Sequence alignment for CL0513

PF03815

VITRN_HUMAN/44-133INCDVKAGKII................DPEFIVKCPAGC..QDPK...YHVYG--TD......................V
Q4WUJ0_ASPFU/168-298LSCHSRLWSNATNCG.LDGDACR.PFDDGAFAFRCPATC..SAAMLLEPYFIG--PQEINYRTLVIGGELGGGNGSDYGV
CRLD2_MOUSE/387-486VDCHATVAQLC.........PFE.KPATHCPRIQCPARC..GEEPSYWAPVYG--TN......................I
CRLD2_MOUSE/286-377VHCDTKMKDSC..............KGSTCNRYQCPAGC..LSNK...AKVFG--SL......................F
COCH_HUMAN/32-121ITCFTRGLDIR................KEKADVLCPGGC..PLEE...FSVYG--NI......................V
Q8IK83_PLAF7/754-852INCETTGMEDS..........FH.SIVNTNIVVLCPLGC..DDEKYHDASIYG--SR.....................GT
Q8IM24_PLAF7/1171-1264FTCSTDGQFIL.........NLS...VGEKRTINCPSNC.NIIKD....KIYG--TN......................I
CRLD1_MOUSE/293-384VSCEVRLRDQC..............KGTTCNRYECPAGC..LDSK...AKVIG--SV......................H
Q4Y3E4_PLACH/7-99FTCFTDGSFLN.............FLMGSTKNIICPENCHKIDK.....QIYG--TN......................T
Q4YW57_PLABA/727-825LNCDTTLKQAI.........EIE.KFVGNEYLFKCPYDCLKRNTE...ATVIG--GEG....................NI
Q2UA88_ASPOR/147-275LTCRATLWEYGNECG.LNGNDCR.PFTAATIPFRCPANC..RDAKLAAPHMVG--NQTYSYKGLVVG..GPQPGSDDTPV
Q8IM24_PLAF7/672-769LTCFDKMLSKS.........NLSVATTGDVFLASCPEKC..DEEV...GIVKG--TF......................L
Q4YUE0_PLABA/1079-1193LNCSDNLLSER..........FN.GKIGAQFLVSCLEDC..TNSK...YIVKG--SN.....................NY
Q8IKS0_PLAF7/726-824LDCQSSLKETN.........EIE.KMIGNEYLIKCPHDCLERDIE...ESVIG--GEG....................NI
Q2GQN4_CHAGB/129-252IDCVDTLWKRNNECG.LDGINCR.PFSNTSFAFRCPADC..ASVRVLNPHHVG--NQDVNFRPL.......VVGGGGNGP
Q5AU59_EMENI/149-276LSCSTTFWSSGNGCG.LNGNDCR.PFTGEATAFRCPANC..RDTKILESYTIG--NETISYRGLVVG..GPQPGSDEPGV
CRLD2_XENTR/291-382IKCATKMRDSC..............KGSTCNRYKCPPGC..INSK...AKVFG--TL......................F
Q4U8P9_THEAN/1093-1187LSCQDTAVFVL.........KMH...IGTRVLLDCPPGC.KDAKP...YNVFG--TG......................V
Q4N1E8_THEPA/188-285VMCNTRAVDIY.........SGT.FVKPFNITVRCPMNC.NNDPL...MSIEG--SS......................L
Q4Y8D6_PLACH/571-667LSCDYTFENIT.............LDNNQTIVARCLPNC..FNQK...NDIFG--SY......................I
Q8IM24_PLAF7/277-384IDCHIRAIDLINTN...NINKLL.QNKVQIFKVRCPQNC.HNSEF...AIIEG--SS......................I
Q4XZL5_PLACH/752-850IDCDTTALDDD..........FN.GIVNTNIVALCPLGC..DHERFKEFHVYG--SN.....................GV
Q4XHB8_PLACH/31-138IDCHIRANDLIDTTKSLNNSFVL.QNKVHIFKVRCPQNC.HSSDF...SIIEG--TS......................I
Q28NX7_JANSC/137-231ISWSDDVDAIG..........YG.DRVGESVTVTCPADR..FGA....GQVWG--TD......................V
Q4Y340_PLACH/467-582LNCDDTLNDIP........DVIP.LIYGDKFVVSCPYNC.IKDVESNNKTVYG--SD......................L
Q28NX7_JANSC/19-119LLCATPSLADWSAN...LIARGL.DTPGATGQIECPPN....GAV...ATVWG--TG......................T
Q8IM24_PLAF7/1059-1160LKCQDNLLSEQ..........FN.GKIGSQFLVSCIENC..TKSK...YFIKG--TN.....................NY
Q4N5G4_THEPA/751-847LDCSDSLGRSK.........KIF.GSLNTSVIVRCDEDC.SQKDN...LFIYG--TN.....................GL
Q4N2Y3_THEPA/528-626LACNSRITDNS.........DLP.TKPGSKFNVKCPQNCHETYEN...YEVEG--GKD....................GL
CRLD2_XENTR/392-491IDCYTTVAEIC..........QFVKPATHCPRFNCPAHC..KNEPSYWAPVIG--TN......................I
Q4N1E8_THEPA/573-671LSCYDTLTSHS.........EFQ.GEFGSFKVASCPMGC..MDEP...ASIKG--TY......................V
Q4XHC4_PLACH/3-100LSCFDKISSKA.........ELSKGNVGDIFLVSCPEKC..DEDS...GVIKG--TF......................V
A0LH15_SYNFM/30-122LPDPGTLNQME.........NVA.PGTTMFFNVTGKTTG.........GSLWG--TD......................Y
COCH_CHICK/28-117ITCFTRGLDLR................KETEDVLCPANC..PLWQ...FYVFG--DG......................I
CRLD1_MOUSE/394-492VTCETTVEQLC..........PFHKPASHCPRVYCPRNC..MQSNPHYARVIG--TR......................I
A1C540_ASPCL/149-277LSCATTFWEHGNECG.LNGNDCR.PFSASTVAFRCPANC..RDAKLLSPHTVG--NHTFSYQRLVVG..GPQPGSSEPGV
B3DFV8_DANRE/31-120ISCGTRAVDLS................DTHLLVLCPANC..SLWS...LSVFG--SG......................V
C8VAW3_EMENI/156-277LSCSSRLWSNATNCG.LDGDYCR.PFDGETFAFRCPAGC..SGFMVLEPYFVG--PKEINYQHLVIG..GAAAESQPDSV
E1C6X0_CHICK/39-126..CDVKAGKII................NPEFIAKCPPGC..QDVK...YRVYG--TD......................I
F1R7U9_DANRE/303-391VACDTRLRDQC..............KGTTCNRYECPPGC..FYNY...GKVIG--SG......................H
H3CRW8_TETNG/411-504ITCETTAAQLC.........SYQ.KPAKHCPRLYCQRNC..LEENPHLSRVIG--TR......................I
H3DGW2_TETNG/36-123..CDVRAGKIN................LPEFIAKCPAHC..KESK...QQVYG--TG......................V
Q5CYM9_CRYPI/740-831IDCDTVAYKNP.........IFE.GPINTNIIVQCPPGC..AEYK...TKVYG--SD.....................GV
V4ZDR3_TOXGO/1033-1123LRCEDTLLRPE..........FS.GVTGHQILVSCPADC..AHST...GPLHG--CK......................I
V5B813_TOXGO/278-371VECHTRALELY.........SRI.PENIGIFKVRCPMNC.QASTF...ASVDG--SS......................I

PF08642

C1H5M7_PARBA/938-1099--------------------TIRVPRFRIDASHR........EEICARRALWG..TG----------------------V
C6HJS8_AJECH/405-563--------------------TIRVPRFRIDASHR........EEICARRALWG..TG----------------------V
E9DVW1_METAQ/816-946--------------------TVKVPLIHLSPVAR........EEITARAYLWG..TD----------------------V
Q6BS67_DEBHA/388-499--------------------EIKIPYKFIKLFKEDL....DDDNIPLKRQIWGGASA----------------------V
H2AYB5_KAZAF/162-271--------------------TIRVKYVDILNFMSG......NNLRLQNSEVWG..TD----------------------I
I2GWB9_TETBL/171-292--------------------TIKINYEDYISSMNRD...DINSPRSNNNEIWG..CD----------------------I
V5INS1_NEUCR/835-967--------------------TVKISKTHLTPEAR........EEITSRRAVWG..TD----------------------I
G1XFK4_ARTOA/516-644--------------------..RIPWYCLSLEER........ERVCKKRLLWG..TE----------------------V
G2QNU5_THIHA/780-921--------------------TMKIGKEHLVPAAR........EEITSRRALWG..TD----------------------V
E3QI42_COLGM/896-1035--------------------TVKVPKVHLTPVAR........EEITARRALWG..TD----------------------V
G0RPD9_HYPJQ/908-1039--------------------TVKVSRVHLSPIAR........EEITARAFLWG..TD----------------------V
G8JRH1_ERECY/140-262--------------------TVVIKSEDLLHAREK.....NGNIRIQNRELWG..VD----------------------I
U1I1E0_ENDPU/1189-1302--------------------TIRVSRTWLHGPER........EAICSERFLWG..SG----------------------I
S2JEL2_MUCC1/530-651--------------------EIRVPARFLTFE..........NVKVKKRALWG..TD----------------------I
K2SGZ9_MACPH/711-828--------------------TVRVPRYYLSERQR........DVIVVSRQLWG..SE----------------------I
Q6CWM7_KLULA/161-283--------------------TIQIDSIYLQQVARS......ENIRYQNREIWG..TD----------------------I
T4ZWG0_OPHSC/258-385--------------------TVKVPRVHLSPPAR........EEITARAYLWG..TD----------------------V
V5G6M3_BYSSN/291-408--------------------TVRVPRFRIDASHR........EEICARRALWG..TG----------------------V
L8G4U8_PSED2/868-994--------------------TVRVPRVYLEPPSR........EEITARRSVWG..TD----------------------I
Q2GN38_CHAGB/751-890--------------------TMKIGKEHLIPAAR........EEITSRRALWG..TD----------------------V
G0RYX0_CHATD/883-1017--------------------TVKIGKQHLTPEAR........EEITARRALWG..TD----------------------V
G0V5S2_NAUCC/148-257--------------------KIHIRYEQLQNAYNN.....ISAPRTTNNELWG..CD----------------------I
G8BPF2_TETPH/128-245--------------------TIHILYEDLTNKFN.......MNPRLDNNELWG..CQ----------------------I
G3AWR6_CANTC/257-368--------------------EVKIPSRFVKSFVQGL....ETGDVANKREIWGGKHG----------------------I
G8BDF2_CANPC/230-371--------------------DVKIPFRYIVEFKQD......FYNEIVSRELWGGASG----------------------V
U4LWB0_PYROM/1012-1143--------------------QVRIPKRFLSDAHR........KEVARRRCVWG..TE----------------------V
A0A0D2XM24_FUSO4/263-390--------------------TVKVARIHLSSIAR........EEITSRGYLWG..TD----------------------V
B8ML52_TALSN/681-800--------------------TIRVPRFRIDPNHR........EEICARRAVWG..TG----------------------V
G2X0U8_VERDV/859-996--------------------TVKVSRTHLTKEAR........EEITYRRALWG..TD----------------------V
Q6FWF5_CANGA/151-280--------------------TISIKYEDLMKSFNDS....GECPRTFNNEIWG..CD----------------------V
A6R2D3_AJECN/948-1106--------------------TIRVPRFRIDASHR........EEICARRALWG..TG----------------------V
G4MPP9_MAGO7/884-1015--------------------TMKVSKAHLLPEAR........EEITARRAVWG..TD----------------------V
E3RQ94_PYRTT/11-136--------------------TVRIPRYYFTCGEEVNEDNHSLEGICRRRQLWG..TE----------------------I
M7TUB4_EUTLA/78-206--------------------TVKVPRAHLTSAAR........EEITSRRAIWG..TD----------------------V
K9FWH9_PEND2/678-800--------------------TVRVPRFRINQSHR........EEICARRALWG..TG----------------------V
C4JXP4_UNCRE/686-823--------------------TIRVPRFRIDGPRR........EEICARRALWG..TG----------------------V
M1W0D1_CLAP2/918-1049--------------------TVKVPHVHLSTVAR........EEITARSYVWG..TD----------------------V
Q4X0R9_ASPFU/841-961--------------------TVRVPRFRIDAGRR........EEICARRALWG..TG----------------------I
Q757D6_ASHGO/125-244--------------------TVELSAEDLESALAT.....GENARVRNRELWG..VD----------------------V
G3ALD5_SPAPN/284-396--------------------EVKIPFRFIVQLKHD......FINEIYVRDVWGGASG----------------------I
S7ZDG8_PENO1/825-943--------------------TVRVPRFRVDAARR........EEICARRALWG..TG----------------------V
G8Y9N4_PICSO/361-472--------------------EVKIPYKHVKLFKEQL....EIGLVPESRAVWGGVSG----------------------V
G8ZUP8_TORDC/127-233--------------------TIRVFYEDLRDSFNH.....SNAPRARNNEIWG..CQ----------------------V
U4KX31_PYROM/4-136--------------------SVHIPKRFLSDAHR........KDVARRRCVWG..TE----------------------V
K1XET6_MARBU/885-1008--------------------TVKVPRIHLDHISR........EEITRRKAVWG..TD----------------------I
S3BP50_OPHP1/1056-1205--------------------TVKISKVFLEAAAR........EEITYRRALWG..SD----------------------I
A7EZ96_SCLS1/865-991--------------------TIKISRAHLRPESR........EEITYRKNLWG..TD----------------------V
M7UT78_BOTF1/895-1021--------------------TIKISRVHLQPPSR........AQITARKNLWG..TD----------------------V
S8A8C9_DACHA/912-1042--------------------..RVPWYCLNLEER........ERVCRKRLLWG..AE----------------------V
A3LUK2_PICST/406-530--------------------EIKIPFHFIDKFIHE.....FESSVIIKRELWGGASG----------------------A
Q6CF00_YARLI/305-431--------------------QVLIPRKHLRKESN.........ILVQRREIWG..TD----------------------I
G9NR46_HYPAI/900-1031--------------------TVKVSRIHLSSIAR........EEITSRAFLWG..TD----------------------V
J7RYF5_KAZNA/125-231--------------------SIRVPCEEIDKLLQN......KSSRLENLELWG..SD----------------------I
M3K5T1_CANMX/305-423--------------------EIKIPFRYIIEFKQD......IGNELFTRDLWGGASG----------------------V
C5M6I7_CANTT/7-119--------------------...FPFRHIIEFKQD......VGNDLITRELWGGASG----------------------V
J5JCU2_BEAB2/722-848--------------------TIKVPRVHLTPVAR........EEITARAFVWG..TD----------------------V
J3PBS3_GAGT3/911-1051--------------------TVKISKAHLNSMAR........EEITSRRALWG..TD----------------------V
H6C4R8_EXODN/575-687--------------------TVRVPRIWLRERER........FLICQERYLWG..SG----------------------I
R7Z1H3_CONA1/712-836--------------------TIRVPRYYLQPDQR........EEICLRRNVWG..TE----------------------I
E9D8H4_COCPS/887-1025--------------------TIRVPRFRIDAPRR........EEICARRALWG..TG----------------------V
C5DS09_ZYGRC/122-228--------------------EVKISYEDLQSSVQV.....KDSPRTVNNEIWG..TD----------------------I
F9X0J4_ZYMTI/93-215--------------------TVRVPRYFLAPSEAGN...SSLEEICKRRQLWG..TE----------------------V
N1JD71_BLUG1/820-944--------------------TVRVPRIYLEDAVR........EEVTHRKALWG..TD----------------------I
G2RGW7_THITE/773-913--------------------TMKIGKEHLTPAAR........EEITSRRALWG..TD----------------------V
C5GEG5_AJEDR/790-947--------------------TIRVPRFRIDASHR........EEICARRALWG..TG----------------------V
G0WAD1_NAUDC/154-276--------------------TVHVLYEQLYDLFNE.....STSPRVNNNEIWG..SD----------------------I
K0KYE9_WICCF/355-474--------------------TIRIPSYQINNLQN........NHNYLNRSIWG..SD----------------------I
N1QMF6_SPHMS/679-804--------------------TIRVPRYYLTSGEGGAAMNHSLEEICKRRQIWG..TE----------------------I
F4NTB3_BATDJ/323-468--------------------QVRIPSEFLTYRG.........NIAVRKSALWG..TD----------------------I
E4ZP84_LEPMJ/937-1052--------------------TIRVPRFYLKPRQR........QHIVLERHLWG..AR----------------------I
A7TGE0_VANPO/131-252--------------------TIKISYEDLCLNENSI....QERPRFLNNEIWG..CQ----------------------I
S3CY53_GLAL2/873-991--------------------TIKVSRAYLSDVSR........EEITRRRAVYG..TD----------------------I
D5GDK0_TUBMM/385-515--------------------QVRIPRRFLSAEQR........RDVHRRRCVWG..TE----------------------V
Q59ZF1_CANAL/377-496--------------------EIKIPFRHIILFKQD......IANELITRELWGGASG----------------------I
N1Q7Z6_PSEFD/658-783--------------------TVRVPRYYLSSSLARAKESYSFEEICKRRQIWG..TD----------------------I
C4XW21_CLAL4/297-409--------------------DVKIPYKFIKLHINAL....AAGKVQRRRELWGGSAD----------------------I
N4VJJ6_COLOR/830-968--------------------TVKVPKVHLSGSSR........EEITSRRALWG..TD----------------------I
E7Q1V9_YEASB/140-252--------------------TLKITYEDIQASFNN.....IESPRTRNNEIWG..CD----------------------I
T0KCQ7_COLGC/297-435--------------------TVKVPKVHLTPSAR........EEITARRAVWG..TE----------------------V
N1Q2C4_DOTSN/668-792--------------------TVRVPRYYLTRSETNRD.EINLEAICKRRQLWG..TD----------------------I
F2PLT8_TRIEC/777-941--------------------TIRVPRFRIDAIHR........EEICARRALWG..TG----------------------V
C5DFG3_LACTC/132-240--------------------SIEVSYEDIAAMSQPH....SSNLHVTNNELWG..SD----------------------I

PF03815

VITRN_HUMAN/44-133YASYSSVCGAAVHSGVL.................----------------------------------------------
Q4WUJ0_ASPFU/168-298YRGDSAICPAALHAGLI................S----------------------------------------------
CRLD2_MOUSE/387-486YADTSSICKAAVHAGVI................V----------------------------------------------
CRLD2_MOUSE/286-377YESSSSICRAAIHYGVI.................----------------------------------------------
COCH_HUMAN/32-121YASVSSICGAAVHRGVI.................----------------------------------------------
Q8IK83_PLAF7/754-852YSDNSSICRAAIHSDII.................----------------------------------------------
Q8IM24_PLAF7/1171-1264YSPTSVLCKAAIHSGAL.................----------------------------------------------
CRLD1_MOUSE/293-384YEMQSSICRAAIHYGII.................----------------------------------------------
Q4Y3E4_PLACH/7-99YSPLSSVCKAAIHAGVI.................----------------------------------------------
Q4YW57_PLABA/727-825YSEDSSICLSSIHAGVY.................----------------------------------------------
Q2UA88_ASPOR/147-275YRADSFICQAAIHAGVI................T----------------------------------------------
Q8IM24_PLAF7/672-769YTYDSPICKSAIHSGVL................P----------------------------------------------
Q4YUE0_PLABA/1079-1193YTPDTSICKAVMHSGIMHKTRNTHKSNEHDEDNN----------------------------------------------
Q8IKS0_PLAF7/726-824YSEDSSICLSAIHAGIY.................----------------------------------------------
Q2GQN4_CHAGB/129-252YRGDSFLCGAAIHAGVI................R----------------------------------------------
Q5AU59_EMENI/149-276YRADSFICQAAIHAGVI.................----------------------------------------------
CRLD2_XENTR/291-382YDSMSSICRAAIHYGVI.................----------------------------------------------
Q4U8P9_THEAN/1093-1187YSPTSSLCQSAIHSGKL.................----------------------------------------------
Q4N1E8_THEPA/188-285HPSSTSICGAAIYDGAT.................----------------------------------------------
Q4Y8D6_PLACH/571-667YAPHSPICKSAIHSGII.................----------------------------------------------
Q8IM24_PLAF7/277-384HPSSTSICAAAIHDGSI.................----------------------------------------------
Q4XZL5_PLACH/752-850YSDSSSICRASIHAGVI.................----------------------------------------------
Q4XHB8_PLACH/31-138HPASTSICAAAIYDGSL.................----------------------------------------------
Q28NX7_JANSC/137-231YSSDSPICNAAVHRGLM................I----------------------------------------------
Q4Y340_PLACH/467-582YSLDSPICKAAVHSGVCLKNGNNT..DVNTLNNY----------------------------------------------
Q28NX7_JANSC/19-119YTSDSSICTAALHYGWI................T----------------------------------------------
Q8IM24_PLAF7/1059-1160YTPDSSICKAAIHAGIYKP.............NM----------------------------------------------
Q4N5G4_THEPA/751-847YSDHSSICLAAIHAGII.................----------------------------------------------
Q4N2Y3_THEPA/528-626YSFNSSVCLSAVHAGEY.................----------------------------------------------
CRLD2_XENTR/392-491YADSSSICKTAVHAGVI................K----------------------------------------------
Q4N1E8_THEPA/573-671YTRDSSICKAAIHSGVL.................----------------------------------------------
Q4XHC4_PLACH/3-100YTFDSYICKAAIHAGVL................S----------------------------------------------
A0LH15_SYNFM/30-122YTTDSSLAMAAVHSGAI................R----------------------------------------------
COCH_CHICK/28-117YASLSSVCGAAIHRGVI.................----------------------------------------------
CRLD1_MOUSE/394-492YSDLSSICRAAVHAGVV.................----------------------------------------------
A1C540_ASPCL/149-277YRADSFVCQAAIHAGVI................T----------------------------------------------
B3DFV8_DANRE/31-120YASISSICGAAIHRGII.................----------------------------------------------
C8VAW3_EMENI/156-277YRGDSSICQAAMHAGLL................E----------------------------------------------
E1C6X0_CHICK/39-126YASFSSVCSAAIHSGAI.................----------------------------------------------
F1R7U9_DANRE/303-391YDMNSSICRAAIHAGVI................Q----------------------------------------------
H3CRW8_TETNG/411-504YSDKSSICRAAIHAGVI................R----------------------------------------------
H3DGW2_TETNG/36-123FASISSICNAAIHSGVI.................----------------------------------------------
Q5CYM9_CRYPI/740-831YSEKSSICKAALQVGVI................S----------------------------------------------
V4ZDR3_TOXGO/1033-1123YSADSSICKAALHMGAI.................----------------------------------------------
V5B813_TOXGO/278-371HPMASSICAAAIHDGVL.................----------------------------------------------

PF08642

C1H5M7_PARBA/938-1099YTDDSDPVAAAIHSGFIRGEWGEDVDVSMLDLEIKEQHQHAPNGKNGNNSMLPKFSSADEPATTANNPTTIASAASQNPD
C6HJS8_AJECH/405-563YTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKEEHQHAPNGKNGT...TSTFHKVSSLDESPTKGPTTATPKPVDEV
E9DVW1_METAQ/816-946YTDDSDVVAACIHGGWIKGEWTDDVDTAMLDLEQ...............................GTAEGGKRKTKIPTP
Q6BS67_DEBHA/388-499YTDDSDILLVLAHLGLF.............................................................NG
H2AYB5_KAZAF/162-271YTDDSDVLLMLKHVGFF...............................................................
I2GWB9_TETBL/171-292YTDDTDPILALIHCGFT...........................................................LNNI
V5INS1_NEUCR/835-967YTDDSDVIAACIHAGWFRGEWPEDVDTAFLGLDEA.............................VSTASDILTSMRNGPQ
G1XFK4_ARTOA/516-644YTDDSNILAVLVHLGYL......PAVRDGAEVVEYASA.......................HDAVLARLSAPKRRGAG..
G2QNU5_THIHA/780-921YTDDSDVIAACIHAGWIRGEWPEDVDVSMLGLDEGYSVS....................DVGDLLHASGTDGKGSRSSSS
E3QI42_COLGM/896-1035YTDDSDVVAACIHGGWIRGEWGDDVDTSLLDLDRGLSA......................PEKEFPASKRRNKEKEKDEK
G0RPD9_HYPJQ/908-1039YTDDSDVVAACIHGGWIRGEWTEDVDTSLLDLDQ..............................GSNGETKRRKAKSLDS
G8JRH1_ERECY/140-262YSCDSDPLLALVHCGAI.............................................................DL
U1I1E0_ENDPU/1189-1302YTDDSDPVAAAIHSGFIRGAWNDEVDTDLLER..................................VSREQNPSID....
S2JEL2_MUCC1/530-651YTDDSDIVAMAIHSGKY......QPHFIEPTIE................................STDPFALAVAGKQKE
K2SGZ9_MACPH/711-828YTHDSDVVAAAVHSGWIRGAWPEDVDVNMLDP..................................RINGGSEPLS....
Q6CWM7_KLULA/161-283YTDDSDIILVLQHCGVL......PF................................................SEPLDQN
T4ZWG0_OPHSC/258-385YTDDSDVMAACIHGGWVKGEWAEDFDSATFDL..................................DDGGPRRKPKNRAN
V5G6M3_BYSSN/291-408YTDDSDPVAAAIHSGFIRGEWGDDVDVEMLDL..................................EIKDTYQHAP....
L8G4U8_PSED2/868-994YTDDTDVVAACIHGGWIRGEWSDDVDISVLDL..................................VIDDSAEDNG.TAT
Q2GN38_CHAGB/751-890YTDDSDVVAACIHAGWIRGEWPDDVDVSLLGLDEGYSV......................SDVRGLLNNHANGSKSANLP
G0RYX0_CHATD/883-1017YTDDSDVIACCIHAGWIRGEWPEDVDVSMLGLDEGY...........................AMSDVRGINILKNGAKK
G0V5S2_NAUCC/148-257YTDDSDPILALRHCGFQ...............................................................
G8BPF2_TETPH/128-245YTDDSDPILVLKHSGVL..............................................................R
G3AWR6_CANTC/257-368YTDDSNILTMLAHLGFF...........................................................EENG
G8BDF2_CANPC/230-371YTDDSDILQVLLHMGFF.............................................................ND
U4LWB0_PYROM/1012-1143YTDDSDTLGVLMHTGKLPAWLPEDVESPEEFVKST.............................ERKVIKKGVLSASPSA
A0A0D2XM24_FUSO4/263-390YTDDSDVVAACIHSGWIKGEWAEDVDNSVLDI..................................DQGVADKRRKKPTN
B8ML52_TALSN/681-800YTDDSDPVAAAIHSGYIRGAWGEDVDISMLDL..................................EIKSDYHHAP....
G2X0U8_VERDV/859-996YTDDTDVVAACIHGGWIRGEWS.NVDVNMLDLDRGILF.......................QDKEPIPNKRRKDKERDEQ
Q6FWF5_CANGA/151-280YTDDTDPILALRHCGFT......CLD..............................................PPPLTPTH
A6R2D3_AJECN/948-1106YTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKEEHQHAPNGKNGT...TSTFHKVSSLDKSPTKGPTTAAPKPVGEV
G4MPP9_MAGO7/884-1015YTDDSDVVAACIHGGWFRGEWPEDVDVDMLGLYP..............................EEPPAAGRGKKQAQHV
E3RQ94_PYRTT/11-136FTDDSDVVTAAVHSGWLKCKFGEFNSD............................................LRKVCDNGP
M7TUB4_EUTLA/78-206YTDDSDVVAACIHAGWIRGEWGENVEDLLDLHK.................................PASSKTQQNRAPSS
K9FWH9_PEND2/678-800YTDDSDPVAAAIHSGFIRGAWGDDVDEAMLDL..................................EIKDTYQHAP....
C4JXP4_UNCRE/686-823YTDDSDPVAAAIHSGFIRGEWGEDVDISMLDLEIKEQH......................QHAPRTANGDTDSTPK..NV
M1W0D1_CLAP2/918-1049HTDDSDVVAACIHGGWIRGEWTDYVDPDMLDLDK..............................DADGKRAAKSQNEMTE
Q4X0R9_ASPFU/841-961YTDDSDPVAAAMHSGFFRGAWSEEIDVDMLDL..................................EIRDAYQHAP....
Q757D6_ASHGO/125-244YTCDSDPLLVLVHCGVL...............................................................
G3ALD5_SPAPN/284-396YTDDSDILQVLVHMGLF.............................................................NQ
S7ZDG8_PENO1/825-943YTDDSDPVAAAIHSGYIRGAWGDDVDESMLDL..................................EIKDTYQHAP....
G8Y9N4_PICSO/361-472YTDDSDVLLALAHSGLF.............................................................DN
G8ZUP8_TORDC/127-233YTDDSEPLLVLRHCGLS...............................................................
U4KX31_PYROM/4-136YTDDSDTLGVLMHTGKLPTWLSEDVESPEQFVKST.............................ERKIIKDGVLSASPAA
K1XET6_MARBU/885-1008YTDDSDIIAACIHQGWFRGAWSEDVDTKYLGL..................................EIDDPNPTGE....
S3BP50_OPHP1/1056-1205YTDDSDVIAACIHGGWIRGEWPEDIDVSLLGLTEQAEARDGTT............KDKDSGPGSRKRAAAAAAASLASAE
A7EZ96_SCLS1/865-991YSDDSDIIAACIHQGWICGKWAKDVDVKLLNL..................................YPSDEGVSVE.PEL
M7UT78_BOTF1/895-1021YSDDSDIIAALIHQGWICGKWSDDIDVKLLDL..................................YQADEGISVE.PEL
S8A8C9_DACHA/912-1042YSDDSNILAVLVHLGYI......PAVRDGQEVAEYAEA.......................HDAVVAKLSAPKRRGAGGN
A3LUK2_PICST/406-530YTDDSDILSILAHNGFF.............................................................HD
Q6CF00_YARLI/305-431YTDDSDIVSVLYHTGVL......PTRAQ..........................................VDAFYSTLRA
G9NR46_HYPAI/900-1031YTDDSDVVAACIHGGWIKGEWTEDVDTSLLDLDQ..............................GANGETKRRRVKNQES
J7RYF5_KAZNA/125-231YTDDSDPLLMLLHMGVF...............................................................
M3K5T1_CANMX/305-423YTDDSDILQVLMHLGLF.............................................................NG
C5M6I7_CANTT/7-119YTDDSDLLQVLMHLGLF.............................................................NN
J5JCU2_BEAB2/722-848YTDDSDAVAACIHSGWIMGEWTEDVDTSLFSL...................................DKADGVKETKKPK
J3PBS3_GAGT3/911-1051YTDDSDVIAACIHGGWFRGEWPEDVNVDMLGLYPEEPSR.....................PSGPNGKGPGSRKAAQHPHM
H6C4R8_EXODN/575-687YTDDSDPVAAAMHSGFIASVYPPGIDEALLQK..................................VIDEQTPVIE....
R7Z1H3_CONA1/712-836YTDDSDPIAAAIHVGWIRGEWGEDVDPDYLLE...................................LATAAANIS..NN
E9D8H4_COCPS/887-1025YTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKDQH......................QHAPHPTNGAFGSSHK.DGP
C5DS09_ZYGRC/122-228HTDDSDPILVLRHCGLS...............................................................
F9X0J4_ZYMTI/93-215YTDDSDVVAAAIHSGWLKGDFGDLNHD............................................LQQASENGP
N1JD71_BLUG1/820-944YTDDSDVLAACIHAGWFRGAWAEDIDVSLLGL..................................ELKNDPNGDP...M
G2RGW7_THITE/773-913YTDDSDVIAACIHAGWIRGEWPEDVDVSMLGLDEGYSVS.....................DMPQLLNARGSGAKDSKPGT
C5GEG5_AJEDR/790-947YTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKKEHQHAPNGKNG....TTTALPKLSSLDELGVKEPKPSDKPETTT
G0WAD1_NAUDC/154-276YTDDSDPLLALKHCGFS......I..................................................PNNKNK
K0KYE9_WICCF/355-474YTDDSDILLILKHNGFL............................................................PSL
N1QMF6_SPHMS/679-804YTDDSDVIAAAIHSGWIKGDFGEYNND............................................LRDICDNAW
F4NTB3_BATDJ/323-468YTDDSDVVAMIIHSGHY......CPVDAPDPKPET............................ALQTAASKASRVGTNGT
E4ZP84_LEPMJ/937-1052YRDDSDPIAAAIHSGWIRGEWDETVDVSMLDP..................................RITAPNDPSD....
A7TGE0_VANPO/131-252YSDDSDPVLALRHCGFL......A...................................................GHFPN
S3CY53_GLAL2/873-991YTDDSDVVAACIHEGWFRGAWAPDVDISLL.......................................DLEIGDP....
D5GDK0_TUBMM/385-515YTDDSDVLGVLVHLGKVPGVLPEGATPDLVAETG..............................CRKTTSRGDITNMLST
Q59ZF1_CANAL/377-496YTDDSDILQVLMHLGLF.............................................................NN
N1Q7Z6_PSEFD/658-783YTDDSDVIAAAVHSGWIKGDFGEYNED............................................LNEVFGNDS
C4XW21_CLAL4/297-409YTDDSELLSVLTHLGLF.............................................................EN
N4VJJ6_COLOR/830-968YTDDSDVIAACIHGGWIRGEWGEDIDPDMLDLDRGLQA.......................PEKEVPASRKRKEKGKEEK
E7Q1V9_YEASB/140-252YSDDSDPILVLRHCGFK...............................................................
T0KCQ7_COLGC/297-435YTDDSDIIAACIHGGWIRGEWADDIDADMLDLDRGLAA.......................PEKEVPANKRRKEKEKEEK
N1Q2C4_DOTSN/668-792YTDDSDVVAAAMHSGWLRGDFGEYNED............................................IRQICDNTS
F2PLT8_TRIEC/777-941YTDDSDPVAAAIHSGFIRGEWAEDVDVSMLNLELKDNRKSSSTTAT......ANGNGTAANGKTTPSSNRTPSVHSNSTR
C5DFG3_LACTC/132-240YTDDSDILLVLRHCGVI...............................................................

PF03815

VITRN_HUMAN/44-133---------------------------------------------------------------------DNSGGKILVRK
Q4WUJ0_ASPFU/168-298---------------------------------------------------------------------DAKGGCGVLRR
CRLD2_MOUSE/387-486---------------------------------------------------------------------DEVGGYADVMP
CRLD2_MOUSE/286-377---------------------------------------------------------------------DDRGGLVDVTR
COCH_HUMAN/32-121---------------------------------------------------------------------SNSGGPVRVYS
Q8IK83_PLAF7/754-852---------------------------------------------------------------------DNKGGLVNVTI
Q8IM24_PLAF7/1171-1264---------------------------------------------------------------------SNQGGLVEIIV
CRLD1_MOUSE/293-384---------------------------------------------------------------------DNEGGWVDVTR
Q4Y3E4_PLACH/7-99---------------------------------------------------------------------SIKGGQIQVVV
Q4YW57_PLABA/727-825---------------------------------------------------------------------.DKHYLINLRV
Q2UA88_ASPOR/147-275---------------------------------------------------------------------NTIGGCGVLKL
Q8IM24_PLAF7/672-769---------------------------------------------------------------------NNIAEDIVLSI
Q4YUE0_PLABA/1079-1193---------------------------------------------------------------------KTNNNSFIIKI
Q8IKS0_PLAF7/726-824---------------------------------------------------------------------.DKHYLIHLRV
Q2GQN4_CHAGB/129-252---------------------------------------------------------------------DTTGGCGVATL
Q5AU59_EMENI/149-276---------------------------------------------------------------------DNDGGCGVARL
CRLD2_XENTR/291-382---------------------------------------------------------------------DNSGGLVDITR
Q4U8P9_THEAN/1093-1187---------------------------------------------------------------------DNDGGEVEIEV
Q4N1E8_THEPA/188-285---------------------------------------------------------------------SPSGGQVVISI
Q4Y8D6_PLACH/571-667---------------------------------------------------------------------TNLGGLIEITK
Q8IM24_PLAF7/277-384---------------------------------------------------------------------SPSGGEIIVTV
Q4XZL5_PLACH/752-850---------------------------------------------------------------------DKQGGLVNVAI
Q4XHB8_PLACH/31-138---------------------------------------------------------------------TESGGEIIVTI
Q28NX7_JANSC/137-231---------------------------------------------------------------------AAEGGTVTILI
Q4Y340_PLACH/467-582---------------------------------------------------------------------EEECKFLLMIK
Q28NX7_JANSC/19-119---------------------------------------------------------------------LDVGGLVGFRQ
Q8IM24_PLAF7/1059-1160---------------------------------------------------------------------GNKNNTFVIRI
Q4N5G4_THEPA/751-847---------------------------------------------------------------------.SSHGSFVVSI
Q4N2Y3_THEPA/528-626---------------------------------------------------------------------DNKSG.LQVEI
CRLD2_XENTR/392-491---------------------------------------------------------------------DGEGGYVDVMP
Q4N1E8_THEPA/573-671---------------------------------------------------------------------DNSGGEIVVII
Q4XHC4_PLACH/3-100---------------------------------------------------------------------SNVADDVVLII
A0LH15_SYNFM/30-122---------------------------------------------------------------------NGQTGVVKVIF
COCH_CHICK/28-117---------------------------------------------------------------------TNAGGAVRVQT
CRLD1_MOUSE/394-492---------------------------------------------------------------------RNHGGYVDVMP
A1C540_ASPCL/149-277---------------------------------------------------------------------NAVGGCGVVKL
B3DFV8_DANRE/31-120---------------------------------------------------------------------GLSGGPVEVHG
C8VAW3_EMENI/156-277---------------------------------------------------------------------DSKGGCGILRR
E1C6X0_CHICK/39-126---------------------------------------------------------------------DNTGGKILVQK
F1R7U9_DANRE/303-391---------------------------------------------------------------------SDSGGYVDVMP
H3CRW8_TETNG/411-504---------------------------------------------------------------------NEAGGYIDVMP
H3DGW2_TETNG/36-123---------------------------------------------------------------------TNAGGKVIVKK
Q5CYM9_CRYPI/740-831---------------------------------------------------------------------TNTGGMFNVAL
V4ZDR3_TOXGO/1033-1123---------------------------------------------------------------------QRHGGEAVVTL
V5B813_TOXGO/278-371---------------------------------------------------------------------SPSGGEVVVSV

PF08642

C1H5M7_PARBA/938-1099KPQTTSISSTTTKLAP.........KIPPLPP.....................................SNKDLHITLLI
C6HJS8_AJECH/405-563EPTANPTAKSKSKPKP.........RTPPLPP.....................................PNKDLHITLLI
E9DVW1_METAQ/816-946ELPSRESEGAITAPPP.........LGPMDIP.....................................ANRDLHVNVLI
Q6BS67_DEBHA/388-499KIDLTEWNEKWTSDDI.........ITPLDAKND................................PNEIHGDLSVTILL
H2AYB5_KAZAF/162-271.......DSDTSDSLQ.........RTPANLDNFDNVTGV.....................DSDLFKLNKKFDLDVTVIL
I2GWB9_TETBL/171-292NKFSSTDKKIDEMKFK.........MTPVNINNTNNIFG.......................ILPIEEDMKFDIELDILI
V5INS1_NEUCR/835-967AVKDEAGSEVYSEPPR.........NGPMAVP.....................................ANRDLHVTLVI
G1XFK4_ARTOA/516-644RSREIAAAVMAEGGAP.........KTSASVQ.....................................LHKDLLVKIVI
G2QNU5_THIHA/780-921QQSSSSSVTVLNEPPK.........TGPMPVP.....................................ENRDLHVTLLI
E3QI42_COLGM/896-1035ARLEANSATYLDQPPK.........TGPVHVP.....................................ADRDMHVSIVI
G0RPD9_HYPJQ/908-1039DMVNATSEGLITRPPP.........TGPMPTP.....................................PDRDLHVTVLI
G8JRH1_ERECY/140-262RSDMDLVKGMQQRELR.........RTPGNINNQDNVISTL..................VPDGTGNQGYLPFDVTIQLLM
U1I1E0_ENDPU/1189-1302..........FKDNVP.........DAPVEPP.....................................EGKDLHIKLLV
S2JEL2_MUCC1/530-651SIEAARRLALSGKKYT.........QHDQHLI.....................................PDHDLKVTVRV
K2SGZ9_MACPH/711-828....EADPAQALESKP.........AHPAPPP.....................................TGFDAHVTVTI
Q6CWM7_KLULA/161-283SNGKPSNVHSLKTKLR.........RTPTNMSDQNSVT........................GAIPEREIPFAIKVDILM
T4ZWG0_OPHSC/258-385ESLDLESEGLITSPPQ.........SGPLSIP.....................................NNRDLHVNVLI
V5G6M3_BYSSN/291-408......RATDEESKGR.........RIPPVPP.....................................ADKDLHITLLI
L8G4U8_PSED2/868-994KVTSKNGDITLTAPPA.........RGPMLPP.....................................PPKDLHVTILV
Q2GN38_CHAGB/751-890NQQPTSALTVLSEPPK.........TGPMPVP.....................................ENRDLHVTVLI
G0RYX0_CHATD/883-1017DAPSTNGEIVLTEPPK.........NGPMPVP.....................................ENRDLHVTLLI
G0V5S2_NAUCC/148-257......IDPKLTQGKV.........RTPGNLQNTDNVHG.......................GLPTEDGAVFDLDLTIIL
G8BPF2_TETPH/128-245DTTKTTDSHRDPALLN.........RTPGNLRNTDDVTDS....................HSLLNNKDDIPYDIEMTILI
G3AWR6_CANTC/257-368KLDLTGWNPKWSPSDV.........IFPRINQE..................................NHIKGDLSVTLML
G8BDF2_CANPC/230-371SIDLSTWNKKWEKRDI.........LRPINLLNQSVKDSNSPENNNENGNKTDSHRQLTATTPQPIDQDIYGDLSVQILL
U4LWB0_PYROM/1012-1143AT.TASANGKKAGKAK.........EELPTIP.....................................HGKDLLVDLLI
A0A0D2XM24_FUSO4/263-390STVDLESEDLITVPPP.........SGPMSIP.....................................AQRDLHVNVLI
B8ML52_TALSN/681-800....QASGETGTTAKL.........SIPPVPP.....................................PNKDLHITLLI
G2X0U8_VERDV/859-996ARQEANMATYLDKAPN.........TGPVQVQ.....................................PDRDMQVTILI
Q6FWF5_CANGA/151-280FKGKASHKPSTPAPLR.........RTPVNQTNKDNVVGE.....................IPKDEHGLKPFDLDVDILL
A6R2D3_AJECN/948-1106GPTTIPTAKPKSKPKP.........RTPPVPP.....................................PNKDLHITLLI
G4MPP9_MAGO7/884-1015TSENLPTPDFLDAPLK.........TGPVNVP.....................................PNKDLHVTLLI
E3RQ94_PYRTT/11-136KHSNGAGAPLTLVERP.........SKPVKVF.....................................NSYGAHITILI
M7TUB4_EUTLA/78-206TSADEQHQEVLTSPPP.........TGPVHVP.....................................TGRDLHVTVLI
K9FWH9_PEND2/678-800.APEATTDGASPTKGP.........RLPPIPP.....................................TDKDLHITLLV
C4JXP4_UNCRE/686-823ASDKTGSESEKQKAAR.........RVPPVPP.....................................PDKDLHITLVI
M1W0D1_CLAP2/918-1049QAPSYESEGAITTPPL.........SGPMSIP.....................................PGRDLHVTVLI
Q4X0R9_ASPFU/841-961...TTAEDMGLTGDRP.........RIPPVPP.....................................TDKDLHITLLI
Q757D6_ASHGO/125-244.DAELSGQGAGSGPRR.........RTPANRANPDCVTRGV..................SAAPSVRRGAYHFDVRAQLLM
G3ALD5_SPAPN/284-396SIDLSKWNPNWKSDDF.........IKPLTTTDNEG.............................VDKDIYGDLSVQVLL
S7ZDG8_PENO1/825-943.....PPSPEEDGGKP.........RLPPVPP.....................................EDKDLHVTLLI
G8Y9N4_PICSO/361-472TLDLSSWNHGWKPTDV.........VVPLNAIKD................................DLGIYGDLSVTLLL
G8ZUP8_TORDC/127-233........LADFNGTS.........RTPANLDNQDFVQ........................GAVPPDNAPFDLEMDLLI
U4KX31_PYROM/4-136ATATAAANSNKSANAK.........EELLTIP.....................................HGKDLLVVLLI
K1XET6_MARBU/885-1008VRKIIDIDRPLTKPPA.........TGPMEVP.....................................KNRDCHVTIVI
S3BP50_OPHP1/1056-1205EQYKQLASGVFTVPPK.........SGPMGIP.....................................ADRDLHVTLLI
A7EZ96_SCLS1/865-991DIPYDGPDETFDHPPA.........KGPMPIR.....................................MDHDLHVTVLV
M7UT78_BOTF1/895-1021DTMADGPDEFFEHPPA.........RGPMPVR.....................................NNRDLHVTVLV
S8A8C9_DACHA/912-1042KGRELAVAMMAENGSP.........KMSGAVQ.....................................VGKDLLVKIVI
A3LUK2_PICST/406-530KMDLTQWNPNWTRNDI.........IKPLNINVNADSKAPP..................SEQDSDEHAEIYGDLSVELLL
Q6CF00_YARLI/305-431QEEGDADDTTDGHLED.........EHPVTVGPNSHLVT.......................STSDNEQIYGDCLVTLRA
G9NR46_HYPAI/900-1031EPANATSEGLISTPPV.........AGPMIVP.....................................TERDLHVTVLI
J7RYF5_KAZNA/125-231........HGDPKNVK.........RTPANLKAPDFVVG.......................SFEESKNKKYDVITDLLM
M3K5T1_CANMX/305-423TLDLSTWNKKWTTKSF.........IKPLDNHDEQEDKE.......................NTGVDKDILGDLAVEILL
C5M6I7_CANTT/7-119SIDLSIWNENWTARDL.........IKPLNVMEDKES..........................MGIDKGIYGDLSVEILL
J5JCU2_BEAB2/722-848VPVELTSEGVISAPPK.........SGPMPIP.....................................ANRDLHINVLI
J3PBS3_GAGT3/911-1051TSEALPTPDALTEPLK.........TGPVNVP.....................................PDKDLHVTVLV
H6C4R8_EXODN/575-687...........GSPAP.........KKPMPVD.....................................ENKDLHITLLV
R7Z1H3_CONA1/712-836NNQPDDIPETMLAPLP.........SGPILPP.....................................PNTDLHITILV
E9D8H4_COCPS/887-1025DGKVKSESDDKQKAKH.........RIPPIPP.....................................PDKDLHITLLI
C5DS09_ZYGRC/122-228........LDDVNGTC.........RTPANLHNSDNLL........................GTVPPAGTPFDVEIQLLL
F9X0J4_ZYMTI/93-215EQDTSEATLLTLTERP.........SKPVQVP.....................................EGFDAHITVLV
N1JD71_BLUG1/820-944PPDIIEEGQLLEKPSE.........KGPGHAP.....................................SGCDCHVTILV
G2RGW7_THITE/773-913SQPSQSSLMVLTEPPK.........SGPMQVP.....................................ANRDLHVTLLI
C5GEG5_AJEDR/790-947TTTTTTNPTTKSKSKP.........KIPPLPP.....................................PNKDLHITLLI
G0WAD1_NAUDC/154-276DRSYKHPSSGSNNEFR.........RTPANLENPDNVKG.......................ESYISTSKKFDLDITILY
K0KYE9_WICCF/355-474DNDFENLIEVNQSTEK.........KTSGNLENKSNIDQTV...................NNFRHFVNIIGGDIHVDLII
N1QMF6_SPHMS/679-804EHGSEGETPLSLVTRP.........QRPIKAP.....................................EGYDAHVTLLI
F4NTB3_BATDJ/323-468AAKTSTVSTLKQSHGV.........NSPISVHVDPLIATPD..................VTQSSTNALFPDHDLHVTLRV
E4ZP84_LEPMJ/937-1052.......AEETLTKVP.........AAPVTPP.....................................ADMDLQIEILI
A7TGE0_VANPO/131-252SNNIHNNSNNVNSIAK.........RTPGNLSNNDSVH........................GILPPDDTPFDIELTIIM
S3CY53_GLAL2/873-991PARPIDAEAVLTAPPP.........HGPLIVP.....................................KNHDVDIKILI
D5GDK0_TUBMM/385-515IPSPVRKKGKGAHAAD.........EGPTIQP......................................GKDLIVNLLI
Q59ZF1_CANAL/377-496TIDLSIWNKKWTTKDL.........IKPLQSQLDNNDDG......................TNLGIDKDVYGDLSVEILL
N1Q7Z6_PSEFD/658-783DNDGPEESPLSLDAKP.........RRPVKVP.....................................EGFDAHITVLI
C4XW21_CLAL4/297-409KMDLTNINPSWTPKDV.........VRPLLVHYDED............................GVELL...DLSVTLLL
N4VJJ6_COLOR/830-968ARMEANAATYLDKPPQ.........TGPVSIP.....................................PDRDMHVTVLI
E7Q1V9_YEASB/140-252...IGAPSGGSFHKLR.........RTPVNVTNQDNVTG.......................NLPLLEGTPFDLEVELLF
T0KCQ7_COLGC/297-435ARQEANAATFLDKPPK.........TGPVTVP.....................................VERDMHVTLLI
N1Q2C4_DOTSN/668-792ERDVDDDPPLSLDERP.........ARPVKVP.....................................EDHDAHITIVI
F2PLT8_TRIEC/777-941SDPTSTAQSEAPQPPPTAAEPVEGKQLPPIPP.....................................PDKDLHIKLLI
C5DFG3_LACTC/132-240.......PSSSPQFHA.........RTPANLADPDHVV........................GTIPPAPTAYDLEVDILL

PF03815

VITRN_HUMAN/44-133VAGQSGYKGS..Y....SNGVQS...LSLPRW..RESF
Q4WUJ0_ASPFU/168-298TGEQSNFLSS..E....RNGISSIAFPSNFPL....SF
CRLD2_MOUSE/387-486VDKKKSYVGS..L....RNGVQS...ESLNTP..QNGN
CRLD2_MOUSE/286-377NGMVPFFVKS..Q....KNGMES...LSKYKP..SSSF
COCH_HUMAN/32-121LPGRENYSSV..D....ANGIQS...QMLSRW..SASF
Q8IK83_PLAF7/754-852ESGMDHYVGS..I....NNNIES...ISLNKN..EKGL
Q8IM24_PLAF7/1171-1264GTGQEEFKGS..T....QNNVES...FSSNNH..SRSI
CRLD1_MOUSE/293-384QGRKHYFIKS..N....RNGIQT...IGKYHS..ANSF
Q4Y3E4_PLACH/7-99GKGQQEFKPS..T....QNNVQS...YIAEKQ..DRSF
Q4YW57_PLABA/727-825LNALGEYEGV..Y....QNGIIS...DSYIND..SQEV
Q2UA88_ASPOR/147-275EGATHSFPAS..K....QNGISSVGFPSTFPK....SF
Q8IM24_PLAF7/672-769AHTHNNFIGT..K....RNNIES...HDFKGT..SKSF
Q4YUE0_PLABA/1079-1193VEGLTEYKSS..R...GHYGIVS..KPEKQSQ..LRSF
Q8IKS0_PLAF7/726-824INALNEYGGF..F....QNGIIS...ESFFNN..TQEV
Q2GQN4_CHAGB/129-252VGEYYQYFSS..S....QHNIESIPFDSYFPL....SF
Q5AU59_EMENI/149-276EGAAHSFHAS..K....RNGIKSIGFPSTFPK....SF
CRLD2_XENTR/291-382KGRLQFFVKS..T....RNSVES...ISKFKP..ANSF
Q4U8P9_THEAN/1093-1187EGERNTFDSN..E....SNGILS...QSSGHY..LKSF
Q4N1E8_THEPA/188-285VQSMAKYFGG..T...GYNGLKS...EDYEPP..ADKN
Q4Y8D6_PLACH/571-667LTNITQSFST..TTDITRNGVKA...IITDNK..NKDS
Q8IM24_PLAF7/277-384ASELNHYYTIKEK...IFNELEA...LDFSAKADEKNF
Q4XZL5_PLACH/752-850ESGLDYYKGS..I....SNNIES...ISLNKG..GNEA
Q4XHB8_PLACH/31-138TKGLNYYYAMDFR....YFELLSDIGQNF.....LKYY
Q28NX7_JANSC/137-231LGEQPAFTGS..T....RNGVTT...ADYTAW..PRSY
Q4Y340_PLACH/467-582EVNGSNFIGK..L....QNNVLS...MNKNVE..DQNK
Q28NX7_JANSC/19-119VAGLDRYEGT..S....QNGVTT...LDYGSW..NSSF
Q8IM24_PLAF7/1059-1160VEGLLEYKSS..R...GHFGILS..KSEKQSQ..LRSF
Q4N5G4_THEPA/751-847ENGRKYYDGD..K....QNGIQS...YFYNKT..WHGL
Q4N2Y3_THEPA/528-626VSSPGELDGF..F....QNGINS...ASVSTT..LGES
CRLD2_XENTR/392-491VEKKKHYFGS..N....KNGIQS...DSIQNH..KEGQ
Q4N1E8_THEPA/573-671AYPQEHFYGT..S....MNGVESLSLSRSGDD..SREK
Q4XHC4_PLACH/3-100THSRNKFIGT..K....RNNVES...KEFNGE..SKSF
A0LH15_SYNFM/30-122YPGRAQYAGS..T....RYGVTS...SSWGSY..ELSF
COCH_CHICK/28-117LPGQENYPAV..H....ANGIQS...QVLSRW..ASSF
CRLD1_MOUSE/394-492VDKRKMYTAS..F....QNGIFS...ESLQNP..TGGK
A1C540_ASPCL/149-277EGAAHTFPAS..K....QNGIQSVGFPSTFPK....SF
B3DFV8_DANRE/31-120LQGRTNYLSS..Y....AHGVQS...QSLSQW..SASF
C8VAW3_EMENI/156-277TGEQKNFPAV..D....RNEISS...VDFP........
E1C6X0_CHICK/39-126VAGHAGYRGS..F....SNGVRS...LSLPRW..RESF
F1R7U9_DANRE/303-391VDKRKQHKGS..Y....QNGISS...ESLQNP......
H3CRW8_TETNG/411-504MDMKKHYTAS..Y....QNGIFS...ETFT........
H3DGW2_TETNG/36-123MAGQNIYKGS..N....SNGVRS...LSLPKW..RESF
Q5CYM9_CRYPI/740-831EGPKNSYEGS..T....KNEIES...EKLS........
V4ZDR3_TOXGO/1033-1123HDGMPSYAAS..R...GHYGVLS...IATNT.......
V5B813_TOXGO/278-371VGELPEYTGS..TL..YPTGTVS...TSFRS.......

PF08642

C1H5M7_PARBA/938-1099LPTLERYDST--V----MYGLKS------RAW------
C6HJS8_AJECH/405-563LPTLERYDST--V----MYGLKS------RAW------
E9DVW1_METAQ/816-946LPRLVKYSGS--T----RFGISS------REF------
Q6BS67_DEBHA/388-499LPSLPDYHGY--Y----ANGINS------RSW------
H2AYB5_KAZAF/162-271LDCLQTYVGT--T----RHGVKS------RDW------
I2GWB9_TETBL/171-292LPSLENYYSI--R----RNNITS------RNW------
V5INS1_NEUCR/835-967LPKLEKYAST--T----RFGIKS------REW------
G1XFK4_ARTOA/516-644CGNLGEYRSV--V----KYGLKS------RGW------
G2QNU5_THIHA/780-921LPRLERYAST--T----RFGIKS------REF------
E3QI42_COLGM/896-1035LPRLEKYSST--T----RFGLQS------REY------
G0RPD9_HYPJQ/908-1039LPRLVKYASS--T----RYGITS------REF------
G8JRH1_ERECY/140-262FPPLRRYPSL--E----RNGFVS------REW------
U1I1E0_ENDPU/1189-1302LPQLEKYGES--A----RYGLKS------RTW------
S2JEL2_MUCC1/530-651LPTLQSYASS--I----RHRLKS------REW------
K2SGZ9_MACPH/711-828LPCLTEYKGS--V----CYGIKS------H..------
Q6CWM7_KLULA/161-283LPPLQGYASS--T----RNNITS------REW------
T4ZWG0_OPHSC/258-385LPKLAKYAAT--T----RFGIAS------REF------
V5G6M3_BYSSN/291-408LPRLERYDGS--V----LFGLKS------RGW------
L8G4U8_PSED2/868-994LPALEKYSST--T----RWGIRS------RAW------
Q2GN38_CHAGB/751-890LPRLQKYASS--T----RFGIQS------REF------
G0RYX0_CHATD/883-1017LPRLEKYAST--T----RFGIKS------REF------
G0V5S2_NAUCC/148-257LQNLQYYPST--S----RFGLSS------RKW------
G8BPF2_TETPH/128-245LPCLRVYSSV--K----RFGLTS------RQW------
G3AWR6_CANTC/257-368LPTLSEYKSV--Y----AHGINT------RTW------
G8BDF2_CANPC/230-371LPSLPSYYGF--F----ANGINS------RSW------
U4LWB0_PYROM/1012-1143LPRLERYTGT--V----RNALKS------RSW------
A0A0D2XM24_FUSO4/263-390LPRLVKYYSS--T----RHGISS------REF------
B8ML52_TALSN/681-800LPRLERYEST--L----MFGLKS------RAW------
G2X0U8_VERDV/859-996LPRLEKYSST--V----RFGVKS------REW------
Q6FWF5_CANGA/151-280LPRLQQYFSV--K----RYGITS------RHW------
A6R2D3_AJECN/948-1106LPTLERYDST--V----MYGLKS------RAW------
G4MPP9_MAGO7/884-1015LPKLQMYAST--V----RFGIKS------RQW------
E3RQ94_PYRTT/11-136LPPLESYASI--N----QNHVTS------REW------
M7TUB4_EUTLA/78-206LPGLEKYSGS--A----RYGISS------REW------
K9FWH9_PEND2/678-800LPRVAQYDSA--L----MFGLKS------RKW------
C4JXP4_UNCRE/686-823LPPLEQYESS--V----MFGLKS------RAW------
M1W0D1_CLAP2/918-1049LPRLTRYTSC--T----RFGISS------REF------
Q4X0R9_ASPFU/841-961LPKLERYESS--V----LFGLKS------RSW------
Q757D6_ASHGO/125-244LPPLQRYASA--E----RFGLQS------REW------
G3ALD5_SPAPN/284-396LPGLSKYVGY--T----ANKINS------RSW------
S7ZDG8_PENO1/825-943LPRVDRYEST--V----MFGLKS------REW------
G8Y9N4_PICSO/361-472LPGLSNYTGF--Y----ANRFNS------RSW------
G8ZUP8_TORDC/127-233LPRLEQYASV--E----QYGVLS------RSW------
U4KX31_PYROM/4-136IPRLERYTGT--V----RNALKS------RSW------
K1XET6_MARBU/885-1008LPALENYGSI--T----RFGIKS------REW------
S3BP50_OPHP1/1056-1205LPTLLKYSAT--T----RFGIRS------REW------
A7EZ96_SCLS1/865-991LDCLDKYSSK--V----RFGIRS------REW------
M7UT78_BOTF1/895-1021LGCLDKYFST--I----RYGIKS------REW------
S8A8C9_DACHA/912-1042VGNLGKYSSV--V----RYGLKS------RSW------
A3LUK2_PICST/406-530LPPLPEYHGF--Y----ANGINS------RSW------
Q6CF00_YARLI/305-431LPKLTEYTGC--Y----RNGINS------RSW------
G9NR46_HYPAI/900-1031LPRLVKYGAS--T----RYGITS------REF------
J7RYF5_KAZNA/125-231LDTLESYHGC--N----RYGVTS------RDW------
M3K5T1_CANMX/305-423LPNLPNYYGF--Y----QNGIYS------RSW------
C5M6I7_CANTT/7-119LPNLPKYYGF--F----QNGINS------RSW------
J5JCU2_BEAB2/722-848VPRLVKYAGC--T----RFGLTS------REF------
J3PBS3_GAGT3/911-1051LPKLQHYAST--V----RYGIKS------REW------
H6C4R8_EXODN/575-687LPQLERYVDS--V----RFGIKS------RSW------
R7Z1H3_CONA1/712-836LPRLEKYAAS--T----RFGLRS------RAW------
E9D8H4_COCPS/887-1025LPPLERYESS--V----MYGLKS------RPW------
C5DS09_ZYGRC/122-228LPPLQKYTSL--R----RYGITS------RQW------
F9X0J4_ZYMTI/93-215LPPLEKYAAT--S----QHHIWS------RDW------
N1JD71_BLUG1/820-944LPLLERYASS--T----RFGIKS------REW------
G2RGW7_THITE/773-913LPRLEKYAST--T----RFGIKS------REF------
C5GEG5_AJEDR/790-947LPTLERYDST--V----MFGLKS------RPW------
G0WAD1_NAUDC/154-276LQPLRYYPPM--Y----RNGIWS------RSW------
K0KYE9_WICCF/355-474LPKLNHYKGH--Y----NNGINS------RDW------
N1QMF6_SPHMS/679-804LPPLEFYAAT--S----QHHLAS------REW------
F4NTB3_BATDJ/323-468LPKLVKYSGC--T----RYDLDS------RGW------
E4ZP84_LEPMJ/937-1052LPQLQKYTGS--V----EYGISS------RK.------
A7TGE0_VANPO/131-252LPCLQYYPSV--S----QYGINS------RQW------
S3CY53_GLAL2/873-991LPALVEYKGC--V----RFGIRS------REW------
D5GDK0_TUBMM/385-515LPTLQKYTGS--V----RNALKS------RSW------
Q59ZF1_CANAL/377-496LPNLPKYYGF--Y----QNGINS------RSW------
N1Q7Z6_PSEFD/658-783LPALESYGAT--N----RHHVWS------REW------
C4XW21_CLAL4/297-409LPPLKRYHGF--Y----RNGINS------RSW------
N4VJJ6_COLOR/830-968LPRLEKYGST--T----RFGIQS------REF------
E7Q1V9_YEASB/140-252LPTLQKYPSV--K----RFDITS------REW------
T0KCQ7_COLGC/297-435LPRLEKYSST--T----RFGIQS------REF------
N1Q2C4_DOTSN/668-792LPALEAYAST--H----QHHIWS------RDW------
F2PLT8_TRIEC/777-941LPTLERYESS--V----MYGLKS------RSW------
C5DFG3_LACTC/132-240LPPLQTYSSS--L----KNGLKS------RSW------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window