Sequence alignment for CL0515

PF07813

A1TI53_ACIAC/63-153-------------------PHGPR--------------------AEALRQKLQLTPAQQPAWDAFTAAMR-PQGPRP...
A1W1Y8_ACISJ/62-156-------------------YMAQR--------------------AEAFKRKLQLTPEQEPAWNSFLQSMK-PDADAR...
A7IPV3_XANP2/124-222-------------------RIEGR--------------------IAFLKAELKITAAQQPVWTAFTEALK-ANRAMM...
A7IQ00_XANP2/4-99-------------------HIEGR--------------------LAFLKTELKITDVQESKWNVFADAVR-ANAKAM...
A9BPA6_DELAS/60-152-------------------HMQQR--------------------IAKLKADLKLTPAQETAWNTYAATFK-PGERPQ...
B0T6A2_CAUSK/56-156-------------------DPEAH--------------------AQHLRDVLQLRPEQEGALKAYLASMA-SPKHPDGEQ
B0TA22_CAUSK/72-191-------------------LSEPR--------------------LSGLKAELNITERQLRAWNTFAEAAR-ADPRPMPAG
P73742_SYNY3/79-180-------------------NKKGG--------------------QGQWMESLDLTDSQKQQLEAIRQKYQ-GQMQSL...
Q12HJ6_POLSJ/70-169-------------------WIAKR--------------------QAELKAQLKLTPAQEGAWTAYTAAMH-PPVHGA...
Q1QP41_NITHX/88-180-------------------IAGLP--------------------IESVQSAIQPNEAQRAALDELVSASE-KAAASL...
Q1QP41_NITHX/207-301-------------------LTSWP--------------------AAMIEQSVKPTEQQHIHLDALQSAAA-RAADML...
Q2W1Y8_MAGSA/76-172-------------------KMAGH--------------------LAFAEVKLALGESQKAAFAKLKETMK-AAHEPM...
Q2WAX5_MAGSA/52-148-------------------RMAAH--------------------MAYSETKLKLTDAQKVEFKHLAETMK-EASAPM...
Q6LI69_PHOPR/76-173-------------------AMQEQ--------------------FDELENQLKLNKEQQVKWDEFEQIIE-LQANSM...
Q6LVK3_PHOPR/38-144-------------------CGMQD--------------------GRKVFSQLDLTDAQKEQMKSMREMNR-DEMKSK...
Q6MPH4_BDEBA/37-138-------------------LENHF--------------------SPKKMKELNLTEEQKEKLKAIREAAK-AEKQKC...
Q747Z5_GEOSL/39-141-------------------GQEHF--------------------LERMASVLKLTDAQQAQIEALISTDA-EQNAPL...
Q7MGW4_VIBVY/46-156-------------------CGMGM--------------------DRGILRQLDLTDAQKEQLDAMRGSNR-AQMKEMHQ.
Q7MY95_PHOLL/54-155-------------------NDIGD--------------------NDHMFNGITLTEQQRQQMRDLVGQKH-QPRSSM...
Q7NJZ4_GLOVI/40-140-------------------KGHGN--------------------KMMVYERLNLTSDQRTQIEQIYTSEK-QKNAPL...
Q82TW7_NITEU/108-211-------------------SYAHS--------------------VAMQAEALGLSDEQLGKIVRFHLKED-KQAHERI..
Q87KW8_VIBPA/39-149-------------------CGMGM--------------------DRGIMRDLNLTDAQKDQLQSFRDANR-AEMKGKYS.
Q89C05_BRADU/118-214-------------------RVEGR--------------------IAFLRTELKITDAQAPAWNAFADALR-ANAKAL...
Q89FZ1_BRADU/237-329-------------------IVGLP--------------------IDQIAAAVQPSEAQGASLDELGNASI-LAAGMI...
Q89FZ1_BRADU/354-446-------------------ALDWP--------------------GADIEARLHPNDTQRAALQVLQDTSA-KVSASL...
Q89KT6_BRADU/182-277-------------------RLEGR--------------------IAFLKAELQISDKQVADWNNVADALR-SSRQHL...
Q89RC3_BRADU/444-536-------------------VTAWP--------------------LADIARAVRPTPEQRALLDQLKTAAA-NAAGVF...
Q89RC3_BRADU/561-653-------------------LTQLP--------------------IQRIEAVLHPAGKQKEALDRLSEATA-KGVEGL...
Q89XF3_BRADU/210-302-------------------PAGFP--------------------ADRITAAVQPNELQRTALDDLSAAWL-AARNSI...
Q89XF3_BRADU/344-435-------------------QQQWP--------------------VADIASTLRLDDIGRARLDVLQDTTL-RTMETL...
Q8CVD1_SHEON/48-153-------------------MGHDG--------------------MHKMFEGLELTDTQKADIKKLFAEQR-AARSDD...
Q8DM07_THEEB/30-131-------------------DGGMG--------------------WGAKVENLNLTPEQRQNLQAIRQRYQ-SQIEET...
Q8XQR1_RALSO/54-156-------------------MGPHH--------------------GGLFLHGLKLTEAQRDKVFAIEYAQM-PELREQ...
Q92UT5_RHIME/72-174-------------------FMEHR--------------------IGTMLDELDATPEQEDKLWDIIDDAR-AEIRPT...
Q9KNP0_VIBCH/39-145-------------------CGDRG--------------------ERGIWKQLDLTAEQQAQLKEMREAGR-EEMRAN...
CPXP_ECOLI/40-136-------------------...ST--------------------QSHMFDGISLTEHQRQQMRDLMQQAR-HEQPPV...
Q32G85_SHIDS/45-141-------------------..GPH--------------------QDMMFKDLNLTDAQKQQIREIMKGQR-DQMKRP...
Q7CLC2_YERPE/45-142-------------------..DRG--------------------HHNMFDGINLTEQQRQQMRDLMRQSH-QSQPRL...
Q8F044_LEPIN/47-146-------------------..EFV--------------------VKKINSELDLNDSQKKELYRIKDEIL-SKRKELKL.
Q92ZA5_RHIME/99-197-------------------.IEGR--------------------IAFLKAELRITPEQEPLWNAFAEVLR-ANSRGM...

PF13801

A0LDI4_MAGSM/14-141GSVALNLFFVGMLGVSYWRCGPLYLAMHGSLSS.........NPYRMGLAMQNLDDQAREKLTPIMQVHM.PTMDNS---
A1BDI6_CHLPD/16-143ILVLLNLTLLGILWMQNFSGKQAPVQVKITRQY.........NRQIYFTAPLALSEKQAISFQELRREHF.RRVRPE---
A5G100_ACICJ/12-138ASLLVNALMIGAFGGGLAVLSHRGGWHRPPHRH..........PGPIQTAGHALKPADRARFRAAMLAVI.RDNRDL---
A6TGQ9_KLEP7/5-127RTLPLALVTFAALTFASNAAWANHHWGNNN..............GMGNQGYSQLTQEQQATVQKLHNDYY.AQTSAL---
A7HRP3_PARL1/22-146VSLAVNLFLLGLISVPLIMGPPDRGGPRGSMH............GLFHESFRDLPEGDRAAIRKVMIGHF.PAIRPH---
A7IFP7_XANP2/10-134ASLALNLFFAGAAVAVAFHRMHGPPLAGRSQT............VHIDRLAATLPAADAAVLRARFGDIA.GSLAAA---
A8I6M7_AZOC5/20-146ASLALNVFFIGGLVSVASHGFTRPPPTPADRTL..........EARIDRLTNSLPPQDAALLQTQFRAVE.ATVERA---
B2JPM0_BURP8/12-138GSLVLNVFLLGGVAGGAYQWFAGHGRPTTAAAQ..........PRALRFAAEELSADRQKQFFTALKEAR.REAREY---
B4RHQ0_PHEZH/13-145VSLAANLFAVGLLVGGYLAGPRGTPPHAARVLGLGP....GPGPGAMLSAAAALSPEQRDAFRESWRAQA.REARPR---
B6ISF4_RHOCS/14-139VSLCINLLIAGIAIGHAVGRDDRPGWDGPSVL............QFMGPGATLIPEETAGNVLARLRRESAGDRGHF---
B6IY70_RHOCS/12-134GSVALNLFLAGALLPPLLAGPEPPHFRPDPE.............AMAQRISKGLPPADAEVLQTVLRPRD..GFREL---
B9JLL2_AGRRK/12-132SLLVLNTFLIGALAGGGLTWISSTQTHV................ETLPLAGEQLPSGQKKAFRQALNDAR.KAERPS---
B9K0K1_AGRVS/12-133GLLVLNTFLICALAGAGFFYLYDTATIPP...............SRLPLAGEQLPSKLRGEFQKALNDAR.RDVRST---
C0QD09_DESAH/9-130TTLVFAIVGLSGVAFAWNHGQGHGKKGCR...............AGYNSPMANLTEDQQTQLKTLHQKFI.DETAAT---
C1F357_ACIC5/11-143LALLAAFLMPGLAPARAQMRPPHRPPMQDAFHMRMM....RWWDDPHMVHKLGLSQEQQKKMDQIYLDHK.LKLIDL---
C4XL18_DESMR/18-142CSLLLNLFLIAVIGGRLLYGRVERLDGASMLS............RLTTRAEAVLPAGEAQAFKAVIERDA.PRFAKT---
C4ZMF9_THASP/12-130LSVALNVGVLGAVVLDRLGPGASSTS..................APPLHRILELDEAQRARWDAVEAPFL.QQFHAA---
C5ABG6_BURGB/20-148LSAAAQAQTAGAAMPPADAHGGPGPHWHRHGGPE........AVFERLHDQLGLNARQEQQYQAAAATSK.QNRQAM---
C5AK13_BURGB/12-138ASVVLNVFLLGAIAGGAYQWYARQHGAGGTHAP..........KQALRFAADGLPAERQREFMEALKAAR.REARVY---
C5AM38_BURGB/12-136LSLVFNVFLLGGIGGALYRWLGDEHAILAQRS............RNLRFAADGLPAAHRQAFAALLKAQH.QQARPL---
E8RL12_ASTEC/22-146VSLALNVFLLGSLIGVGVIASKHFRPKPDRSS............PALLHMIEGLSPANQEKARQILTDAA.LAGEGD---
C6XIN1_HIRBI/15-143GSLAVNAALIGIVGGQFLGNNGIGIDEKPPNTSR........ERPHIERVFGQLEKADREKLFRTMKEHW.RSSKAE---
C7LQA2_DESBD/3-131RTTTIAILAIFGIIALSTLTFAGPMRGKGMRGDC........PGWNQNPAVQQLTQEKQDQLKNILDEHR.KEMTPM---
C7LTM1_DESBD/4-123KHLIITLTLVLALAAGAQAYRGGCPGQ.................GHYQDFMSGLPPEQQQKVQALTDEHH.KELFAL---
D9QMN5_BRESC/16-143VSVGVNLFAGTAAYSVMSRQEHGDRRQGDGEPQ.........RRPSSREMIGNLSPEAREPVRQALRAAA.QRARPE---
E3I3I3_RHOVT/20-146WSLALNMFFICGVVAFSVASLYKPAFRGGGGGP..........AYQFERIAARLPAQDADRLKAAFAERA.SEVEET---
D2QGU3_SPILD/13-140GLLLLNLLTIGFLVFKPGQLPRPDHPPGPPGAN.........DPATIIIRRLHFDSDQRARYQELVHEHQ.NAVRKL---
Q0AR45_MARMM/13-149GSVLINGALAGYVVHRTADGPRWQMPSPEAREVGRRAGPGSRQGFDLRSFVDALPDEARAEARARLRNAF.LDMRGP---
Q0C2K5_HYPNA/15-140VSLLVNLGLGGYVAGQHLRADPPRQERSQERP...........RFERPEGMPEISREDRREVRGLMRQGF.ESAQAE---
Q13NK1_BURXL/12-138VSLVLNVFLVGAIVGGAYQWFAAHGAAAPVLAQ..........QRALRFAAQTLPAGRQKAFLDSLKNAR.REARQY---
Q1D1L1_MYXXD/3-129GFLFGTACLAGLIYTVRGGRHGYRRGGRWSSRG..........RLRWLFERLDTSPGQEKVLLKAADDVM.EAFAKA---
Q21QV9_ALBFT/12-136VSLLVNVGVLAGAWFQAWRAQGATELAFFGMG............HERVPDYLKLDGTQIERWHAMEKDFV.KVLNDV---
Q28ML3_JANSC/19-144ISLALNLAIVGLIGGAVLGGGGPGDGGVPALR...........ALGLGPFARALSREDRAELRTRIEGTG.VELREE---
Q2IEG5_ANADE/9-129LGAVVVLFLAGLVRVVAFRRWRHHRGAR................AGWLLRRIGASPEQERAVRAELDALS.QAFLAL---
Q2W3F7_MAGSA/13-146ASLAFNVFLATVLFMREPGFPPGPPGGPGGPGGPGG...PPTPLHLAERLAADLPAADAAILRAAVQSRS.QAVEYQ---
Q3A3V3_PELCD/9-130KVVVIVLLGVLVIPLNSDADRMRGGSGYH...............MMGSGMMSQLTAEEQKTVNDLVQKYH.GPMMEL---
Q3B234_PELLD/32-158LLVILNVTLLSVLWWQNIHAPAPRPVTLTREVS..........RQIYFQLPLSLTRSQAASFQELRRQHF.RKVRPQ---
Q4K9D5_PSEF5/10-136LSLLINVFLIGGVAGGLYQWLGHPKPAQALAVP..........QHGLRQAMAQMPEERRRQLRQLLRQTR.IDSQPL---
Q5LPU5_RUEPO/18-137GSLALNLLVIGLAAGAMWRYGGDHGHRPPL..............PMAATLYRALPEADRDQLRQHIHGRL..DGRKA---
Q5P1Y0_AROAE/159-278CSVLVNLGVVAAAGVHVLRPASTNAGA.................TPSLPVHLGLDARQLERWHAAEQPFL.RQFSDA---
Q8U4U5_AGRT5/12-133VLLVVNTFLVCALAGAGFVYLRNDTTASA...............SRMPLAGEQLPKAEREAFRQMLSDAR.KPLRET---
B4EKQ8_BURCJ/12-140GSVVLNVFMLGAIGGGAYQWFSTHRDGHAAGAPA........SRTALRFAADGLPDARQREFAAALKAAR.KSGRDF---
G2ITZ7_9SPHN/11-131VLVTFAAAIAGVVIGRVYVVPVRPVENEL...............HELLHRDLKLNSAQHSRLETIEKNYA.IRRQAL---
CNRR_RALME/13-133...TLFGALLGVSVAAAWLYYSHRNEAGHGDL............HEILHEAVPLDANEREILELKEDAFA.QRRREI---
Q3J0U4_RHOS4/24-148LSVALNLAVVGMAGGALWRFRADDDMHGPVRD............LGFGPFAEALALEDRKEMRRAFLDER.GDFRMI---
Q6N1G0_RHOPA/17-140ASLCVNVALGAYVGAQWLRPQWTPPHAGMP.I............RLIERVASRLPPADAEILWRNFNAKQ.VTLQPL---
ZRAP_SALTY/8-124...AIALIALSLLALSSGAAFAGHHWGNND..............GMWQQGGSPLTTEQQATAQKIYDDYY.TQTSAL---
V6EVP5_9PROT/13-130ASLLANGFLAGVLVVDRPPPPGPPKPG.................DIVEKMAATLPAADARILRQAAGDQG...LLDV---

PF07813

A1TI53_ACIAC/63-153.........DMAGMAQ.................LTTPERIDRMRALRAQHNAE....ADRRDDATKTFYAALTPAQQKVF
A1W1Y8_ACISJ/62-156.....KARLDWQGMDQ.................LTTPERIDRMRALRSQRAAE....MDRRGDAVKAFYGTLTPAQQKTF
A7IPV3_XANP2/124-222....GDMQEMMMAAQG..............GGAPTALQRIDAHERMLVARLEA....VRRLKAALGPLYAAFDEAQKRTA
A7IQ00_XANP2/4-99....RGMREGMMQARG.................GALPVRLERIEKAMALCQES....LRTIKAAVEPLYASFSDEQKRAA
A9BPA6_DELAS/60-152.......RMEREDFAK.................LTTPQRIDKMREMRAQRAAD....ADRRGEATKAFYAQLDASQQKTF
B0T6A2_CAUSK/56-156HGDGKHDDEDSQA...................PLTTPQRLDREAEQLARATEA....FKARAAATKTFYAALSPSQRKAF
B0TA22_CAUSK/72-191MTMPMAKKPGDMPMPMKSDAKPGGDGMMAMMMAKPLPERLAHHETMMKAHLKA....LHKSRTAVLGLYRVLTPEQRLMA
P73742_SYNY3/79-180.......SEQMRTSQNELR......TLMSGNGSDSEIRAKH..NQVANLRQQL....GELRFNSMLESRQVLTPEQRQKF
Q12HJ6_POLSJ/70-169....RPTPEQRAEFDK.................LTTPERIDKMRALRSQRMSEMAAAMDKRDAATKTFYAALMPEQQKTF
Q1QP41_NITHX/88-180....KASCPTDV....................ALTAPRRLEVMQQRIEAMIAA....VQMVQPPLKNFYGLLSDEQKARL
Q1QP41_NITHX/207-301....KASCQSQAED..................GLTPPARLATVGKRLDIMLQA....VKAVHIAMHDFYGSLTDEQKAAF
Q2W1Y8_MAGSA/76-172....KKVCAEIVAQPP................ATTLPTHMERMRKMMEARVSV....MGKVIPAMTGFYDTLTPEQKKTA
Q2WAX5_MAGSA/52-148....AKMCADKVDPSK................FATLPERMGRMQQQAEIRAEA....LRKVVPAMSAFYASLSLEQQKIA
Q6LI69_PHOPR/76-173....IEHRQQMLEFFQ...............DSQTLPQRLERHTQMMGERFAS....MTSYSAALSSVYQSLDPNQKKIL
Q6LVK3_PHOPR/38-144...RLEKHAEMKANHDKMQE.....LVLASDFDENAVRDLA..QQMSTAQVER....RVAMLEKRHEVLNILTPEQKTQY
Q6MPH4_BDEBA/37-138.......REDMRTARKAFK......EALRSNASKEAVTAAY..QSMLEKKQQL....SKARLDTLLSARDVLTEEQRAKL
Q747Z5_GEOSL/39-141...HRQLAENERALREAT.........TAASLDEATVRALA..ATKGNLMTEM....IVSRAKLRNAINAILTAEQRELA
Q7MGW4_VIBVY/46-156.GNFAANQAERQAQHAKVQA.....LLLADNFDQATANELA..KQMAEKQAER....RVKMLEKQHQMLSILTPEQKAKF
Q7MY95_PHOLL/54-155....SMSPTEREEMRKLV.........TAKDFDGVAVKALI..ERMIRCNVEH....QVEMARIHHQMYQLLTPEQQAQL
Q7NJZ4_GLOVI/40-140.......KEQMRQLRSEYQ.......AAREANDTAKIESVR..ERMMVLKPQM....QQARTETEQQVAAILTPEQRAQM
Q82TW7_NITEU/108-211...KQKMMESMKAFRKAV.........GEPATDDETLRKLG..QAHIDSFNEM....VKYHIDERKAVRSILTPEQIGKL
Q87KW8_VIBPA/39-149.QNREARMAERQAHHAKMQS.....LLLADTFDEAQATALA..KEMVERQTEH....RVKMLERKHQMLSVLTPEQKAEF
Q89C05_BRADU/118-214....GELRTSMMSQAG................TEPLVDRLTWQEKWLSARLEA....TRAMKSALTNLVGSFSDEQKKTA
Q89FZ1_BRADU/237-329....RASCPAQV....................AATAPGRLAAMQQRIEAMTKA....VDLVQPALDKFYGSLTDEQKARF
Q89FZ1_BRADU/354-446....KAACQPNE....................VMTPPARMAAVRKRLDLMLDG....VKSVRAALEDFYGTLNDEQKAQF
Q89KT6_BRADU/182-277.....LDARKMLAMDD................RLGSADRLEHYERHLSERLEA....LKAARVAFTRLYASLNESQKQTA
Q89RC3_BRADU/444-536....KDSCADTY....................ALTPPGRLRAMMNRVSATLEA....VKIVRPALENFYNSLSDEQQARF
Q89RC3_BRADU/561-653....QAACPNDV....................PLTPVGRLEAMQRRLEAMLAA....AKLVEPALDEFYATLSSEQKARF
Q89XF3_BRADU/210-302....RATCPAQV....................PATASERLGLMRERLEAMIKA....TDAVAPPLSKFVDLLDANQKSRL
Q89XF3_BRADU/344-435.....SACPTKP....................AATPQGRLAAVKARLETMLQA....VSGVADALDDFEADLSDEQKAGF
Q8CVD1_SHEON/48-153....KPTKEERLARRAEMHA.....LITAATFDETQAKALI..GAQQEKRQAQ....AIERMKMQNQIYNLLTPEQQAKF
Q8DM07_THEEB/30-131.......RTQLRTAKDELR......RLMASNASDEQIRAKH..AQVQQLQQKL....ATLRFESMLATRKILTPEQRQAL
Q8XQR1_RALSO/54-156...RKAIEHARRDLREMV.........VSGQYDEARSRALT..DALGRAVARE....TQLRAQADAKILQVLTPEQRKQI
Q92UT5_RHIME/72-174.......FRDFRETREEVIE.....LLGAPGIDRAAAEKLR..SERIAAIDEA....SRKMTTALLDAAEVLTPEQRAKL
Q9KNP0_VIBCH/39-145...RGQSHDAMKALHAQERA.....LVLAADFDQAAAENLA..KQMVDQQVTH....RVKMMEKRHQMMSILTAEQKAKL
CPXP_ECOLI/40-136......NVSELETMHRLV.........TAENFDENAVRAQA..EKMANEQIAR....QVEMAKVRNQMYRLLTPEQQAVL
Q32G85_SHIDS/45-141......PLEERRAMHDII.........ASDTFDKAKAEAQI..AKMEEQRKAN....MLAHMETQNKIYNILTPEQKKQF
Q7CLC2_YERPE/45-142......DLEDREAMHKLI.........TADKFDEAAVRAQA..EKMSQNQIER....HVEMAKVRNQMYNLLTPEQKEAL
Q8F044_LEPIN/47-146.QGPRIPAEVLTEFRQ.............PTLDEKKINKSF..ELEMNKMIEM....RTFMTKKAVEFHSILTPEQRNQL
Q92ZA5_RHIME/99-197....DGMMQTQAAMGQ............LAGAAATPLQRVDVGERALASRLES....VRKLKAALVPLYQLFEGAQKQAA

PF13801

A0LDI4_MAGSM/14-141---LRQLRVKKAEVHQLL---------ITDPVDQVALEQAF--RELRLQAQQA----QESVHRMMMQAAATLSPEARQQ-
A1BDI6_CHLPD/16-143---MQAISLLKEQLVKEA---------IRDNPDSLKIVKLA--ESIGKHQTSV----ERQLAEHFHELSEVCTPSQRDS-
A5G100_ACICJ/12-138---IRDARLRRQQAGALF---------VRPDFDRAAIAALL--ARARRDRAEL----LAKLDNAALRFAATLPRGERRK-
A6TGQ9_KLEP7/5-127---RQQLQSKRYEYNALL---------TAQKPDSGKIEAVA--QEMEGLRQKL----DQQRVKFDIALAEAGVPRGAGM-
A7HRP3_PARL1/22-146---LRSMRDAKSRLSEAL---------AAEPYDEATVRAAF--DDMDAAMREM----TAIGQNAMMAGFAQLTPEQRRR-
A7IFP7_XANP2/10-134---EQASRLAQDKARSAI---------SATPFDESRGDQAF--VELRAARRAV----WLIVHKAILDAAKDMSQEGRDQ-
A8I6M7_AZOC5/20-146---RQASRDAQQNVRVAL---------TAPTFDPDAATQAL--GALREARERI----WIEIHSALVKAAIAMSPEGRER-
B2JPM0_BURP8/12-138---AREGREQRREVLRLL---------AAPQLDRTALDMAL--NRTRAADIAL----RSRIEQGVADFAATLSPDERVK-
B4RHQ0_PHEZH/13-145---LREARQVRREAYQRF---------VREPFDASAALTDL--DRARRLELEG----RALADRQLVEFAATLPAADRIR-
B6ISF4_RHOCS/14-139---FSEIRKAREEVRSAL---------AARPFDPAAADAAF--TSVRQATAAM----QQRLQEAVVRTMAEEQARGTLP-
B6IY70_RHOCS/12-134---GGLMEENIRATSAAL---------TAEPFDPAALRAAL--DRGTQERVRF----EQRQHEAMVEAAARLSPEGRRR-
B9JLL2_AGRRK/12-132---VLESQQAKIDAASLL---------GQPTLDAEALSAAL--ARARNADIAL----RAKLEQRAVDFAATLSYDERRT-
B9K0K1_AGRVS/12-133---GLEARQARVEAAALM---------GKPELDGVALADAL--KRAREAEYAV----RAATEQKAIDFVASLSVDERRR-
C0QD09_DESAH/9-130---RAAMRAKKDELRILM---------QTSAPDGQRLVALA--NEAGDLQKAL----MVKRINFALEAKKIAPEINFFA-
C1F357_ACIC5/11-143---HAALEKQEALLGPML---------GADQPNEGKILSQI--DAIAQARANL----EKEFWRMLLGIRRQLTPEQWQK-
C4XL18_DESMR/18-142---RHQLGAARAELVRQV---------VADPYDKKATGQAL--LAWKAAWDSF----AADFSDTLVDALGQVSPEGRRK-
C4ZMF9_THASP/12-130---SGQLEAHRRALVEAL---------FAEAIDPLRIETAR--AAIAELQQDQ----QRLIIEQLIAEREILDARQRQQ-
C5ABG6_BURGB/20-148---RRNFEQARSQLEAAQ---------SQPILDLDALHSAR--QQVEQQNALL----REQTERAWLAFYDGLNDQQKTT-
C5AK13_BURGB/12-138---AREAREGRRDVLDLL---------AMPQLDRPALDEAL--SRTREADTRL----RAQVESNVADFAASLTPEERQR-
C5AM38_BURGB/12-136---AQAARDGRRSVAQLL---------VAPGFDRAAIDAAL--ARTRDADFEQ----RRRLEESIVSFAEALPPTERAS-
E8RL12_ASTEC/22-146---MDQSRSYRKSAAELM---------LQPKPDPVAIQAEI--TKARRAEASA----KDKIETAVISLLIQLPPEERAR-
C6XIN1_HIRBI/15-143---RATMHAKHLEVLNAI---------RAEPFDRGQVELGI--NEFMRVDSEL----KTLATTGILDVMETLPPEARVA-
C7LQA2_DESBD/3-131---RNAMWEKRTLLKTLS---------VNPNTKPETITALV--GELSDLRAQA----QTRREALQSRVSKEIGIDLPMG-
C7LTM1_DESBD/4-123---HKELLARHEAMEALF---------AATPTDKSAIDKAV--AEVSELQAKK----AQLNADYRVELTEIAGKPVPIE-
D9QMN5_BRESC/16-143---FQASRDARRQAIAAA---------SAEQLDSARVAALL--DQSRAAEVRG----REMLEADAIAILGTLGPADRAV-
E3I3I3_RHOVT/20-146---HAASHKARDAMRLAL---------RAEPYDGDATRKAM--ADAQDARRRL----ETVIQAVIASAAADMSLEGRAQ-
D2QGU3_SPILD/13-140---REQSTELFQDYYGLL---------ESDHPDSAQANALS--QQIATNQREL----AQLNFTHFSQIRALCRPDQKAD-
Q0AR45_MARMM/13-149---GRDAMDVRRELDALL---------VAEEFDAEAVADAM--ARMHASQRAI----EMQIETIVLDVVAGLDAETRAA-
Q0C2K5_HYPNA/15-140---LAARREAEARFALVL---------AAENFDREAAEVAL--RELRDADVML----RDRIGLEVLSGISELSPDQRAW-
Q13NK1_BURXL/12-138---AREGREGRREVLRLL---------AAPQFDRAALDAAL--ARTREADSHL----RAQVEGGVADFAATLSPEERVQ-
Q1D1L1_MYXXD/3-129---RDEVGPSRTALGAAL---------RGEHFDGAALRELF--ARHDVAIDNV----RRTVQGSLAQVHEALDPRQRRE-
Q21QV9_ALBFT/12-136---DGKIQIHREHLVREI---------FSAQPDTSVIERER--AAIFTLQEAQ----QRSVIEQLLKEREMLNARQRLA-
Q28ML3_JANSC/19-144---RREIGRALRAVEGAL---------RADPFDRATVEEAF--ARSRGMVVSL----QETGHTALLDQIETMSAAERQD-
Q2IEG5_ANADE/9-129---RADAHPLRGDLADLF---------VAPSLDAAHVRDAI--DARLASAVAL----PARVAEAIARVHDVLDPAQRER-
Q2W3F7_MAGSA/13-146---WRVWTGMPERARTAL---------AAPDFNAEALRAIL--AEGREAHYAV----DGLIAEVVLDAASGLSAESRQA-
Q3A3V3_PELCD/9-130---KKQLFAKRAELNAVM---------AQEKFDAKKARSLS--KEISALQSKF----MDQHAEMFIEMREKGVSYYGTC-
Q3B234_PELLD/32-158---IQAIGSLKQQLVEES---------FQESPDTMKITALA--TELGNRQAEI----ERELAHHFHELAMTCTPAQRDS-
Q4K9D5_PSEF5/10-136---IIAGREARQAVVREL---------GAEPLDRNALDAQL--GKSRDADIAL----RARVDEVLADFAGSLSLKERQQ-
Q5LPU5_RUEPO/18-137---RR..AQEMAELAAAL---------RASPFDPAQFAALL--ATHETRRAES----HGAMRAALIDRIASMDQGTRAA-
Q5P1Y0_AROAE/159-278---AARIEAHRAEMIRTI---------FAGNVDRNAIEAER--LAIATLQHEQ----QRLMIEQLLAEREILDEAQRVR-
Q8U4U5_AGRT5/12-133---SAEARQARIEAASLM---------GADTLDTKALSDAL--ERARKAEYAV----RAAVELQAVEFARTLSLDARRR-
B4EKQ8_BURCJ/12-140---AREGRDGRITVLDLL---------AAPQLDRAAIDAAL--DRTRAADTAM----RAQVERSVVDFAATLTPDERAK-
G2ITZ7_9SPHN/11-131---EAELRADNARLAEAI---------EAEHGYGPQVATAV--DRSHQAMGAL----QKETLEHIFAMRAVLRPDQTD.-
CNRR_RALME/13-133---ETRLRAANGKLADAI---------AKNPAWSPEVEAAT--QEVERAAGDL----QRATLVHVFEMRAGLKPEHRP.-
Q3J0U4_RHOS4/24-148---RREMREDFRAMLATL---------RAEPYDPAALQAVL--DRQQQRGAET----AALGSRLLGARIEAMAPEERRA-
Q6N1G0_RHOPA/17-140---QHDYVAALRTTLNLA---------AQPELDKPALRAAV--ENARDKRSKV----GDAMIDTFVETLEQISPEGRRQ-
ZRAP_SALTY/8-124---RQQLISKRYEYNALL---------TASSPDTAKINAVA--KEMESLGQKL----DEQRVKRDVAMAQAGIPRG...-
V6EVP5_9PROT/13-130---DRDQSEQHRRIGMLM---------QAEPFDAEAFRQAV--TDLSSRREQA----GDRIGKALIQAIPQMSTAGRQA-

PF07813

A1TI53_ACIAC/63-153DAEH
A1W1Y8_ACISJ/62-156DAEG
A7IPV3_XANP2/124-222DQLL
A7IQ00_XANP2/4-99DQLM
A9BPA6_DELAS/60-152DAAT
B0T6A2_CAUSK/56-156DALG
B0TA22_CAUSK/72-191DKSL
P73742_SYNY3/79-180SQLM
Q12HJ6_POLSJ/70-169DVEH
Q1QP41_NITHX/88-180NGLA
Q1QP41_NITHX/207-301DAIG
Q2W1Y8_MAGSA/76-172DALM
Q2WAX5_MAGSA/52-148DDLM
Q6LI69_PHOPR/76-173DQNT
Q6LVK3_PHOPR/38-144QTLQ
Q6MPH4_BDEBA/37-138FSHG
Q747Z5_GEOSL/39-141DRLD
Q7MGW4_VIBVY/46-156VELQ
Q7MY95_PHOLL/54-155EQHY
Q7NJZ4_GLOVI/40-140EQLR
Q82TW7_NITEU/108-211KAVK
Q87KW8_VIBPA/39-149VKLQ
Q89C05_BRADU/118-214DELL
Q89FZ1_BRADU/237-329NALA
Q89FZ1_BRADU/354-446EAIG
Q89KT6_BRADU/182-277DTIL
Q89RC3_BRADU/444-536NALG
Q89RC3_BRADU/561-653NTLQ
Q89XF3_BRADU/210-302DALA
Q89XF3_BRADU/344-435EAIG
Q8CVD1_SHEON/48-153KARF
Q8DM07_THEEB/30-131AERM
Q8XQR1_RALSO/54-156SDRE
Q92UT5_RHIME/72-174VEHL
Q9KNP0_VIBCH/39-145QTLQ
CPXP_ECOLI/40-136NEKH
Q32G85_SHIDS/45-141NAN.
Q7CLC2_YERPE/45-142NKKH
Q8F044_LEPIN/47-146VDL.
Q92ZA5_RHIME/99-197DKL.

PF13801

A0LDI4_MAGSM/14-141----
A1BDI6_CHLPD/16-143----
A5G100_ACICJ/12-138----
A6TGQ9_KLEP7/5-127----
A7HRP3_PARL1/22-146----
A7IFP7_XANP2/10-134----
A8I6M7_AZOC5/20-146----
B2JPM0_BURP8/12-138----
B4RHQ0_PHEZH/13-145----
B6ISF4_RHOCS/14-139----
B6IY70_RHOCS/12-134----
B9JLL2_AGRRK/12-132----
B9K0K1_AGRVS/12-133----
C0QD09_DESAH/9-130----
C1F357_ACIC5/11-143----
C4XL18_DESMR/18-142----
C4ZMF9_THASP/12-130----
C5ABG6_BURGB/20-148----
C5AK13_BURGB/12-138----
C5AM38_BURGB/12-136----
E8RL12_ASTEC/22-146----
C6XIN1_HIRBI/15-143----
C7LQA2_DESBD/3-131----
C7LTM1_DESBD/4-123----
D9QMN5_BRESC/16-143----
E3I3I3_RHOVT/20-146----
D2QGU3_SPILD/13-140----
Q0AR45_MARMM/13-149----
Q0C2K5_HYPNA/15-140----
Q13NK1_BURXL/12-138----
Q1D1L1_MYXXD/3-129----
Q21QV9_ALBFT/12-136----
Q28ML3_JANSC/19-144----
Q2IEG5_ANADE/9-129----
Q2W3F7_MAGSA/13-146----
Q3A3V3_PELCD/9-130----
Q3B234_PELLD/32-158----
Q4K9D5_PSEF5/10-136----
Q5LPU5_RUEPO/18-137----
Q5P1Y0_AROAE/159-278----
Q8U4U5_AGRT5/12-133----
B4EKQ8_BURCJ/12-140----
G2ITZ7_9SPHN/11-131----
CNRR_RALME/13-133----
Q3J0U4_RHOS4/24-148----
Q6N1G0_RHOPA/17-140----
ZRAP_SALTY/8-124----
V6EVP5_9PROT/13-130----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window