Sequence alignment for CL0520

PF01500

KRA11_HUMAN/1-177M..ACCQTSFCGFPSCSTSGTCG..............................................SSCCQPSCCET
KRA3A_SHEEP/1-130T.GSCCG......PTFSSLS.CGGGCLQPCCYRD...................................PCCCRPVSSTQ
Q28707_RABIT/1-126MVNSCCG......SVCSERG.CGQDFCQE........................................ESCCRPSCCRP
KRB2C_SHEEP/1-152M..ACCSTSFCGFPICSTAGTCG..............................................SSCCRSTCSQT
KRA13_HUMAN/1-177M..TCCQTSFCGYPSCSTSGTCGSSCCQPSCCETSCCQPSCCETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPSCCET
O70148_RAT/1-188M..ACCATSFCGFPTCSTGGTCGSNCCQPSCSQSSCCQPSCSQ..........................SSCCQPSCTQS
E9LK77_SHEEP/1-172M..ACCSTSFCGFPICSTGGTCGSSPCQPTCCQ....................................TSCCQPTSIQT
KRB2D_SHEEP/1-182M..ACCSTSFCGFPTCSTGGTCGSNFCQPTCCQ....................................TSCCQPTSIQT

PF13885

D3ZD90_RAT/24-64--------------------------------------------------------------------------------
D3ZD90_RAT/98-141--------------------------------------------------------------------------------
D4A8A6_RAT/96-153--------------------------------------------------------------------------------
A6NC61_HUMAN/112-155--------------------------------------------------------------------------------
D3Z5T3_MOUSE/78-122--------------------------------------------------------------------------------
D3ZDA4_RAT/29-74--------------------------------------------------------------------------------
D3ZMN9_RAT/83-127--------------------------------------------------------------------------------
D3ZMN9_RAT/143-187--------------------------------------------------------------------------------
D3ZNY7_RAT/180-226--------------------------------------------------------------------------------
D3ZTU8_RAT/144-188--------------------------------------------------------------------------------
D3ZV25_RAT/59-103--------------------------------------------------------------------------------
D3ZV25_RAT/69-113--------------------------------------------------------------------------------
D4A5R4_RAT/44-90--------------------------------------------------------------------------------
KRA45_HUMAN/25-69--------------------------------------------------------------------------------
KRA45_HUMAN/105-150--------------------------------------------------------------------------------
A0JN45_BOVIN/96-140--------------------------------------------------------------------------------
A0JN45_BOVIN/141-186--------------------------------------------------------------------------------
A2A4L9_MOUSE/69-113--------------------------------------------------------------------------------
A2A4M0_MOUSE/24-68--------------------------------------------------------------------------------
A2A4M2_MOUSE/84-127--------------------------------------------------------------------------------
A2A5X3_MOUSE/75-120--------------------------------------------------------------------------------
A2A5X3_MOUSE/232-274--------------------------------------------------------------------------------
KR161_MOUSE/88-132--------------------------------------------------------------------------------
A4IF42_MOUSE/141-185--------------------------------------------------------------------------------
KR108_BOVIN/111-155--------------------------------------------------------------------------------
KR161_HUMAN/68-112--------------------------------------------------------------------------------
KR161_HUMAN/128-172--------------------------------------------------------------------------------
KR161_HUMAN/193-237--------------------------------------------------------------------------------
KRA96_HUMAN/80-124--------------------------------------------------------------------------------
KR291_HUMAN/115-159--------------------------------------------------------------------------------
KR291_HUMAN/165-209--------------------------------------------------------------------------------
KRA91_HUMAN/37-79--------------------------------------------------------------------------------
KRA91_HUMAN/80-122--------------------------------------------------------------------------------
B1AQ90_MOUSE/24-68--------------------------------------------------------------------------------
B1AQ90_MOUSE/79-123--------------------------------------------------------------------------------
B1AQA8_MOUSE/109-152--------------------------------------------------------------------------------
B1AQA9_MOUSE/24-68--------------------------------------------------------------------------------
B1AQA9_MOUSE/178-222--------------------------------------------------------------------------------
D2HJK5_AILME/29-73--------------------------------------------------------------------------------
D3ZDT9_RAT/84-128--------------------------------------------------------------------------------
D3ZJ72_RAT/72-115--------------------------------------------------------------------------------
D3ZW67_RAT/79-121--------------------------------------------------------------------------------
D3ZRR1_RAT/101-148--------------------------------------------------------------------------------
D3ZUG4_RAT/130-173--------------------------------------------------------------------------------
D4A3Q1_RAT/42-85--------------------------------------------------------------------------------
KR121_HUMAN/24-68--------------------------------------------------------------------------------
KR101_HUMAN/71-113--------------------------------------------------------------------------------
KR103_HUMAN/84-128--------------------------------------------------------------------------------
KR105_HUMAN/60-102--------------------------------------------------------------------------------
KR105_HUMAN/199-244--------------------------------------------------------------------------------
KR106_HUMAN/265-311--------------------------------------------------------------------------------
KR104_HUMAN/349-395--------------------------------------------------------------------------------
Q148I6_BOVIN/91-135--------------------------------------------------------------------------------
Q64526_MOUSE/118-164--------------------------------------------------------------------------------
Q8CAY5_MOUSE/64-107--------------------------------------------------------------------------------
KRA98_HUMAN/18-60--------------------------------------------------------------------------------
KRA98_HUMAN/65-109--------------------------------------------------------------------------------
KRA93_HUMAN/56-99--------------------------------------------------------------------------------
KRA92_HUMAN/32-75--------------------------------------------------------------------------------
KRA44_HUMAN/70-114--------------------------------------------------------------------------------
KRA44_HUMAN/115-159--------------------------------------------------------------------------------
KRA42_HUMAN/85-129--------------------------------------------------------------------------------
KR121_MOUSE/19-63--------------------------------------------------------------------------------
F1N3V7_BOVIN/76-118--------------------------------------------------------------------------------
H0XZU6_OTOGA/5-48--------------------------------------------------------------------------------
KR107_HUMAN/41-84--------------------------------------------------------------------------------
Q9D732_MOUSE/24-68--------------------------------------------------------------------------------

PF05287

KRA14_MOUSE/1-166-----------------------------------------------------------------------MSCNSCSGT
KR261_HUMAN/4-210-----------------------------------------------------------------------PNY..CSGN
Q9D6L6_MOUSE/1-179-----------------------------------------------------------------------MSNNCCSEV
KR241_HUMAN/6-191-----------------------------------------------------------------------MSTTGYPGV
KR261_MOUSE/4-213-----------------------------------------------------------------------RNNCSSSGN
Q9D6T8_MOUSE/1-200-----------------------------------------------------------------------MAYSCCSGN
KR132_HUMAN/1-170-----------------------------------------------------------------------MSYNCCSGN
KR271_HUMAN/1-201-----------------------------------------------------------------------MPHSHC...
Q8K198_MOUSE/1-165-----------------------------------------------------------------------MSYGCYSGN
Q9D6S9_MOUSE/1-169-----------------------------------------------------------------------MTYSCRSGS
W5NRP7_SHEEP/1-163-----------------------------------------------------------------------MSYNCCSGN

PF01500

KRA11_HUMAN/1-177SSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSCCQPSCCETSCCQPS-CYQTSS--CGTGCGIGGGIGYGQEGSS
KRA3A_SHEEP/1-130TVSRPVTFVSRCTRPI......................CEP......CRRPV-CCDPCS--LQEGC..............
Q28707_RABIT/1-126QCCQP.....SCCRPTCCI................SSCCRPQCCQSVCCQPT-CCRPSC--YISSC..............
KRB2C_SHEEP/1-152SCCQPT....................................SIQTSCCQPT-CLQTSG--CETGCGIGGSTGYGQVGSS
KRA13_HUMAN/1-177S..............................................CCQPS-CCQTSS--CGTGCGIGGGIGYGQEGSS
O70148_RAT/1-188SCCQPTCSQSSCCQPTCSQ................SSCCQPSCCQTSCCQPT-CCQNSS--CQTSC...CGTGSGQEGGS
E9LK77_SHEEP/1-172SCCQPISIQTSCCQPT..........................SIQTSCCQPT-CLQTSG--CETGCGIGGSIGYGQVGSS
KRB2D_SHEEP/1-182SCCQPTSIQTSCCQPTSIQ................TSCCQPISIQTSCCQPT-CLQTSG--CETGCGIGGSIGYGQVGSS

PF13885

D3ZD90_RAT/24-64-----------------------------------------------CWRPS.CV.TSC..CQP.C--------------
D3ZD90_RAT/98-141-----------------------------------------------CCQPS.CCQSSC..CQPSC--------------
D4A8A6_RAT/96-153-----------------------------------------------CCRPV.CCQTTC..CQSSC--------------
A6NC61_HUMAN/112-155-----------------------------------------------CCNPC.CCQSSC..CVPVC--------------
D3Z5T3_MOUSE/78-122-----------------------------------------------CCTPS.CCQQSS..CQPAC--------------
D3ZDA4_RAT/29-74-----------------------------------------------CCRTT.CCRPSC..CVSSC--------------
D3ZMN9_RAT/83-127-----------------------------------------------CCRTT.CCRPSC..CVSSC--------------
D3ZMN9_RAT/143-187-----------------------------------------------CCRPC.CGSSSC..CGSSC--------------
D3ZNY7_RAT/180-226-----------------------------------------------CCQPS.CCVTLC..CRPVC--------------
D3ZTU8_RAT/144-188-----------------------------------------------CCQSS.CCKPCC..CQSSC--------------
D3ZV25_RAT/59-103-----------------------------------------------CCRPS.CCQSVC..CQPTC--------------
D3ZV25_RAT/69-113-----------------------------------------------CCQPT.CCRPSC..CVSSC--------------
D4A5R4_RAT/44-90-----------------------------------------------CCRPQ.CCQSVC..CQPTC--------------
KRA45_HUMAN/25-69-----------------------------------------------CCQTT.CCRTTC..CRPSC--------------
KRA45_HUMAN/105-150-----------------------------------------------CCRPQ.CCQSVC..CQPTC--------------
A0JN45_BOVIN/96-140-----------------------------------------------CCISS.PCQQDC..CEPVC--------------
A0JN45_BOVIN/141-186-----------------------------------------------CCEASLCSTSSC..CQQSS--------------
A2A4L9_MOUSE/69-113-----------------------------------------------CCRPS.CCRPSC..CRPSC--------------
A2A4M0_MOUSE/24-68-----------------------------------------------CCRPS.CCVSSC..CRPQC--------------
A2A4M2_MOUSE/84-127-----------------------------------------------CCQP..CCQPSC..CQSSC--------------
A2A5X3_MOUSE/75-120-----------------------------------------------CCSPP.CCQPSC..CETTC--------------
A2A5X3_MOUSE/232-274-----------------------------------------------CCRTT.CCKPTC..VI.SC--------------
KR161_MOUSE/88-132-----------------------------------------------CAQPV.CCEATI..CEPSC--------------
A4IF42_MOUSE/141-185-----------------------------------------------CCKPC.CCQSSC..CKPCC--------------
KR108_BOVIN/111-155-----------------------------------------------CCRPV.CCRPVC..CTPVC--------------
KR161_HUMAN/68-112-----------------------------------------------CAQPL.CCDPVI..CEPSC--------------
KR161_HUMAN/128-172-----------------------------------------------CCQPV.CFEATV..CEPSC--------------
KR161_HUMAN/193-237-----------------------------------------------LCKSS.CCQPVV..CEPSC--------------
KRA96_HUMAN/80-124-----------------------------------------------CCSTP.CYQPIC..CGSSC--------------
KR291_HUMAN/115-159-----------------------------------------------CCQEK.CCDASP..CQQSS--------------
KR291_HUMAN/165-209-----------------------------------------------SCPET.SCLPTI..CTASP--------------
KRA91_HUMAN/37-79-----------------------------------------------CCQPS.CCVPSC..CQP.C--------------
KRA91_HUMAN/80-122-----------------------------------------------CCSTP.CCQPTC..CGSSC--------------
B1AQ90_MOUSE/24-68-----------------------------------------------CCQTT.CCRTTC..CRPSC--------------
B1AQ90_MOUSE/79-123-----------------------------------------------CCQSV.CCQPTC..CRPSC--------------
B1AQA8_MOUSE/109-152-----------------------------------------------CCRPS.CCRPSC..CVSSC--------------
B1AQA9_MOUSE/24-68-----------------------------------------------CCQTT.CCRTTC..CRPSC--------------
B1AQA9_MOUSE/178-222-----------------------------------------------CCRPC.CGSSSC..CGSSC--------------
D2HJK5_AILME/29-73-----------------------------------------------SCQTT.CYVPSS..CQTTC--------------
D3ZDT9_RAT/84-128-----------------------------------------------CCRPS.CCTSSC..CRPCC--------------
D3ZJ72_RAT/72-115-----------------------------------------------CCDTA.CCDSKC..CKPTC--------------
D3ZW67_RAT/79-121-----------------------------------------------CCVSS.CCQP.C..CRPSC--------------
D3ZRR1_RAT/101-148-----------------------------------------------CCVPS.CCQPSC..CQL.C--------------
D3ZUG4_RAT/130-173-----------------------------------------------CCKPV.CCTP.I..CSESC--------------
D4A3Q1_RAT/42-85-----------------------------------------------CCEPC.GCAPSC..CQPSC--------------
KR121_HUMAN/24-68-----------------------------------------------CYIPV.GCQSSV..CVPVS--------------
KR101_HUMAN/71-113-----------------------------------------------CTS...SCTPSC..CQQSS--------------
KR103_HUMAN/84-128-----------------------------------------------SCQPA.CCTSSP..CQQAC--------------
KR105_HUMAN/60-102-----------------------------------------------PCQSG.CT..SS..CTPSC--------------
KR105_HUMAN/199-244-----------------------------------------------CCQQS.SCQPAC..CTTSC--------------
KR106_HUMAN/265-311-----------------------------------------------PCQHA.CCVPVCSGASTSC--------------
KR104_HUMAN/349-395-----------------------------------------------CCTTS.CCRPSS..SVSLL--------------
Q148I6_BOVIN/91-135-----------------------------------------------SCQSA.CCTSSP..CQQAC--------------
Q64526_MOUSE/118-164-----------------------------------------------CCQP..CCRPSC..CQSSC--------------
Q8CAY5_MOUSE/64-107-----------------------------------------------CCPPT.CCDPAS..CDSNC--------------
KRA98_HUMAN/18-60-----------------------------------------------CWKPT.TV.TTC..SSTPC--------------
KRA98_HUMAN/65-109-----------------------------------------------CCQPS.CCSTPC..CQPTC--------------
KRA93_HUMAN/56-99-----------------------------------------------CCRTT.CCQPI...CVTSC--------------
KRA92_HUMAN/32-75-----------------------------------------------CSSTP.CCQPAC..CVSSC--------------
KRA44_HUMAN/70-114-----------------------------------------------CCRPQ.CCQSVC..CQPTC--------------
KRA44_HUMAN/115-159-----------------------------------------------CCQPT.CCCPSY..CVSSC--------------
KRA42_HUMAN/85-129-----------------------------------------------CFRPQ.CCQSVY..CQPTC--------------
KR121_MOUSE/19-63-----------------------------------------------SCQPS.CCVSSP..CQASC--------------
F1N3V7_BOVIN/76-118-----------------------------------------------CCKPT.CV.TTC..CQHNC--------------
H0XZU6_OTOGA/5-48-----------------------------------------------CCGSV.CSDQGC..GQETC--------------
KR107_HUMAN/41-84-----------------------------------------------CCEPP.CCAPSC..CAPAP--------------
Q9D732_MOUSE/24-68-----------------------------------------------CCVSS.CCRPQC..CQSVC--------------

PF05287

KRA14_MOUSE/1-166FS.QSFGGQLQYPISSCGS..SYPNNVFYSTDLQTPITHQLGSSLHSGCQET-FCEPTN--CQTAY--------------
KR261_HUMAN/4-210SNSGSLRTSRHIPLTSID...LCPTSVSCGDVLYLPTSSQDHTWVTDNCQET-CGEPTS--CQPVH--------------
Q9D6L6_MOUSE/1-179HSSSSCRNSSHVPVTSPVTSGVCSTETRGKDAPCSPTSSQGSNTPRDNCQEP-CGEPRS--CQSTS--------------
KR241_HUMAN/6-191CSTTSYRTHCYIPVTSSVT..LSSSDLSPTFGHCLPSSYQGNLWLLDYCQES-YGEAPT--CKSPS--------------
KR261_MOUSE/4-213CSSGSLRNTCHIPASSSIA..LCSTNMGCGEVFCVPSSCQDHTWFMDNCPET-FAEPLS--GQPPS--------------
Q9D6T8_MOUSE/1-200FSSRSLRSCLPSSGSCRGS..SYPSNLVYTTTSCSPSTCQLSSSVRSGCQES-CIEPIR--CQESC--------------
KR132_HUMAN/1-170FSSRSCGDYLRYPASSRGF..SYPSNLVYSTDLCSPSTCQLGSSLYRGCQEI-CWEPTS--CQTSY--------------
KR271_HUMAN/1-201...HSLRSFHNAPPLSAIT..HGTNPITFEDRLCLPSSFHSRTCFLDNFQET-CNETTS--CQMTN--------------
Q8K198_MOUSE/1-165FSSRSSGDHLSYPHSSCGS..SYPSHLLQSTRFYSPGTCHLGSSLHSGCQQN-CFQPIR--CQTSH--------------
Q9D6S9_MOUSE/1-169FSSRSYGGQLCYP.SSCGS..SFPRQLTHRTNFCSPRNRHLGSSFRHGYHQN-CFQPIR--CQTSH--------------
W5NRP7_SHEEP/1-163FSSRSLQDHLRYSGSSCGS..SFPSNLVYSTDLCSPSSCQLGSSLYS..QET-CCEPIR--TQTVV--------------

PF01500

KRA11_HUMAN/1-177GAVSTRIRWCR--------------------PDCRVEGTCLPPCC--V-VSCTPP--SC----CQLHHAE----ASCC-R
KRA3A_SHEEP/1-130.........CR--------------------PITCCPTSCQAVVC--R-PCCWAT--TC----CQPVSVQ----CPCC-R
Q28707_RABIT/1-126.........CR--------------------PTCCRPTCCRPTCC--R-PTSCQT--TC----CRT....----.QCC-R
KRB2C_SHEEP/1-152GAVSSRTRWCR--------------------PDCRVEGTSLPPCC--V-VSCTSP--SC----CQLYYAQ----ASCC-R
KRA13_HUMAN/1-177GAVSTRIRWCR--------------------PDCRVEGTCLPPCC--V-VSCTPP--TC----CQLHHAE----ASCC-R
O70148_RAT/1-188GATSCRVRWCR--------------------PDCRVEGTCLPPCC--V-VSCTPP--TC----CQLHHAQ----ASCC-R
E9LK77_SHEEP/1-172GAVSSRTRWCR--------------------PDCRVEGTSLPPCC--V-VSCTPP--SC----CQLYYAQ----ASCC-R
KRB2D_SHEEP/1-182GAVSSRTKWCR--------------------PDCRVEGTSLPPCC--V-VSCTSP--SC----CQLYYAQ----ASCC-R

PF13885

D3ZD90_RAT/24-64---------CQ--------------------P.SC....CGSSCC..Q.P.CCQT..TC....CR.........T.CF.Q
D3ZD90_RAT/98-141---------CQ--------------------P.RC....CISSCC..Q.P.CCRP..SC....CQ.........SSCC.K
D4A8A6_RAT/96-153---------CR--------------------P.VCCQTTCRPSCG..V.SSCCRP..VC....CQTTCRPSCGVSSCC.R
A6NC61_HUMAN/112-155---------CQ--------------------S.SC....CKPCCC..Q.SSCCVS..SC....CR.........S.CC.S
D3Z5T3_MOUSE/78-122---------CT--------------------C.SP....CQQPCC..V.TLCCKP..VC....CT.........PICS.G
D3ZDA4_RAT/29-74---------CR--------------------P.QC....CQSVCC..QPPTCCRP..SC....CI.........SSCC.R
D3ZMN9_RAT/83-127---------CR--------------------P.SC....CVSSCC..R.PSCCQS..VC....CR.........PSCC.R
D3ZMN9_RAT/143-187---------CR--------------------P.TC....CISSCC..R.PSCCCP..SC....CT.........TCCR.T
D3ZNY7_RAT/180-226---------CT--------------------P.ICS..ASSSSCC..Q.PSCCAP..VC....CK.........PVCC.K
D3ZTU8_RAT/144-188---------CK--------------------P.CC....CQSSCC..K.PCCCQS..SC....CK.........PCCC.Q
D3ZV25_RAT/59-103---------CR--------------------P.SC....CVSSCC..Q.PTCCRP..SC....CI.........SSCC.R
D3ZV25_RAT/69-113---------CQ--------------------P.TC....CRPSCC..I.SSCCRP..SC....CR.........PSCC.V
D4A5R4_RAT/44-90---------CR--------------------P.SC....CRPSCC..I.SSCCRPSSAC....CQ.........SVCC.Q
KRA45_HUMAN/25-69---------CK--------------------P.QC....CQSVCY..Q.PTCCHP..SC....CI.........SSCC.R
KRA45_HUMAN/105-150---------CR--------------------P.SC....CISSCC..H.PSCCES..SC....CR.........PCCCVR
A0JN45_BOVIN/96-140---------CR--------------------P.VC....CKPVCR..T.PVCCTP..VC....CR.........PVCC.T
A0JN45_BOVIN/141-186---------CQ--------------------P.PC....CTSSPC..Q.QACCEP..IC....CT.........PVCC.R
A2A4L9_MOUSE/69-113---------CR--------------------P.SC....CQPSCC..V.SSCCKP..SC....CV.........SSCC.R
A2A4M0_MOUSE/24-68---------CQ--------------------S.VC....CQPTCC..H.PSCCIS..SC....RV.........SSCC.C
A2A4M2_MOUSE/84-127---------CQ--------------------P.SC....CQPSCC..Q.SSCCQP..SC....CQ.........SSCC.Q
A2A5X3_MOUSE/75-120---------YR--------------------TTCC....CYKPTC..A.TNCCQP..SC....YE.........TTCC.K
A2A5X3_MOUSE/232-274---------CQ--------------------P.SC....CETTCC..R.TTCCKP..TC....VI.........S.CC.Q
KR161_MOUSE/88-132---------SM--------------------G.SC....CQPVCC..E.ATICEP..SC....SV.........STCA.Q
A4IF42_MOUSE/141-185---------CQ--------------------S.SC....CKPCCC..Q.SSCCKP..CC....CQ.........SSCC.R
KR108_BOVIN/111-155---------CR--------------------P.VC....CRPVCC..R.PVCCRP..VC....CT.........PVCC.R
KR161_HUMAN/68-112---------SV--------------------S.SG....CQPVCC..E.ATTCEP..SC....SV.........SNCY.Q
KR161_HUMAN/128-172---------SV--------------------S.SC....AQPVCC..E.PAICEP..SC....SV.........SSCC.Q
KR161_HUMAN/193-237---------CS--------------------A.VC....TLPSSC..Q.PVVCEP..SC....CQ.........PVCP.T
KRA96_HUMAN/80-124---------CG--------------------Q.TS....CGSSCG..Q.SSSCAP..VY....CR.........RTCY.H
KR291_HUMAN/115-159---------CQ--------------------E.SV....CMSGSC..Q.AACGQS..VC....CD.........AGSC.Q
KR291_HUMAN/165-209---------CQ--------------------P.TW....CQGSSC..Q.PVSGEG..QP....CK.........STYY.Q
KRA91_HUMAN/37-79---------CH--------------------P.TC....CQNTCC..R.TTCCQP..TC....VA.........S.CC.Q
KRA91_HUMAN/80-122---------CG--------------------Q.TS....CGSSCC..Q.PIC.GS..SC....CQ.........P.CC.H
B1AQ90_MOUSE/24-68---------CV--------------------S.SC....CRPQCC..Q.SVCCQP..TC....CR.........PSCC.R
B1AQ90_MOUSE/79-123---------CR--------------------P.SC....CISSCC..Q.PSCGSS..SC....CG.........SSCC.R
B1AQA8_MOUSE/109-152---------CR--------------------P.SC....CISSCC..R.P.CCRP..CC....GS.........SSCC.G
B1AQA9_MOUSE/24-68---------CV--------------------S.SC....CRPSCC..V.SSCCRP..QC....CQ.........SVCC.Q
B1AQA9_MOUSE/178-222---------CR--------------------P.SC....CRPSCC..V.SSCCRP..QC....CI.........SSCC.R
D2HJK5_AILME/29-73---------YV--------------------P.SS....CQVSCC..V.PSSCQA..SC....SM.........PVIC.R
D3ZDT9_RAT/84-128---------CR--------------------P.SC....CISSCC..R.PSCCIS..SC....CR.........PSCC.R
D3ZJ72_RAT/72-115---------V.--------------------S.IC....CSTPCC..Q.PSCCVP..SC....CV.........PSCC.Q
D3ZW67_RAT/79-121---------CQ--------------------P.C.....CRPSCC..E.SSCCQP..RC....CI.........SSCC.Q
D3ZRR1_RAT/101-148---------FL--------------------P.TC....CETSCC..K.TTSIKP..TCVVLGCS.........TPCC.Q
D3ZUG4_RAT/130-173---------CQ--------------------Q.SS....CQSSCC..Q.PSCCVP..VC....CR.........PVCC.T
D4A3Q1_RAT/42-85---------CV--------------------P.C.....CAPSCC..V.PSCCQA..SC....CA.........PSCC.T
KR121_HUMAN/24-68---------FK--------------------P.AV....CVPVRC..Q.SSVCVP..VS....CR.........PVVY.A
KR101_HUMAN/71-113---------CQ--------------------P.AC....CTSSPC..Q.QACCVP..VC....CK.........PVCC.L
KR103_HUMAN/84-128---------CV--------------------P.VC....CKPVCC..V.PVCCKP..VC....CK.........PICC.V
KR105_HUMAN/60-102---------CQ--------------------P.AC....CASSPC..Q.QACCVP..VC....CK.........PVCC.L
KR105_HUMAN/199-244---------CR--------------------P.SS....SVSLLC..R.PIC.RP..AC....CVP.......ISSCC.A
KR106_HUMAN/265-311---------CQ--------------------Q.SS....CQPACC..T.ASCCRP..SS....SV.........SLLC.H
KR104_HUMAN/349-395---------CR--------------------P.V.....CRPACCVPV.PSCCAP.TSS....CQ.........PSCC.R
Q148I6_BOVIN/91-135---------CE--------------------P.VC....CRPVSC..T.PVCCTP..VY....CR.........PVCC.E
Q64526_MOUSE/118-164---------CR--------------------P.CCQ.PFCLNLCC..Q.PACSGP..VT....CT.........RTCY.Q
Q8CAY5_MOUSE/64-107---------CK--------------------P.T.....CVTICC..S.TPCCQP..SC....CV.........PTCC.Q
KRA98_HUMAN/18-60---------CQ--------------------P.SC....CVSSCC..Q.P.CCRP..TC....CQ.........NTCC.Q
KRA98_HUMAN/65-109---------CG--------------------Q.TS....CGSSCG..Q.SSSCAP..VY....CR.........RTCY.H
KRA93_HUMAN/56-99---------CQ--------------------P.SC....CSTPCC..Q.PTCCGS..SC....GQ.........SSSC.A
KRA92_HUMAN/32-75---------CQ--------------------P.C.....CRPTCC..Q.NTCCRT..TC....CQ.........PTCV.T
KRA44_HUMAN/70-114---------CR--------------------P.QC....CQTTCC..R.TTCCRP..SC....CR.........PQCC.Q
KRA44_HUMAN/115-159---------CR--------------------P.QC....CQTTCC..R.TTCCRP..SC....CV.........SRCY.R
KRA42_HUMAN/85-129---------CR--------------------P.SC....GQTTCC..R.TTCYRP..SC....CV.........STCC.R
KR121_MOUSE/19-63---------FV--------------------S.SP....CQPSCC..V.SSSCQS..AC....CR.........PAIC.I
F1N3V7_BOVIN/76-118---------GG--------------------S.SC....CQP.CC..R.PVRCQT..TC....CR.........TTCL.K
H0XZU6_OTOGA/5-48---------CQ--------------------P.SC....CQTTCC..R.TTCCRP..SC....CV.........SSCC.R
KR107_HUMAN/41-84---------CL--------------------S.LV....CTPVSR..V.SSPCCP..VT....CE.........PSPC.Q
Q9D732_MOUSE/24-68---------CQ--------------------P.TC....CRPSCC..I.SSCCRP..SC....CR.........PSCC.R

PF05287

KRA14_MOUSE/1-166---------VV..............................SRPC--Q-RPFYSQRIRGPCRPCQ---------STFS-G
KR261_HUMAN/4-210---------CETGN..............LETSCGSSTAYYVPRPC--Q-GSSFLPA.SFFSSSCL---------PVSC-R
Q9D6L6_MOUSE/1-179---------CN....................RSTGSPSVCSPITS--G-ISGSQEGTSCLPNTPR---------HSSF-G
KR241_HUMAN/6-191---------CE....................PKTCSTTGCDPSNS--S-VPCNSPSAGQVFSVCE---------TTNV-S
KR261_MOUSE/4-213---------REASG..............FENSCCSST.YCVPRHC--Q-GSGYIPASSFISGSCL---------PASY-R
Q9D6T8_MOUSE/1-200---------IEPIRCQETYIEPIRCQESCIEPIRCQRSCVVPSPC--Q-KPCYYPRSSTPCRPCQ---------GTYA-G
KR132_HUMAN/1-170---------VE..............................SSPC--Q-TSCYRPRTSLLCSPCK---------TTYS-G
KR271_HUMAN/1-201---------CEQDLFTDDSCVQSNCFPGVVQTTYSNSRPCERTAC--Q-SESSSAGLACVSQPCQ---------SEST-Q
Q8K198_MOUSE/1-165---------VV..............................HSSC--Q-RPCYSPRVSSVCSPCR---------TTYA-G
Q9D6S9_MOUSE/1-169---------VV..............................HSSC--Q-RPCYRPSVSSFCSPCR---------ATYA-G
W5NRP7_SHEEP/1-163---------................................SSPC--Q-TSCYRPRTSTFFSPCQ---------TTCS-G

PF01500

KRA11_HUMAN/1-177PSYCGQS-----------------------------------------------------------------------CC
KRA3A_SHEEP/1-130PTSC.PS-----------------------------------------------------------------------AP
Q28707_RABIT/1-126PSCCVST-----------------------------------------------------------------------CC
KRB2C_SHEEP/1-152PSYCGQS-----------------------------------------------------------------------CC
KRA13_HUMAN/1-177PSYCGQS-----------------------------------------------------------------------CC
O70148_RAT/1-188PSYCGQS-----------------------------------------------------------------------CC
E9LK77_SHEEP/1-172PSYCGQS-----------------------------------------------------------------------CC
KRB2D_SHEEP/1-182PSYCGQS-----------------------------------------------------------------------CC

PF13885

D3ZD90_RAT/24-64P-------------------------------------------------------------------------------
D3ZD90_RAT/98-141P-------------------------------------------------------------------------------
D4A8A6_RAT/96-153P-------------------------------------------------------------------------------
A6NC61_HUMAN/112-155K-------------------------------------------------------------------------------
D3Z5T3_MOUSE/78-122P-------------------------------------------------------------------------------
D3ZDA4_RAT/29-74P-------------------------------------------------------------------------------
D3ZMN9_RAT/83-127P-------------------------------------------------------------------------------
D3ZMN9_RAT/143-187T-------------------------------------------------------------------------------
D3ZNY7_RAT/180-226P-------------------------------------------------------------------------------
D3ZTU8_RAT/144-188S-------------------------------------------------------------------------------
D3ZV25_RAT/59-103P-------------------------------------------------------------------------------
D3ZV25_RAT/69-113C-------------------------------------------------------------------------------
D4A5R4_RAT/44-90P-------------------------------------------------------------------------------
KRA45_HUMAN/25-69P-------------------------------------------------------------------------------
KRA45_HUMAN/105-150P-------------------------------------------------------------------------------
A0JN45_BOVIN/96-140P-------------------------------------------------------------------------------
A0JN45_BOVIN/141-186P-------------------------------------------------------------------------------
A2A4L9_MOUSE/69-113P-------------------------------------------------------------------------------
A2A4M0_MOUSE/24-68P-------------------------------------------------------------------------------
A2A4M2_MOUSE/84-127P-------------------------------------------------------------------------------
A2A5X3_MOUSE/75-120P-------------------------------------------------------------------------------
A2A5X3_MOUSE/232-274P-------------------------------------------------------------------------------
KR161_MOUSE/88-132P-------------------------------------------------------------------------------
A4IF42_MOUSE/141-185P-------------------------------------------------------------------------------
KR108_BOVIN/111-155P-------------------------------------------------------------------------------
KR161_HUMAN/68-112P-------------------------------------------------------------------------------
KR161_HUMAN/128-172P-------------------------------------------------------------------------------
KR161_HUMAN/193-237P-------------------------------------------------------------------------------
KRA96_HUMAN/80-124P-------------------------------------------------------------------------------
KR291_HUMAN/115-159P-------------------------------------------------------------------------------
KR291_HUMAN/165-209P-------------------------------------------------------------------------------
KRA91_HUMAN/37-79P-------------------------------------------------------------------------------
KRA91_HUMAN/80-122P-------------------------------------------------------------------------------
B1AQ90_MOUSE/24-68P-------------------------------------------------------------------------------
B1AQ90_MOUSE/79-123P-------------------------------------------------------------------------------
B1AQA8_MOUSE/109-152S-------------------------------------------------------------------------------
B1AQA9_MOUSE/24-68P-------------------------------------------------------------------------------
B1AQA9_MOUSE/178-222P-------------------------------------------------------------------------------
D2HJK5_AILME/29-73P-------------------------------------------------------------------------------
D3ZDT9_RAT/84-128P-------------------------------------------------------------------------------
D3ZJ72_RAT/72-115P-------------------------------------------------------------------------------
D3ZW67_RAT/79-121P-------------------------------------------------------------------------------
D3ZRR1_RAT/101-148P-------------------------------------------------------------------------------
D3ZUG4_RAT/130-173P-------------------------------------------------------------------------------
D4A3Q1_RAT/42-85P-------------------------------------------------------------------------------
KR121_HUMAN/24-68A-------------------------------------------------------------------------------
KR101_HUMAN/71-113P-------------------------------------------------------------------------------
KR103_HUMAN/84-128P-------------------------------------------------------------------------------
KR105_HUMAN/60-102P-------------------------------------------------------------------------------
KR105_HUMAN/199-244P-------------------------------------------------------------------------------
KR106_HUMAN/265-311P-------------------------------------------------------------------------------
KR104_HUMAN/349-395P-------------------------------------------------------------------------------
Q148I6_BOVIN/91-135S-------------------------------------------------------------------------------
Q64526_MOUSE/118-164P-------------------------------------------------------------------------------
Q8CAY5_MOUSE/64-107P-------------------------------------------------------------------------------
KRA98_HUMAN/18-60P-------------------------------------------------------------------------------
KRA98_HUMAN/65-109P-------------------------------------------------------------------------------
KRA93_HUMAN/56-99P-------------------------------------------------------------------------------
KRA92_HUMAN/32-75S-------------------------------------------------------------------------------
KRA44_HUMAN/70-114S-------------------------------------------------------------------------------
KRA44_HUMAN/115-159P-------------------------------------------------------------------------------
KRA42_HUMAN/85-129P-------------------------------------------------------------------------------
KR121_MOUSE/19-63P-------------------------------------------------------------------------------
F1N3V7_BOVIN/76-118P-------------------------------------------------------------------------------
H0XZU6_OTOGA/5-48P-------------------------------------------------------------------------------
KR107_HUMAN/41-84S-------------------------------------------------------------------------------
Q9D732_MOUSE/24-68P-------------------------------------------------------------------------------

PF05287

KRA14_MOUSE/1-166SLGFGSR..GFQSFGC..........G...YPSQG.FGSHGFQSVGCGTPTFSSLNCGSS..FYRPTCF.........ST
KR261_HUMAN/4-210PQRYVSS..GCRPLRP..........LLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTS..GCQPSSCLAYRPQSLHVV
Q9D6L6_MOUSE/1-179RPAFCRQPMSCYVPSY..........LSDGCQPLG.YMTYGRPPWRNLTYGSQPF.......SCMPGCY.........GS
KR241_HUMAN/6-191PSPSCSP..STQTNGYVCNCHIPTRNASKACQTLR.NGSNCFGQLNCLSKSFQTLN......HCRLSTL.........GY
KR261_MOUSE/4-213PVSYVSS..SCRPVSP..........FMNNCRPVS.CVSGGYRPLPCGSNSCRPLGIVTY..GCRPSGCVTYGPQTIHIV
Q9D6T8_MOUSE/1-200SLGFGSR..SCSSLAY..........GSRSCYPVG.CGSSGFRSLDCGVYGFPSLSYGSR..FYYPVYV.........AS
KR132_HUMAN/1-170SLGFGSS..SCRSLGY..........GSRSCYSVG.CGSSGVRSLGYGSCGFPSLGYGSG..FCRPTYL.........AS
KR271_HUMAN/1-201QMGFVAQ..SCQPASL..........KGNSCPPKT.SKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESS
Q8K198_MOUSE/1-165SQSFGSS..SCHSQGY..........GSRSSYSLN.CGSSGFRPQR.....VSSLGYGSG..FCHPSYV.........PY
Q9D6S9_MOUSE/1-169FLGFRSS..SCHSQVY..........GSRRVYTSG.CGSSCFRPVSYRVCGYPSFGYGSR..FCHPTYV.........TS
W5NRP7_SHEEP/1-163SLGFGSS..NLQSAGH.............VFPSLG.FGSGGFQSVGHSPNIFSSLSCRSS..FYRPTFF.........SS

PF01500

KRA11_HUMAN/1-177RPVC.......CCY............CSEPTC
KRA3A_SHEEP/1-130RTTCRTFRTSPC...................C
Q28707_RABIT/1-126RPCC...SSGSC...................C
KRB2C_SHEEP/1-152RPAC.......CCQPTCTEPVC.EPTCSQPIC
KRA13_HUMAN/1-177RPVC.......CCY............SCEPTC
O70148_RAT/1-188RPAC.......CCH..CCEPSCSKPSCSEPSC
E9LK77_SHEEP/1-172RPAC.......CCQPTCIEPIC.EPSCCEPTC
KRB2D_SHEEP/1-182RPAC.......CCQPTCIEPVC.EPTCCEPTC

PF13885

D3ZD90_RAT/24-64-------------------------------S
D3ZD90_RAT/98-141-------------------------------C
D4A8A6_RAT/96-153-------------------------------V
A6NC61_HUMAN/112-155-------------------------------S
D3Z5T3_MOUSE/78-122-------------------------------C
D3ZDA4_RAT/29-74-------------------------------S
D3ZMN9_RAT/83-127-------------------------------S
D3ZMN9_RAT/143-187-------------------------------C
D3ZNY7_RAT/180-226-------------------------------C
D3ZTU8_RAT/144-188-------------------------------S
D3ZV25_RAT/59-103-------------------------------S
D3ZV25_RAT/69-113-------------------------------C
D4A5R4_RAT/44-90-------------------------------T
KRA45_HUMAN/25-69-------------------------------Y
KRA45_HUMAN/105-150-------------------------------V
A0JN45_BOVIN/96-140-------------------------------V
A0JN45_BOVIN/141-186-------------------------------V
A2A4L9_MOUSE/69-113-------------------------------S
A2A4M0_MOUSE/24-68-------------------------------S
A2A4M2_MOUSE/84-127-------------------------------R
A2A5X3_MOUSE/75-120-------------------------------A
A2A5X3_MOUSE/232-274-------------------------------S
KR161_MOUSE/88-132-------------------------------V
A4IF42_MOUSE/141-185-------------------------------C
KR108_BOVIN/111-155-------------------------------M
KR161_HUMAN/68-112-------------------------------V
KR161_HUMAN/128-172-------------------------------V
KR161_HUMAN/193-237-------------------------------T
KRA96_HUMAN/80-124-------------------------------T
KR291_HUMAN/115-159-------------------------------S
KR291_HUMAN/165-209-------------------------------I
KRA91_HUMAN/37-79-------------------------------S
KRA91_HUMAN/80-122-------------------------------T
B1AQ90_MOUSE/24-68-------------------------------S
B1AQ90_MOUSE/79-123-------------------------------C
B1AQA8_MOUSE/109-152-------------------------------S
B1AQA9_MOUSE/24-68-------------------------------T
B1AQA9_MOUSE/178-222-------------------------------T
D2HJK5_AILME/29-73-------------------------------A
D3ZDT9_RAT/84-128-------------------------------C
D3ZJ72_RAT/72-115-------------------------------S
D3ZW67_RAT/79-121-------------------------------C
D3ZRR1_RAT/101-148-------------------------------C
D3ZUG4_RAT/130-173-------------------------------I
D4A3Q1_RAT/42-85-------------------------------T
KR121_HUMAN/24-68-------------------------------P
KR101_HUMAN/71-113-------------------------------T
KR103_HUMAN/84-128-------------------------------V
KR105_HUMAN/60-102-------------------------------T
KR105_HUMAN/199-244-------------------------------A
KR106_HUMAN/265-311-------------------------------V
KR104_HUMAN/349-395-------------------------------A
Q148I6_BOVIN/91-135-------------------------------S
Q64526_MOUSE/118-164-------------------------------T
Q8CAY5_MOUSE/64-107-------------------------------S
KRA98_HUMAN/18-60-------------------------------I
KRA98_HUMAN/65-109-------------------------------T
KRA93_HUMAN/56-99-------------------------------V
KRA92_HUMAN/32-75-------------------------------C
KRA44_HUMAN/70-114-------------------------------V
KRA44_HUMAN/115-159-------------------------------H
KRA42_HUMAN/85-129-------------------------------T
KR121_MOUSE/19-63-------------------------------V
F1N3V7_BOVIN/76-118-------------------------------I
H0XZU6_OTOGA/5-48-------------------------------.
KR107_HUMAN/41-84-------------------------------.
Q9D732_MOUSE/24-68-------------------------------S

PF05287

KRA14_MOUSE/1-166KSC.QS...............VSYQPTCGTGF
KR261_HUMAN/4-210SSSLRPLGPLFSGCQPLTHVFSTCRPSC.SGL
Q9D6L6_MOUSE/1-179TSY.NY...............SSFQPYSSSLS
KR241_HUMAN/6-191KSY.QN...............PCFIPSYVSPL
KR261_MOUSE/4-213SNSLRPLQPVCGGCQPSIPVFGTCRPSCSAQG
Q9D6T8_MOUSE/1-200TGF.QP...............SCYRSVCGTGF
KR132_HUMAN/1-170RSC.QS...............PCYRPAYGSTF
KR271_HUMAN/1-201PGV.EP...............TC....CVTGG
Q8K198_MOUSE/1-165RTC.QS...............PCYRPSCGTGS
Q9D6S9_MOUSE/1-169RNF.QS...............SCHRPTCGSTK
W5NRP7_SHEEP/1-163RSG.QS...............LSFQPTCGSGF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window