADINHGNDVEII--------------------------------------------------
RPOA_BUCCC/29-228KDEVTLYLKKSGIGPVLAKDINHDNSTEI---------------------------------------------------
RPOA1_PSYIN/29-227KNEVLVSLTKSGAGPVIAADITHDSDLE----------------------------------------------------
F9ZWY4_METMM/29-226KDEVTLTLSKSGIGSVTAADIEVTSSVE----------------------------------------------------
U5N4B0_9BURK/26-224RNEVTLVLRKDTDGEITAADIVLPHDVE----------------------------------------------------
RPOA_NEIMB/29-227RSQVQLVLKKSGSGVVSAGDIELPHDVE----------------------------------------------------
F8GHK6_NITSI/27-224NDEAIITLKKSGKCVVTAGDIDVGHDVE----------------------------------------------------
D7DLR4_METV0/29-227KSETILVLNKSVEGVVTAGDFETGHDAE----------------------------------------------------
RPOA_NITEU/27-226NKTQSVLTLKKSSEGIVTAGDIEATHDVE---------------------------------------------------
D9SCT8_GALCS/27-224VKEVVLTLKKEGFGVVTAADISANAEVE----------------------------------------------------
RPOA_LEGPH/29-230GNEAQITLNKEGPCQVTAGDIQLTHGQEII--------------------------------------------------
RPOA_RUTMC/29-225AETAQVVIEKKGPCEITVADIEANGIDI----------------------------------------------------
RPOA_METCA/29-225PHDVYLNVDKHGPGPVLAGDIEASHDVE----------------------------------------------------
D3EQH5_ATETH/26-221DQIQIGRLVAVGAAHVTAAQFDLPSEV-----------------------------------------------------
RPOA_NOSS1/26-221SQAQIGRLLVNGPTTITASHFDLPSEV-----------------------------------------------------
K9YNU7_CYASC/24-218DTPQIGRLVATGPDTVTAAQFSLPSEI-----------------------------------------------------
B0C430_ACAM1/26-221NDPQIGRLFVQGPATVTTDDFELPTEV-----------------------------------------------------
K9YFL4_HALP7/30-225PGPHIARLAATGPATITAGDFNVPSEV-----------------------------------------------------
RPOA_THEEB/25-228SEPQMGRLFAQAPENEPLTVTAGMVQLGS---------------------------------------------------
RPOA_SYNE7/25-220PQPQIGRLRVVGPATVTAADVDFGPEV-----------------------------------------------------
RPOA_SYNJB/46-241PETQVGRLVAQGPGEVTAEKLQLPSDV-----------------------------------------------------
RPOA_GLOVI/26-221SDIQIGRLAVQGPKRVTAADLELPTEV-----------------------------------------------------
RPOA_SYNPW/26-222SELEIGRLVVAGPATVKARDLQFSSQVQ----------------------------------------------------
F2YGP3_CHLVA/29-231SKLINLENFQATGFLKSCGPRKLSGADVKLP-------------------------------------------------
M0ZUU3_SOLTU/6-197YGTSEASISVKGPGYVTAQDIILPPY------------------------------------------------------
A0A2K1KJX0_PHYPA/147-339DEPQKAIISAIGPGPVTAGDIVLPPS------------------------------------------------------
RPOA_PHATC/29-220QDTQFGHLKVQGPSVVTADLIQLPPGV-----------------------------------------------------
H0UL77_9BACT/20-215VEVRVLRLEATGPKKVTVADIQPDSEI-----------------------------------------------------
I4BV50_ACEMN/23-218DEVRVLRLEAQGPKEVTAADIAPDSEI-----------------------------------------------------
RPOA_WOLSU/29-223DAERVTLDYSFKGPATIKGSDLVNDYV-----------------------------------------------------
RPOA_HELPY/29-231LVGQDSSLENQSVVVDYSFKGPMELRARDL--------------------------------------------------
B9L6T7_NAUPA/28-221GDEAVVDYVFVGPKEIKGSDLANDLV------------------------------------------------------
RPOA_CAMHC/29-223DSKREVIEYNFTGPKEITGKDLNNDIV-----------------------------------------------------
RPOA_SULNB/29-223GSDRVELKYSFSGYKEVTAQDLNNDQI-----------------------------------------------------
W0JDL0_DESAE/30-226ENFKECVLKINKKGPGVLKASDIELTSD----------------------------------------------------
A5K332_PLAVS/443-664NIETNIRLIFKGPLMLVAGMIPLPSHLQVVNKEQYICT------------------------------------------
A2DQ63_TRIVA/37-104--------------------------------------------------------------------------------
M0T693_MUSAM/32-98--------------------------------------------------------------------------------
D2UZC7_NAEGR/31-97--------------------------------------------------------------------------------
D7G4D0_ECTSI/79-145--------------------------------------------------------------------------------
G1X7Y3_ARTOA/102-168--------------------------------------------------------------------------------
L2GT01_VAVCU/22-88--------------------------------------------------------------------------------
K5X3Y7_PHACS/32-98--------------------------------------------------------------------------------
W5JCM8_ANODA/18-84--------------------------------------------------------------------------------
C4WWR4_ACYPI/19-85--------------------------------------------------------------------------------
E0W436_PEDHC/18-83--------------------------------------------------------------------------------
E9FTC8_DAPPU/3-68--------------------------------------------------------------------------------
G4VD46_SCHMA/404-469--------------------------------------------------------------------------------
Q6C4D6_YARLI/56-122--------------------------------------------------------------------------------
K1WJJ6_MARBU/57-123--------------------------------------------------------------------------------
Q0UFU4_PHANO/45-119--------------------------------------------------------------------------------
H9GMN1_ANOCA/27-93--------------------------------------------------------------------------------
A0A015MNU0_RHIIW/44-110--------------------------------------------------------------------------------
B3S798_TRIAD/12-78--------------------------------------------------------------------------------
D8U457_VOLCA/12-78--------------------------------------------------------------------------------
F2UL86_SALR5/40-112--------------------------------------------------------------------------------
Q4U9J3_THEAN/12-77--------------------------------------------------------------------------------
A0A384LDW2_PLAKH/17-82--------------------------------------------------------------------------------
U4LH46_PYROM/41-111--------------------------------------------------------------------------------
D7FJZ6_ECTSI/27-92--------------------------------------------------------------------------------
M2WNE1_DOTSN/42-108--------------------------------------------------------------------------------
R9ADM4_WALI9/35-101--------------------------------------------------------------------------------
I2G5Z2_USTH4/35-101--------------------------------------------------------------------------------
I2GXX0_TETBL/22-88--------------------------------------------------------------------------------
E2RTX5_GIAIC/33-107--------------------------------------------------------------------------------
D7DR78_METV3/13-87--------------------------------------------------------------------------------
RPOL_METMP/15-89--------------------------------------------------------------------------------
A6UTG0_META3/15-90--------------------------------------------------------------------------------
RPOL_METAR/14-80--------------------------------------------------------------------------------
D7E9E3_METEZ/14-79--------------------------------------------------------------------------------
RPOL_METTP/14-79--------------------------------------------------------------------------------
N0BKM3_9EURY/14-79--------------------------------------------------------------------------------
D2RHL4_ARCPA/14-79--------------------------------------------------------------------------------
G0EET7_PYRF1/15-81--------------------------------------------------------------------------------
A1RX43_THEPD/25-90--------------------------------------------------------------------------------
RPOL_KORCO/14-80--------------------------------------------------------------------------------
RPOL_HALSA/14-83--------------------------------------------------------------------------------
F7PHA3_9EURY/14-83--------------------------------------------------------------------------------
H1YXQ0_9EURY/14-79--------------------------------------------------------------------------------
A2SSW1_METLZ/18-85--------------------------------------------------------------------------------
RPOL_NANEQ/19-85--------------------------------------------------------------------------------
A1RWW0_THEPD/10-260LYEQGKDPQVIFSLEEEAGERPRTVLSGHLRFEGIEGAPLPPESAGIEPVSKNIPIL-----------------------
D9Q275_ACIS3/17-268EECSNASENDSHCFAQVYLEYEVPQDAASGVYVKASDLKFSDPDIRPIYPETPIVYLA----------------------
A0RXU9_CENSY/15-196IDPDDPINRVMLTLDSGEAAETR---------------------------------------------------------
G0EF28_PYRF1/10-270EEFQESCIDSSGVPKFDEPGCFATLTLEVETGVDEVRMVYSGDLQSSDPTVKPVYPNIPIVL------------------
A2BK79_HYPBU/15-266EECEKAELGDPSCYVVLRLEVETGPREERIVYSGDLETSDPDVRPVYDNMPIVVMAPD----------------------
I3TDW7_THEC1/14-266EECREAGEKGVFSEDCFVKLELSGEGTPGGVKTLYAGDLVTGDPDVRPVYEKIPIVQL----------------------
E0SQ92_IGNAA/14-269DIDVCYKCGSDSEDKPPSDVCEKCYVHMFLEAVAEDSEYTVYSSDIKSEDEFVKPVYGNI--------------------
A8A8W5_IGNH4/14-271EACMECTPEEAEADKCVVDGKPCYVRLYLDASAEGKQIIVYSKDLKSEDEDVRPVYENIPV-------------------
K7J3Y0_NASVI/1262-1538TTADEEEVSDQDTLRYEIKAICKWNPHAPKDSRRPDDIYCGNNVYSKDIKWNPIGRQNELYPDGEKQFGM----------
E2ACS1_CAMFO/52-332GRKDEEVSEQDTLKYELKVTCTTHPQAPKYSRLPEDMYRNSKVYSKDIKWVPIGRQGDMFPHGTEQFSVLEN--------
T1IB98_RHOPR/49-320GDSVGTDTDTLEYELRVKCVKNPHCRVGHYRPEDMYLDYHVMSKDIKWVPVGGQSSIHKAEDVRPVHD------------
E9GTW6_DAPPU/70-342DDDAGTPEDTLEFELKVKCSWNPQRTKDHTNPEHLYRDFRVLTSHLKWMPLGGQKDIFTPDAVGPVDD------------
H9J5X2_BOMMO/53-321EDTEGTEFNTLEFSLKVKCTNSKSQPKDSYRAEDLYENHSIYSSHMKWHPIGNQATVYKEADVGPV--------------
B0W725_CULQU/57-325EGDAANAQDTLEFELKVKCTKKNKDSTEVTNNDSMYKNHSIYSGQIKWVPVGNQASIYKEADVGPI--------------
D6WP50_TRICA/56-325PTAEGTEQDTLEFALKIKCTNNKDSSKDSLRAEDMYKNNNVYSKHIKWVPIGKQKERFSDVGPIHPD-------------
E0VYJ4_PEDHC/56-328NSNEPNEQDTLEFELKIKCSVNKEGHKNSYQIDDLYINHSVYSKHLKWVPIGSQGTTYDEKNIGPVLP------------
B7Q825_IXOSC/59-330DSEGSPEDTVEFELKVKCTRNPQAPKDATTPDELYKDHVVYTRHLTWTPIGSQAEIFGNKPPKPVYDD------------
F6YSX7_CIOIN/63-332DDADGTPEDTLEFELNIKCTKNLSAPKDTTDLDVLYKHHKVYSKDIKWIPLGNQKDLLTVKPVYDDI-------------
G3ND01_GASAC/63-338GEASAEEEGSEIDTIQLQLKIKCSRNPRATKDSADPRELYLNHMVYSRDIKWVPIGNQADVFADSVIAPV----------
T1KCG6_TETUR/56-326NDMEGTPQDTIELSLKIKCVKNPEASKETGVTDLYLNRNVYSKSIKWVPLGNQSSFIKETIKPVNDD-------------
J9K0P2_ACYPI/45-312ENSEPNEHDSLVYEMKIKCTKKDLDALAHKQFISFPVYAKHIKWLPLGNQKDIFTEKDVGIISDDI--------------
G4VD46_SCHMA/51-335KPPASDDLSGFDPKEHLVYDLCVGFTHSSKDSHNKPEKDKDDTLPVAQYLPVYSSDLKWIPLAGQEDHFNINN-------
A0A068Y929_ECHMU/48-328DLPDIDDLNGFDPNSHLVFDLSVKAERPSSKGNSDSQPKESFQSFPLYSSSLTWVPLPGQEDAFKNEGASY---------
G0MU26_CAEBE/68-353KVVGINEKGVDCDEEPEGDPTRNLIFKINVACTKNRNAANGTTDPKQLYHHSSVYSRAFEWIPIGNQKEGYTKQN-----
K1RM70_CRAGI/59-328GEDFSPEDTIIFQLKVKCTKNSQAKDTTDPDEMYKDHKVTTKHLKWIPMKGQDTIFKEGDLRPVNDD-------------
T1G2S8_HELRO/59-331DSTEMTATDSIGFKLQVKCQKNLKASKGTLDKNELYNHFKVTTKDLIWFPVGDQTYTDENEIPKPADD------------
B3S4F3_TRIAD/60-333GDTPTNKNSITFTLQIKCIRNRSAHSDATDPEELYINSKVTTKDLKLKYNEDQDNAIPNKDIRPVHEDI-----------
S0DJA1_GIBF5/72-369WHKKPEAGEDPYAGCFDWNTVRLELNVTCTVNEDASPAENDPLKAYHNAHVYARDIVFVPTGKQAEYFSGEDAIAPTNPD
S3BZ54_OPHP1/66-364FWKRPAVDAEQGEFPTSFDYNTIKLDLRVECTHNRDAAPGETDPTKLYNHAHVYAKDIVFVPEGRQVQYFSGADAIAPVN
V5I0T0_BYSSN/65-363FKKPTDEDDPSTGSTPSDYNTVVLRLDVECTKNPNAAPGEDDPRKLYNNAHVYAKDITFHPVGRQETYFKDDEAIQPVNP
U4L7M8_PYROM/58-336SRKGVDPKTNAEYPPTVNDTLILHLEVTCQRIPGAPKNETDPDKLYTGHTVYARDLQWRPANSTQQVKFGD---------
G1XAZ6_ARTOA/62-343RKKSPDEPAAEATDFNTVVMTLKVACTRNHATPNTETDPSKLYFNSSVYARDIKFAPQGRQSSWFSGAGEIRP-------
B2WCA1_PYRTR/63-364YAKPTDEDEGSGGPTSENTVALTLKTKCTWQPGGVARAVAGETDPDRLYVGHNVYAKDMRFEPNGNQAENLSEAEGKHIR
M7SAL9_EUTLA/70-367FWRRPRDGQDAFDTTFDNNTVSLQLRVKCAHNKDAAPDERDPKKLYHNAHVYASDITTELLGGQAKYFEGDGAVRPVYPD
B6JXY4_SCHJY/59-335PGPGMEATHTDYDTVVFSLNVKCDFNKEAAPGETDPKKLYLNSEVLSGELVWKPQGRQAERFADNPLTVV----------
M7PLN2_PNEMU/62-338PGENQEPKPTDYDTVVLSLKVSCTRNPKASKNETDPEKLYINSKVYSGDIQWQPAGRQIEIFKDDPIRAV----------
R4XFB4_TAPDE/65-343PAEGEAPQPTDADTVVLSLNVKCERNKDAPADCEDPKELYINGDVTSGMIKWTPMGEQSNTLSRFKIGPTQ---------
C4XY85_CLAL4/52-323AADEAERFNDTNTIVMSLDVSCTRNPHAPAGTTDPKLLYRNSSVYARDLKFEPQGRQAELFKDSPVVP------------
Q6C4T2_YARLI/58-326GLDASEIEDYYDDSNTFVLRLNVTCERLADGTMKNAHIYARDITFDPMGNQCQWVKDEGLENVFKV--------------
F4S444_MELLP/74-344EGATDMNTLVFKLVARCSRNPNVSKTEKDPSILYTDSDVTSGYLDWQPKGDQPALFGSQPPKAVQDD-------------
G7E7N5_MIXOS/75-348DEGPTDLNTVVFSLLAKCEHRPGHDPDEKDPDELYIDSNVFSGKLEWKPQGAQESMFDTDATRPRPVQD-----------
R9PBB7_PSEHS/88-358GDDADDSNTVVFHLKAKCERNRTAARGETDPDKLYIGHNVYSEQLQWDPKGGQDEDFADAPPRPVHD-------------
L8X0D5_THACA/736-1007AVGPTDRNTLVFKLSVTCSRNPGVPKDETDPAVLYKNANVLSGHMEWNGVGEQVNDFGNNPPRPHNPK------------
S8EGP7_FOMPI/70-342NGVPTDQDTIVFKLNVTCEVEKNAPKEKGAPRKLIHEEVLSGDLLWVPQGEQQSVFPAGSPFPAPTNK------------
B0CTH8_LACBS/57-328SADQATDRNTIVFEIKLTCERNPKAKKDSTDPDESYINHEVLSSHLVWKPAGEQEEVFAGNPPAPTNP------------
V2Y1G5_MONRO/66-340DDPPTDRNTMVFKADFYCQKNPAFKPTPNTTPKPKEMYINHEFLAEHLVWHPAGEQESAIEDGPRPGPT-----------
I4YFV5_WALMC/58-331GDSPNDQNTIVFTLQVACTRKAKVAAGETDPDKIYENHKVYSKDFKWVPQGGQASDPLFTDNPPRVAYP-----------
D0NVB2_PHYIT/45-311NEEAEATDENTIVFKLDVTCKFDPEHPKDPTKAIHSSVYSRDLEWVPQGNQEERFGSIRPVHEDI---------------
D7FPF8_ECTSI/59-340EGGEQDEPTEFNTCVFKLEVKNPADPADMPDPMPTGTSYAAGPRRTMNVFSGAMEWCPHGDQVERFEGEGGLR-------
B8CCH8_THAPS/58-351DVDEVGEVAATDRNTIVFRLNEATSLHSSSNQQKTVIDSPHRPFTKHIYTRDLLWAPQGSQLTNFPLHSTGVGSGVGGG-
A0A0D2X5I3_CAPO3/125-396PDTQATDRNTLVFTLDVKCTKNPHASPNATDDTEKYINSRVLSSDIVWVPKGDQEAQFQDAPIAPVHD------------
A9V9D0_MONBE/62-334DGGQPTDANTIVFNLKRVCTKKPNAPADATNPEDLYENAVIYSRDLEWAPQGQQEQVFGKNGFSVVYD------------
F4PDW3_BATDJ/53-324SDDPPTDLNTLVFRLNIKCTRNPHASASEINPSNKYIDSDVLSKHLIWEPQGDQVEKFKDSPIRPYYD------------
S2JI72_MUCC1/65-335DGGPTDLNTLVFKLKKKCEFNPEASADETDPNKKYINSFVYSSDLVWEPKGNQEEKFGDNPPRPVHD-------------
A0A015L7C0_RHIIW/2-272TEHPTDQNTIVFKLKQECKRNPKASADEAEYINHNVYSAALIWEPKGDQAERFKDSPIRPVHDDILI-------------
F2UC17_SALR5/48-314DNNEMNDLNTLVFDLDVECKHREGAKAGETDKNKKYINHMVMSSDIKWQPKGNQKDRFKTAICPV---------------
A7SL38_NEMVE/59-329GDEEAQDDTTLVFELKVKCIKNKNAPKDATDPDELYINSKVTTDHLKWIPTPQQAQKFGPQDIRPLSN------------
B4FAR4_MAIZE/85-364NDVPNERNTIVYKLHVSCPKNSQRITVKSSELEWLPEGSQLSMSAPAQSGDKQKTFTSFSQSQKEILEKPLG--------
I1N089_SOYBN/94-380AGDDKNEKNTIVFKLHVRCQVGQPRITVKSDKLKWLPNGSELPCEDVKPNAGSKPKTFTSFTCSQDSLPEFSNNS-----
A9T5P0_PHYPA/74-352EENANEKNTIVFKIDVVCTRKGERVLNSSVTSDQMKWLPEGSEMPFNTMTKFTSFGSSQKNLPGLPAEGIS---------
C1MRA1_MICPC/92-403GDTPTEKNTIVFKMCVKCTREKTTDGTKGALINDKVYTDSLVWLPNGSELPPDEETKFTQFSCDQGEYLKKRNKESKELG
A0D2I2_PARTE/44-310QEEYNELNSIDFTLYAKCEKKPNSKQDDPIEQQYTNTTVHSSSLIWQPKGQQAKLFAANPIRPVH---------------
Q235X0_TETTS/59-332EDEYNEKNSLKFTLKIKCSKKEQYKNYSEADLENLTPETYLENAIVYSGDFKWVSQGEQNKKFEENPIR-----------
B6KLD3_TOXGV/72-331NQEVTDENALRVSLHVKCTEQSLGPHQTSLPVYAKHIKWEPMSPSQKEAFAANPPRAVHPDI------------------
F4Q915_CAVFA/82-344SKEYTAEDTLIFKLNVRCYKDENGETVNGTVTSGQLKWEPTEDQESMFGENPEDFPRPVHDDI-----------------
D2UXC7_NAEGR/70-352INQNEDIILLDNEYILFELNVTCEKTLVPNPHNQNKLEYKHSKVYSGDLKWVPIGNQSTHFNGENAIRPVYD--------
E1ZQP2_CHLVA/92-364EDAPSEQNTIVLKLKVECRRLPNSGMENDKVYSRDLQWLPEGSEMPDETSCRFASSQAALVPEDVRPV------------
L2GLK3_VITCO/40-283EETFENVLNFRIDKTADKEPVNLMSDDIEFVPAEGQDHFSFRFKPNVLVCKMVP--------------------------
J8ZX59_EDHAE/40-294TDTENEKNALKFVLKKQNNMNDIVVVTSDDIKWVPLGNQKDTLVPRPRIKSGIPITKICN--------------------
R0KMW6_NOSB1/50-299THDSSNSLYFSLKIENKTKDVIDVTSNDIKWLPKDDQNDLCRNVELKKDIPIAKLAP-----------------------
C4V751_NOSCE/43-279FELKKTNTSSEVMTVTSNDIKYIKKDGQPDIEISKDIPIAKLAPKQALIIE-----------------------------
S7XPP5_SPRLO/33-271DLSPTNSIKFHLNVKNDTKNITTVYSDSIEVDQQHNLSDVVKKGCIITKLAP----------------------------
H8ZEB8_NEMS1/21-261SEVLDPLAELTDENSIKMELNVENTTDKVLTVRSNDIKIVSNTKTTLKQNVII---------------------------
C4M554_ENTHI/23-272DAILELKEENNSNQLVVVTSNDLVSIGDKRVAPVNYKNDVDPIVITQLGPRQNIHMV-----------------------
C1MVZ5_MICPC/25-313DYAGDDESVTDVHFELNTGICASAETVDVTSNDLVCYDPRVAPVNYHPGESIKGKGGAMEFEAQAAARGPDDGPDI----
Q01F02_OSTTA/22-286EYMGEDDSATDVHLELNVRCLTEQAMDVTSEDMVSYDERVKPITFQGTVSDAAKPGGILIVKLR----------------

PF13656

H2M356_ORYLA/23-97--------------------------------------------------------------------------------
H2R0V0_PANTR/30-104--------------------------------------------------------------------------------
RPOL_SACS2/12-86--------------------------------------------------------------------------------
Q0UWS5_PHANO/103-177--------------------------------------------------------------------------------
B8GF45_METPE/12-85--------------------------------------------------------------------------------
A7I5J1_METB6/12-86--------------------------------------------------------------------------------
S9VSU8_SCHCR/29-103--------------------------------------------------------------------------------
L0ACU8_CALLD/16-88--------------------------------------------------------------------------------
RPOL_SULTO/12-86--------------------------------------------------------------------------------
A0A384KHM4_PLAKH/36-108--------------------------------------------------------------------------------
F0ZJT3_DICPU/35-109--------------------------------------------------------------------------------
V5IL63_NEUCR/30-104--------------------------------------------------------------------------------
G2XWM6_BOTF4/61-134--------------------------------------------------------------------------------
C1EAB7_MICCC/30-99--------------------------------------------------------------------------------
J1AN07_9EURY/12-85--------------------------------------------------------------------------------
U5D302_AMBTC/21-94--------------------------------------------------------------------------------
B6AD73_CRYMR/32-146--------------------------------------------------------------------------------
K1V9X0_TRIAC/34-108--------------------------------------------------------------------------------
A0A068YHT2_ECHMU/30-104--------------------------------------------------------------------------------
RPOL_METBU/12-83--------------------------------------------------------------------------------
A0A068Y929_ECHMU/386-458--------------------------------------------------------------------------------
G1XT40_ARTOA/53-127--------------------------------------------------------------------------------
F8PIR5_SERL3/20-94--------------------------------------------------------------------------------
A0A015L6K0_RHIIW/30-104--------------------------------------------------------------------------------
RPOL_PICTO/15-88--------------------------------------------------------------------------------
K4MG73_9EURY/12-84--------------------------------------------------------------------------------
I4Y8T6_WALMC/32-106--------------------------------------------------------------------------------
M7PEH0_PNEMU/31-106--------------------------------------------------------------------------------
RPOL_METS5/12-86--------------------------------------------------------------------------------
U7Q4U5_SPOS1/37-111--------------------------------------------------------------------------------
M2MYP9_BAUPA/30-104--------------------------------------------------------------------------------
K1WMN3_MARBU/31-104--------------------------------------------------------------------------------
F2KQH2_ARCVS/13-85--------------------------------------------------------------------------------
M2SYV1_COCSN/30-104--------------------------------------------------------------------------------
G7E8P6_MIXOS/27-101--------------------------------------------------------------------------------
T1JXZ6_TETUR/15-91--------------------------------------------------------------------------------
L0L0D7_METHD/12-85--------------------------------------------------------------------------------
R4XFR4_TAPDE/31-121--------------------------------------------------------------------------------
YR470_MIMIV/277-352--------------------------------------------------------------------------------
D8RRF0_SELML/32-104--------------------------------------------------------------------------------
C6HHU3_AJECH/49-123--------------------------------------------------------------------------------
N1RT61_FUSC4/58-131--------------------------------------------------------------------------------
M1B174_SOLTU/11-84--------------------------------------------------------------------------------
T1JU99_TETUR/30-104--------------------------------------------------------------------------------
E0SNS0_IGNAA/14-87--------------------------------------------------------------------------------
F2U1F2_SALR5/30-104--------------------------------------------------------------------------------
M9SCC2_METAX/7-77--------------------------------------------------------------------------------
D8QE38_SCHCM/21-95--------------------------------------------------------------------------------
A4I2U7_LEIIN/39-119--------------------------------------------------------------------------------
U5H732_USTV1/35-109--------------------------------------------------------------------------------
V2XV85_MONRO/10-84--------------------------------------------------------------------------------
D7LLA3_ARALL/11-84--------------------------------------------------------------------------------
D9Q2R4_ACIS3/13-87--------------------------------------------------------------------------------
RPAC2_DANRE/22-96--------------------------------------------------------------------------------
RPOL_AERPE/15-87--------------------------------------------------------------------------------
R4XLF1_TAPDE/31-105--------------------------------------------------------------------------------
E3GW45_METFV/12-82--------------------------------------------------------------------------------
Q75CF1_ASHGO/30-104--------------------------------------------------------------------------------
K0IDG9_NITGG/12-80--------------------------------------------------------------------------------
N1JCQ0_BLUG1/30-104--------------------------------------------------------------------------------
E1RHP8_METP4/13-82--------------------------------------------------------------------------------
Q4UD30_THEAN/39-109--------------------------------------------------------------------------------
A7SGE2_NEMVE/30-104--------------------------------------------------------------------------------
I1H2S9_BRADI/30-104--------------------------------------------------------------------------------
C5DEP5_LACTC/30-104--------------------------------------------------------------------------------
K3YB14_SETIT/11-84--------------------------------------------------------------------------------
H6BY80_EXODN/40-116--------------------------------------------------------------------------------
C1N3U7_MICPC/5-79--------------------------------------------------------------------------------
A7ELB7_SCLS1/31-105--------------------------------------------------------------------------------
A3DM82_STAMF/12-86--------------------------------------------------------------------------------
T0N787_9EURY/16-89--------------------------------------------------------------------------------
K0KAE3_WICCF/30-104--------------------------------------------------------------------------------
B7G3C7_PHATC/32-107--------------------------------------------------------------------------------
T1FV14_HELRO/24-100--------------------------------------------------------------------------------
RPOL_HALMA/12-89--------------------------------------------------------------------------------
RPOL_PYRAE/16-89--------------------------------------------------------------------------------
D5E7V1_METMS/12-83--------------------------------------------------------------------------------
B8P7Q9_POSPM/10-85--------------------------------------------------------------------------------
I1CQ65_RHIO9/65-139--------------------------------------------------------------------------------
A3FPR0_CRYPI/32-103--------------------------------------------------------------------------------
Q4E3C1_TRYCC/40-120--------------------------------------------------------------------------------
A1CD73_ASPCL/66-140--------------------------------------------------------------------------------
R4G2Y7_RHOPR/16-87--------------------------------------------------------------------------------
N1JCX8_BLUG1/50-124--------------------------------------------------------------------------------
K1W3H6_TRIAC/50-124--------------------------------------------------------------------------------
C3YRU6_BRAFL/10-83--------------------------------------------------------------------------------
V5FS87_BYSSN/46-120--------------------------------------------------------------------------------
H3GWJ9_PHYRM/21-94--------------------------------------------------------------------------------
A4S056_OSTLU/30-104--------------------------------------------------------------------------------
J3K3I0_COCIM/30-104--------------------------------------------------------------------------------
F4P6Q6_BATDJ/4-78--------------------------------------------------------------------------------
M7SKI7_EUTLA/74-148--------------------------------------------------------------------------------
I3EF49_NEMP3/8-90--------------------------------------------------------------------------------
R9T596_METII/12-84--------------------------------------------------------------------------------
J9DLV1_EDHAE/73-147--------------------------------------------------------------------------------
G7WNR7_METH6/12-85--------------------------------------------------------------------------------
J9DRQ7_EDHAE/17-93--------------------------------------------------------------------------------
R0KLQ1_NOSB1/56-130--------------------------------------------------------------------------------
G4TQB3_SERID/33-107--------------------------------------------------------------------------------
E6N524_CALS0/14-87--------------------------------------------------------------------------------
S2JHT7_MUCC1/30-104--------------------------------------------------------------------------------
C7YU34_NECH7/39-113--------------------------------------------------------------------------------
S7W7N8_SPRLO/17-90--------------------------------------------------------------------------------
F4BTP0_METSG/12-85--------------------------------------------------------------------------------
T1H6G1_MEGSC/11-83--------------------------------------------------------------------------------
B5IB51_ACIB4/15-88--------------------------------------------------------------------------------
E2C409_HARSA/11-83--------------------------------------------------------------------------------
Q7PM95_ANOGA/17-91--------------------------------------------------------------------------------
D4GVL8_HALVD/12-89--------------------------------------------------------------------------------
Q6C7Q3_YARLI/30-104--------------------------------------------------------------------------------
D3BVK7_POLPP/27-100--------------------------------------------------------------------------------
L7K018_TRAHO/20-92--------------------------------------------------------------------------------
E4NQ40_HALBP/12-89--------------------------------------------------------------------------------
A0RXH5_CENSY/12-85--------------------------------------------------------------------------------
H6BMI7_EXODN/175-249--------------------------------------------------------------------------------
B9GIX0_POPTR/11-84--------------------------------------------------------------------------------
L0JP64_NATP1/12-89--------------------------------------------------------------------------------
B6AF09_CRYMR/38-109--------------------------------------------------------------------------------
S7ZBA7_PENO1/30-104--------------------------------------------------------------------------------
W7WXG3_TETTS/100-173--------------------------------------------------------------------------------
F8QFM3_SERL3/30-104--------------------------------------------------------------------------------
Q2FNB5_METHJ/12-85--------------------------------------------------------------------------------
U5H4K1_USTV1/30-104--------------------------------------------------------------------------------
I2FXZ1_USTH4/31-103--------------------------------------------------------------------------------
RPOL_METJA/12-94--------------------------------------------------------------------------------
R9SMX5_9EURY/16-89--------------------------------------------------------------------------------
E1QRF2_VULDI/13-86--------------------------------------------------------------------------------
M1XQZ1_NATM8/12-86--------------------------------------------------------------------------------
E2AMR2_CAMFO/8-79--------------------------------------------------------------------------------
B4JPA4_DROGR/18-90--------------------------------------------------------------------------------
I0A279_FERFK/18-92--------------------------------------------------------------------------------
D8J3W9_HALJB/12-89--------------------------------------------------------------------------------
M7P2B5_PNEMU/30-104--------------------------------------------------------------------------------
T1IFN7_RHOPR/30-104--------------------------------------------------------------------------------
W1QG67_OGAPD/30-104--------------------------------------------------------------------------------
H1VZW5_COLHI/30-104--------------------------------------------------------------------------------
Q22RW2_TETTS/60-133--------------------------------------------------------------------------------
B7P8Y3_IXOSC/17-90--------------------------------------------------------------------------------
A0A087ZQW2_APIME/16-89--------------------------------------------------------------------------------
R0KJ67_SETT2/43-117--------------------------------------------------------------------------------
RPOL_METKA/17-102--------------------------------------------------------------------------------
A0DTF6_PARTE/43-114--------------------------------------------------------------------------------
Q2NE51_METST/10-81--------------------------------------------------------------------------------
R0MC98_NOSB1/13-94--------------------------------------------------------------------------------
R4WAG4_9EURY/12-87--------------------------------------------------------------------------------
F4Q1X1_CAVFA/30-102--------------------------------------------------------------------------------
D3DYV1_METRM/12-87--------------------------------------------------------------------------------
D3S1Z5_FERPA/13-85--------------------------------------------------------------------------------
F4B3S3_ACIHW/12-83--------------------------------------------------------------------------------
T0MN48_9EURY/13-85--------------------------------------------------------------------------------
Q5KMK6_CRYNJ/39-113--------------------------------------------------------------------------------
A8NBN7_COPC7/30-104--------------------------------------------------------------------------------
F1A1H8_DICPU/30-104--------------------------------------------------------------------------------
A0BUX3_PARTE/39-112--------------------------------------------------------------------------------
H8ZDJ1_NEMS1/30-105--------------------------------------------------------------------------------
B7FZW0_PHATC/2-83--------------------------------------------------------------------------------
I2H4R7_TETBL/30-104--------------------------------------------------------------------------------
RPOL_HALWD/12-91--------------------------------------------------------------------------------
C4V9M5_NOSCE/14-88--------------------------------------------------------------------------------
B6Q8P4_TALMQ/30-104--------------------------------------------------------------------------------
G8BPN3_TETPH/48-122--------------------------------------------------------------------------------
D5G8A7_TUBMM/30-104--------------------------------------------------------------------------------
RPB3_ASFB7/278-353--------------------------------------------------------------------------------
A7SBE9_NEMVE/4-77--------------------------------------------------------------------------------
S3D3J4_GLAL2/36-110--------------------------------------------------------------------------------
R7YXM0_CONA1/57-131--------------------------------------------------------------------------------
K1QKY4_CRAGI/25-98--------------------------------------------------------------------------------
L2GWA5_VAVCU/33-104--------------------------------------------------------------------------------
RPOL_SULAC/12-86--------------------------------------------------------------------------------
D8T4E7_SELML/4-76--------------------------------------------------------------------------------
M2R9T6_CERS8/30-104--------------------------------------------------------------------------------
C4LXS9_ENTHI/28-101--------------------------------------------------------------------------------
G2MGD7_9EURY/12-89--------------------------------------------------------------------------------
A2DKG2_TRIVA/20-91--------------------------------------------------------------------------------
W5J6V9_ANODA/30-104--------------------------------------------------------------------------------
G4RLB3_THETK/13-85--------------------------------------------------------------------------------
Q6CIV1_KLULA/45-119--------------------------------------------------------------------------------
RPAC2_CAEEL/60-134--------------------------------------------------------------------------------
E2LXE8_MONPE/30-104--------------------------------------------------------------------------------
Q8SS03_ENCCU/18-92--------------------------------------------------------------------------------
RPOL_NATPD/12-89--------------------------------------------------------------------------------
F4RFP0_MELLP/30-104--------------------------------------------------------------------------------
L2FWL1_COLFN/54-127--------------------------------------------------------------------------------
A8M9E3_CALMQ/15-88--------------------------------------------------------------------------------
R1GQM6_BOTPV/30-104--------------------------------------------------------------------------------
W0JQG4_9EURY/12-89--------------------------------------------------------------------------------
M5EBF3_MALS4/31-105--------------------------------------------------------------------------------
RPB11_DICDI/30-104--------------------------------------------------------------------------------
B8C8G2_THAPS/2-77--------------------------------------------------------------------------------
A5DL81_PICGU/34-108--------------------------------------------------------------------------------
A4RTY9_OSTLU/12-88--------------------------------------------------------------------------------
D8T102_SELML/13-86--------------------------------------------------------------------------------
A9A3V3_NITMS/12-84--------------------------------------------------------------------------------
G2XE43_VERDV/55-129--------------------------------------------------------------------------------
U7PQ43_SPOS1/69-142--------------------------------------------------------------------------------
D8QD48_SCHCM/30-104--------------------------------------------------------------------------------
RPOL_ARCFU/12-85--------------------------------------------------------------------------------
B6JWF5_SCHJY/34-108--------------------------------------------------------------------------------
B8D6L1_DESA1/12-85--------------------------------------------------------------------------------
Q5KMB4_CRYNJ/30-104--------------------------------------------------------------------------------
RPOL_THEKO/12-86--------------------------------------------------------------------------------
E1Z8C1_CHLVA/21-94--------------------------------------------------------------------------------
W0K2F8_9EURY/12-86--------------------------------------------------------------------------------
K0K8C5_WICCF/41-115--------------------------------------------------------------------------------
C5DRN5_ZYGRC/48-122--------------------------------------------------------------------------------
D2VMS3_NAEGR/73-147--------------------------------------------------------------------------------
B3S6B1_TRIAD/30-104--------------------------------------------------------------------------------
Q4D7H8_TRYCC/46-118--------------------------------------------------------------------------------
B8C993_THAPS/30-105--------------------------------------------------------------------------------
F4R4H4_MELLP/28-101--------------------------------------------------------------------------------
A0A1I7VJK8_LOALO/25-99--------------------------------------------------------------------------------
A0A3Q7JPU4_SOLLC/30-104--------------------------------------------------------------------------------
A7AT13_BABBO/10-83--------------------------------------------------------------------------------
A0A0D2WNY4_CAPO3/30-104--------------------------------------------------------------------------------
F7XMD7_METZD/12-85--------------------------------------------------------------------------------
RPOL_METAC/12-85--------------------------------------------------------------------------------
I3TDP2_THEC1/12-84--------------------------------------------------------------------------------
L0IAW3_HALRX/12-89--------------------------------------------------------------------------------
G4MRX6_MAGO7/30-104--------------------------------------------------------------------------------
I4Y841_WALMC/30-105--------------------------------------------------------------------------------
A9V2R7_MONBE/30-104--------------------------------------------------------------------------------
G3B1F5_CANTC/30-104--------------------------------------------------------------------------------
D5TZM1_THEAM/12-85--------------------------------------------------------------------------------
G0QUQ1_ICHMG/39-110--------------------------------------------------------------------------------
RPOL_METTH/10-80--------------------------------------------------------------------------------
D8TM87_VOLCA/31-104--------------------------------------------------------------------------------
D1YYQ6_METPS/12-86--------------------------------------------------------------------------------
Q2GXS9_CHAGB/4-78--------------------------------------------------------------------------------
D5GDE1_TUBMM/9-87--------------------------------------------------------------------------------
Q384D9_TRYB2/46-118--------------------------------------------------------------------------------
A2BNA1_HYPBU/16-90--------------------------------------------------------------------------------
A0A0K3CST6_RHOTO/30-104--------------------------------------------------------------------------------
A8AA05_IGNH4/20-92--------------------------------------------------------------------------------
Q386T9_TRYB2/39-119--------------------------------------------------------------------------------
RPOL_THEAC/20-93--------------------------------------------------------------------------------
F9XIJ4_ZYMTI/8-82--------------------------------------------------------------------------------
C4R3Z5_KOMPG/30-104--------------------------------------------------------------------------------
S7W9T0_SPRLO/10-89--------------------------------------------------------------------------------
J3NY74_GAGT3/30-104--------------------------------------------------------------------------------
L8FLZ9_PSED2/92-166--------------------------------------------------------------------------------
G0MZ50_CAEBE/29-103--------------------------------------------------------------------------------

PF01193

H3E9U3_PRIPA/103-278--------------------------------------------------------------------------------
RPOD_HALSA/19-239-----------------------------------------------------ELEADAVMGHGRDHAKHQGGVAVGYRH
A6UW03_META3/17-181--------------------------------------------------------------------------------
K4MD35_9EURY/16-255--------------------------------------------QKVVLEAIAHMGYGNQHARWQAGVACGYKNMPVVTF
RPOD_METAC/16-256-------------------------------------------GQKLVLEAIAHMGYGRDSVKWQAGVACGYKNMPVITI
F7XMN5_METZD/16-254--------------------------------------------QKLFIEALAHAGYGKEHAKWQAGVGCGYKNYPIVSF
D5EC45_METMS/14-256------------------------------------------GGQQLVLEGIAKMGYGHDHAKWQAGVACGYKNVPVIEI
A0B9L4_METTP/14-253--------------------------------------------GEKLVIEGFATLRTGKEHAKWQAGTLCGYKNLPSIE
RPOD_ARCFU/16-253--------------------------------------------GQQLMLEAVARLGTGREHAKFQPVSVCVYKIIPEIV
D2RD94_ARCPA/14-250---------------------------------------------GQQLMIEAVARLGTGKEHAKYQPVSACYYKIIPEI
E1RIT7_METP4/14-260----------------------------------------VLEARAELNIGDEHAKWEPTLACGYKAYPVITIDDRCDAC
L0HCN0_METFS/14-260----------------------------------------VIEARAILNTGRAHAKWQSTLVCGYKNHPVITVSDVCDAC
U6EDP0_9EURY/14-254-------------------------------------------EVELEAIAQLGQGQEHAKWQPTTTCAYKNYSQITIDG
RPOD_METTH/14-254-------------------------------------------DDDELELEAVAQLGVGREHAKWEPTTACAYKYYPRIE
R9SN57_9EURY/14-256------------------------------------------NEEIELEAVAKLGFGKDHAKWMPTTVCAYKQYPKITFN
E3GZF2_METFV/14-254-------------------------------------------EDEKIELEAIAQLGLGKKHAKWRPTTACGYKYYPKII
RPOD_METKA/20-261-------------------------------------------QRIRLEVIAVPGLGLEHAKWKPVSAVGYKGLPELEID
RPOD_PICTO/13-262---------------------------------------IVKLKKGQAMLVTCEAIMGRGKDHAKWQVTSGVSYKYHREF
T0M5U1_9EURY/14-262---------------------------------------PIVKLGPKQAILVTAEAIMGRGRDHTKWQATSGVSYKYHRE
T0LUK9_9EURY/20-279----------------------------------GPKQALLVTAEATMGTAKEHAKWQVTSAVSFKYHREFEINKADNEG
B5ID28_ACIB4/14-263---------------------------------------PIVKLKEHQAILLEAEAIMGTAKEHAKWQVTSGVSYKYHRE
T0LNF0_9EURY/16-263----------------------------------------PIVELNERQAIMLDAEAYMGRAREHARFQATSGVSYRYGR
R9T5Y4_METII/14-266-------------------------------------IVKLGPGQALLAYASAELGTAKRHAKWQVVSGAGYRYYPTIEI
G0NUY4_CAEBE/20-263------------------------------------------RGSAREEFHNREEILIVKLRKGQELNLKAYAKKGFGKE
A0A1P6BJD5_BRUMA/20-256---------------------------------------------RNRNAEENASDDILIVKLRKGQDIDIKCIAKKGFG
B7QL55_IXOSC/20-255----------------------------------------------DDTNEYGETDDILIVKLRKGQEVKARAYAKKGFG
H2XZ54_CIOIN/23-282----------------------------------DDILIAKLRKGQSLKFKAFAKKGFGKEHAKWQCVSAVAFEYDPDNA
T1G647_HELRO/20-255----------------------------------------------DEDGDYGDNEEILIVKLRKGQELKLRAVAIKGFA
F6YKL2_XENTR/20-256---------------------------------------------DNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFG
G4LUY0_SCHMA/20-254----------------------------------------------ADESSYVGQESILIVKMRKGQRLKLRAIAKKGFG
B3RV95_TRIAD/20-256---------------------------------------------EDDTVYGDQEDDILIAKLRRGQEIKIKAYAKKGLG
A9URC4_MONBE/24-258----------------------------------------------SAREESNIRNPIVICKLAKGQRIQLTAFAKKGFG
A0A0D2U3Z5_CAPO3/20-246--------------------------------------------------SGSEQHDVVLVKLGAGQRIKLTAIAKKGIG
U7PPH9_SPOS1/29-265---------------------------------------------RDPDGLGVMIAKLRKGQELQMTCIAKKGIAKEHAK
Q0CYF6_ASPTN/26-254-------------------------------------------------GTPVITDPEGKGPLICKLRRGQELKMTCIAK
R1EC75_BOTPV/27-264---------------------------------------------DPNGHGAIICKLRKGQELKMRCIAKKGIAKEHAKW
G2QN84_MYCTT/29-265---------------------------------------------NDAEGLGPLILKLRPGQEIKLECIAKKGIAKEHAK
A0A0C4DLK5_MAGP6/28-267--------------------------------------------ITDPDENGIILFKLRYGQEIRIRCIAKKGIAKEHAK
Q0UL31_PHANO/23-262--------------------------------------------SEGTGSCIVKLRRGQAINMRCIAKKGIAKEHAKWAP
S8BIG5_DACHA/27-261----------------------------------------------DEAGKGSIICKLRKGQELNLKCIAKKGIAKEHAK
R4X6D5_TAPDE/21-255----------------------------------------------DADGNGVLICKLRKEQELRLVCIAKKGVAKEHAK
M2MTP9_BAUPA/30-292--------------------------------HAEELPPRGFPILMDPEQKGPLLCSLRKGQDLKLRCIAKKGIAKEHAK
F9WWV9_ZYMTI/30-284------------------------------------PERGRPIVMDRDNQGPLICQLRRGQEIKLKCIARKGIAKEHAKW
B6K2N9_SCHJY/18-256--------------------------------------------LADARSHGPLILKLRKEQEVSLRCIAKKGIAKEHAK
L0PEQ4_PNEJ8/20-247--------------------------------------------------GKGILICKLRKAQELRLKCIAKKGIAKEHA
C5MDV1_CANTT/22-257----------------------------------------------DPRNRGPIICKLRKDQELALTCIAKKGIAKEHAK
K0KH51_WICCF/17-253---------------------------------------------TDPEENGVLICKLRNEQELFIRCIAKKGIAKEHAK
G8BQU0_TETPH/19-255---------------------------------------------QDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAK
S2K833_MUCC1/25-255------------------------------------------------KDDSGVLLVKLRKGHELKLKCIAKKGVAKEHA
F8PUU9_SERL3/22-274-------------------------------------NFGHPVGKDDVSLPPVLICKMRKGQELKLRCIAKKGIAKEHAK
K1VZJ3_TRIAC/39-304-------------------------------IAHHDPELGVPVGKGDPTASPIQLARISRGQEIEVVCKAYKGIAKHHAK
I4YBL8_WALMC/14-265--------------------------------------NFGLPINYHQEGAYPITLCKLRQGQELRINCIAKKGINKEHA
S7W9P7_SPRLO/40-267-------------------------------------------------TARNIETDENIIRTDSIITKLNYNQTLRARG
I3EI10_NEMP3/15-244-----------------------------------------------YPSIITRLGHKQSIKCKCIAVKGIGKKHSKWSP
Q8SRR5_ENCCU/15-229---------------------------------------------------------IIKSGPVITKLARDQGLKARCIG
A9SHD1_PHYPA/23-296---------------------------VKLRKGQELKLRAIARKGIGKDHAKWSPAATVTFQYEPEIHINEALMETLTLE
M7ZTZ3_TRIUA/27-283-----------------------------------NVDAYEPDAAELSMIFSCSHKGVVGAGAAGRLSLDAALWLSVAGA
B8BWN8_THAPS/17-296------------------------GPGQHLKLKAIARMGISKEHAKWCPVAVATYRFWPIITINEEACNMLTLEQKQELV
H3GMV0_PHYRM/20-302----------------------RLRLSAIAKLGIGKEHAKWSPVAVATFMYDPIITLNQAVLSTYSPEQKAELYKCCPTE
Q4DWU1_TRYCC/46-312---------------------------------LNLRVVIRKNIAKTHAKFMPVATVAMRYASDIVLNPDGFAKLDTEHR
Q580S5_TRYB2/20-286---------------------------------INLRVLIRKSIAKTHAKFMPVSTVSMRYEPEVILNKDVISSLDPEQL
A5K6U4_PLAVS/25-297---------------------------KNQTLHMKLIATKGIGKMHAKWIPANVSYRIDHKVAIKHHLINSLSREHKLLL
Q4UFZ3_THEAN/23-314------------------INMKLTASKGLGKFHAKWIVANVNYKMEPRFSFNSALMEQLSSDEKAGIAASCPRNVFKYTG
B6AI35_CRYMR/22-307---------------------MTATKGIGKFHAKWIPVATATFTNEADIRINQSSMTNVSLKHRREIVNSCPKNVFGLSA
A2F4R6_TRIVA/26-308----------------------PQPVTITKLAPGQTLRLAAYIRKGIGRNHAKWSPVCVSTYHQVASIDFREAYKQIMDQ
F4Q3D5_CAVFA/22-285--------------------------------GQEVKLKAIAKKGVGKEHAKWIPTCIATYQFQPKIVVNQNRFDELSDR
F0ZT58_DICPU/25-291------------------------------GQELRLRAIAKKGVGKEHAKWSPSCIATYQFQPIVTINQNRMDELSDKQK
D2W3Y1_NAEGR/24-310---------------------AKKGVGKGHAKWSPVAITTYYIVPDIRIKGCQNTPVNPSDQDNQTEVPAADWIGKFINS
G0QT24_ICHMG/17-295------------------------IPIVKLSKNQQIHFECEAMKGIGKMHSKWSAVSVASFKIEPLIKFSDDIQQLTREQ
A4VDR4_TETTS/17-290---------------------------IKLSKGQQIHFECEAQKGIGKMHSKWNPVCISTFSVEPEIIFDQEIQNLDIEQ
C9LTF6_SELS3/26-221---------------------------------------------------------------------EILNPDLHIAT
R7CMC0_9FIRM/26-223--------------------------------------------------------------------IDVLNTELPICT
G0VNJ6_MEGEL/26-223--------------------------------------------------------------------IEILNPDLHIAT
G4Q722_ACIIR/26-226------------------------------------------------------------------QDTEVLNPELHIAT
H6LGS3_ACEWD/26-221---------------------------------------------------------------------DILNPEMHIAT
R7JZW8_9CLOT/26-225-------------------------------------------------------------------EILNPDQVIATLS
F2JSG3_CELLD/26-227------------------------------------------------------------------ILNPEHHIATLNGG
C6D4L1_PAESJ/26-221---------------------------------------------------------------------EILNPDLHIAT
C9R8G2_AMMDK/26-220----------------------------------------------------------------------EILNPDHYIA
K4LIA3_THEPS/27-222---------------------------------------------------------------------EVVNPELYIAT
RPOA_DESAP/26-221---------------------------------------------------------------------EILNPDLHIAT
K0AZL2_CLOA9/26-221---------------------------------------------------------------------EILNKDLHIAT
R6EZR6_9FIRM/25-220---------------------------------------------------------------------EIFNPDLHIAT
E3PTT6_ACESD/24-219---------------------------------------------------------------------EILNKDLHIAT
R5JIV4_9FIRM/26-221---------------------------------------------------------------------NIVSKDLHIAT
R6AIY4_9CLOT/24-220---------------------------------------------------------------------EIINPDLHIAT
R5B3L1_9CLOT/24-219---------------------------------------------------------------------EIMNPDLHIAS
R7FCM6_9FIRM/27-223---------------------------------------------------------------------ILDPGMHIATL
D4JY85_9FIRM/26-224-------------------------------------------------------------------ILNPEWHIATLGE
R6TUA7_9FIRM/26-222---------------------------------------------------------------------ILNPDLHIATV
R5SMX9_9FIRM/26-222---------------------------------------------------------------------EVLNPDLHIAT
R5KMS2_9CLOT/28-224---------------------------------------------------------------------ILNPDLHIAYL
R7IEB4_9FIRM/25-223-------------------------------------------------------------------IINPDMHIATLNE
R6MU37_9FIRM/26-222---------------------------------------------------------------------IFNPDLHIATL
D3QZ73_MAGIU/26-223--------------------------------------------------------------------VQIMNPEQPIAT
B0RZT5_FINM2/26-221---------------------------------------------------------------------EVKNPDHYIAT
RPOA_STRMU/24-219---------------------------------------------------------------------EIVNPDHYLFT
RPOA_LACDA/24-219---------------------------------------------------------------------EVLNPDQYICT
F8HYY1_WEIKK/24-221--------------------------------------------------------------------ILNDDLFIATVA
F2I816_AERUA/26-221---------------------------------------------------------------------DVLNPYLHICS
R6B5I3_9CLOT/26-221---------------------------------------------------------------------EILNPDLHIAT
RPOA_SYNWW/26-222---------------------------------------------------------------------ILNPDLHLASL
RPOA_CLOBH/26-221---------------------------------------------------------------------EVINKDLHIAT
F3YWQ5_DESAF/40-235---------------------------------------------------------------------RVLNPGQHIAT
E6W737_DESIS/31-227---------------------------------------------------------------------VLNSDCVIATL
D4H3B5_DENA2/31-227---------------------------------------------------------------------ILTPDQHICTI
E4TEN1_CALNY/31-227---------------------------------------------------------------------VLNPDQHIATI
RPOA_SYNFM/31-226---------------------------------------------------------------------EVLNPEQHICT
E8REB6_DESPD/41-236---------------------------------------------------------------------EVMNPELVICT
RPOA_DESPS/41-236---------------------------------------------------------------------EIMNEDHILCN
D6Z3J5_DESAT/38-233---------------------------------------------------------------------EVMNPEQHICT
F2NJB1_DESAR/31-226---------------------------------------------------------------------EILNPDSHIAT
F8AA62_THEID/38-231----------------------------------------------------------------------AEVVNPDHHI
F8C4H0_THEGP/30-223----------------------------------------------------------------------GEIVNPDHHI
B3E857_GEOLS/31-226---------------------------------------------------------------------EIMNPEMHIAT
E1QKQ5_DESB2/31-226---------------------------------------------------------------------EILNPEHHIAT
RPOA_DESOH/34-230---------------------------------------------------------------------EILNPESHIAT
B8FEQ9_DESAL/34-230---------------------------------------------------------------------QVLNPDLYIAT
I5B4C3_9DELT/34-230---------------------------------------------------------------------KILNPEQHIAT
RPOA_SYNAS/31-226---------------------------------------------------------------------EVLNEDHYIAS
I4CE87_DESTA/39-234---------------------------------------------------------------------EIINPDQEIAS
E1X0J6_HALMS/35-231---------------------------------------------------------------------VLNPEHVICNI
D0LI99_HALO1/46-240----------------------------------------------------------------------NILNPDHVIG
RPOA_SORC5/41-236---------------------------------------------------------------------SVLNPDHLIAV
Q08ZH0_STIAD/36-231---------------------------------------------------------------------EILNPGHHICT
RPOA_KORVE/29-224---------------------------------------------------------------------EILDKDVYIAT
RPOA_MAGMM/32-228---------------------------------------------------------------------ILNPDHHIATL
I0IMW4_LEPFC/30-225---------------------------------------------------------------------EILDPDHLIAT
E3DPU4_HALPG/24-221--------------------------------------------------------------------VVNKEHHVATLA
L0K7Y4_HALHC/24-219---------------------------------------------------------------------EILNPELEIAT
D9QTH6_ACEAZ/24-220---------------------------------------------------------------------ILNPDQHIATL
S5MF87_9MOLU/26-226------------------------------------------------------------------TGVEVMNPELHICT
RPOA_MYCMS/26-227------------------------------------------------------------------GVEILNKDLLIATI
R4UKN9_9MOLU/26-226------------------------------------------------------------------AGVEVVNPSLHLAT
RPOA_MYCGA/26-232---------------------------------------------------------------IECPLGFEVFNKDLEIC
RPOA_UREPA/27-235--------------------------------------------------------------IVCPVGFEIVNQDLYIAE
RPOA_MYCPN/28-236--------------------------------------------------------------LECPAGFEVVNKDLYLFS
K7XLF5_MYCHR/27-238-------------------------------------------------------------NKDQVVANTSEVGALKFEM
C5J5V6_MYCCR/27-237-------------------------------------------------------------VNQDQYIASVGKVGALKFE
D5E4Y4_MYCCM/27-240------------------------------------------------------------IDHNIHIADVALENSLRLEL
A5IYV9_MYCAP/29-243-----------------------------------------------------------NKSQEIANIQKGALVIELFLR
C4XFY9_MYCFP/30-246----------------------------------------------------------KSLEIAHLSANGKHKLNIELYL
RPOA_MYCPU/27-239------------------------------------------------------------VNKDLEIATNNGQKPFVMEV
RPOA_MYCMO/27-239------------------------------------------------------------VNPGLLIATTAAANVLEIDV
B3PMM1_MYCA5/27-238-------------------------------------------------------------NKDQHICSLQKGTTLEFDL
D1J860_MYCHP/27-238-------------------------------------------------------------NKDQYIATISKNGSLEFEL
R7GIT7_9CLOT/28-225--------------------------------------------------------------------VTIINPEQHICT
A9NEG0_ACHLI/27-222--------------------------------------------------------------------DIEVVNKDQHIA
RPOA_ONYPE/27-222--------------------------------------------------------------------GVKIINPDHYIT
R7GP82_9FIRM/26-221---------------------------------------------------------------------KMISNDLVIAH
E7FW50_ERYRH/26-225-------------------------------------------------------------------LNKDHIIATLAEG
A8R9G7_9FIRM/26-225-------------------------------------------------------------------LSKDLHICTLEEG
E2SG59_9ACTN/24-219---------------------------------------------------------------------EVHNPDLHVAT
RPOA_TROWT/24-220---------------------------------------------------------------------IGNGDLVIATL
C7M300_ACIFD/25-219----------------------------------------------------------------------EVINRDLHIA
D3EYS1_CONWI/24-220---------------------------------------------------------------------EILNPDAHIAT
RPOA_RUBXD/25-220---------------------------------------------------------------------EVVNPDAYIAS
W0RNS5_9BACT/33-230--------------------------------------------------------------------RIVDAAHHLLTL
D6YRY5_WADCW/31-243------------------------------------------------------------GDIVEGGIFEVVNPNHHIFT
I4B7F9_TURPD/36-231---------------------------------------------------------------------EIMNPDLVLAH
RPOA_LEPBP/33-231-------------------------------------------------------------------SIEIMNPDLHIAT
RPOA_TREPA/33-238----------------------------------------------------------------KKFQLEVLSQDLLIME
RPOA_TREDE/33-238----------------------------------------------------------------VEGQLEILGEPFYVME
F5YDT8_TREAZ/33-238----------------------------------------------------------------RQGQVEVLSVGQHIMT
G0G9S3_SPITZ/33-237----------------------------------------------------------------EVDQLEVMNKDFRVMT
V5WFH8_9SPIO/33-238----------------------------------------------------------------VDSEIEVINNDLHLLT
E1RCN4_SEDSS/33-238----------------------------------------------------------------KDNDVEIINKDWKILT
H9UGN5_SPIAZ/33-238----------------------------------------------------------------VDTDVKVANPELYLMT
E6SRZ2_BACT6/27-225-------------------------------------------------------------------GFEVLNPELVICH
R7IYK3_9BACT/27-225-------------------------------------------------------------------SFQVLNPDQVICH
R7F4Y6_9BACT/27-226-------------------------------------------------------------------FEVLNPDLEICRL
F4KMP5_PORAD/27-225-------------------------------------------------------------------SYKVQNPDLVICN
F0NYA8_WEEVC/27-225-------------------------------------------------------------------GFQVLNPELVIAN
R5W600_9BACT/27-225-------------------------------------------------------------------NFKVLNPDLVICH
R5P2Q1_9BACT/27-225-------------------------------------------------------------------GFEVLNTDLVICN
C6Y0U0_PEDHD/27-225-------------------------------------------------------------------NFEVLNPDFVICN
R5ID85_9BACT/27-225-------------------------------------------------------------------NFSVLNPQLHICS
A8Z691_SULMW/27-228------------------------------------------------------------------NKFDILNPDLIILN
G0IXD0_CYCMS/27-224--------------------------------------------------------------------FEVLNPDLVICH
E4TU12_MARTH/27-224--------------------------------------------------------------------FEILNPDLLICH
C6W1Z7_DYAFD/20-217--------------------------------------------------------------------FEVLNPDQVICH
I4AN46_BERLS/27-225-------------------------------------------------------------------EFEVLNPELVICH
B3EUJ6_AMOA5/27-224--------------------------------------------------------------------FEITNPELVICH
C7PU98_CHIPD/27-226-------------------------------------------------------------------AFQIMNPELLICT
H6L0L7_SAPGL/27-227------------------------------------------------------------------NVFQVTNPDLVICN
F4KXU3_HALH1/27-227------------------------------------------------------------------NAFRVMNPELLLCT
RPOA_SALRD/27-223---------------------------------------------------------------------DVLNPDQHVAT
RPOA_CHLT3/28-224---------------------------------------------------------------------EVLNPEHHIAT
H1XVZ1_9BACT/29-225---------------------------------------------------------------------EVLNPDLHIAT
I6ZWK0_MELRP/29-225---------------------------------------------------------------------EILNPDLHIAH
B3DVZ0_METI4/31-226---------------------------------------------------------------------EIVNPEQLICT
D5EJT5_CORAD/31-226---------------------------------------------------------------------QVVNPDQVICT
B2UL53_AKKM8/43-238---------------------------------------------------------------------QVVNPDQIICT
D5SQ96_PLAL2/31-226---------------------------------------------------------------------EILNRDLVIAT
D2R6J4_PIRSD/31-226---------------------------------------------------------------------EIINKNHVLAT
E8R483_ISOPI/31-226---------------------------------------------------------------------EVVNPDHILCT
I0IGZ7_PHYMF/31-230-------------------------------------------------------------------HNKDEILATLSKQ
B2KEJ3_ELUMP/29-224---------------------------------------------------------------------EIINKDLEIAN
A9WI15_CHLAA/28-222----------------------------------------------------------------------EIVNPQHYIC
I0HZI5_CALAS/21-215----------------------------------------------------------------------EVVNPDQYLL
E8N3Q1_ANATU/27-222---------------------------------------------------------------------EIVNPELELFT
B5YG22_THEYD/30-227--------------------------------------------------------------------YEVLNKSQYICS
D1CFF3_THET1/45-239----------------------------------------------------------------------DIVSLDQPIA
D3DH88_HYDTT/26-221---------------------------------------------------------------------DIINPDQKIAT
RPOA_HYDS0/25-220---------------------------------------------------------------------TIINKDAYIAT
C0QQQ1_PERMH/29-224---------------------------------------------------------------------IKIVNPDVHIA
RPOA_PSELT/29-227-------------------------------------------------------------------AGFEIANPSLKIA
RPOA_THEMA/29-227-------------------------------------------------------------------AGIEVVNPDLHIA
C5CGH4_KOSOT/37-233---------------------------------------------------------------------VEVVNPSQYIA
H2J776_MARPK/30-231------------------------------------------------------------------PPGIEIANPDFKIA
RPOA_DEHM1/24-218----------------------------------------------------------------------EVVNPELYLL
D8K192_DEHLB/24-218----------------------------------------------------------------------EIANPDLYLV
B0VI04_CLOAI/30-225---------------------------------------------------------------------KIINKDLYLLE
S0EXQ0_CHTCT/23-227----------------------------------------------------------------EDVEVVNPEVYLATLS
B8E1G0_DICTD/23-218---------------------------------------------------------------------KILNPDLVIAT
D3PN14_MEIRD/25-221---------------------------------------------------------------------AEVVNPDQYIA
E3H8Z9_ILYPC/28-223---------------------------------------------------------------------EIINPDQVICT
RPOA_METNO/33-228---------------------------------------------------------------------QILNPDLVLCT
RPOA_ZYMMO/34-229---------------------------------------------------------------------EVMNPELVICH
D5AM21_RHOCB/32-227---------------------------------------------------------------------EVLNKDHVICH
D5BQE0_PUNMI/32-227---------------------------------------------------------------------EIMNPDHVLCH
F2I1G2_PELSM/31-226---------------------------------------------------------------------EILNPDQVICN
RPOA_PELUB/36-231---------------------------------------------------------------------EILNPDLVICN
F7XUM3_MIDMI/11-206---------------------------------------------------------------------QVVNKDLVICT
RPOA_ORITB/35-232--------------------------------------------------------------------VTILNPQHVICN
RPOA_ANAPZ/30-232-----------------------------------------------------------------NKDLHICTLGKDVDF
RPOA_EHRCR/62-261-------------------------------------------------------------------LNKDLLICTLDQG
J9Z1B3_9PROT/31-227---------------------------------------------------------------------IVDKDAVIMNV
RPOA_ALKEH/29-225---------------------------------------------------------------------VKNPELLICTL
RPOA_HALHL/29-225---------------------------------------------------------------------IQNPDLHIATI
F9ZMD2_ACICS/28-224---------------------------------------------------------------------VANPEQVIATL
D0KXN7_HALNC/29-225---------------------------------------------------------------------IINPEHHIATL
S6BQG0_9GAMM/29-227-------------------------------------------------------------------IANPEFLIAHLTD
L0H1T5_9GAMM/31-229-------------------------------------------------------------------LYNPDLVIANLTG
F6AJD1_PSEF1/29-227-------------------------------------------------------------------IVNGDHVIANLAA
H8KYM7_FRAAD/29-227-------------------------------------------------------------------IINPEHVICHLTK
RPOA_PSYA2/29-226--------------------------------------------------------------------IINPELVLGTLS
D3SCR1_THISK/27-225-------------------------------------------------------------------VVNPEHVIATITK
RPOA_NITOC/27-225-------------------------------------------------------------------VINPEHVIAHLTK
RPOA_BUCBP/29-230------------------------------------------------------------------NLDHIICTLTCKNA
RPOA_BUCCC/29-228-------------------------------------------------------------------INNKHIICNLTCS
RPOA1_PSYIN/29-227-------------------------------------------------------------------IVNPEHVICHLTG
F9ZWY4_METMM/29-226--------------------------------------------------------------------IINPGLVIANLT
U5N4B0_9BURK/26-224-------------------------------------------------------------------VLNPEHVIAHLAT
RPOA_NEIMB/29-227-------------------------------------------------------------------ILNPGHVICHLAD
F8GHK6_NITSI/27-224--------------------------------------------------------------------ILNPDHVLAHLT
D7DLR4_METV0/29-227-------------------------------------------------------------------IVNPDHVIAHLTK
RPOA_NITEU/27-226-------------------------------------------------------------------IVNPDHVIAHITS
D9SCT8_GALCS/27-224--------------------------------------------------------------------VLNPEHVIAHLT
RPOA_LEGPH/29-230------------------------------------------------------------------NPELVIANLNEKGK
RPOA_RUTMC/29-225---------------------------------------------------------------------TAFNPDKVIAT
RPOA_METCA/29-225---------------------------------------------------------------------VLNPELLIAHI
D3EQH5_ATETH/26-221---------------------------------------------------------------------EIINPTQPIAT
RPOA_NOSS1/26-221---------------------------------------------------------------------EVIDPTQYVAT
K9YNU7_CYASC/24-218---------------------------------------------------------------------EIIEPNHYICT
B0C430_ACAM1/26-221---------------------------------------------------------------------EIVNPTQYVAT
K9YFL4_HALP7/30-225---------------------------------------------------------------------EVIDPSQYVAT
RPOA_THEEB/25-228-------------------------------------------------------------------EVEVVNPNHYIAT
RPOA_SYNE7/25-220---------------------------------------------------------------------EVINPNHYIAS
RPOA_SYNJB/46-241---------------------------------------------------------------------EVINPRHHIAT
RPOA_GLOVI/26-221---------------------------------------------------------------------QVVHPRHYIAT
RPOA_SYNPW/26-222---------------------------------------------------------------------VVDGERAIATV
F2YGP3_CHLVA/29-231----------------------------------------------------------------LTLKCVEPKAHIATIT
M0ZUU3_SOLTU/6-197-----------------------------------------------------------------------MEIVDNTQH
A0A2K1KJX0_PHYPA/147-339-----------------------------------------------------------------------LEVTDPTQH
RPOA_PHATC/29-220---------------------------------------------------------------------EIINPNHYIAT
H0UL77_9BACT/20-215---------------------------------------------------------------------EFIDPNFYICT
I4BV50_ACEMN/23-218---------------------------------------------------------------------EFPNPDAYICT
RPOA_WOLSU/29-223----------------------------------------------------------------------DVVTPNQHLA
RPOA_HELPY/29-231-----------------------------------------------------------------NSEQIEIVNPEMPLA
B9L6T7_NAUPA/28-221----------------------------------------------------------------------DIVTPNEYIA
RPOA_CAMHC/29-223----------------------------------------------------------------------EIVNPDAYLA
RPOA_SULNB/29-223----------------------------------------------------------------------EVVNGDLPLA
W0JDL0_DESAE/30-226---------------------------------------------------------------------LKIINPNHYIA
A5K332_PLAVS/443-664----------------------------------------------------------LKEDGHLDISIKIEYGKGHWLT
A2DQ63_TRIVA/37-104--------------------------------------------------------------------------------
M0T693_MUSAM/32-98--------------------------------------------------------------------------------
D2UZC7_NAEGR/31-97--------------------------------------------------------------------------------
D7G4D0_ECTSI/79-145--------------------------------------------------------------------------------
G1X7Y3_ARTOA/102-168--------------------------------------------------------------------------------
L2GT01_VAVCU/22-88--------------------------------------------------------------------------------
K5X3Y7_PHACS/32-98--------------------------------------------------------------------------------
W5JCM8_ANODA/18-84--------------------------------------------------------------------------------
C4WWR4_ACYPI/19-85--------------------------------------------------------------------------------
E0W436_PEDHC/18-83--------------------------------------------------------------------------------
E9FTC8_DAPPU/3-68--------------------------------------------------------------------------------
G4VD46_SCHMA/404-469--------------------------------------------------------------------------------
Q6C4D6_YARLI/56-122--------------------------------------------------------------------------------
K1WJJ6_MARBU/57-123--------------------------------------------------------------------------------
Q0UFU4_PHANO/45-119--------------------------------------------------------------------------------
H9GMN1_ANOCA/27-93--------------------------------------------------------------------------------
A0A015MNU0_RHIIW/44-110--------------------------------------------------------------------------------
B3S798_TRIAD/12-78--------------------------------------------------------------------------------
D8U457_VOLCA/12-78--------------------------------------------------------------------------------
F2UL86_SALR5/40-112--------------------------------------------------------------------------------
Q4U9J3_THEAN/12-77--------------------------------------------------------------------------------
A0A384LDW2_PLAKH/17-82--------------------------------------------------------------------------------
U4LH46_PYROM/41-111--------------------------------------------------------------------------------
D7FJZ6_ECTSI/27-92--------------------------------------------------------------------------------
M2WNE1_DOTSN/42-108--------------------------------------------------------------------------------
R9ADM4_WALI9/35-101--------------------------------------------------------------------------------
I2G5Z2_USTH4/35-101--------------------------------------------------------------------------------
I2GXX0_TETBL/22-88--------------------------------------------------------------------------------
E2RTX5_GIAIC/33-107--------------------------------------------------------------------------------
D7DR78_METV3/13-87--------------------------------------------------------------------------------
RPOL_METMP/15-89--------------------------------------------------------------------------------
A6UTG0_META3/15-90--------------------------------------------------------------------------------
RPOL_METAR/14-80--------------------------------------------------------------------------------
D7E9E3_METEZ/14-79--------------------------------------------------------------------------------
RPOL_METTP/14-79--------------------------------------------------------------------------------
N0BKM3_9EURY/14-79--------------------------------------------------------------------------------
D2RHL4_ARCPA/14-79--------------------------------------------------------------------------------
G0EET7_PYRF1/15-81--------------------------------------------------------------------------------
A1RX43_THEPD/25-90--------------------------------------------------------------------------------
RPOL_KORCO/14-80--------------------------------------------------------------------------------
RPOL_HALSA/14-83--------------------------------------------------------------------------------
F7PHA3_9EURY/14-83--------------------------------------------------------------------------------
H1YXQ0_9EURY/14-79--------------------------------------------------------------------------------
A2SSW1_METLZ/18-85--------------------------------------------------------------------------------
RPOL_NANEQ/19-85--------------------------------------------------------------------------------
A1RWW0_THEPD/10-260--------------------------------------KLGKGQKISLTAIARMGTGRQHAKWQPVGPVGYKYKPVVRIL
D9Q275_ACIS3/17-268--------------------------------------PGQRIHLVGYARLGRGYEHGKWSPASVAVLRYSVHVEYDPSK
A0RXU9_CENSY/15-196-------------------------------------------------------------------------TVLSSEL
G0EF28_PYRF1/10-270---------------------------------MAPGQRLHVRAYARLGYGKEHAKWFPVSVAAHRYLPVLEFDPKHEKA
A2BK79_HYPBU/15-266--------------------------------------QRLRLQAYARLGYGREHAKWMPVSVAAHRYLPILEFNLDEMS
I3TDW7_THEC1/14-266-------------------------------------LENQRIKLEAYARLGRGREHIKWSPASVASHKYIAKINIDREK
E0SQ92_IGNAA/14-269------------------------------------PIVILSPGQRISLELRARVGRGIEHIKWSPATIAVTRYVADIRI
A8A8W5_IGNH4/14-271-----------------------------------VPLIGDQKVKVIAYARLGRGREHAKWMPATVSIVKPLLKGISVKE
K7J3Y0_NASVI/1262-1538-------------------------IADDILICKMRPNQEIHAYMHAVKGIGKDHAKFSPVATATYRLLPEIQIIKPVRG
E2ACS1_CAMFO/52-332-----------------------DILICKMRPGHEIHAFMHAVKGIGKDHAKFSPVAPARYRLMPAIELTKPVRNEDADL
T1IB98_RHOPR/49-320----------------------------DIVIVKMRPGHELHVTMIAVKGIGKDHAKFSPVGTASYRLLPYIELLEEVEG
E9GTW6_DAPPU/70-342---------------------------KILIAKMRPGHELDIKLHAMKGTGREHAKFSPVATAFYRLLPQVKLLKEVEGE
H9J5X2_BOMMO/53-321-----------------------------HKDILISKMRPGHEIDLQMIAVKGIGKDHAKFSPVATATYRLLPEVTLTRE
B0W725_CULQU/57-325-----------------------------DDDILISRMRPGHEFDIKLFAVKGVGKDHAKFSPVATASYRLLPEIHLKRP
D6WP50_TRICA/56-325-----------------------------ILIAKMRPGHELDLKLLAVKSNGRDHAKFSPVATAFYRLLPDIKLLREVEG
E0VYJ4_PEDHC/56-328---------------------------DILLNKLRPGQELDLKLHAVKGLGKDHTKFSPVATAFYRMLPEITMVKKVTGE
B7Q825_IXOSC/59-330----------------------------IILAKLRPGQEIDLKLHCMKGTGQDHAKFSPVATASYRLLPEIVLLREVRDE
F6YSX7_CIOIN/63-332-----------------------------LVAKLRPGHILDVKLHAVKGVGQDHAKFSPVATASYRLLPQIRLLDQILNS
G3ND01_GASAC/63-338--------------------------HDDILIAQLRPGQELDVIMHCVKGIGQDHAKFSPVATASYRLLPDITLLEPVEG
T1KCG6_TETUR/56-326----------------------------ILIAKISPGQALDLKLHCVKGIGRDHAKFSPVATVYYRLHPAIEITRPIHGE
J9K0P2_ACYPI/45-312------------------------------LIAKLRPGQEIELKMFAVKGIPKDHAKFQSVCTAWYRMMPNIKLLDEIKG
G4VD46_SCHMA/51-335----------------------PPIPVSSTILINKLALGDEIEARCVAVKGIGRDHAKFSPVAAAYYKFHPIIKLLRTIE
A0A068Y929_ECHMU/48-328------------------------PAPVSRKVLLNKLGPGDEIMARCLAVKGVGRDHAKFSPVSAAFYKLLPSIEINGVV
G0MU26_CAEBE/68-353---------------------KPKMVSDDILVAKLRPGQEIEASCHAVKGIGRDHAKFSPVATASYRLLPTIRLNAEISG
K1RM70_CRAGI/59-328-----------------------------ILIAKLRPGQEIDIRVFCNKGIGKDHAKFSPVATASYRLLPEIYLKSPVTG
T1G2S8_HELRO/59-331---------------------------DILIAKLKPGQEIDIVCYCFKGIGKDHAKFSPVATAFYRNLPEIKLLRKVTGR
B3S4F3_TRIAD/60-333---------------------------LIAKLRPGQEIDLEMICVKGTGADHAKFSPVGNNLYLLVWLMPEIILKQAVTG
S0DJA1_GIBF5/72-369I--------------LIAKLRPRQTINLAMHMHKGIGSDHAKFSPVATASYRLLPTITITKPILGADAEKFAKCFPKGVI
S3BZ54_OPHP1/66-364P-------------DILIAKLRPGQVIDIEMHMHKGIGADHAKYSPVCTASYRLLPLIDITKPIVGADAEKFAKCFPEGV
V5I0T0_BYSSN/65-363D-------------ILLAKMRPGQKIEMEMHCIKGIGADHAKFSPVATATYRLLPDIKITKPIIGEDAKKFAKCFPRGVI
U4L7M8_PYROM/58-336------------------------DPVRAGNPDIVIAKLRPGQEIVVTSHAIKGLGKDHAKFSPVATAGYRLLPTIDIKE
G1XAZ6_ARTOA/62-343-----------------------VNPDILLAKLRPGQEIDLEIHCVLGIGQDHAKFSPVATASYRLLPSIKIKKPITGED
B2WCA1_PYRTR/63-364STN----------PDILICKMRPGQELEIRMHAIKGIGQDHAKFSPVATASYRLMPTIDITKPIVGADAKKFSRCFPSGV
M7SAL9_EUTLA/70-367I--------------LIAKMRPGQELDIDMHMHKGFGWDHSKYSPVATASYRLMPVIKILKPILGADAKKFVDCFPEGVA
B6JXY4_SCHJY/59-335-------------------------NPNIVVAKLRPGQEIDLEAHAILGIGQDHAKFSPVSTASYRLLPAIHILEPIEGE
M7PLN2_PNEMU/62-338-------------------------HDKILIAKLRPGQEIDLTMHCVLGIGQDHAKYSPVSTSSYRLLPTIHILEPIYDD
R4XFB4_TAPDE/65-343------------------------DDILIAKLRPGQEIDLEMHAILGLGQDHAKFSPVAPATYRIMPTITILEPIEGDDA
C4XY85_CLAL4/52-323----------------------------CDPDILLAKLRPGQEISLRVHCVLGVGSDHAKFSPVATASYRLMPVIDILEP
Q6C4T2_YARLI/58-326-----------------------------ANPDILIAKLRPNQSINLTMFCHLGFGHDHAKFSPVATASYRLMPTITITG
F4S444_MELLP/74-344----------------------------ILLVKMRPGQEISIEMHCVKGIGKDHAKFSPVATASYRLLPHIIIHEPILEP
G7E7N5_MIXOS/75-348---------------------------DILLAKLRPGQTISVELHCNKGNGKTHAKWSPVATASYRLMPHIRILKPIPEH
R9PBB7_PSEHS/88-358----------------------------KILIAKLRPGQELDLELHCEKGIGKDHAKFSPVATASYRLLPHIQLLKPIPD
L8X0D5_THACA/736-1007----------------------------ILLAKLRPGQELEMELHCVKGVGQDHAKFSPVATASYRLMPHVIFRQPIPPH
S8EGP7_FOMPI/70-342---------------------------NIVLAKLRPGQEIDMDLHAIKGVGKEHAKWSPVATASYRLHPLILLNPSKPVP
B0CTH8_LACBS/57-328----------------------------NIVLAKLRPGQDVHVELHAMKGVGKDHAKYCPVATASYRLLPHIKIKKPIPP
V2Y1G5_MONRO/66-340--------------------------NGKIVLAKLRPGQGVNLEVHAVKGVGKDHAKFNPVATASYRLHPYIKITKPIPT
I4YFV5_WALMC/58-331---------------------------EILITKLRPGQSIDLELHCVKGLGQDHAKFSPAATASYRLLPTVKLHQPIKSE
D0NVB2_PHYIT/45-311------------------------------LMAKLRPGQSIALEAHCRKGVGKDHAKFSPVATASYRLMPKVELMEKVEG
D7FPF8_ECTSI/59-340-----------------------PVHDDILIAKLRPGQEIVAEMHCRKGIGKDHAKFSPVATASYRLLPVVTLKEEVEGQ
B8CCH8_THAPS/58-351-----------------IRPISEDILLAKLRPGQVIELEAHARKGVGKDHAKFSPVATASYRLMPHIEIVKPIYDELAEE
A0A0D2X5I3_CAPO3/125-396----------------------------DILIAKLRPGQAVACEMHCIKSIGRDHAKFSPVGTASYRLLPEIILTRPVTG
A9V9D0_MONBE/62-334---------------------------DIVIMKMRPGQEVNMQLFCEKGVGKTHAKWSPVATASYRLMPEIILKEPIVGP
F4PDW3_BATDJ/53-324----------------------------DILITKLRPGQEIEAELHCQKGIGKEHAKWSPVATASYRLLPDIQILKPITG
S2JI72_MUCC1/65-335----------------------------DIVIAKLRPGQEMEMELHCQKGVGREHAKWSPVATASYRILPEITILEPITG
A0A015L7C0_RHIIW/2-272----------------------------AQMRPGQKIELEAHCEKGCGKEHAKWSPAATASYRLMPDIILKEEITGDLAD
F2UC17_SALR5/48-314------------------------------HEDIPIVELRPGQRVSMELHCSKGVGKLHAKWSPVATASYRNAPHIVLKQ
A7SL38_NEMVE/59-329---------------------------VVFFFTLQELDIKMHAVKGVGKDHAKFSPVGKSTASYRLLPEITLLKPCEDEL
B4FAR4_MAIZE/85-364------------------------VKYKDITIARLGPGQAIELEAHAVKGTGNVHAKWSPVATAWYRMLPEVVILKEVEG
I1N089_SOYBN/94-380--------------------IGLTYSDIILAKLGPGQEIELEAHAVKGIGKTHAKWSPVATAWYRMLPEVVLLEAVEDEL
A9T5P0_PHYPA/74-352------------------------CQYPDIIVAKLRPGQAIELEGHAIKGSGNIHAKWSPVATARYRMLPEVNLMEDIQG
C1MRA1_MICPC/92-403EKEYFNRNGKDPNVISTVHDDILLVKMVAGQEIELEAHCTKGDGKEHAKWSPVGTTWYRMVPQVTFPSGPLTGEDADVFM
A0D2I2_PARTE/44-310------------------------------SNIIIAKLRENQELNLRLICEKGVGKRHAKWSPVCTAFYKLMPSITIKNQ
Q235X0_TETTS/59-332---------------------------MVHDNIIVAKLRENQEIICEVICQKGIGKTHAKWSPVCTAYYRLMPEININSD
B6KLD3_TOXGV/72-331----------------------------------LITKLRPGQEIELKAYLEKGVGKTHAKWSPVCTAVYRLEPEIVFKE
F4Q915_CAVFA/82-344--------------------------------PIVKLRPGQTVDIQLYCEKNIGREHIKWSPVGTASYRLMPDITVDSSK
D2UXC7_NAEGR/70-352-----------------------DILLAKLNPGQSIHVQCYCVKGIGRSHAKWQPVATATYRLMPEVVFKGEPVTELKQA
E1ZQP2_CHLVA/92-364---------------------------HDDILIAKLRPGQAIELECHCIKGVGDDHAKWSPVATTWYRLMPEVVLLQQPR
L2GLK3_VITCO/40-283-----------------------------------------GNQVEMTFKAIKGRGEQHAKWSPVSLCSYRIMPKIILEK
J8ZX59_EDHAE/40-294------------------------------------GQEIEIEMYAIKGIGKDHAKWSPVCPVSYRLHPAIEIKDIYDED
R0KMW6_NOSB1/50-299--------------------------------------KQRIEVNMIAIKGTGSEHGKWSPVCPATYRLMPIIQIEDIYD
C4V751_NOSCE/43-279---------------------------------------------MVACKNVGRVHAKWSPVCTAAYRLMPIIKIEDFYD
S7XPP5_SPRLO/33-271--------------------------------------------GQHIHLEMYAEKNIAKVHTKWSPVCPITYRLHPIIQ
H8ZEB8_NEMS1/21-261-------------------------------------------TRLAPGKRIECKMLAVVGTGREHAKWMPTSVCYYRSI
C4M554_ENTHI/23-272---------------------------------------CYVKKGTGKFHAKWNPTCQCVFQTLADIRINDEKMISLTPE
C1MVZ5_MICPC/25-313-------------------PGVVIVKLRRGQQINMRCVARKGVGRDHAKWQPVATATYRFEPEITINEELMATLTEEEKM
Q01F02_OSTTA/22-286-------------------------------NKQQLLLKCIARKGTGKDHAKWSPVATAVFKHDPVVHVNQELLKTLSGS

PF13656

H2M356_ORYLA/23-97--------------------------------------------------------------------------------
H2R0V0_PANTR/30-104--------------------------------------------------------------------------------
RPOL_SACS2/12-86--------------------------------------------------------------------------------
Q0UWS5_PHANO/103-177--------------------------------------------------------------------------------
B8GF45_METPE/12-85--------------------------------------------------------------------------------
A7I5J1_METB6/12-86--------------------------------------------------------------------------------
S9VSU8_SCHCR/29-103--------------------------------------------------------------------------------
L0ACU8_CALLD/16-88--------------------------------------------------------------------------------
RPOL_SULTO/12-86--------------------------------------------------------------------------------
A0A384KHM4_PLAKH/36-108--------------------------------------------------------------------------------
F0ZJT3_DICPU/35-109--------------------------------------------------------------------------------
V5IL63_NEUCR/30-104--------------------------------------------------------------------------------
G2XWM6_BOTF4/61-134--------------------------------------------------------------------------------
C1EAB7_MICCC/30-99--------------------------------------------------------------------------------
J1AN07_9EURY/12-85--------------------------------------------------------------------------------
U5D302_AMBTC/21-94--------------------------------------------------------------------------------
B6AD73_CRYMR/32-146--------------------------------------------------------------------------------
K1V9X0_TRIAC/34-108--------------------------------------------------------------------------------
A0A068YHT2_ECHMU/30-104--------------------------------------------------------------------------------
RPOL_METBU/12-83--------------------------------------------------------------------------------
A0A068Y929_ECHMU/386-458--------------------------------------------------------------------------------
G1XT40_ARTOA/53-127--------------------------------------------------------------------------------
F8PIR5_SERL3/20-94--------------------------------------------------------------------------------
A0A015L6K0_RHIIW/30-104--------------------------------------------------------------------------------
RPOL_PICTO/15-88--------------------------------------------------------------------------------
K4MG73_9EURY/12-84--------------------------------------------------------------------------------
I4Y8T6_WALMC/32-106--------------------------------------------------------------------------------
M7PEH0_PNEMU/31-106--------------------------------------------------------------------------------
RPOL_METS5/12-86--------------------------------------------------------------------------------
U7Q4U5_SPOS1/37-111--------------------------------------------------------------------------------
M2MYP9_BAUPA/30-104--------------------------------------------------------------------------------
K1WMN3_MARBU/31-104--------------------------------------------------------------------------------
F2KQH2_ARCVS/13-85--------------------------------------------------------------------------------
M2SYV1_COCSN/30-104--------------------------------------------------------------------------------
G7E8P6_MIXOS/27-101--------------------------------------------------------------------------------
T1JXZ6_TETUR/15-91--------------------------------------------------------------------------------
L0L0D7_METHD/12-85--------------------------------------------------------------------------------
R4XFR4_TAPDE/31-121--------------------------------------------------------------------------------
YR470_MIMIV/277-352--------------------------------------------------------------------------------
D8RRF0_SELML/32-104--------------------------------------------------------------------------------
C6HHU3_AJECH/49-123--------------------------------------------------------------------------------
N1RT61_FUSC4/58-131--------------------------------------------------------------------------------
M1B174_SOLTU/11-84--------------------------------------------------------------------------------
T1JU99_TETUR/30-104--------------------------------------------------------------------------------
E0SNS0_IGNAA/14-87--------------------------------------------------------------------------------
F2U1F2_SALR5/30-104--------------------------------------------------------------------------------
M9SCC2_METAX/7-77--------------------------------------------------------------------------------
D8QE38_SCHCM/21-95--------------------------------------------------------------------------------
A4I2U7_LEIIN/39-119--------------------------------------------------------------------------------
U5H732_USTV1/35-109--------------------------------------------------------------------------------
V2XV85_MONRO/10-84--------------------------------------------------------------------------------
D7LLA3_ARALL/11-84--------------------------------------------------------------------------------
D9Q2R4_ACIS3/13-87--------------------------------------------------------------------------------
RPAC2_DANRE/22-96--------------------------------------------------------------------------------
RPOL_AERPE/15-87--------------------------------------------------------------------------------
R4XLF1_TAPDE/31-105--------------------------------------------------------------------------------
E3GW45_METFV/12-82--------------------------------------------------------------------------------
Q75CF1_ASHGO/30-104--------------------------------------------------------------------------------
K0IDG9_NITGG/12-80--------------------------------------------------------------------------------
N1JCQ0_BLUG1/30-104--------------------------------------------------------------------------------
E1RHP8_METP4/13-82--------------------------------------------------------------------------------
Q4UD30_THEAN/39-109--------------------------------------------------------------------------------
A7SGE2_NEMVE/30-104--------------------------------------------------------------------------------
I1H2S9_BRADI/30-104--------------------------------------------------------------------------------
C5DEP5_LACTC/30-104--------------------------------------------------------------------------------
K3YB14_SETIT/11-84--------------------------------------------------------------------------------
H6BY80_EXODN/40-116--------------------------------------------------------------------------------
C1N3U7_MICPC/5-79--------------------------------------------------------------------------------
A7ELB7_SCLS1/31-105--------------------------------------------------------------------------------
A3DM82_STAMF/12-86--------------------------------------------------------------------------------
T0N787_9EURY/16-89--------------------------------------------------------------------------------
K0KAE3_WICCF/30-104--------------------------------------------------------------------------------
B7G3C7_PHATC/32-107--------------------------------------------------------------------------------
T1FV14_HELRO/24-100--------------------------------------------------------------------------------
RPOL_HALMA/12-89--------------------------------------------------------------------------------
RPOL_PYRAE/16-89--------------------------------------------------------------------------------
D5E7V1_METMS/12-83--------------------------------------------------------------------------------
B8P7Q9_POSPM/10-85--------------------------------------------------------------------------------
I1CQ65_RHIO9/65-139--------------------------------------------------------------------------------
A3FPR0_CRYPI/32-103--------------------------------------------------------------------------------
Q4E3C1_TRYCC/40-120--------------------------------------------------------------------------------
A1CD73_ASPCL/66-140--------------------------------------------------------------------------------
R4G2Y7_RHOPR/16-87--------------------------------------------------------------------------------
N1JCX8_BLUG1/50-124--------------------------------------------------------------------------------
K1W3H6_TRIAC/50-124--------------------------------------------------------------------------------
C3YRU6_BRAFL/10-83--------------------------------------------------------------------------------
V5FS87_BYSSN/46-120--------------------------------------------------------------------------------
H3GWJ9_PHYRM/21-94--------------------------------------------------------------------------------
A4S056_OSTLU/30-104--------------------------------------------------------------------------------
J3K3I0_COCIM/30-104--------------------------------------------------------------------------------
F4P6Q6_BATDJ/4-78--------------------------------------------------------------------------------
M7SKI7_EUTLA/74-148--------------------------------------------------------------------------------
I3EF49_NEMP3/8-90--------------------------------------------------------------------------------
R9T596_METII/12-84--------------------------------------------------------------------------------
J9DLV1_EDHAE/73-147--------------------------------------------------------------------------------
G7WNR7_METH6/12-85--------------------------------------------------------------------------------
J9DRQ7_EDHAE/17-93--------------------------------------------------------------------------------
R0KLQ1_NOSB1/56-130--------------------------------------------------------------------------------
G4TQB3_SERID/33-107--------------------------------------------------------------------------------
E6N524_CALS0/14-87--------------------------------------------------------------------------------
S2JHT7_MUCC1/30-104--------------------------------------------------------------------------------
C7YU34_NECH7/39-113--------------------------------------------------------------------------------
S7W7N8_SPRLO/17-90--------------------------------------------------------------------------------
F4BTP0_METSG/12-85--------------------------------------------------------------------------------
T1H6G1_MEGSC/11-83--------------------------------------------------------------------------------
B5IB51_ACIB4/15-88--------------------------------------------------------------------------------
E2C409_HARSA/11-83--------------------------------------------------------------------------------
Q7PM95_ANOGA/17-91--------------------------------------------------------------------------------
D4GVL8_HALVD/12-89--------------------------------------------------------------------------------
Q6C7Q3_YARLI/30-104--------------------------------------------------------------------------------
D3BVK7_POLPP/27-100--------------------------------------------------------------------------------
L7K018_TRAHO/20-92--------------------------------------------------------------------------------
E4NQ40_HALBP/12-89--------------------------------------------------------------------------------
A0RXH5_CENSY/12-85--------------------------------------------------------------------------------
H6BMI7_EXODN/175-249--------------------------------------------------------------------------------
B9GIX0_POPTR/11-84--------------------------------------------------------------------------------
L0JP64_NATP1/12-89--------------------------------------------------------------------------------
B6AF09_CRYMR/38-109--------------------------------------------------------------------------------
S7ZBA7_PENO1/30-104--------------------------------------------------------------------------------
W7WXG3_TETTS/100-173--------------------------------------------------------------------------------
F8QFM3_SERL3/30-104--------------------------------------------------------------------------------
Q2FNB5_METHJ/12-85--------------------------------------------------------------------------------
U5H4K1_USTV1/30-104--------------------------------------------------------------------------------
I2FXZ1_USTH4/31-103--------------------------------------------------------------------------------
RPOL_METJA/12-94--------------------------------------------------------------------------------
R9SMX5_9EURY/16-89--------------------------------------------------------------------------------
E1QRF2_VULDI/13-86--------------------------------------------------------------------------------
M1XQZ1_NATM8/12-86--------------------------------------------------------------------------------
E2AMR2_CAMFO/8-79--------------------------------------------------------------------------------
B4JPA4_DROGR/18-90--------------------------------------------------------------------------------
I0A279_FERFK/18-92--------------------------------------------------------------------------------
D8J3W9_HALJB/12-89--------------------------------------------------------------------------------
M7P2B5_PNEMU/30-104--------------------------------------------------------------------------------
T1IFN7_RHOPR/30-104--------------------------------------------------------------------------------
W1QG67_OGAPD/30-104--------------------------------------------------------------------------------
H1VZW5_COLHI/30-104--------------------------------------------------------------------------------
Q22RW2_TETTS/60-133--------------------------------------------------------------------------------
B7P8Y3_IXOSC/17-90--------------------------------------------------------------------------------
A0A087ZQW2_APIME/16-89--------------------------------------------------------------------------------
R0KJ67_SETT2/43-117--------------------------------------------------------------------------------
RPOL_METKA/17-102--------------------------------------------------------------------------------
A0DTF6_PARTE/43-114--------------------------------------------------------------------------------
Q2NE51_METST/10-81--------------------------------------------------------------------------------
R0MC98_NOSB1/13-94--------------------------------------------------------------------------------
R4WAG4_9EURY/12-87--------------------------------------------------------------------------------
F4Q1X1_CAVFA/30-102--------------------------------------------------------------------------------
D3DYV1_METRM/12-87--------------------------------------------------------------------------------
D3S1Z5_FERPA/13-85--------------------------------------------------------------------------------
F4B3S3_ACIHW/12-83--------------------------------------------------------------------------------
T0MN48_9EURY/13-85--------------------------------------------------------------------------------
Q5KMK6_CRYNJ/39-113--------------------------------------------------------------------------------
A8NBN7_COPC7/30-104--------------------------------------------------------------------------------
F1A1H8_DICPU/30-104--------------------------------------------------------------------------------
A0BUX3_PARTE/39-112--------------------------------------------------------------------------------
H8ZDJ1_NEMS1/30-105--------------------------------------------------------------------------------
B7FZW0_PHATC/2-83--------------------------------------------------------------------------------
I2H4R7_TETBL/30-104--------------------------------------------------------------------------------
RPOL_HALWD/12-91--------------------------------------------------------------------------------
C4V9M5_NOSCE/14-88--------------------------------------------------------------------------------
B6Q8P4_TALMQ/30-104--------------------------------------------------------------------------------
G8BPN3_TETPH/48-122--------------------------------------------------------------------------------
D5G8A7_TUBMM/30-104--------------------------------------------------------------------------------
RPB3_ASFB7/278-353--------------------------------------------------------------------------------
A7SBE9_NEMVE/4-77--------------------------------------------------------------------------------
S3D3J4_GLAL2/36-110--------------------------------------------------------------------------------
R7YXM0_CONA1/57-131--------------------------------------------------------------------------------
K1QKY4_CRAGI/25-98--------------------------------------------------------------------------------
L2GWA5_VAVCU/33-104--------------------------------------------------------------------------------
RPOL_SULAC/12-86--------------------------------------------------------------------------------
D8T4E7_SELML/4-76--------------------------------------------------------------------------------
M2R9T6_CERS8/30-104--------------------------------------------------------------------------------
C4LXS9_ENTHI/28-101--------------------------------------------------------------------------------
G2MGD7_9EURY/12-89--------------------------------------------------------------------------------
A2DKG2_TRIVA/20-91--------------------------------------------------------------------------------
W5J6V9_ANODA/30-104--------------------------------------------------------------------------------
G4RLB3_THETK/13-85--------------------------------------------------------------------------------
Q6CIV1_KLULA/45-119--------------------------------------------------------------------------------
RPAC2_CAEEL/60-134--------------------------------------------------------------------------------
E2LXE8_MONPE/30-104--------------------------------------------------------------------------------
Q8SS03_ENCCU/18-92--------------------------------------------------------------------------------
RPOL_NATPD/12-89--------------------------------------------------------------------------------
F4RFP0_MELLP/30-104--------------------------------------------------------------------------------
L2FWL1_COLFN/54-127--------------------------------------------------------------------------------
A8M9E3_CALMQ/15-88--------------------------------------------------------------------------------
R1GQM6_BOTPV/30-104--------------------------------------------------------------------------------
W0JQG4_9EURY/12-89--------------------------------------------------------------------------------
M5EBF3_MALS4/31-105--------------------------------------------------------------------------------
RPB11_DICDI/30-104--------------------------------------------------------------------------------
B8C8G2_THAPS/2-77--------------------------------------------------------------------------------
A5DL81_PICGU/34-108--------------------------------------------------------------------------------
A4RTY9_OSTLU/12-88--------------------------------------------------------------------------------
D8T102_SELML/13-86--------------------------------------------------------------------------------
A9A3V3_NITMS/12-84--------------------------------------------------------------------------------
G2XE43_VERDV/55-129--------------------------------------------------------------------------------
U7PQ43_SPOS1/69-142--------------------------------------------------------------------------------
D8QD48_SCHCM/30-104--------------------------------------------------------------------------------
RPOL_ARCFU/12-85--------------------------------------------------------------------------------
B6JWF5_SCHJY/34-108--------------------------------------------------------------------------------
B8D6L1_DESA1/12-85--------------------------------------------------------------------------------
Q5KMB4_CRYNJ/30-104--------------------------------------------------------------------------------
RPOL_THEKO/12-86--------------------------------------------------------------------------------
E1Z8C1_CHLVA/21-94--------------------------------------------------------------------------------
W0K2F8_9EURY/12-86--------------------------------------------------------------------------------
K0K8C5_WICCF/41-115--------------------------------------------------------------------------------
C5DRN5_ZYGRC/48-122--------------------------------------------------------------------------------
D2VMS3_NAEGR/73-147--------------------------------------------------------------------------------
B3S6B1_TRIAD/30-104--------------------------------------------------------------------------------
Q4D7H8_TRYCC/46-118--------------------------------------------------------------------------------
B8C993_THAPS/30-105--------------------------------------------------------------------------------
F4R4H4_MELLP/28-101--------------------------------------------------------------------------------
A0A1I7VJK8_LOALO/25-99--------------------------------------------------------------------------------
A0A3Q7JPU4_SOLLC/30-104--------------------------------------------------------------------------------
A7AT13_BABBO/10-83--------------------------------------------------------------------------------
A0A0D2WNY4_CAPO3/30-104--------------------------------------------------------------------------------
F7XMD7_METZD/12-85--------------------------------------------------------------------------------
RPOL_METAC/12-85--------------------------------------------------------------------------------
I3TDP2_THEC1/12-84--------------------------------------------------------------------------------
L0IAW3_HALRX/12-89--------------------------------------------------------------------------------
G4MRX6_MAGO7/30-104--------------------------------------------------------------------------------
I4Y841_WALMC/30-105--------------------------------------------------------------------------------
A9V2R7_MONBE/30-104--------------------------------------------------------------------------------
G3B1F5_CANTC/30-104--------------------------------------------------------------------------------
D5TZM1_THEAM/12-85--------------------------------------------------------------------------------
G0QUQ1_ICHMG/39-110--------------------------------------------------------------------------------
RPOL_METTH/10-80--------------------------------------------------------------------------------
D8TM87_VOLCA/31-104--------------------------------------------------------------------------------
D1YYQ6_METPS/12-86--------------------------------------------------------------------------------
Q2GXS9_CHAGB/4-78--------------------------------------------------------------------------------
D5GDE1_TUBMM/9-87--------------------------------------------------------------------------------
Q384D9_TRYB2/46-118--------------------------------------------------------------------------------
A2BNA1_HYPBU/16-90--------------------------------------------------------------------------------
A0A0K3CST6_RHOTO/30-104--------------------------------------------------------------------------------
A8AA05_IGNH4/20-92--------------------------------------------------------------------------------
Q386T9_TRYB2/39-119--------------------------------------------------------------------------------
RPOL_THEAC/20-93--------------------------------------------------------------------------------
F9XIJ4_ZYMTI/8-82--------------------------------------------------------------------------------
C4R3Z5_KOMPG/30-104--------------------------------------------------------------------------------
S7W9T0_SPRLO/10-89--------------------------------------------------------------------------------
J3NY74_GAGT3/30-104--------------------------------------------------------------------------------
L8FLZ9_PSED2/92-166--------------------------------------------------------------------------------
G0MZ50_CAEBE/29-103--------------------------------------------------------------------------------

PF01193

H3E9U3_PRIPA/103-278-----PAIARETPHGEVMCLVCNMAVMPKIRTAHVVGKTHRSKAEKLKKEVSCPTQDCDNCRQACSGGRWGIDSSI----
RPOD_HALSA/19-239LQRVHVVGDSPEYADDDPQMLRGVIEEDDELVPTDDFDNDLTTRYPGKEVEIE------------------DVDGA----
A6UW03_META3/17-181--LESESDSMVAFDNIPIVKLKEGQKLELECEALVGVGKNHAKWQPCNASYKL------------------IKDNE----
K4MD35_9EURY/16-255NKCDSCGACVKECPQGIITMGPEGAGISEDDILKCILCKLCQGICEIDAITVS------------------QDERA----
RPOD_METAC/16-256ENCDACGHCAAECPKGIISVEEAGAKIAEEDIMKCSICRLCEQVCDINAIKVD------------------FYENS----
F7XMN5_METZD/16-254TNCDQCGTCIEECPKEIIKMGPAGAEISSEDLLKCTLCKTCAEACGINAVSVN------------------QSESS----
D5EC45_METMS/14-256EGCDLCEKCVSACPRDILTLGKESAEVVDDRLLNCSLCKQCVAACDIDAISVS------------------ENNTS----
A0B9L4_METTP/14-253ISGCNNCGRCVKVCPRGVLVLDENDSIKVRDITECSLCRLCVEECDQRAISVV------------------PLEDA----
RPOD_ARCFU/16-253VNENCNGCGDCIEACPRNVFEKDGDKVRVKNVMACSMCGECVEVCEMNAISVN-------------------ETNN----
D2RD94_ARCPA/14-250IVKDNCNNCGNCVSACPRNILRLNGKVEVTDILSCSMCRECVKVCEENAIDVV-------------------ETDN----
E1RIT7_METP4/14-260GNCVEECPRNVLRVGKKSVEIADGKLEDCSMCRLCEKACMASGIGDRPAISVK------------------PDNTR----
L0HCN0_METFS/14-260GMCVEECPRDILVAKGKKVQVAEGKLPECSMCRLCERACLASGIGEEPAIKIS------------------AEPDR----
U6EDP0_9EURY/14-254DNCESCLKCVQECPRNVLEFDEEKNQIKVVDLDNCSMCRTCMKDCPNQAITVE------------------IVEDK----
RPOD_METTH/14-254FSEDCDECLECIEACPRDVLGEESGKPVVVDLENCSMCKSCVRACDKRAIDVG------------------YEEGK----
R9SN57_9EURY/14-256DDVEIDYDCASACPRGILKADRRSKKIKVLDIENCAMCKSCVRACVNDYIHVG------------------YEENN----
E3GZF2_METFV/14-254IKDTCDNCQACIEECPKDVLKANKDTIKIENIEACSLCRACERICENESISVQ------------------YIDNK----
RPOD_METKA/20-261EDKLKEKKITYECPQGIIRIENGEVVHIDEDRLPECRMYKEYERETDGAVRVR------------------LRDDA----
RPOD_PICTO/13-262KINKNELENWSFYKDKCPKSVISENENEITFTDDVECRYLQQLFDEKSGVTIT------------------EDDTK----
T0M5U1_9EURY/14-262LRITKADFENWEFYKEKCPKSVLSEDSKQISFTDDDRCPWISQLLDRQGVKII------------------EDDTN----
T0LUK9_9EURY/20-279WEKIKEKFPVSVVKETKETITITDDYQQRTVMNYINTVNHRTVINQSKPVKVS------------------EDRTR----
B5ID28_ACIB4/14-263IKVNKKDSELWEKVKKSCPKNVIKEDDKFIIFTDDIPCKEIAEILSFENPEIT------------------EDDSW----
T0LNF0_9EURY/16-263ELKVSAREPELDDIIKHSPKNVLRKNDKEVVFTTDYPSKYVSKLYRMDSLEEK------------------EDDKR----
R9T5Y4_METII/14-266DPARCDSGGTCIKACPRGVLAKEDGIVKVVDLESCILCKSCFEVCELNAIKLS------------------GSDSK----
G0NUY4_CAEBE/20-263HAKWNPTTGVAFEYDPDNALRHTIYPSVEEWPRSDHSSLPEDSVEKEAPFDPH------------------GKPNK----
A0A1P6BJD5_BRUMA/20-256KEHAKWNPTCCVAFEYDPDNALRHTMLAKPEEWPKSEYSQLEDDEYEAPFDPM------------------AKPNK----
B7QL55_IXOSC/20-255KEHAKWNPTCGVAFEYDPDNAFRHTTYPRPEEWPKSEYSEIEDDKVEADFIVE------------------GKPNK----
H2XZ54_CIOIN/23-282LRHTTYPKPEEWPKSEYSELADDEDKYQAEHVVHNETWNLKCLLRSEISFDPH------------------GKPNK----
T1G647_HELRO/20-255KEHAKWNPTAGVAFEYDPDNEFKHTVYPKPEEWPKSEFSELPENVHEAPFNYQ------------------SKPHK----
F6YKL2_XENTR/20-256KEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSEIDEEEAEAPYDPT------------------GKPER----
G4LUY0_SCHMA/20-254KEHAKWNPTAGVGFEYDPDNALRHTFLHKPEEWPRSEYSTLPENEHQAPYDPT------------------GKPNR----
B3RV95_TRIAD/20-256TEHAKWNPTASVAFEYDPDNAMRHTTYPKPEEWPKSEYSNLPEDNYEASYDPQ------------------TVADK----
A9URC4_MONBE/24-258KEHAKWCPTAGIAFEYDPDNALRHTFFEVPSMWPKSEFSTLPEGEHEAEYDYK------------------GKPST----
A0A0D2U3Z5_CAPO3/20-246KEHAKWNPTCGVSMEYDPDNKLRHTTYYDPQNWPQSHLSELPAGQCEAPFDIN------------------AKADK----
U7PPH9_SPOS1/29-265WCPTAAVGFEYDPHNKLHHLDMWYEQDPAKEWPPTENARLEEPPQEGEVFDYD------------------AVPGR----
Q0CYF6_ASPTN/26-254KGIAKEHAKWAPTAAIGFEYDPHNNLRHVDYWPVSQNAAWEHAAPPDQPFDYD------------------AQPAN----
R1EC75_BOTPV/27-264APTSAVGFEYDPYNKLRHLEYWFEDDPQKEWPISDNANFEGDPPQEGEPFDYD------------------AAPNQ----
G2QN84_MYCTT/29-265WAPSAAIGFEYDPHNKLRHTDYWYESDPKAEWPPSEYAAWEEPPQEGEPFDYD------------------AVPNR----
A0A0C4DLK5_MAGP6/28-267WCPATAIGFEYDPHNRLRHLDLWYETDPKEEWPLSKNAEREPAPQEGERFDYD------------------AVPNR----
Q0UL31_PHANO/23-262SASAIGFEYDPANKLHHLDYWFEENAAAEWPKDEERINLDGGPELPDTEFDHK------------------AVPER----
S8BIG5_DACHA/27-261WQPCAAVAFEYDPHNKLKHVDYWYETDAKAEWPKSANAGWEEPAQENEPFDYN------------------AVPNK----
R4X6D5_TAPDE/21-255FAPVSACGFEYDPHNKLRHTELWFEEDAKKEWPPSKNATWEEEPQEGERFDYN------------------AEPDR----
M2MTP9_BAUPA/30-292WAPTAAIGFEYDPHNKLRHTTLWHEEDAKKEWPESKNREWEEPPQEGQNFDFV------------------AEPEQ----
F9WWV9_ZYMTI/30-284APTAAIGFEYDPWNKLRHTTLWYETDAKAEWPRPEKNGGWEEEPQEGEPFNYA------------------AEPSA----
B6K2N9_SCHJY/18-256WSPTAAVSFEYDPWNKLKHTDYWFETDADEEWPKSKNADWEEPPREGETFDYN------------------AQPRK----
L0PEQ4_PNEJ8/20-247KWSPVSAIAFEYDPWNKLHHTDYWFEESSDAEWPKSKNSDWEEAPRDEAFDYT------------------AEPSK----
C5MDV1_CANTT/22-257WSPCAAVGFEYDPWNKLKHTDYWYEVDAESEWPKSRNCDWEEAPDPEAKFDYK------------------AKPNT----
K0KH51_WICCF/17-253WSPCAAIGFEYDPWNKLKHTDYWYEEDIDEEWPRSENCEYEDPPNPEEPFDYK------------------AEPNK----
G8BQU0_TETPH/19-255WGPAAAIEFEYDPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYK------------------AKADT----
S2K833_MUCC1/25-255KWSPVSGVSFEYDPYNKLRHTTYWFEETEDEWPLSKNAQFETPPDKDAPFDYN------------------AKPDK----
F8PUU9_SERL3/22-274WSPCSAVSFEYDPYNKLRHTTHWFETDERAEWPLSENAKEEEPPRDDEVFDFN------------------AKPGK----
K1VZJ3_TRIAC/39-304WSPLSAVAYEYDPYNKLRHTDYWFETDAAAEWPLSANANFETPPNPNEPFDFN------------------AVPST----
I4YBL8_WALMC/14-265KWGPTSAVAFEYDPYNKLKHTHYWFEQDERAEWPLSANATEEAPPDDSPIGLN------------------AEPRT----
S7W9P7_SPRLO/40-267VIKMDNAKKHAKWAAVTAVGYNYDGGNKTSDCNKDHDNENNHSGNNTTNIDYK------------------SDITE----
I3EI10_NEMP3/15-244VSTVAFGYDEDNSLRHTKFWHEKSINKEWPAPWFSDKSTPAQSEEYVHSADPS----------------------K----
Q8SRR5_ENCCU/15-229RKGVGKTHAKWSPVSAISFEYDKDNVRRETNYWFEESIEEEWPGVRQGEANLM------------------QKIDK----
A9SHD1_PHYPA/23-296EKQEWIDSSPTKVFELDPVSQQVVVVDPEAYTYDEEVLKKAEAMGKPGLVEIY------------------SKEDS----
M7ZTZ3_TRIUA/27-283GTPGRREVAAVATGTGEEQTYEVTIVDPEAYTYDDEVIKKAEAMGKPGLVEIN------------------AKEDS----
B8BWN8_THAPS/17-296EACPDRILELDEITGNLVAVENAYEMATFTEDLKTVQNAMKKRPEDDDFVNVV------------------QSTDR----
H3GMV0_PHYRM/20-302VFETDENYEQVRYGCVMQFTVGDAMRCMYCDECVKLADSFKDNPEDDSAVSIR------------------MREDK----
Q4DWU1_TRYCC/46-312RQWVERCPRQVFRYDDRTGQVLLADPDACIFCRECLLKEPPFNKLAEPLVFVR------------------HKKDKRGYH
Q580S5_TRYB2/20-286RQWMRSCVHRPHSIAESNGEGHTGHIDVNKLCEECLLKEPSVVSFTEPLVFAR------------------PKKDARGHY
A5K6U4_PLAVS/25-297ANSLNKNCYVLKNAEAHDREVSLRLNENMSVVMAESCIEFLNELGYKDVVKII------------------YDETK----
Q4UFZ3_THEAN/23-314VRSENPSFLGHSDKTFKLDAGGLQVVNKLDCIYCDECINYCRELGHKDLIRIQ------------------PDESK----
B6AI35_CRYMR/22-307SKSEFGMFDKPVEKSTNIPDIEVLNSSDCIFCNECVNTCRNLGYINPPLIRVD------------------TKPDK----
A2F4R6_TRIVA/26-308KEKEEVVASCPKKCLKMGLDDNIQVANFEDCTFCNQCIRTAEVHGHKDAIVIQ------------------SKRGL----
F4Q3D5_CAVFA/22-285QKDEWISSCPTNVFKYNPNSMQQVTTDDLKCMFCQECVKKSEALGKPDLVSVE------------------QKQDR----
F0ZT58_DICPU/25-291EEWVGSCPTKVFGYSPHNQSQPVSVDEPMRCMYCLECKKKAEAFGKPDLISIE------------------QKQDK----
D2W3Y1_NAEGR/24-310CPTKVFSVTNDDRLIIDLDKCTYCNECKDFVNDELIPNTSPEFKDFVSIKEKD-----------------LGGKRE----
G0QT24_ICHMG/17-295KKQIVDCCPVKVYEINQENDQLEIANLQKCMFCDECVFKCEEEIKKPKLIKID------------------HNKNK----
A4VDR4_TETTS/17-290KKALVNACPTKVFGINPHTNTLEVQDHMKCMYCEECVYKCAEDFQKPKLIKID------------------HKKDK----
C9LTF6_SELS3/26-221LNEDGELHMEMIVERGKGYVAAEKNKKPDHVIGVIPIDSIFSPIQRVNYTVQDTRV------------GNVTDYDK----
R7CMC0_9FIRM/26-223LDADAHLGMEMTINRGHGYVPFSKNKRDDVVIGVIPIDSIYSPVIKCNYLVSDTRV------------GNEMDYDK----
G0VNJ6_MEGEL/26-223LDTDANIRMQCHIERGKGYVPSTKNKKETDMIGVIPIDSIFSPIVRTNYEVGNIRV------------GNEMDYDS----
G4Q722_ACIIR/26-226LDKNANLNMEIYVDIGRGYVSADKNKSKDQPIGFIPVDSIYSPITRVKFGVTDTRV------------GNVTNYDR----
H6LGS3_ACEWD/26-221LSKGS