Sequence alignment for CL0513

PF03815

VITRN_HUMAN/44-133INCDVKAGKII................DPEFIVKCPAG----C..QDPK...YHVYG--TD...................
Q4WUJ0_ASPFU/168-298LSCHSRLWSNATNCG.LDGDACR.PFDDGAFAFRCPAT----C..SAAMLLEPYFIG--PQEINYRTLVIGGELGGGNGS
CRLD2_MOUSE/387-486VDCHATVAQLC.........PFE.KPATHCPRIQCPAR----C..GEEPSYWAPVYG--TN...................
CRLD2_MOUSE/286-377VHCDTKMKDSC..............KGSTCNRYQCPAG----C..LSNK...AKVFG--SL...................
COCH_HUMAN/32-121ITCFTRGLDIR................KEKADVLCPGG----C..PLEE...FSVYG--NI...................
Q8IK83_PLAF7/754-852INCETTGMEDS..........FH.SIVNTNIVVLCPLG----C..DDEKYHDASIYG--SR...................
Q8IM24_PLAF7/1171-1264FTCSTDGQFIL.........NLS...VGEKRTINCPSN----C.NIIKD....KIYG--TN...................
CRLD1_MOUSE/293-384VSCEVRLRDQC..............KGTTCNRYECPAG----C..LDSK...AKVIG--SV...................
Q4Y3E4_PLACH/7-99FTCFTDGSFLN.............FLMGSTKNIICPEN----CHKIDK.....QIYG--TN...................
Q4YW57_PLABA/727-825LNCDTTLKQAI.........EIE.KFVGNEYLFKCPYD----CLKRNTE...ATVIG--GEG..................
Q5CNE9_CRYHO/562-661LSCESRFSDMN........VFKS.SPLLTSILVKCPTS----C.NPENG...GVVIG--SD...................
Q2UA88_ASPOR/147-275LTCRATLWEYGNECG.LNGNDCR.PFTAATIPFRCPAN----C..RDAKLAAPHMVG--NQTYSYKGLVVG..GPQPGSD
Q8IM24_PLAF7/672-769LTCFDKMLSKS.........NLSVATTGDVFLASCPEK----C..DEEV...GIVKG--TF...................
Q5CLR6_CRYHO/1149-1244LTCSDTASFIF.........QLP...VGERELVSCPSN----C.GLESD...AKVYG--MD...................
Q5H993_HUMAN/156-248ITCLERASHYL................KTEYSKFCPAG----C..RDVA...GDISG--NMV..................
Q4YUE0_PLABA/1079-1193LNCSDNLLSER..........FN.GKIGAQFLVSCLED----C..TNSK...YIVKG--SN...................
Q8IKS0_PLAF7/726-824LDCQSSLKETN.........EIE.KMIGNEYLIKCPHD----CLERDIE...ESVIG--GEG..................
Q2GQN4_CHAGB/129-252IDCVDTLWKRNNECG.LDGINCR.PFSNTSFAFRCPAD----C..ASVRVLNPHHVG--NQDVNFRPL.......VVGGG
Q5AU59_EMENI/149-276LSCSTTFWSSGNGCG.LNGNDCR.PFTGEATAFRCPAN----C..RDTKILESYTIG--NETISYRGLVVG..GPQPGSD
Q5CLR6_CRYHO/300-397IDCNTRAIDIV.........PRA.PVTTITFKVKCPVN----C.GSEKF...ATIYG--TG...................
CRLD2_XENTR/291-382IKCATKMRDSC..............KGSTCNRYKCPPG----C..INSK...AKVFG--TL...................
Q4U8P9_THEAN/1093-1187LSCQDTAVFVL.........KMH...IGTRVLLDCPPG----C.KDAKP...YNVFG--TG...................
Q4N1E8_THEPA/188-285VMCNTRAVDIY.........SGT.FVKPFNITVRCPMN----C.NNDPL...MSIEG--SS...................
Q4Y8D6_PLACH/571-667LSCDYTFENIT.............LDNNQTIVARCLPN----C..FNQK...NDIFG--SY...................
Q8IM24_PLAF7/277-384IDCHIRAIDLINTN...NINKLL.QNKVQIFKVRCPQN----C.HNSEF...AIIEG--SS...................
Q4XZL5_PLACH/752-850IDCDTTALDDD..........FN.GIVNTNIVALCPLG----C..DHERFKEFHVYG--SN...................
Q4XHB8_PLACH/31-138IDCHIRANDLIDTTKSLNNSFVL.QNKVHIFKVRCPQN----C.HSSDF...SIIEG--TS...................
Q28NX7_JANSC/137-231ISWSDDVDAIG..........YG.DRVGESVTVTCPAD----R..FGA....GQVWG--TD...................
Q4Y340_PLACH/467-582LNCDDTLNDIP........DVIP.LIYGDKFVVSCPYN----C.IKDVESNNKTVYG--SD...................
Q28NX7_JANSC/19-119LLCATPSLADWSAN...LIARGL.DTPGATGQIECPPN----....GAV...ATVWG--TG...................
Q8IM24_PLAF7/1059-1160LKCQDNLLSEQ..........FN.GKIGSQFLVSCIEN----C..TKSK...YFIKG--TN...................
Q4N5G4_THEPA/751-847LDCSDSLGRSK.........KIF.GSLNTSVIVRCDED----C.SQKDN...LFIYG--TN...................
Q4N2Y3_THEPA/528-626LACNSRITDNS.........DLP.TKPGSKFNVKCPQN----CHETYEN...YEVEG--GKD..................
CRLD2_XENTR/392-491IDCYTTVAEIC..........QFVKPATHCPRFNCPAH----C..KNEPSYWAPVIG--TN...................
Q4N1E8_THEPA/573-671LSCYDTLTSHS.........EFQ.GEFGSFKVASCPMG----C..MDEP...ASIKG--TY...................
Q4XHC4_PLACH/3-100LSCFDKISSKA.........ELSKGNVGDIFLVSCPEK----C..DEDS...GVIKG--TF...................
Q5CLR6_CRYHO/1043-1138IKCDTNLDNAR...........F.SSKANKFRVECPAG----C..SKSR...YPVKG--HK...................
A0LH15_SYNFM/30-122LPDPGTLNQME.........NVA.PGTTMFFNVTGKTT----G.........GSLWG--TD...................
COCH_CHICK/28-117ITCFTRGLDLR................KETEDVLCPAN----C..PLWQ...FYVFG--DG...................
CRLD1_MOUSE/394-492VTCETTVEQLC..........PFHKPASHCPRVYCPRN----C..MQSNPHYARVIG--TR...................
A1C540_ASPCL/149-277LSCATTFWEHGNECG.LNGNDCR.PFSASTVAFRCPAN----C..RDAKLLSPHTVG--NHTFSYQRLVVG..GPQPGSS
Q5CLR6_CRYHO/681-774FDCNDSPVSIK.............GAVGTGAIIACPSK----C..SKAS...SHIKG--SY...................
B3DFV8_DANRE/31-120ISCGTRAVDLS................DTHLLVLCPAN----C..SLWS...LSVFG--SG...................
C8VAW3_EMENI/156-277LSCSSRLWSNATNCG.LDGDYCR.PFDGETFAFRCPAG----C..SGFMVLEPYFVG--PKEINYQHLVIG..GAAAESQ
E1C6X0_CHICK/39-126..CDVKAGKII................NPEFIAKCPPG----C..QDVK...YRVYG--TD...................
F1R7U9_DANRE/303-391VACDTRLRDQC..............KGTTCNRYECPPG----C..FYNY...GKVIG--SG...................
H3CRW8_TETNG/411-504ITCETTAAQLC.........SYQ.KPAKHCPRLYCQRN----C..LEENPHLSRVIG--TR...................
H3DGW2_TETNG/36-123..CDVRAGKIN................LPEFIAKCPAH----C..KESK...QQVYG--TG...................
Q5CYM9_CRYPI/740-831IDCDTVAYKNP.........IFE.GPINTNIIVQCPPG----C..AEYK...TKVYG--SD...................
V4ZDR3_TOXGO/1033-1123LRCEDTLLRPE..........FS.GVTGHQILVSCPAD----C..AHST...GPLHG--CK...................
V5B813_TOXGO/278-371VECHTRALELY.........SRI.PENIGIFKVRCPMN----C.QASTF...ASVDG--SS...................

PF08642

C6HJS8_AJECH/405-563------------------------TIRVPRFRIDASHR........EEICARRALWG..TG-------------------
E9DVW1_METAQ/816-946------------------------TVKVPLIHLSPVAR........EEITARAYLWG..TD-------------------
Q6BS67_DEBHA/388-499------------------------EIKIPYKFIKLFKE....DLDDDNIPLKRQIWGGASA-------------------
H2AYB5_KAZAF/162-271------------------------TIRVKYVDILNFMS......GNNLRLQNSEVWG..TD-------------------
I2GWB9_TETBL/171-292------------------------TIKINYEDYISSMN...RDDINSPRSNNNEIWG..CD-------------------
V5INS1_NEUCR/835-967------------------------TVKISKTHLTPEAR........EEITSRRAVWG..TD-------------------
G1XFK4_ARTOA/516-644------------------------..RIPWYCLSLEER........ERVCKKRLLWG..TE-------------------
G2QNU5_THIHA/780-921------------------------TMKIGKEHLVPAAR........EEITSRRALWG..TD-------------------
E3QI42_COLGM/896-1035------------------------TVKVPKVHLTPVAR........EEITARRALWG..TD-------------------
G0RPD9_HYPJQ/908-1039------------------------TVKVSRVHLSPIAR........EEITARAFLWG..TD-------------------
G8JRH1_ERECY/140-262------------------------TVVIKSEDLLHARE.....KNGNIRIQNRELWG..VD-------------------
U1I1E0_ENDPU/1189-1302------------------------TIRVSRTWLHGPER........EAICSERFLWG..SG-------------------
S2JEL2_MUCC1/530-651------------------------EIRVPARFLTFE..........NVKVKKRALWG..TD-------------------
K2SGZ9_MACPH/711-828------------------------TVRVPRYYLSERQR........DVIVVSRQLWG..SE-------------------
Q6CWM7_KLULA/161-283------------------------TIQIDSIYLQQVAR......SENIRYQNREIWG..TD-------------------
T4ZWG0_OPHSC/258-385------------------------TVKVPRVHLSPPAR........EEITARAYLWG..TD-------------------
V5G6M3_BYSSN/291-408------------------------TVRVPRFRIDASHR........EEICARRALWG..TG-------------------
L8G4U8_PSED2/868-994------------------------TVRVPRVYLEPPSR........EEITARRSVWG..TD-------------------
Q2GN38_CHAGB/751-890------------------------TMKIGKEHLIPAAR........EEITSRRALWG..TD-------------------
G0RYX0_CHATD/883-1017------------------------TVKIGKQHLTPEAR........EEITARRALWG..TD-------------------
G0V5S2_NAUCC/148-257------------------------KIHIRYEQLQNAYN.....NISAPRTTNNELWG..CD-------------------
G8BPF2_TETPH/128-245------------------------TIHILYEDLTNKFN.......MNPRLDNNELWG..CQ-------------------
G3AWR6_CANTC/257-368------------------------EVKIPSRFVKSFVQ....GLETGDVANKREIWGGKHG-------------------
G8BDF2_CANPC/230-371------------------------DVKIPFRYIVEFKQ....DF..YNEIVSRELWGGASG-------------------
U4LWB0_PYROM/1012-1143------------------------QVRIPKRFLSDAHR........KEVARRRCVWG..TE-------------------
J9MQ22_FUSO4/263-390------------------------TVKVARIHLSSIAR........EEITSRGYLWG..TD-------------------
B8ML52_TALSN/681-800------------------------TIRVPRFRIDPNHR........EEICARRAVWG..TG-------------------
G2X0U8_VERDV/859-996------------------------TVKVSRTHLTKEAR........EEITYRRALWG..TD-------------------
Q6FWF5_CANGA/151-280------------------------TISIKYEDLMKSFN....DSGECPRTFNNEIWG..CD-------------------
A6R2D3_AJECN/948-1106------------------------TIRVPRFRIDASHR........EEICARRALWG..TG-------------------
G4MPP9_MAGO7/884-1015------------------------TMKVSKAHLLPEAR........EEITARRAVWG..TD-------------------
E3RQ94_PYRTT/11-136------------------------TVRIPRYYFTCGEEVNEDNHSLEGICRRRQLWG..TE-------------------
M7TUB4_EUTLA/78-206------------------------TVKVPRAHLTSAAR........EEITSRRAIWG..TD-------------------
K9FWH9_PEND2/678-800------------------------TVRVPRFRINQSHR........EEICARRALWG..TG-------------------
C4JXP4_UNCRE/686-823------------------------TIRVPRFRIDGPRR........EEICARRALWG..TG-------------------
M1W0D1_CLAP2/918-1049------------------------TVKVPHVHLSTVAR........EEITARSYVWG..TD-------------------
Q4X0R9_ASPFU/841-961------------------------TVRVPRFRIDAGRR........EEICARRALWG..TG-------------------
Q757D6_ASHGO/125-244------------------------TVELSAEDLESALA.....TGENARVRNRELWG..VD-------------------
G3ALD5_SPAPN/284-396------------------------EVKIPFRFIVQLKH....DF..INEIYVRDVWGGASG-------------------
S7ZDG8_PENO1/825-943------------------------TVRVPRFRVDAARR........EEICARRALWG..TG-------------------
G8Y9N4_PICSO/361-472------------------------EVKIPYKHVKLFKE....QLEIGLVPESRAVWGGVSG-------------------
G8ZUP8_TORDC/127-233------------------------TIRVFYEDLRDSFN.....HSNAPRARNNEIWG..CQ-------------------
U4KX31_PYROM/4-136------------------------SVHIPKRFLSDAHR........KDVARRRCVWG..TE-------------------
K1XET6_MARBU/885-1008------------------------TVKVPRIHLDHISR........EEITRRKAVWG..TD-------------------
S3BP50_OPHP1/1056-1205------------------------TVKISKVFLEAAAR........EEITYRRALWG..SD-------------------
A7EZ96_SCLS1/865-991------------------------TIKISRAHLRPESR........EEITYRKNLWG..TD-------------------
M7UT78_BOTF1/895-1021------------------------TIKISRVHLQPPSR........AQITARKNLWG..TD-------------------
S8A8C9_DACHA/912-1042------------------------..RVPWYCLNLEER........ERVCRKRLLWG..AE-------------------
A3LUK2_PICST/406-530------------------------EIKIPFHFIDKFIH....EFE.SSVIIKRELWGGASG-------------------
Q6CF00_YARLI/305-431------------------------QVLIPRKHLRKESN.........ILVQRREIWG..TD-------------------
G9NR46_HYPAI/900-1031------------------------TVKVSRIHLSSIAR........EEITSRAFLWG..TD-------------------
J7RYF5_KAZNA/125-231------------------------SIRVPCEEIDKLLQ......NKSSRLENLELWG..SD-------------------
M3K5T1_CANMX/305-423------------------------EIKIPFRYIIEFKQ....DI..GNELFTRDLWGGASG-------------------
C5M6I7_CANTT/7-119------------------------...FPFRHIIEFKQ....DV..GNDLITRELWGGASG-------------------
J5JCU2_BEAB2/722-848------------------------TIKVPRVHLTPVAR........EEITARAFVWG..TD-------------------
J3PBS3_GAGT3/911-1051------------------------TVKISKAHLNSMAR........EEITSRRALWG..TD-------------------
H6C4R8_EXODN/575-687------------------------TVRVPRIWLRERER........FLICQERYLWG..SG-------------------
R7Z1H3_CONA1/712-836------------------------TIRVPRYYLQPDQR........EEICLRRNVWG..TE-------------------
E9D8H4_COCPS/887-1025------------------------TIRVPRFRIDAPRR........EEICARRALWG..TG-------------------
C5DS09_ZYGRC/122-228------------------------EVKISYEDLQSSVQ.....VKDSPRTVNNEIWG..TD-------------------
F9X0J4_MYCGM/93-215------------------------TVRVPRYFLAPSEA...GNSSLEEICKRRQLWG..TE-------------------
N1JD71_BLUG1/820-944------------------------TVRVPRIYLEDAVR........EEVTHRKALWG..TD-------------------
G2RGW7_THITE/773-913------------------------TMKIGKEHLTPAAR........EEITSRRALWG..TD-------------------
C5GEG5_AJEDR/790-947------------------------TIRVPRFRIDASHR........EEICARRALWG..TG-------------------
G0WAD1_NAUDC/154-276------------------------TVHVLYEQLYDLFN.....ESTSPRVNNNEIWG..SD-------------------
K0KYE9_WICCF/355-474------------------------TIRIPSYQINNLQN........NHNYLNRSIWG..SD-------------------
N1QMF6_SPHMS/679-804------------------------TIRVPRYYLTSGEGGAAMNHSLEEICKRRQIWG..TE-------------------
F4NTB3_BATDJ/323-468------------------------QVRIPSEFLTYRG.........NIAVRKSALWG..TD-------------------
E4ZP84_LEPMJ/937-1052------------------------TIRVPRFYLKPRQR........QHIVLERHLWG..AR-------------------
A7TGE0_VANPO/131-252------------------------TIKISYEDLCLNEN....SIQERPRFLNNEIWG..CQ-------------------
S3CY53_GLAL2/873-991------------------------TIKVSRAYLSDVSR........EEITRRRAVYG..TD-------------------
D5GDK0_TUBMM/385-515------------------------QVRIPRRFLSAEQR........RDVHRRRCVWG..TE-------------------
Q59ZF1_CANAL/377-496------------------------EIKIPFRHIILFKQ....DI..ANELITRELWGGASG-------------------
N1Q7Z6_MYCFI/658-783------------------------TVRVPRYYLSSSLARAKESYSFEEICKRRQIWG..TD-------------------
C4XW21_CLAL4/297-409------------------------DVKIPYKFIKLHIN....ALAAGKVQRRRELWGGSAD-------------------
N4VJJ6_COLOR/830-968------------------------TVKVPKVHLSGSSR........EEITSRRALWG..TD-------------------
E7Q1V9_YEASB/140-252------------------------TLKITYEDIQASFN.....NIESPRTRNNEIWG..CD-------------------
C0SC36_PARBP/719-879------------------------TIRVPRFRIDASHR........EEICARRALWG..TG-------------------
T0KCQ7_COLGC/297-435------------------------TVKVPKVHLTPSAR........EEITARRAVWG..TE-------------------
C1H5M7_PARBA/800-961------------------------TIRVPRFRIDASHR........EEICARRALWG..TG-------------------
N1Q2C4_MYCP1/668-792------------------------TVRVPRYYLTRSET.NRDEINLEAICKRRQLWG..TD-------------------
F2PLT8_TRIEC/777-941------------------------TIRVPRFRIDAIHR........EEICARRALWG..TG-------------------
C5DFG3_LACTC/132-240------------------------SIEVSYEDIAAMSQ....PHSSNLHVTNNELWG..SD-------------------

PF03815

VITRN_HUMAN/44-133...VYASYSSVCGAAVHSGVL.................------------------------------------------
Q4WUJ0_ASPFU/168-298DYGVYRGDSAICPAALHAGLI................S------------------------------------------
CRLD2_MOUSE/387-486...IYADTSSICKAAVHAGVI................V------------------------------------------
CRLD2_MOUSE/286-377...FYESSSSICRAAIHYGVI.................------------------------------------------
COCH_HUMAN/32-121...VYASVSSICGAAVHRGVI.................------------------------------------------
Q8IK83_PLAF7/754-852..GTYSDNSSICRAAIHSDII.................------------------------------------------
Q8IM24_PLAF7/1171-1264...IYSPTSVLCKAAIHSGAL.................------------------------------------------
CRLD1_MOUSE/293-384...HYEMQSSICRAAIHYGII.................------------------------------------------
Q4Y3E4_PLACH/7-99...TYSPLSSVCKAAIHAGVI.................------------------------------------------
Q4YW57_PLABA/727-825..NIYSEDSSICLSSIHAGVY.................------------------------------------------
Q5CNE9_CRYHO/562-661...VYRDDSSICLAAMHANTL.................------------------------------------------
Q2UA88_ASPOR/147-275DTPVYRADSFICQAAIHAGVI................T------------------------------------------
Q8IM24_PLAF7/672-769...LYTYDSPICKSAIHSGVL................P------------------------------------------
Q5CLR6_CRYHO/1149-1244...IYSPISSICRAAIHASKL................S------------------------------------------
Q5H993_HUMAN/156-248..DGYRDTSLLCKAAIHAGII................A------------------------------------------
Q4YUE0_PLABA/1079-1193..NYYTPDTSICKAVMHSGIMHKTRNTHKSNEHDEDNN------------------------------------------
Q8IKS0_PLAF7/726-824..NIYSEDSSICLSAIHAGIY.................------------------------------------------
Q2GQN4_CHAGB/129-252GNGPYRGDSFLCGAAIHAGVI................R------------------------------------------
Q5AU59_EMENI/149-276EPGVYRADSFICQAAIHAGVI.................------------------------------------------
Q5CLR6_CRYHO/300-397...IHAASSSICKSAVFDNIL.................------------------------------------------
CRLD2_XENTR/291-382...FYDSMSSICRAAIHYGVI.................------------------------------------------
Q4U8P9_THEAN/1093-1187...VYSPTSSLCQSAIHSGKL.................------------------------------------------
Q4N1E8_THEPA/188-285...LHPSSTSICGAAIYDGAT.................------------------------------------------
Q4Y8D6_PLACH/571-667...IYAPHSPICKSAIHSGII.................------------------------------------------
Q8IM24_PLAF7/277-384...IHPSSTSICAAAIHDGSI.................------------------------------------------
Q4XZL5_PLACH/752-850..GVYSDSSSICRASIHAGVI.................------------------------------------------
Q4XHB8_PLACH/31-138...IHPASTSICAAAIYDGSL.................------------------------------------------
Q28NX7_JANSC/137-231...VYSSDSPICNAAVHRGLM................I------------------------------------------
Q4Y340_PLACH/467-582...LYSLDSPICKAAVHSGVCLKNGNNT..DVNTLNNY------------------------------------------
Q28NX7_JANSC/19-119...TYTSDSSICTAALHYGWI................T------------------------------------------
Q8IM24_PLAF7/1059-1160..NYYTPDSSICKAAIHAGIYKP.............NM------------------------------------------
Q4N5G4_THEPA/751-847..GLYSDHSSICLAAIHAGII.................------------------------------------------
Q4N2Y3_THEPA/528-626..GLYSFNSSVCLSAVHAGEY.................------------------------------------------
CRLD2_XENTR/392-491...IYADSSSICKTAVHAGVI................K------------------------------------------
Q4N1E8_THEPA/573-671...VYTRDSSICKAAIHSGVL.................------------------------------------------
Q4XHC4_PLACH/3-100...VYTFDSYICKAAIHAGVL................S------------------------------------------
Q5CLR6_CRYHO/1043-1138...VYSPKSSICQAAMHMGII.................------------------------------------------
A0LH15_SYNFM/30-122...YYTTDSSLAMAAVHSGAI................R------------------------------------------
COCH_CHICK/28-117...IYASLSSVCGAAIHRGVI.................------------------------------------------
CRLD1_MOUSE/394-492...IYSDLSSICRAAVHAGVV.................------------------------------------------
A1C540_ASPCL/149-277EPGVYRADSFVCQAAIHAGVI................T------------------------------------------
Q5CLR6_CRYHO/681-774...IYSDDTPVCKAAIHAGII................T------------------------------------------
B3DFV8_DANRE/31-120...VYASISSICGAAIHRGII.................------------------------------------------
C8VAW3_EMENI/156-277PDSVYRGDSSICQAAMHAGLL................E------------------------------------------
E1C6X0_CHICK/39-126...IYASFSSVCSAAIHSGAI.................------------------------------------------
F1R7U9_DANRE/303-391...HYDMNSSICRAAIHAGVI................Q------------------------------------------
H3CRW8_TETNG/411-504...IYSDKSSICRAAIHAGVI................R------------------------------------------
H3DGW2_TETNG/36-123...VFASISSICNAAIHSGVI.................------------------------------------------
Q5CYM9_CRYPI/740-831..GVYSEKSSICKAALQVGVI................S------------------------------------------
V4ZDR3_TOXGO/1033-1123...IYSADSSICKAALHMGAI.................------------------------------------------
V5B813_TOXGO/278-371...IHPMASSICAAAIHDGVL.................------------------------------------------

PF08642

C6HJS8_AJECH/405-563---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKEEHQHAPNGKNGTTSTFHKVSSLDESPTKGPTT...ATPKP
E9DVW1_METAQ/816-946---VYTDDSDVVAACIHGGWIKGEWTDDVDTAMLDLEQGTAEGGK...............................RKTK
Q6BS67_DEBHA/388-499---VYTDDSDILLVLAHLGLF...........................................................
H2AYB5_KAZAF/162-271---IYTDDSDVLLMLKHVGFF...........................................................
I2GWB9_TETBL/171-292---IYTDDTDPILALIHCGFT...........................................................
V5INS1_NEUCR/835-967---IYTDDSDVIAACIHAGWFRGEWPEDVDTAFLGLDEAVSTASDI.............................LTSMR
G1XFK4_ARTOA/516-644---VYTDDSNILAVLVHLGYL.........PAVRDGAEVVEYASAH....................DAVLARLSAPKRRG
G2QNU5_THIHA/780-921---VYTDDSDVIAACIHAGWIRGEWPEDVDVSMLGLDEGYSVSDVG....................DLLHASGTDGKGSR
E3QI42_COLGM/896-1035---VYTDDSDVVAACIHGGWIRGEWGDDVDTSLLDLDRGLSAPEKE......................FPASKRRNKEKE
G0RPD9_HYPJQ/908-1039---VYTDDSDVVAACIHGGWIRGEWTEDVDTSLLDLDQGSNGETKR..............................RKAK
G8JRH1_ERECY/140-262---IYSCDSDPLLALVHCGAI...........................................................
U1I1E0_ENDPU/1189-1302---IYTDDSDPVAAAIHSGFIRGAWNDEVDTDLLERVSREQNPSID..................................
S2JEL2_MUCC1/530-651---IYTDDSDIVAMAIHSGKY......................................QPHFIEPTIESTDPFALAVAG
K2SGZ9_MACPH/711-828---IYTHDSDVVAAAVHSGWIRGAWPEDVDVNMLDPRINGGSEPLS..................................
Q6CWM7_KLULA/161-283---IYTDDSDIILVLQHCGVL......................................................PFSEP
T4ZWG0_OPHSC/258-385---VYTDDSDVMAACIHGGWVKGEWAEDFDSATFDLDDGGPR..................................RKPK
V5G6M3_BYSSN/291-408---VYTDDSDPVAAAIHSGFIRGEWGDDVDVEMLDLEIKDTYQHAP..................................
L8G4U8_PSED2/868-994---IYTDDTDVVAACIHGGWIRGEWSDDVDISVLDLVIDDSAEDNG..................................
Q2GN38_CHAGB/751-890---VYTDDSDVVAACIHAGWIRGEWPDDVDVSLLGLDEGYSVSDVR......................GLLNNHANGSKS
G0RYX0_CHATD/883-1017---VYTDDSDVIACCIHAGWIRGEWPEDVDVSMLGLDEGYAMSDVR...........................GINILKN
G0V5S2_NAUCC/148-257---IYTDDSDPILALRHCGFQ...........................................................
G8BPF2_TETPH/128-245---IYTDDSDPILVLKHSGVL...........................................................
G3AWR6_CANTC/257-368---IYTDDSNILTMLAHLGFF...........................................................
G8BDF2_CANPC/230-371---VYTDDSDILQVLLHMGFF...........................................................
U4LWB0_PYROM/1012-1143---VYTDDSDTLGVLMHTGKLPAWLPEDVE.........SPEEFVK....................STERKVIKKGVLSA
J9MQ22_FUSO4/263-390---VYTDDSDVVAACIHSGWIKGEWAEDVDNSVLDIDQGVAD..................................KRRK
B8ML52_TALSN/681-800---VYTDDSDPVAAAIHSGYIRGAWGEDVDISMLDLEIKSDYHHAP..................................
G2X0U8_VERDV/859-996---VYTDDTDVVAACIHGGWIRGEWS.NVDVNMLDLDRGILFQDKE.......................PIPNKRRKDKE
Q6FWF5_CANGA/151-280---VYTDDTDPILALRHCGFT....................................................CLDPPPL
A6R2D3_AJECN/948-1106---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKEEHQHAPNGKNGTTSTFHKVSSLDKSPTKGPTT...AAPKP
G4MPP9_MAGO7/884-1015---VYTDDSDVVAACIHGGWFRGEWPEDVDVDMLGLYPEEPPAAGR..............................GKKQ
E3RQ94_PYRTT/11-136---IFTDDSDVVTAAVHSGWLKCKFGE............................................FNSDLRKVC
M7TUB4_EUTLA/78-206---VYTDDSDVVAACIHAGWIRGEWGENVE.DLLDLHKPASSKTQQ................................NR
K9FWH9_PEND2/678-800---VYTDDSDPVAAAIHSGFIRGAWGDDVDEAMLDLEIKDTYQHAP..................................
C4JXP4_UNCRE/686-823---VYTDDSDPVAAAIHSGFIRGEWGEDVDISMLDLEIKEQHQHAPRTANGDTDSTPK......................
M1W0D1_CLAP2/918-1049---VHTDDSDVVAACIHGGWIRGEWTDYVDPDMLDLDKDADGKRAA..............................KSQN
Q4X0R9_ASPFU/841-961---IYTDDSDPVAAAMHSGFFRGAWSEEIDVDMLDLEIRDAYQHAP..................................
Q757D6_ASHGO/125-244---VYTCDSDPLLVLVHCGVL...........................................................
G3ALD5_SPAPN/284-396---IYTDDSDILQVLVHMGLF...........................................................
S7ZDG8_PENO1/825-943---VYTDDSDPVAAAIHSGYIRGAWGDDVDESMLDLEIKDTYQHAP..................................
G8Y9N4_PICSO/361-472---VYTDDSDVLLALAHSGLF...........................................................
G8ZUP8_TORDC/127-233---VYTDDSEPLLVLRHCGLS...........................................................
U4KX31_PYROM/4-136---VYTDDSDTLGVLMHTGKLPTWLSEDVE.........SPEQFVK....................STERKIIKDGVLSA
K1XET6_MARBU/885-1008---IYTDDSDIIAACIHQGWFRGAWSEDVDTKYLGLEIDDPNPTGE..................................
S3BP50_OPHP1/1056-1205---IYTDDSDVIAACIHGGWIRGEWPEDIDVSLLGLTEQAEARDGT............TKDKDSGPGSRKRAAAAAAASL
A7EZ96_SCLS1/865-991---VYSDDSDIIAACIHQGWICGKWAKDVDVKLLNLYPSDEGVSVE..................................
M7UT78_BOTF1/895-1021---VYSDDSDIIAALIHQGWICGKWSDDIDVKLLDLYQADEGISVE..................................
S8A8C9_DACHA/912-1042---VYSDDSNILAVLVHLGYI.........PAVRDGQEVAEYAEAH....................DAVVAKLSAPKRRG
A3LUK2_PICST/406-530---AYTDDSDILSILAHNGFF...........................................................
Q6CF00_YARLI/305-431---IYTDDSDIVSVLYHTGVL................................................PTRAQVDAFYS
G9NR46_HYPAI/900-1031---VYTDDSDVVAACIHGGWIKGEWTEDVDTSLLDLDQGANGETKR..............................RRVK
J7RYF5_KAZNA/125-231---IYTDDSDPLLMLLHMGVF...........................................................
M3K5T1_CANMX/305-423---VYTDDSDILQVLMHLGLF...........................................................
C5M6I7_CANTT/7-119---VYTDDSDLLQVLMHLGLF...........................................................
J5JCU2_BEAB2/722-848---VYTDDSDAVAACIHSGWIMGEWTEDVDTSLFSLDKADG...................................VKET
J3PBS3_GAGT3/911-1051---VYTDDSDVIAACIHGGWFRGEWPEDVNVDMLGLYPEEPSRPSG.....................PNGKGPGSRKAAQ
H6C4R8_EXODN/575-687---IYTDDSDPVAAAMHSGFIASVYPPGIDEALLQKVIDEQTPVIE..................................
R7Z1H3_CONA1/712-836---IYTDDSDPIAAAIHVGWIRGEWGEDVDPDYL.LELATAAANIS..................................
E9D8H4_COCPS/887-1025---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKDQHQHAPHPTNGAFGSSHK......................
C5DS09_ZYGRC/122-228---IHTDDSDPILVLRHCGLS...........................................................
F9X0J4_MYCGM/93-215---VYTDDSDVVAAAIHSGWLKGDFGD............................................LNHDLQQAS
N1JD71_BLUG1/820-944---IYTDDSDVLAACIHAGWFRGAWAEDIDVSLLGLELKNDPNGDP..................................
G2RGW7_THITE/773-913---VYTDDSDVIAACIHAGWIRGEWPEDVDVSMLGLDEGYSVSDMP.....................QLLNARGSGAKDS
C5GEG5_AJEDR/790-947---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSLLDLEIKKEHQHAPNGKNGTTTALPKLSSLDELGVKEPKP....SDKP
G0WAD1_NAUDC/154-276---IYTDDSDPLLALKHCGFS........................................................IPN
K0KYE9_WICCF/355-474---IYTDDSDILLILKHNGFL...........................................................
N1QMF6_SPHMS/679-804---IYTDDSDVIAAAIHSGWIKGDFGE............................................YNNDLRDIC
F4NTB3_BATDJ/323-468---IYTDDSDVVAMIIHSGHY..................................CPVDAPDPKPETALQTAASKASRVG
E4ZP84_LEPMJ/937-1052---IYRDDSDPIAAAIHSGWIRGEWDETVDVSMLDPRITAPNDPSD..................................
A7TGE0_VANPO/131-252---IYSDDSDPVLALRHCGFL.........................................................AG
S3CY53_GLAL2/873-991---IYTDDSDVVAACIHEGWFRGAWAPDVDISLLDLEIGDP.......................................
D5GDK0_TUBMM/385-515---VYTDDSDVLGVLVHLGKVPGVLPEGA..........TPDLVAE....................TGCRKTTSRGDITN
Q59ZF1_CANAL/377-496---IYTDDSDILQVLMHLGLF...........................................................
N1Q7Z6_MYCFI/658-783---IYTDDSDVIAAAVHSGWIKGDFGE............................................YNEDLNEVF
C4XW21_CLAL4/297-409---IYTDDSELLSVLTHLGLF...........................................................
N4VJJ6_COLOR/830-968---IYTDDSDVIAACIHGGWIRGEWGEDIDPDMLDLDRGLQAPEKE.......................VPASRKRKEKG
E7Q1V9_YEASB/140-252---IYSDDSDPILVLRHCGFK...........................................................
C0SC36_PARBP/719-879---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSMLDLEIKEQHQHAPNGKNGKSSMLPKFSSADEPAMTANNPTTIASAAS
T0KCQ7_COLGC/297-435---VYTDDSDIIAACIHGGWIRGEWADDIDADMLDLDRGLAAPEKE.......................VPANKRRKEKE
C1H5M7_PARBA/800-961---VYTDDSDPVAAAIHSGFIRGEWGEDVDVSMLDLEIKEQHQHAPNGKNGNNSMLPKFSSADEPATTANNPTTIASAAS
N1Q2C4_MYCP1/668-792---IYTDDSDVVAAAMHSGWLRGDFGE............................................YNEDIRQIC
F2PLT8_TRIEC/777-941---VYTDDSDPVAAAIHSGFIRGEWAEDVDVSMLNLELKDNRKSSS......TTATANGNGTAANGKTTPSSNRTPSVHS
C5DFG3_LACTC/132-240---IYTDDSDILLVLRHCGVI...........................................................

PF03815

VITRN_HUMAN/44-133-------------------------------------------------------------------------DNSGGKI
Q4WUJ0_ASPFU/168-298-------------------------------------------------------------------------DAKGGCG
CRLD2_MOUSE/387-486-------------------------------------------------------------------------DEVGGYA
CRLD2_MOUSE/286-377-------------------------------------------------------------------------DDRGGLV
COCH_HUMAN/32-121-------------------------------------------------------------------------SNSGGPV
Q8IK83_PLAF7/754-852-------------------------------------------------------------------------DNKGGLV
Q8IM24_PLAF7/1171-1264-------------------------------------------------------------------------SNQGGLV
CRLD1_MOUSE/293-384-------------------------------------------------------------------------DNEGGWV
Q4Y3E4_PLACH/7-99-------------------------------------------------------------------------SIKGGQI
Q4YW57_PLABA/727-825-------------------------------------------------------------------------.DKHYLI
Q5CNE9_CRYHO/562-661-------------------------------------------------------------------------NRSTGLA
Q2UA88_ASPOR/147-275-------------------------------------------------------------------------NTIGGCG
Q8IM24_PLAF7/672-769-------------------------------------------------------------------------NNIAEDI
Q5CLR6_CRYHO/1149-1244-------------------------------------------------------------------------SGTAGEI
Q5H993_HUMAN/156-248-------------------------------------------------------------------------DELGGQI
Q4YUE0_PLABA/1079-1193-------------------------------------------------------------------------KTNNNSF
Q8IKS0_PLAF7/726-824-------------------------------------------------------------------------.DKHYLI
Q2GQN4_CHAGB/129-252-------------------------------------------------------------------------DTTGGCG
Q5AU59_EMENI/149-276-------------------------------------------------------------------------DNDGGCG
Q5CLR6_CRYHO/300-397-------------------------------------------------------------------------TPSGGEL
CRLD2_XENTR/291-382-------------------------------------------------------------------------DNSGGLV
Q4U8P9_THEAN/1093-1187-------------------------------------------------------------------------DNDGGEV
Q4N1E8_THEPA/188-285-------------------------------------------------------------------------SPSGGQV
Q4Y8D6_PLACH/571-667-------------------------------------------------------------------------TNLGGLI
Q8IM24_PLAF7/277-384-------------------------------------------------------------------------SPSGGEI
Q4XZL5_PLACH/752-850-------------------------------------------------------------------------DKQGGLV
Q4XHB8_PLACH/31-138-------------------------------------------------------------------------TESGGEI
Q28NX7_JANSC/137-231-------------------------------------------------------------------------AAEGGTV
Q4Y340_PLACH/467-582-------------------------------------------------------------------------EEECKFL
Q28NX7_JANSC/19-119-------------------------------------------------------------------------LDVGGLV
Q8IM24_PLAF7/1059-1160-------------------------------------------------------------------------GNKNNTF
Q4N5G4_THEPA/751-847-------------------------------------------------------------------------.SSHGSF
Q4N2Y3_THEPA/528-626-------------------------------------------------------------------------DNKSG.L
CRLD2_XENTR/392-491-------------------------------------------------------------------------DGEGGYV
Q4N1E8_THEPA/573-671-------------------------------------------------------------------------DNSGGEI
Q4XHC4_PLACH/3-100-------------------------------------------------------------------------SNVADDV
Q5CLR6_CRYHO/1043-1138-------------------------------------------------------------------------SDTGGEF
A0LH15_SYNFM/30-122-------------------------------------------------------------------------NGQTGVV
COCH_CHICK/28-117-------------------------------------------------------------------------TNAGGAV
CRLD1_MOUSE/394-492-------------------------------------------------------------------------RNHGGYV
A1C540_ASPCL/149-277-------------------------------------------------------------------------NAVGGCG
Q5CLR6_CRYHO/681-774-------------------------------------------------------------------------DEVGGEV
B3DFV8_DANRE/31-120-------------------------------------------------------------------------GLSGGPV
C8VAW3_EMENI/156-277-------------------------------------------------------------------------DSKGGCG
E1C6X0_CHICK/39-126-------------------------------------------------------------------------DNTGGKI
F1R7U9_DANRE/303-391-------------------------------------------------------------------------SDSGGYV
H3CRW8_TETNG/411-504-------------------------------------------------------------------------NEAGGYI
H3DGW2_TETNG/36-123-------------------------------------------------------------------------TNAGGKV
Q5CYM9_CRYPI/740-831-------------------------------------------------------------------------TNTGGMF
V4ZDR3_TOXGO/1033-1123-------------------------------------------------------------------------QRHGGEA
V5B813_TOXGO/278-371-------------------------------------------------------------------------SPSGGEV

PF08642

C6HJS8_AJECH/405-563VDEVEPTANPTAKSKSKPKP.........RTPPLPP.....................................PNKDLHI
E9DVW1_METAQ/816-946IPTPELPSRESEGAITAPPP.........LGPMDIP.....................................ANRDLHV
Q6BS67_DEBHA/388-499..NGKIDLTEWNEKWTSDDI.........ITPLDAKND................................PNEIHGDLSV
H2AYB5_KAZAF/162-271...........DSDTSDSLQ.........RTPANLDNFDNVTGVDSD..................LFKLN...KKFDLDV
I2GWB9_TETBL/171-292LNNINKFSSTDKKIDEMKFK.........MTPVNINNTNNI...FGI..................LPIEED..MKFDIEL
V5INS1_NEUCR/835-967NGPQAVKDEAGSEVYSEPPR.........NGPMAVP.....................................ANRDLHV
G1XFK4_ARTOA/516-644AG..RSREIAAAVMAEGGAP.........KTSASVQ.....................................LHKDLLV
G2QNU5_THIHA/780-921SSSSQQSSSSSVTVLNEPPK.........TGPMPVP.....................................ENRDLHV
E3QI42_COLGM/896-1035KDEKARLEANSATYLDQPPK.........TGPVHVP.....................................ADRDMHV
G0RPD9_HYPJQ/908-1039SLDSDMVNATSEGLITRPPP.........TGPMPTP.....................................PDRDLHV
G8JRH1_ERECY/140-262..DLRSDMDLVKGMQQRELR.........RTPGNINNQDNVISTLVP..................DGTGNQGYLPFDVTI
U1I1E0_ENDPU/1189-1302..............FKDNVP.........DAPVEPP.....................................EGKDLHI
S2JEL2_MUCC1/530-651KQKESIEAARRLALSGKKYT.........QHDQHLI.....................................PDHDLKV
K2SGZ9_MACPH/711-828........EADPAQALESKP.........AHPAPPP.....................................TGFDAHV
Q6CWM7_KLULA/161-283LDQNSNGKPSNVHSLKTKLR.........RTPTNMSDQNSV...TGA..................IPERE...IPFAIKV
T4ZWG0_OPHSC/258-385NRANESLDLESEGLITSPPQ.........SGPLSIP.....................................NNRDLHV
V5G6M3_BYSSN/291-408..........RATDEESKGR.........RIPPVPP.....................................ADKDLHI
L8G4U8_PSED2/868-994.TATKVTSKNGDITLTAPPA.........RGPMLPP.....................................PPKDLHV
Q2GN38_CHAGB/751-890ANLPNQQPTSALTVLSEPPK.........TGPMPVP.....................................ENRDLHV
G0RYX0_CHATD/883-1017GAKKDAPSTNGEIVLTEPPK.........NGPMPVP.....................................ENRDLHV
G0V5S2_NAUCC/148-257..........IDPKLTQGKV.........RTPGNLQNTDNV...HGG..................LPTEDG..AVFDLDL
G8BPF2_TETPH/128-245...RDTTKTTDSHRDPALLN.........RTPGNLRNTDDVTDSHSL..................LNNKDD..IPYDIEM
G3AWR6_CANTC/257-368EENGKLDLTGWNPKWSPSDV.........IFPRINQEN..................................HIKGDLSV
G8BDF2_CANPC/230-371..NDSIDLSTWNKKWEKRDI.........LRPINLLNQSVKDSNSPENNNENGNKTDSHRQLTATTPQPIDQDIYGDLSV
U4LWB0_PYROM/1012-1143SPSAAT.TASANGKKAGKAK.........EELPTIP.....................................HGKDLLV
J9MQ22_FUSO4/263-390KPTNSTVDLESEDLITVPPP.........SGPMSIP.....................................AQRDLHV
B8ML52_TALSN/681-800........QASGETGTTAKL.........SIPPVPP.....................................PNKDLHI
G2X0U8_VERDV/859-996RDEQARQEANMATYLDKAPN.........TGPVQVQ.....................................PDRDMQV
Q6FWF5_CANGA/151-280TPTHFKGKASHKPSTPAPLR.........RTPVNQTNKDNV...VGE..................IPKDEHGLKPFDLDV
A6R2D3_AJECN/948-1106VGEVGPTTIPTAKPKSKPKP.........RTPPVPP.....................................PNKDLHI
G4MPP9_MAGO7/884-1015AQHVTSENLPTPDFLDAPLK.........TGPVNVP.....................................PNKDLHV
E3RQ94_PYRTT/11-136DNGPKHSNGAGAPLTLVERP.........SKPVKVF.....................................NSYGAHI
M7TUB4_EUTLA/78-206APSSTSADEQHQEVLTSPPP.........TGPVHVP.....................................TGRDLHV
K9FWH9_PEND2/678-800.....APEATTDGASPTKGP.........RLPPIPP.....................................TDKDLHI
C4JXP4_UNCRE/686-823..NVASDKTGSESEKQKAAR.........RVPPVPP.....................................PDKDLHI
M1W0D1_CLAP2/918-1049EMTEQAPSYESEGAITTPPL.........SGPMSIP.....................................PGRDLHV
Q4X0R9_ASPFU/841-961.......TTAEDMGLTGDRP.........RIPPVPP.....................................TDKDLHI
Q757D6_ASHGO/125-244.....DAELSGQGAGSGPRR.........RTPANRANPDCVTRGVSA..................APSVRRGAYHFDVRA
G3ALD5_SPAPN/284-396..NQSIDLSKWNPNWKSDDF.........IKPLTTTDN.............................EGVDKDIYGDLSV
S7ZDG8_PENO1/825-943.........PPSPEEDGGKP.........RLPPVPP.....................................EDKDLHV
G8Y9N4_PICSO/361-472..DNTLDLSSWNHGWKPTDV.........VVPLNAIKD................................DLGIYGDLSV
G8ZUP8_TORDC/127-233............LADFNGTS.........RTPANLDNQDFV...QGA..................VPPDN...APFDLEM
U4KX31_PYROM/4-136SPAAATATAAANSNKSANAK.........EELLTIP.....................................HGKDLLV
K1XET6_MARBU/885-1008....VRKIIDIDRPLTKPPA.........TGPMEVP.....................................KNRDCHV
S3BP50_OPHP1/1056-1205ASAEEQYKQLASGVFTVPPK.........SGPMGIP.....................................ADRDLHV
A7EZ96_SCLS1/865-991.PELDIPYDGPDETFDHPPA.........KGPMPIR.....................................MDHDLHV
M7UT78_BOTF1/895-1021.PELDTMADGPDEFFEHPPA.........RGPMPVR.....................................NNRDLHV
S8A8C9_DACHA/912-1042AGGNKGRELAVAMMAENGSP.........KMSGAVQ.....................................VGKDLLV
A3LUK2_PICST/406-530..HDKMDLTQWNPNWTRNDI.........IKPLNINVNADSKAPPSE..................QDSDEHAEIYGDLSV
Q6CF00_YARLI/305-431TLRAQEEGDADDTTDGHLED.........EHPVTVGPNSHLVTSTSD..................NEQ.....IYGDCLV
G9NR46_HYPAI/900-1031NQESEPANATSEGLISTPPV.........AGPMIVP.....................................TERDLHV
J7RYF5_KAZNA/125-231............HGDPKNVK.........RTPANLKAPDFVVGSFEE..................SKN.....KKYDVIT
M3K5T1_CANMX/305-423..NGTLDLSTWNKKWTTKSF.........IKPLDNHDEQEDKEN.......................TGVDKDILGDLAV
C5M6I7_CANTT/7-119..NNSIDLSIWNENWTARDL.........IKPLNVMEDKES..........................MGIDKGIYGDLSV
J5JCU2_BEAB2/722-848KKPKVPVELTSEGVISAPPK.........SGPMPIP.....................................ANRDLHI
J3PBS3_GAGT3/911-1051HPHMTSEALPTPDALTEPLK.........TGPVNVP.....................................PDKDLHV
H6C4R8_EXODN/575-687...............GSPAP.........KKPMPVD.....................................ENKDLHI
R7Z1H3_CONA1/712-836..NNNNQPDDIPETMLAPLP.........SGPILPP.....................................PNTDLHI
E9D8H4_COCPS/887-1025.DGPDGKVKSESDDKQKAKH.........RIPPIPP.....................................PDKDLHI
C5DS09_ZYGRC/122-228............LDDVNGTC.........RTPANLHNSDNL...LGT..................VPPAG...TPFDVEI
F9X0J4_MYCGM/93-215ENGPEQDTSEATLLTLTERP.........SKPVQVP.....................................EGFDAHI
N1JD71_BLUG1/820-944...MPPDIIEEGQLLEKPSE.........KGPGHAP.....................................SGCDCHV
G2RGW7_THITE/773-913KPGTSQPSQSSLMVLTEPPK.........SGPMQVP.....................................ANRDLHV
C5GEG5_AJEDR/790-947ETTTTTTTTTNPTTKSKSKP.........KIPPLPP.....................................PNKDLHI
G0WAD1_NAUDC/154-276NKNKDRSYKHPSSGSNNEFR.........RTPANLENPDNVKGESYI.......................STSKKFDLDI
K0KYE9_WICCF/355-474.PSLDNDFENLIEVNQSTEK.........KTSGNLENKSNIDQTVNN..................FRHFVNI.IGGDIHV
N1QMF6_SPHMS/679-804DNAWEHGSEGETPLSLVTRP.........QRPIKAP.....................................EGYDAHV
F4NTB3_BATDJ/323-468TNGTAAKTSTVSTLKQSHGV.........NSPISVHVDPLIATPDVT..................QSSTNALFPDHDLHV
E4ZP84_LEPMJ/937-1052...........AEETLTKVP.........AAPVTPP.....................................ADMDLQI
A7TGE0_VANPO/131-252HFPNSNNIHNNSNNVNSIAK.........RTPGNLSNNDSV...HGI..................LPPDD...TPFDIEL
S3CY53_GLAL2/873-991....PARPIDAEAVLTAPPP.........HGPLIVP.....................................KNHDVDI
D5GDK0_TUBMM/385-515MLSTIPSPVRKKGKGAHAAD.........EGPTIQP......................................GKDLIV
Q59ZF1_CANAL/377-496..NNTIDLSIWNKKWTTKDL.........IKPLQSQLDNNDDGTN......................LGIDKDVYGDLSV
N1Q7Z6_MYCFI/658-783GNDSDNDGPEESPLSLDAKP.........RRPVKVP.....................................EGFDAHI
C4XW21_CLAL4/297-409..ENKMDLTNINPSWTPKDV.........VRPLLVHYDEDGVELL...............................DLSV
N4VJJ6_COLOR/830-968KEEKARMEANAATYLDKPPQ.........TGPVSIP.....................................PDRDMHV
E7Q1V9_YEASB/140-252.......IGAPSGGSFHKLR.........RTPVNVTNQDNV...TGN..................LPLLEG..TPFDLEV
C0SC36_PARBP/719-879QNPDKPQTTSISST.TKPPP.........KIPPLPP.....................................SNKDLHI
T0KCQ7_COLGC/297-435KEEKARQEANAATFLDKPPK.........TGPVTVP.....................................VERDMHV
C1H5M7_PARBA/800-961QNPDKPQTTSISSTTTKLAP.........KIPPLPP.....................................SNKDLHI
N1Q2C4_MYCP1/668-792DNTSERDVDDDPPLSLDERP.........ARPVKVP.....................................EDHDAHI
F2PLT8_TRIEC/777-941NSTRSDPTSTAQSEAPQPPPTAAEPVEGKQLPPIPP.....................................PDKDLHI
C5DFG3_LACTC/132-240...........PSSSPQFHA.........RTPANLADPDHVVGTIPP..................AP......TAYDLEV

PF03815

VITRN_HUMAN/44-133LVRKVAGQSGYKGS..Y....SNGVQS...LSLPRW..RESF
Q4WUJ0_ASPFU/168-298VLRRTGEQSNFLSS..E....RNGISSIAFPSNFPL....SF
CRLD2_MOUSE/387-486DVMPVDKKKSYVGS..L....RNGVQS...ESLNTP..QNGN
CRLD2_MOUSE/286-377DVTRNGMVPFFVKS..Q....KNGMES...LSKYKP..SSSF
COCH_HUMAN/32-121RVYSLPGRENYSSV..D....ANGIQS...QMLSRW..SASF
Q8IK83_PLAF7/754-852NVTIESGMDHYVGS..I....NNNIES...ISLNKN..EKGL
Q8IM24_PLAF7/1171-1264EIIVGTGQEEFKGS..T....QNNVES...FSSNNH..SRSI
CRLD1_MOUSE/293-384DVTRQGRKHYFIKS..N....RNGIQT...IGKYHS..ANSF
Q4Y3E4_PLACH/7-99QVVVGKGQQEFKPS..T....QNNVQS...YIAEKQ..DRSF
Q4YW57_PLABA/727-825NLRVLNALGEYEGV..Y....QNGIIS...DSYIND..SQEV
Q5CNE9_CRYHO/562-661QITPIEGLESYGAS..I....KNGISS...VAYTGKRWKKSF
Q2UA88_ASPOR/147-275VLKLEGATHSFPAS..K....QNGISSVGFPSTFPK....SF
Q8IM24_PLAF7/672-769VLSIAHTHNNFIGT..K....RNNIES...HDFKGT..SKSF
Q5CLR6_CRYHO/1149-1244QIEVGPEQFHFEQS..N....RNGIQS...QSTGYY..IRSF
Q5H993_HUMAN/156-248SVLQRKGISRYEGI..L....ANGVLS...RDGSLS..DKRF
Q4YUE0_PLABA/1079-1193IIKIVEGLTEYKSS..R...GHYGIVS..KPEKQSQ..LRSF
Q8IKS0_PLAF7/726-824HLRVINALNEYGGF..F....QNGIIS...ESFFNN..TQEV
Q2GQN4_CHAGB/129-252VATLVGEYYQYFSS..S....QHNIESIPFDSYFPL....SF
Q5AU59_EMENI/149-276VARLEGAAHSFHAS..K....RNGIKSIGFPSTFPK....SF
Q5CLR6_CRYHO/300-397VLTIVPSLPKYFGG..K...GAFSIES...SDFFPK..PGSE
CRLD2_XENTR/291-382DITRKGRLQFFVKS..T....RNSVES...ISKFKP..ANSF
Q4U8P9_THEAN/1093-1187EIEVEGERNTFDSN..E....SNGILS...QSSGHY..LKSF
Q4N1E8_THEPA/188-285VISIVQSMAKYFGG..T...GYNGLKS...EDYEPP..ADKN
Q4Y8D6_PLACH/571-667EITKLTNITQSFST..TTDITRNGVKA...IITDNK..NKDS
Q8IM24_PLAF7/277-384IVTVASELNHYYTIKEK...IFNELEA...LDFSAKADEKNF
Q4XZL5_PLACH/752-850NVAIESGLDYYKGS..I....SNNIES...ISLNKG..GNEA
Q4XHB8_PLACH/31-138IVTITKGLNYYYAMDFR....YFELLSDIGQNF.....LKYY
Q28NX7_JANSC/137-231TILILGEQPAFTGS..T....RNGVTT...ADYTAW..PRSY
Q4Y340_PLACH/467-582LMIKEVNGSNFIGK..L....QNNVLS...MNKNVE..DQNK
Q28NX7_JANSC/19-119GFRQVAGLDRYEGT..S....QNGVTT...LDYGSW..NSSF
Q8IM24_PLAF7/1059-1160VIRIVEGLLEYKSS..R...GHFGILS..KSEKQSQ..LRSF
Q4N5G4_THEPA/751-847VVSIENGRKYYDGD..K....QNGIQS...YFYNKT..WHGL
Q4N2Y3_THEPA/528-626QVEIVSSPGELDGF..F....QNGINS...ASVSTT..LGES
CRLD2_XENTR/392-491DVMPVEKKKHYFGS..N....KNGIQS...DSIQNH..KEGQ
Q4N1E8_THEPA/573-671VVIIAYPQEHFYGT..S....MNGVESLSLSRSGDD..SREK
Q4XHC4_PLACH/3-100VLIITHSRNKFIGT..K....RNNVES...KEFNGE..SKSF
Q5CLR6_CRYHO/1043-1138VVALYPGLKQYTGAAGK....NNIVST...DENTPQ..TRSF
A0LH15_SYNFM/30-122KVIFYPGRAQYAGS..T....RYGVTS...SSWGSY..ELSF
COCH_CHICK/28-117RVQTLPGQENYPAV..H....ANGIQS...QVLSRW..ASSF
CRLD1_MOUSE/394-492DVMPVDKRKMYTAS..F....QNGIFS...ESLQNP..TGGK
A1C540_ASPCL/149-277VVKLEGAAHTFPAS..K....QNGIQSVGFPSTFPK....SF
Q5CLR6_CRYHO/681-774VITFVSGQKQYFGS..F....NNGIQS...RSIETS..ASKS
B3DFV8_DANRE/31-120EVHGLQGRTNYLSS..Y....AHGVQS...QSLSQW..SASF
C8VAW3_EMENI/156-277ILRRTGEQKNFPAV..D....RNEISS...VDFP........
E1C6X0_CHICK/39-126LVQKVAGHAGYRGS..F....SNGVRS...LSLPRW..RESF
F1R7U9_DANRE/303-391DVMPVDKRKQHKGS..Y....QNGISS...ESLQNP......
H3CRW8_TETNG/411-504DVMPMDMKKHYTAS..Y....QNGIFS...ETFT........
H3DGW2_TETNG/36-123IVKKMAGQNIYKGS..N....SNGVRS...LSLPKW..RESF
Q5CYM9_CRYPI/740-831NVALEGPKNSYEGS..T....KNEIES...EKLS........
V4ZDR3_TOXGO/1033-1123VVTLHDGMPSYAAS..R...GHYGVLS...IATNT.......
V5B813_TOXGO/278-371VVSVVGELPEYTGS..TL..YPTGTVS...TSFRS.......

PF08642

C6HJS8_AJECH/405-563TLLILPTLERYDST--V----MYGLKS------------RAW
E9DVW1_METAQ/816-946NVLILPRLVKYSGS--T----RFGISS------------REF
Q6BS67_DEBHA/388-499TILLLPSLPDYHGY--Y----ANGINS------------RSW
H2AYB5_KAZAF/162-271TVILLDCLQTYVGT--T----RHGVKS------------RDW
I2GWB9_TETBL/171-292DILILPSLENYYSI--R----RNNITS------------RNW
V5INS1_NEUCR/835-967TLVILPKLEKYAST--T----RFGIKS------------REW
G1XFK4_ARTOA/516-644KIVICGNLGEYRSV--V----KYGLKS------------RGW
G2QNU5_THIHA/780-921TLLILPRLERYAST--T----RFGIKS------------REF
E3QI42_COLGM/896-1035SIVILPRLEKYSST--T----RFGLQS------------REY
G0RPD9_HYPJQ/908-1039TVLILPRLVKYASS--T----RYGITS------------REF
G8JRH1_ERECY/140-262QLLMFPPLRRYPSL--E----RNGFVS------------REW
U1I1E0_ENDPU/1189-1302KLLVLPQLEKYGES--A----RYGLKS------------RTW
S2JEL2_MUCC1/530-651TVRVLPTLQSYASS--I----RHRLKS------------REW
K2SGZ9_MACPH/711-828TVTILPCLTEYKGS--V----CYGIKS------------H..
Q6CWM7_KLULA/161-283DILMLPPLQGYASS--T----RNNITS------------REW
T4ZWG0_OPHSC/258-385NVLILPKLAKYAAT--T----RFGIAS------------REF
V5G6M3_BYSSN/291-408TLLILPRLERYDGS--V----LFGLKS------------RGW
L8G4U8_PSED2/868-994TILVLPALEKYSST--T----RWGIRS------------RAW
Q2GN38_CHAGB/751-890TVLILPRLQKYASS--T----RFGIQS------------REF
G0RYX0_CHATD/883-1017TLLILPRLEKYAST--T----RFGIKS------------REF
G0V5S2_NAUCC/148-257TIILLQNLQYYPST--S----RFGLSS------------RKW
G8BPF2_TETPH/128-245TILILPCLRVYSSV--K----RFGLTS------------RQW
G3AWR6_CANTC/257-368TLMLLPTLSEYKSV--Y----AHGINT------------RTW
G8BDF2_CANPC/230-371QILLLPSLPSYYGF--F----ANGINS------------RSW
U4LWB0_PYROM/1012-1143DLLILPRLERYTGT--V----RNALKS------------RSW
J9MQ22_FUSO4/263-390NVLILPRLVKYYSS--T----RHGISS------------REF
B8ML52_TALSN/681-800TLLILPRLERYEST--L----MFGLKS------------RAW
G2X0U8_VERDV/859-996TILILPRLEKYSST--V----RFGVKS------------REW
Q6FWF5_CANGA/151-280DILLLPRLQQYFSV--K----RYGITS------------RHW
A6R2D3_AJECN/948-1106TLLILPTLERYDST--V----MYGLKS------------RAW
G4MPP9_MAGO7/884-1015TLLILPKLQMYAST--V----RFGIKS------------RQW
E3RQ94_PYRTT/11-136TILILPPLESYASI--N----QNHVTS------------REW
M7TUB4_EUTLA/78-206TVLILPGLEKYSGS--A----RYGISS------------REW
K9FWH9_PEND2/678-800TLLVLPRVAQYDSA--L----MFGLKS------------RKW
C4JXP4_UNCRE/686-823TLVILPPLEQYESS--V----MFGLKS------------RAW
M1W0D1_CLAP2/918-1049TVLILPRLTRYTSC--T----RFGISS------------REF
Q4X0R9_ASPFU/841-961TLLILPKLERYESS--V----LFGLKS------------RSW
Q757D6_ASHGO/125-244QLLMLPPLQRYASA--E----RFGLQS------------REW
G3ALD5_SPAPN/284-396QVLLLPGLSKYVGY--T----ANKINS------------RSW
S7ZDG8_PENO1/825-943TLLILPRVDRYEST--V----MFGLKS------------REW
G8Y9N4_PICSO/361-472TLLLLPGLSNYTGF--Y----ANRFNS------------RSW
G8ZUP8_TORDC/127-233DLLILPRLEQYASV--E----QYGVLS------------RSW
U4KX31_PYROM/4-136VLLIIPRLERYTGT--V----RNALKS------------RSW
K1XET6_MARBU/885-1008TIVILPALENYGSI--T----RFGIKS------------REW
S3BP50_OPHP1/1056-1205TLLILPTLLKYSAT--T----RFGIRS------------REW
A7EZ96_SCLS1/865-991TVLVLDCLDKYSSK--V----RFGIRS------------REW
M7UT78_BOTF1/895-1021TVLVLGCLDKYFST--I----RYGIKS------------REW
S8A8C9_DACHA/912-1042KIVIVGNLGKYSSV--V----RYGLKS------------RSW
A3LUK2_PICST/406-530ELLLLPPLPEYHGF--Y----ANGINS------------RSW
Q6CF00_YARLI/305-431TLRALPKLTEYTGC--Y----RNGINS------------RSW
G9NR46_HYPAI/900-1031TVLILPRLVKYGAS--T----RYGITS------------REF
J7RYF5_KAZNA/125-231DLLMLDTLESYHGC--N----RYGVTS------------RDW
M3K5T1_CANMX/305-423EILLLPNLPNYYGF--Y----QNGIYS------------RSW
C5M6I7_CANTT/7-119EILLLPNLPKYYGF--F----QNGINS------------RSW
J5JCU2_BEAB2/722-848NVLIVPRLVKYAGC--T----RFGLTS------------REF
J3PBS3_GAGT3/911-1051TVLVLPKLQHYAST--V----RYGIKS------------REW
H6C4R8_EXODN/575-687TLLVLPQLERYVDS--V----RFGIKS------------RSW
R7Z1H3_CONA1/712-836TILVLPRLEKYAAS--T----RFGLRS------------RAW
E9D8H4_COCPS/887-1025TLLILPPLERYESS--V----MYGLKS------------RPW
C5DS09_ZYGRC/122-228QLLLLPPLQKYTSL--R----RYGITS------------RQW
F9X0J4_MYCGM/93-215TVLVLPPLEKYAAT--S----QHHIWS------------RDW
N1JD71_BLUG1/820-944TILVLPLLERYASS--T----RFGIKS------------REW
G2RGW7_THITE/773-913TLLILPRLEKYAST--T----RFGIKS------------REF
C5GEG5_AJEDR/790-947TLLILPTLERYDST--V----MFGLKS------------RPW
G0WAD1_NAUDC/154-276TILYLQPLRYYPPM--Y----RNGIWS------------RSW
K0KYE9_WICCF/355-474DLIILPKLNHYKGH--Y----NNGINS------------RDW
N1QMF6_SPHMS/679-804TLLILPPLEFYAAT--S----QHHLAS------------REW
F4NTB3_BATDJ/323-468TLRVLPKLVKYSGC--T----RYDLDS------------RGW
E4ZP84_LEPMJ/937-1052EILILPQLQKYTGS--V----EYGISS------------RK.
A7TGE0_VANPO/131-252TIIMLPCLQYYPSV--S----QYGINS------------RQW
S3CY53_GLAL2/873-991KILILPALVEYKGC--V----RFGIRS------------REW
D5GDK0_TUBMM/385-515NLLILPTLQKYTGS--V----RNALKS------------RSW
Q59ZF1_CANAL/377-496EILLLPNLPKYYGF--Y----QNGINS------------RSW
N1Q7Z6_MYCFI/658-783TVLILPALESYGAT--N----RHHVWS------------REW
C4XW21_CLAL4/297-409TLLLLPPLKRYHGF--Y----RNGINS------------RSW
N4VJJ6_COLOR/830-968TVLILPRLEKYGST--T----RFGIQS------------REF
E7Q1V9_YEASB/140-252ELLFLPTLQKYPSV--K----RFDITS------------REW
C0SC36_PARBP/719-879TLLILPTLERYDST--V----MYGLKS------------RAW
T0KCQ7_COLGC/297-435TLLILPRLEKYSST--T----RFGIQS------------REF
C1H5M7_PARBA/800-961TLLILPTLERYDST--V----MYGLKS------------RAW
N1Q2C4_MYCP1/668-792TIVILPALEAYAST--H----QHHIWS------------RDW
F2PLT8_TRIEC/777-941KLLILPTLERYESS--V----MYGLKS------------RSW
C5DFG3_LACTC/132-240DILLLPPLQTYSSS--L----KNGLKS------------RSW

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window