Sequence alignment for CL0523

PF03564

A7SE42_NEMVE/491-638-------------F--AG--SVGEWQEFWDGFESSIHSNPRLATVDKFNYL-----------------------------
Q17051_ASCLU/155-293-------------F--SG--NPKEWTGFWETFNSAV...GHLPKIQCLNYL-----------------------------
Q23992_DROME/160-308-------------F--FG--DSKEWDLFNELFTELIHVREDLSPSLKFNYL-----------------------------
A7XDH0_DROAN/157-302-------------F--GG--IYKEWPAFKALYISTVHSKQHLGKIQKYHYL-----------------------------
Q4JS97_ANOGA/133-280-------------F--DG--EITKWLTFKDRFSSMVHDSTEMPEVLKLQYL-----------------------------
Q4EAY5_9RICK/161-306-------------F--SG--DYKEWPAFWDIYKSTIHKKRQLSDTQKFHYL-----------------------------

PF13961

Q5AT23_EMENI/319-345-------------L--DR.TNVSSWKVQYKLF------------------------------------------------
Q5AT23_EMENI/515-541-------------L--TK.TNVTTWKSDVREF------------------------------------------------
A9RSN5_PHYPA/14-40-------------F--DG.SWYSIWKKKIQMK------------------------------------------------
B0D6P6_LACBS/11-37-------------L--NN.SNYAEWSVRMEAI------------------------------------------------
B0WQU4_CULQU/10-36-------------L--DG.TNWPVWEMRVEAL------------------------------------------------
B0WWB7_CULQU/11-37-------------L--NE.ANWSTWKLRMEAL------------------------------------------------
B4K1A4_DROGR/12-38-------------L--DG.ENYVVWSVHMKSV------------------------------------------------
B4LA17_DROMO/10-36-------------L--DE.GNYDTWRVQMRSV------------------------------------------------
B4LAF9_DROMO/10-36-------------L--DE.NNYGVWHMAMESV------------------------------------------------
B4LE08_DROVI/13-41-------------L--SGRDNYKEWSHKVELH------------------------------------------------
B4MX54_DROWI/10-37-------------L--RGRENYDVWKRQAQSY------------------------------------------------
B4NQE5_DROWI/11-37-------------L--NA.ENYDTWKLRMRAI------------------------------------------------
B4NQR9_DROWI/10-36-------------L--ED.SNYDWWCIQMKSV------------------------------------------------
B6HA76_PENCW/19-46-------------L--TGSDNFATWKRLMTSY------------------------------------------------
B6QCF0_PENMQ/36-62-------------A--GR.SNIKNWKLRMQIF------------------------------------------------
B9NDW0_POPTR/15-41-------------L--IE.SNYKVWRTCLESY------------------------------------------------
B9RBX9_RICCO/17-43-------------L--TG.DNYSKWAVKMQCY------------------------------------------------
B9RC68_RICCO/10-37-------------L--GSYNNYANWSACMKSY------------------------------------------------
B9S5P6_RICCO/16-42-------------L--DS.DHYNIWHLKMHYV------------------------------------------------
C5GBD9_AJEDR/188-215-------------L--TGTSNYTTWSISMKLK------------------------------------------------
C5WNA6_SORBI/166-192-------------L--TR.TNYGEWAVTMKVK------------------------------------------------
C5XQM0_SORBI/42-68-------------L--TK.SNYHEWSTLMRLK------------------------------------------------
C5XUK3_SORBI/137-163-------------L--DK.SNYYEWSQTMKLR------------------------------------------------
C5Z583_SORBI/42-68-------------L--TR.TNYGEWATQMKWK------------------------------------------------
C6JSM1_SORBI/23-49-------------L--TA.NNYISWSIRVRAI------------------------------------------------
C7J1L6_ORYSJ/181-207-------------L--TK.TNYIEWAAVMRVR------------------------------------------------
C7J1U3_ORYSJ/16-44-------------F--DG.TNYAQWKIHMISY------------------------------------------------
C7J5A1_ORYSJ/49-75-------------L--TK.TNYNDWALLMKIK------------------------------------------------
C7J6P4_ORYSJ/14-42-------------F--DG.TDFPHWCCKMQSY------------------------------------------------
C7J7K5_ORYSJ/83-109-------------L--TR.TNYTDWALVMRVN------------------------------------------------
D0NBZ2_PHYIT/18-44-------------F--DG.ADFEMWLERVKLK------------------------------------------------
D0P386_PHYIT/3-29-------------F--NG.KNYAPWKARIKTL------------------------------------------------
D0P4P1_PHYIT/16-42-------------F--DG.TGYRVWARQLQLY------------------------------------------------
D0RLQ9_PHYIT/21-47-------------F--DG.KDYEVWHERVKLK------------------------------------------------
D2A4C7_TRICA/13-39-------------L--NK.ENYDTWKIQMQAV------------------------------------------------
D2A543_TRICA/14-40-------------F--NG.KDYDHWKFRMEII------------------------------------------------
Q0DA14_ORYSJ/28-54-------------L--TR.ANYHQWALVMRVS------------------------------------------------
Q0IZT5_ORYSJ/33-59-------------L--TS.TNYSTWAIKMEAN------------------------------------------------
Q0J5Y3_ORYSJ/54-80-------------L--TR.TNYDEWAMLMQVN------------------------------------------------
Q16S15_AEDAE/12-38-------------F--DG.TNFSNWSFRMESY------------------------------------------------
Q6K285_ORYSJ/82-108-------------L--TK.TNYSNWELLMKVK------------------------------------------------
Q75M81_ORYSJ/48-74-------------L--TR.SNYSDWAVLMRVN------------------------------------------------
Q7G5Z8_ORYSJ/52-78-------------L--TS.SNYIEWSLLMKVN------------------------------------------------
Q7G756_ORYSJ/12-40-------------F--DG.TDFPYWCSKMQSY------------------------------------------------
Q7XKY1_ORYSJ/53-79-------------L--TK.TNYSDWSLLMRAM------------------------------------------------
Q7XMT1_ORYSJ/56-82-------------L--SR.TNYPDWALLMRVN------------------------------------------------
Q84Q85_ORYSJ/36-62-------------L--TR.TNYHEWSLVMQVS------------------------------------------------
Q850T3_ORYSJ/12-40-------------F--DE.TGFSYWCSKMQSY------------------------------------------------
B9GKP2_POPTR/14-39-------------L--SG.SNYNLWIQGMKSF------------------------------------------------
B9HL08_POPTR/16-42-------------L--RG.DNYDDWSACMKSY------------------------------------------------
D7U4H2_VITVI/8-34-------------L--TE.DNYENWKACLQSY------------------------------------------------
F6H7D5_VITVI/16-42-------------L--DG.NNYSYWSYVMRNF------------------------------------------------
F6HTJ6_VITVI/13-39-------------L--NN.QNYNTWSTCMMSY------------------------------------------------
F6HVN0_VITVI/97-122-------------L--TE.NNYENWSTCVKWY------------------------------------------------
F6HVN2_VITVI/18-42-------------.--.E.GNYENWRTCIKRY------------------------------------------------
I1Q6P1_ORYGL/57-85-------------F--DG.THYAAWKHKMKLH------------------------------------------------
Q0IZC5_ORYSJ/9-35-------------F--AG.ENYDIWSIKMRTL------------------------------------------------
Q0J8A6_ORYSJ/26-52-------------L--TA.TNYTSWCIRVQAM------------------------------------------------
Q53L57_ORYSJ/161-185-------------F--DG.INYNHWAQHMHLN------------------------------------------------
Q60EK9_ORYSJ/143-168-------------.--EE.NNYGVWAVKMKIF------------------------------------------------
Q682G3_ARATH/13-39-------------L--TK.SNYDNWSLRMKAI------------------------------------------------
Q7X7W1_ORYSJ/19-45-------------L--TK.TNYGDWALMMKVM------------------------------------------------
Q852C7_ORYSJ/12-40-------------F--DG.HNFVIWKARMEAY------------------------------------------------
Q8S5D4_ORYSJ/104-130-------------L--TR.TNYEECALFMTVN------------------------------------------------
Q8SAX3_ORYSJ/39-67-------------F--NG.TDYAAWKHKMKMH------------------------------------------------
Q94GR9_ORYSJ/14-42-------------F--NG.TNYSTWKIKMSTH------------------------------------------------
Q9AUM6_ORYSJ/511-536-------------L--TK.TNYAEWAMVMKVK------------------------------------------------
U5G3M5_POPTR/16-42-------------F--NG.TNYDFWAVKMKTV------------------------------------------------

PF14893

H0XX29_OTOGA/1-328-------------M--AL-AMLQDWCGWMGANAQRALLILGIPDDCQEDEF......RAALHAALWPLGRHRVLSKVFRK
M3Z644_MUSPF/1-327-------------M--TL-RLLEDWCRGMDVDPRRAVLVAGIPPTCTVAEI......EEALRAGLAPLGECRLLGRMFRR
F7CY48_HORSE/1-330-------------M--PL-VMLQDWCRWSGANAQRSLLILGIPEDCEDREF......QEAVRAALWPLGRYRVLGNVFRK
M4B0W2_XIPMA/1-317-------------M--GM-AQLRHWCKGEGIDPEYAILVKNVPEEVEVNTI......EETLQ.SIKALGRVKVRGRMYDP
F6TXQ3_HORSE/2-329-------------M--AL-ALLEDWCRIMSVDDQKSLMVMGIPVDCDEAEI......QEVLQETLKSLGRYRLLGKIFRK
D3Z8Y9_RAT/1-327-------------M--PL-NLLQDWCRGEHLNIQRSMLILGIPEDCTEDEF......EETLHEALKHLGRYRIIGRMFRR
M4AZW3_XIPMA/2-318-------------.--.M-TQLLHWCKGEGINPLHAVLVKDIPEETEVSVI......EDTLQ.TIKALGRVRVRGRMYDP
F7AVZ0_XENTR/7-324-------------.--..-.....WCNALGLNPQKVAVVGPMMPRVKEDSI......YEILDGE...........PIFFR
PNMA5_HUMAN/1-322-------------M--AL-TLLEDWCKGMDMDPRKALLIVGIPMECSEVEI......QDTVKAGLQPLCAYRVLGRMFRR
G1PM76_MYOLU/2-362-------------M--TM-TLLEDWCRGMDVDIHRALLVTGIPQDCGPEEM......EETLSRVLSPLGPYRVLNRIFVR
F7D322_HORSE/1-321-------------M--AV-TLLEDWCKGMDLDPRKALLIVGIPVECSEAEI......KETVKAGLQPLCAYKVLGRMFRR
G3N1H8_BOVIN/3-317-------------.--.L-ALLRDWCRWMGVNEERSVLLLGIPDDCEDQEF......RDAVQAALGPLGRYRVLGKVFRK
F1S2C6_PIG/1-333-------------M--AL-AMLRDWCRWMGVKAQRALLILGIPDDCEDQEFLEDQEFQEAVRAALRPLGRYRVLGKVFRK
H2PX42_PONAB/1-327-------------M--PL-TLLQDWCRGEHLNTQRCMLILGIPEDCGEDEF......EETLQEACRPLGRYRVIGRMFRR
G1LQR5_AILME/1-315-------------M--AL-AMLRDWCRWMGVNAHRSLLILGIPDDCGEEEF......QKAVHAALWPLGGYRVLGKVFRK
PNMA5_MOUSE/1-323-------------M--AV-ALLDDWCKGMDLDPKKAVLIVGIPVQYTEAAI......NDALKEGLPPLCAYKVIGRMFRR
PNML1_BOVIN/3-358-------------M--AA-NLLEDWCRGMEADIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGPYSVLNKIFLR
G3U141_LOXAF/1-317-------------M--AL-AMLRDWCRWMGVNAQRSLLLLGIPDDCDENEF......QEAVRAALWPLGRYRVQGKVFRK
H0W6U3_CAVPO/1-332-------------M--GL-SMLRDWCRWMGVNAQRCLLIMGIPDDCEEDEF......QERVQAALRPLGRYRVLCRVFRK
H0VWL7_CAVPO/1-322-------------M--AV-VLLEDWCKGMDLDPRKALLIVGIPVECSEAEI......KETVQEGLYPLSMYRIVGRMFRR
PNML1_PONAB/5-364-------------M--AM-NLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLAPLGPYRVLNKIFVR
H0VK73_CAVPO/6-363-------------.--AM-NLLEDWCRGMEVDVHRSLLVTGIPEDCGQAEL......EETLNGVLAPLGTYRVLNKIFLR
G3U379_LOXAF/1-308-------------M--AV-AMLRDWCRWMGVSARRGLLVLGIPEDCEEAEV......HEALEAALWPLGRFSVLGRVFRE
M4AZA8_XIPMA/3-326-------------.--.V-TKLKNWCLGEGINESHALLTK.VPQNTEVAQI......EETLQ.TIKCLGRVRVRGRMFDE
PN6BL_HUMAN/1-326-------------M--AL-AMLRDWCRWMGANAERSLLILGIPDDCKEHEF......QEAVRAALSPLGRYRVLTKHFRK
D2GZV4_AILME/1-325-------------M--AM-TLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI......EETLQAAM.PQVRYRVLGRMFWR
F6Z9T2_HORSE/5-364-------------M--AM-NLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGQYLVLNKIFLR
PNML1_MOUSE/6-363-------------.--AM-TLLEDWCRGMGMDIHRSLLVTGIPEYCSHAEI......EETLNGVLLPLGTYRVLNKIFLR
F1PIM5_CANFA/1-358-------------M--AM-NLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGPYFVLNKIFLR
F7H8Z7_CALJA/1-318-------------M--AR-AMIQDWCRWMGVNAERSLLILGIPDDCEEHEF......QEAVRAALSPLGRYRVLTKVFRR
PNM6B_HUMAN/1-319-------------M--AV-TMLQDWCRWMGVNARRGLLILGIPEDCDDAEF......QESLEAALRPMGHFTVLGKVFRE
G3QYD8_GORGO/1-326-------------M--TL-RLLEDWCRGMDMNPRKALLIAGISQSCSVAEI......EEALQAGLAPLGEYRLLGRMFRR
F6WC96_CALJA/1-321-------------M--AR-AMIQDWCRWMGVNAERSLLILGIPDDCEEHEF......QEAVRAALSPLGRYRVLTKVFRR
Q5BJV6_RAT/1-328-------------M--TL-RLLEDWCRGMDMNPRKALLVAGIPPTCGVADI......EEALQVGLAPLGEHRLLGRMFRR

PF14244

A5AE14_VITVI/10-125NDNPGNIITQ.VQL..KA-.............------------------------------------------------
A5AFL1_VITVI/24-172AEGSSFLITQ.HKL..TG-HNYHQWAKVVLMF------------------------------------------------
A5AL35_VITVI/26-142GDRPGDFITS.TRL..RG-DNYDDWASDIQLA------------------------------------------------
A5APA9_VITVI/42-180TENSTAXIG..IKL..DG-STYALWSQVVZMY------------------------------------------------
A5AR29_VITVI/23-171METSHLPITA.HKL..NG-QNYLQWSQSILMF------------------------------------------------
A5ARJ9_VITVI/24-165SENSIHHITV.HKL..NG-KNYLQWSQSVMMY------------------------------------------------
A5ATA8_VITVI/24-171TDSAIAPIX..IKL..DG-TNYALWSQVVEMY------------------------------------------------
A5AW26_VITVI/23-156LDKPTLNITI.EKL..NG-KFFLEWFHSVKLF------------------------------------------------
A5AXC5_VITVI/8-148SXQSIS.....VRL..DG-NNYSYWSYVMRNF------------------------------------------------
A5AZ64_VITVI/47-175SDHPGLVLIS.KPL..NG-DNYSAWRKAMTLA------------------------------------------------
A5AZK9_VITVI/143-291LDNPTLQITT.EKL..NG-KKFLEWSHFEKLF------------------------------------------------
A5B0N9_VITVI/37-186KKNRFVNFNPKIIL..TE-SNYDVWSQLVELH------------------------------------------------
A5B3L9_VITVI/16-147FDNPSLSITI.HKI..NG-QNFLXWSQFVKLY------------------------------------------------
A5B8L2_VITVI/15-147IENSTAPIG..IKL..NG-SNYALWSQVVEMY------------------------------------------------
A5BAZ3_VITVI/31-163SDSSPILIIG.HKL..NG-HNYLQWSQSVLLF------------------------------------------------
A5BCQ9_VITVI/83-209SDHPGMVLVS.KVI..EG-DNYSTWSRAMRIS------------------------------------------------
A5BG06_VITVI/43-189TDSAIAPIV..IKL..DD-TNYALWSQVVEMY------------------------------------------------
A5BJC0_VITVI/21-165QPGELQNIQAAYRL..DG-KNYLKWSQLVRTV------------------------------------------------
A5BKK0_VITVI/191-331TDSPTV.LG..IKL..DG-SNYALWSQVVEMY------------------------------------------------
A5BM32_VITVI/27-149FDNPGALLVS.KIF..TG-ENYIAWSRSMSIA------------------------------------------------
A5BN45_VITVI/28-176AVNPSLLITG.HKL..NG-HNFLQWSQLVMMY------------------------------------------------
A5BNR5_VITVI/308-456SDQPGHVLVP.IKL..NG-VNYQSWSKAVIHA------------------------------------------------
A5BP26_VITVI/33-181LDHPGIVLVS.HHL..TG-ANYNTWSRAMVMA------------------------------------------------
A5BQW4_VITVI/215-363SLNSNLQLMV.HKL..NK-KNYLESAQFLKLA------------------------------------------------
A5BSG2_VITVI/5-152HETTSPTIS..IKL..DG-TNYSVWSQILDMH------------------------------------------------
A5BT41_VITVI/40-187SHEPTTQIG..IKL..DG-TNYALWSQIVEMY------------------------------------------------
A5BVQ3_VITVI/17-164ADSSTTXIG..IKL..EG-SNYALWSQVVEMY------------------------------------------------
A5BWZ5_VITVI/42-189ADSSTTPIG..IKL..EG-SNYALWSQVVEMY------------------------------------------------
A5BXA9_VITVI/396-529SDSSPILITG.HKL..NG-HNYLQWSQSVLLF------------------------------------------------
A5C3H8_VITVI/42-155TEYSIALIN..IKL..DG-SNYALWSQVVEMY------------------------------------------------
A5C4L4_VITVI/24-140SDHPGLVLIS.KSL..NG-DNYSAWKRAMILA------------------------------------------------
A5C4S3_VITVI/27-177GDHPSLSLVS.LSLAGSG-SNYHSWCRSMVTA------------------------------------------------
A5C9I0_VITVI/13-150GDHPGLIFVS.HNL..TG-SNYNTWSRVMAMA------------------------------------------------
B9SLN1_RICCO/35-176SDHTGMILFS.KTL..NG-DNYPGWKRAIKLA------------------------------------------------
O22175_ARATH/27-174SDNPGALISS.VVL..KE-NNYAEWSEELQNF------------------------------------------------
O23588_ARATH/73-209SDHPGLNIVS.HIL..DG-TNYNNWSIAMRMS------------------------------------------------
Q0PY40_SOLLC/17-166SDSSSAVLIP.IKLV.GS-EKYGIWSRAMRIA------------------------------------------------
Q2HT49_MEDTR/20-168SDGPSSLIIT.PKL..NG-SNYLAWHRSMQRA------------------------------------------------
Q2HU07_MEDTR/24-172SEGPNSVTVT.PLL..TG-PNYLAWNRSMKRA------------------------------------------------
Q6L4J8_SOLDE/13-160ADHTGICITP.VVL..KG-YNYEEWAKAMRNA------------------------------------------------
Q9FIC5_ARATH/29-177GDNPGTLISK.PLL..RG-PNYDEWATNLRLA------------------------------------------------
Q9LGZ8_ARATH/19-166SDNPGALISS.VIL..KE-DNYSEWAEELMNS------------------------------------------------
Q9M0P5_ARATH/20-169SDQAGLILVS.DRPS.SG-SEFHSWRRSVRMA------------------------------------------------
Q9XIM3_ARATH/23-161ADHPGLNIIS.HRL..DE-TNYGDWNVAMLIS------------------------------------------------
Q9ZPU4_ARATH/37-185SDNPGAVISS.VEL..NG-DNYNQWATEMLNA------------------------------------------------

PF16297

H0W794_CAVPO/2-110-----------DGR.EQLTKVFMGWPRP....------------------------------------------------
D3ZTE6_RAT/24-138-----------NQLLKQLRILVCERARLLRQV------------------------------------------------
G1MLQ7_AILME/2-114-----------DGRPSALIKALLALPLR.PQT------------------------------------------------
F7ASC6_CALJA/2-113-----------DGR.VQLMKALLAWPLL.PAR------------------------------------------------
Q9D6I0_MOUSE/2-112-----------DRR.IKLIMALMAWPEL..RK------------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204-------------L-----SAFEFLENLKQMF------------------------------------------------
A5BQ76_VITVI/412-525-------------D-----TAYDILENLKEMF------------------------------------------------
A5AHT8_VITVI/92-205-------------T-----RAKAFLDQIANRF------------------------------------------------
B8BH64_ORYSI/219-332-------------T-----TAKVFLETLQKRF------------------------------------------------
A5BI38_VITVI/288-401-------------D-----NVKALLKVIDEQF------------------------------------------------
A5ANU6_VITVI/96-209-------------N-----SAREIWEALENKY------------------------------------------------
A5B8Q0_VITVI/530-643-------------N-----MATKLWLKLESLY------------------------------------------------
A5AQ94_VITVI/79-192-------------T-----TAKGVWNKLEQLY------------------------------------------------
Q18L98_CITSI/81-195-------------K-----TALGIWNKVETLC------------------------------------------------
Q1KUM3_9ROSI/118-231-------------R-----TAFGIWRKLERLH------------------------------------------------
Q7XTM9_ORYSJ/78-191-------------E-----TAAGLWLKLEQIC------------------------------------------------
Q01M93_ORYSA/78-191-------------K-----TSAELWLKLESIC------------------------------------------------
A5AS33_VITVI/79-194-------------K-----TIADLMKALSGMY------------------------------------------------
Q2AA06_ASPOF/860-974-------------T-----SVMKMWEILNNKY------------------------------------------------
Q6XMP8_AEDAL/82-196-------------G-----TAKAMWKSLEDTF------------------------------------------------
D2A543_TRICA/77-191-------------T-----TAYQMWISLEAGF------------------------------------------------
Q9U6V8_DROWI/75-189-------------I-----TARQILENLDAVY------------------------------------------------
A5BIJ4_VITVI/84-197-------------N-----PAYKLWMRQDNLL------------------------------------------------
Q0ZCD8_POPTR/118-230-------------K-----TSQEAWHKLHTMY------------------------------------------------
A5B6L3_VITVI/126-238-------------S-----SAFEVWNTISHNF------------------------------------------------
A5BYA6_VITVI/62-174-------------D-----TSFLFWGRLEQYF------------------------------------------------
A5BK17_VITVI/103-215-------------D-----TSAQVWKTLELYF------------------------------------------------
A5CAE5_VITVI/64-176-------------Q-----TSHEAWTALQQSF------------------------------------------------
A5BJ70_VITVI/81-193-------------Q-----TSHEAWMALHKIF------------------------------------------------
A5BFR8_VITVI/115-227-------------N-----TSHSAWNALESIF------------------------------------------------
Q9SV56_ARATH/103-217-------------H-----TSREVWFSLAKKY------------------------------------------------
Q9SSB1_ARATH/101-216-------------F-----TSHQVWLTLANHF------------------------------------------------
D1GEF6_BRARP/107-222-------------T-----NSYEIWMTLASHF------------------------------------------------
C0SQ79_PYRYE/115-228-------------K-----TAAEVWECLRVLF------------------------------------------------
A5B3I2_VITVI/89-207-------------D-----TAKNIWDSLKQKY------------------------------------------------
A5B8H9_VITVI/153-271-------------D-----TAKCIWDSLKQKY------------------------------------------------
A5BGM4_VITVI/89-207-------------D-----TSQQIWDSMKKKY------------------------------------------------
Q9M1C6_ARATH/91-209-------------S-----TSKAIWESMKKKY------------------------------------------------
A5BYF7_VITVI/162-280-------------N-----TSKSIWDSIRQKY------------------------------------------------
A5BY31_VITVI/28-146-------------N-----TSKQIWDSMKKKY------------------------------------------------
A5BFQ9_VITVI/28-146-------------D-----TAKDIWDAMKKKF------------------------------------------------
Q9C7Y1_ARATH/87-205-------------E-----TSKDLWESMKRKY------------------------------------------------
A5AMT2_VITVI/80-198-------------D-----TAKHIWDSMKKKY------------------------------------------------
Q2QXM6_ORYSJ/85-203-------------K-----KSKKAWDKLKEEF------------------------------------------------
Q6L3N8_SOLDE/84-202-------------E-----TSKQAWEILKQEY------------------------------------------------
A6YTD9_CUCME/91-209-------------T-----SAKAAWDILRSTY------------------------------------------------
Q9M2D1_ARATH/89-207-------------T-----SAKEAWEKLRTSY------------------------------------------------
A5BLB0_VITVI/283-400-------------S-----KAKEAWDILQQEF------------------------------------------------
Q9LH44_ARATH/87-205-------------S-----SATEAWNALEMEF------------------------------------------------
Q9ZQE9_ARATH/91-209-------------S-----SSKEAWDVLKDEY------------------------------------------------
A5B9M8_VITVI/90-208-------------E-----TPKQVWDKLQGEF------------------------------------------------
A5BRD1_VITVI/91-209-------------K-----TTNEIWNFLKKEY------------------------------------------------
A5B779_VITVI/91-209-------------E-----SAKDIWDHLKKEY------------------------------------------------
Q9SEL2_VITVI/89-207-------------D-----SAAEIWEYLKEEY------------------------------------------------
A5BFD6_VITVI/89-207-------------E-----SATEIWKHLWEEY------------------------------------------------
A5BRW6_VITVI/90-208-------------R-----TTKEAWDKLKLEY------------------------------------------------
Q6L3X6_SOLDE/202-320-------------K-----TAKEAWDRLKEEY------------------------------------------------
A5ACV7_VITVI/90-208-------------E-----TPKEAWDKLKEMY------------------------------------------------
Q6L3Y5_SOLDE/89-207-------------E-----SAKESWDMLKQEF------------------------------------------------
Q60EG1_ORYSJ/85-201-------------R-----TAKEVWDCLKTRF------------------------------------------------
C6JSM1_SORBI/92-210-------------K-----TGKEVWDALKARH------------------------------------------------
B6TPM7_MAIZE/94-212-------------K-----TAAEVWASLKTRF------------------------------------------------
Q9SHT5_ARATH/47-166-------------K-----TSKAMWEAIKTRN------------------------------------------------
Q9ZUF2_ARATH/41-160-------------K-----TSKAVWDKIQSRN------------------------------------------------
Q4ABY7_BRACM/83-202-------------E-----DAKAVWDAIKTRH------------------------------------------------
Q9LQK3_ARATH/80-199-------------Q-----TAKEVWDSIKTRN------------------------------------------------
Q9SKV6_ARATH/80-199-------------A-----TAKLVWDSIKTRY------------------------------------------------
Q9LE43_ARATH/83-202-------------D-----TAKKVWEAIKEKN------------------------------------------------
B6REL9_9BRAS/81-200-------------D-----SSKAIWEAIKTRH------------------------------------------------
B6REL1_9BRAS/60-179-------------D-----TTKGIWEAIKTRH------------------------------------------------
Q7F814_ORYSJ/95-213-------------E-----TAKEAWDALKQMN------------------------------------------------
B8BA29_ORYSI/100-218-------------E-----TASDVWVALRYMH------------------------------------------------
D3IVE4_9POAL/219-337-------------E-----TAREVWVTLQKMH------------------------------------------------
Q7X7K3_ORYSJ/176-294-------------E-----TVQEAWEAIKTRR------------------------------------------------
Q0J5Y3_ORYSJ/115-233-------------R-----SARAAWDAIKTIR------------------------------------------------
Q7XH44_ORYSJ/165-269-------------R-----TVKSAWEAIKTVC------------------------------------------------
Q2QYR6_ORYSJ/52-170-------------N-----YTEWSMEAIRTIR------------------------------------------------
Q5TKD7_ORYSJ/109-227-------------D-----TAKEVWDAIKTMR------------------------------------------------
Q7XTU6_ORYSJ/114-232-------------D-----TAKAAWDAIKTMR------------------------------------------------
Q8LMZ0_ORYSJ/135-253-------------D-----TAKEAWESVKTMR------------------------------------------------
Q7G5Z8_ORYSJ/110-228-------------D-----TAKEAWEAVRTMR------------------------------------------------
Q53P77_ORYSJ/86-204-------------E-----TAKAAWDCIKTMR------------------------------------------------
Q2QZL2_ORYSJ/49-167-------------A-----SAREAWECIKTMR------------------------------------------------
Q7XWP2_ORYSJ/116-231-------------A-----SAKEAWDCIKTMR------------------------------------------------
Q10C26_ORYSJ/22-139-------------E-----TAKEAWDSIRVMR------------------------------------------------
Q7XUD9_ORYSJ/115-233-------------P-----SAKEAWDAIKTMR------------------------------------------------
Q25AF6_ORYSA/117-235-------------D-----SAKDAWDAIKVMH------------------------------------------------
C1IJC5_HORVU/114-232-------------K-----TSQELWEAIRAMR------------------------------------------------
C5Y7F6_SORBI/35-153-------------K-----SFKEAWEAIKTMR------------------------------------------------
Q94I41_ORYSJ/94-212-------------K-----SAKEAWDVVKKMH------------------------------------------------
C5XUK3_SORBI/218-337-------------A-----TAKEAWDAIAATR------------------------------------------------
C5XQM0_SORBI/100-219-------------L-----TAKEVWNSIAAAR------------------------------------------------
Q9AUM6_ORYSJ/569-688-------------R-----TTKDAWDAIASAR------------------------------------------------
Q2QWI2_ORYSJ/47-166-------------R-----TAKEAWDAIAAAR------------------------------------------------
C5Z583_SORBI/100-218-------------D-----TAKQAWEMLESLR------------------------------------------------
C5WNA6_SORBI/224-342-------------K-----TAKEAWEAIAAMR------------------------------------------------
D3IVP8_9POAL/630-749-------------K-----SANKIWTTLADYH------------------------------------------------
D3IVT7_9POAL/58-177-------------R-----SAHEIWKTICDYH------------------------------------------------
D3IVI1_9POAL/86-205-------------S-----SAYDIWVTLDAYH------------------------------------------------
Q10PG0_ORYSJ/85-204-------------K-----SAHDMWTALCNFH------------------------------------------------
D3IVI3_9POAL/99-218-------------E-----TAHEIWHTLETYH------------------------------------------------
Q5H9X1_ORYSJ/112-231-------------E-----SAKVIWDTLRNLH------------------------------------------------
Q10NE5_ORYSJ/129-248-------------E-----EAKEIWDTLQLAH------------------------------------------------
C5WYF6_SORBI/63-181-------------N-----VAKQIWDTLVLAH------------------------------------------------
Q8S467_MAIZE/138-257-------------K-----NAKEIWDLLKTAH------------------------------------------------
Q8H6I4_MAIZE/204-323-------------E-----DARDIWNILRMSH------------------------------------------------
Q33BC8_ORYSJ/86-203-------------E-----TAYEIWNKLAEIH------------------------------------------------
A2Q5V3_MEDTR/101-218-------------D-----VAKDAWDILRTTH------------------------------------------------
O65147_SOYBN/76-194-------------T-----VAKDAWEILKTTH------------------------------------------------
A5BZ48_VITVI/103-221-------------T-----SAKEAWDILQVTH------------------------------------------------
Q9XEB1_ARATH/433-551-------------L-----SAKEVWEILQVSF------------------------------------------------
Q9FG84_ARATH/101-219-------------E-----SAKEAWDKLAKAY------------------------------------------------
Q9ZV83_ARATH/82-200-------------K-----SAKQAWDTLQKSH------------------------------------------------
A2I5F8_BETVU/104-223-------------K-----SAKQIWDLLEVTH------------------------------------------------
A5BW11_VITVI/73-191-------------K-----SAKEIWRLLEITH------------------------------------------------
Q1S5J6_MEDTR/118-236-------------S-----TAKAMFASLCANF------------------------------------------------
Q9FJT0_ARATH/33-146-------------T-----SSKEAWEILMVRS------------------------------------------------
Q9LJD1_ARATH/93-210-------------S-----SAKDVWDLLRKGN------------------------------------------------
Q9LJD1_ARATH/509-622-------------S-----SAKDLWDSLEKGN------------------------------------------------
Q9LJC8_ARATH/91-202-------------A-----SAKELWDLLKK..------------------------------------------------
Q9LJC9_ARATH/91-203-------------A-----SSKELWDLLKK..------------------------------------------------
A9TSN8_PHYPA/23-136-------------T-----NLAVAWKILANVY------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308-----------RKFLTFLEGRARNKAGEILAK------------------------------------------------
PEG10_MOUSE/174-267-----------CFVTSMLIGRAARWATAKLQR------------------------------------------------
Q9AUY8_ARATH/31-127-----------DIAIHLLEGDAHNWWLAVDKR------------------------------------------------
Q9FWC7_ORYSJ/155-249-----------SAVVLHMSGNAAQWYHSYKLV------------------------------------------------
Q9FE41_ORYSJ/775-871-----------APAHVTAEGDPRQHARQHAPR------------------------------------------------
Q9LP90_ARATH/163-253-----------ALVSVSVSGEALSWYNWAISR------------------------------------------------
Q9LMV1_ARATH/257-344-----------QIFIEHLTGPAHNWFSRLKPN------------------------------------------------
Q9ARZ4_ORYSJ/100-192-----------KVIHLTLDGIARSWYFNLPAN------------------------------------------------
Q9FYC9_ARATH/102-194-----------DIASIHFDDIDATWHQSIVQS------------------------------------------------
Q9SK57_ARATH/214-310-----------DIAVHFLEGDAHNWWLTVEKR------------------------------------------------
Q9FRJ2_ORYSJ/81-182-----------RRADHCV....VNWLHNSIAK------------------------------------------------
Q9AV68_ORYSJ/351-443-----------NYLPVALADSARSWLHGLPRR------------------------------------------------
Q9AYB5_ORYSJ/567-664-----------SFASHQLLGPASEWWDHFRLN------------------------------------------------
O23529_ARATH/90-186-----------RLIFSALIGAISPPVQPLVSR------------------------------------------------
O82608_ARATH/272-360-----------HLFVEHLKGPALNWFTRLKGN------------------------------------------------
Q9AYC2_ORYSJ/729-826-----------AFATHQLQGPASAWWDNHMAT------------------------------------------------
Q9FGL3_ARATH/131-241-----------SMV........KSWILNSVTK------------------------------------------------
Q9SQW9_ARATH/264-354-----------EKAVSCLTGASVTWWRCSKDR------------------------------------------------
Q9LNM2_ARATH/83-178-----------HLFVEHLKGPALDWFSRLEGN------------------------------------------------
Q9AYB6_ORYSJ/694-791-----------IFAAHQLQGPASLWWDHFQAT------------------------------------------------
Q9XE67_SORBI/155-252-----------GVAAHQLTGAARAWWDSYSDT------------------------------------------------
O49369_ARATH/139-231-----------GFASLHFDDTAATLHQSIVQS------------------------------------------------
Q9ZPF9_ARATH/97-196-----------KVAATEFYDYALSWWDQVVTT------------------------------------------------
Q9XII7_ARATH/126-236-----------SMV........KSWLLNSVSP------------------------------------------------
Q9SIM3_ARATH/131-240-----------MVKSWLLNSVSPQIYRSILRL------------------------------------------------
Q9MA68_ARATH/89-183-----------RLFPFSLGDEAHLWEKTLLVD------------------------------------------------
Q9M225_ARATH/186-282-----------DLAVHFLEEDAHLWWKSVTAR------------------------------------------------
Q96467_HORVU/82-176-----------KLFPFSLRDRAKTWFSSLPKS------------------------------------------------
Q9AXC5_ANTHI/295-388-----------NFAAFRLEDAARHWWRILDQR------------------------------------------------
Q9M0T9_ARATH/89-183-----------RLFPFSLGDKAHIWEKNLPHD------------------------------------------------
Q9SY43_ARATH/188-284-----------DLTVHFLEGDAHLWWRSVTAR------------------------------------------------
Q9C7H8_ARATH/150-242-----------KMVAIHFDSHAATWHHSFIQS------------------------------------------------
Q9ZNW4_SORBI/210-302-----------KSFVIAAEGDALAWYSMLRPG------------------------------------------------
Q9SUN0_ARATH/223-313-----------QLFVEGLTGNALTCFSRLEAN------------------------------------------------
Q9M252_ARATH/163-260-----------DIIVHFLREEASHWWDGVLGN------------------------------------------------
O93283_TAKRU/149-242-----------GFITSLLADKALSWAIAAVDL------------------------------------------------
Q9ZQQ3_ARATH/198-290-----------KLFSENLCGQALMWFTQLEPG------------------------------------------------
Q9ATX2_MAIZE/179-271-----------KSFVMAVRSVAQTWYSSLRPG------------------------------------------------
O81471_ARATH/148-242-----------KLFPYSLAGEAASWLKQLKAG------------------------------------------------
Q9FW76_ORYSJ/181-275-----------KIATLNFCGNAAFWLQSVRSQ------------------------------------------------
Q9SKF2_ARATH/107-197-----------RLFPFSLGDRARIWEKNLPQR------------------------------------------------
Q9SYE8_ARATH/131-230-----------KIAATKFYNYALSWWDQLVTS------------------------------------------------
Q98SV9_TAKRU/117-207-----------AFVVNLLSGRAAQWATAVLEN------------------------------------------------
Q9SJP0_ARATH/291-382-----------QLFVKHLSGAALTWFSRLEAN------------------------------------------------
Q9XE85_SORBI/114-212-----------LYASGQLQGAAQTWWESYQAA------------------------------------------------
Q9ZS84_SOLLC/150-247-----------NITTMYLSGDAKLWWRTRNAD------------------------------------------------
O48967_MAIZE/245-337-----------TYFHVALSGPARTWLMNLSPG------------------------------------------------
Q9LZG5_ARATH/148-244-----------DLASCYLRGEAQEWWERVKQR------------------------------------------------
Q9SX87_ARATH/132-224-----------SIASTLCDGAAAKWYKSLFES------------------------------------------------
Q9LQH2_ARATH/476-575-----------KVAPTEFQNYALSWWDQLVTT------------------------------------------------
Q9FZN9_ARATH/121-215-----------RLFPFSLGDKAHQWEKSLLQG------------------------------------------------
Q9SLQ0_ORYSI/194-290-----------RAATSEFTDFASIWWSEFVRS------------------------------------------------
Q9UVC2_PASFU/52-153-----------IFATTFLRGRAQHWVKPFLRK------------------------------------------------
Q9ZPG6_ARATH/97-191-----------RLFPFSLGDKAHHWKKTLPPD------------------------------------------------
Q9ZUK1_ARATH/211-302-----------KLFSENLFGLALTWFTQLEEG------------------------------------------------
Q9FWB1_ARATH/104-198-----------KLFSFSLADKTHRLFKSMNPE------------------------------------------------
Q9HFY8_COLGL/148-252-----------VHAATFLRGRALAWFEPLQQE------------------------------------------------

PF14227

A5BY76_VITVI/104-226-----------------CKLAKEIWRLLEITH------------------------------------------------
A5B9Z7_VITVI/12-134-----------------CKXAKEIXRLLEITH------------------------------------------------
A5BSC1_VITVI/688-789-----------------YQSTQCTFIGYSLSH------------------------------------------------
A5BWL8_VITVI/342-448-----------------CYMIRVFAFQVD...------------------------------------------------
A5BLR1_VITVI/94-215-----------------WKAFRLVWNTIIDVL------------------------------------------------
A5BLB0_VITVI/282-404-----------------ASKAKEAWDILQQEF------------------------------------------------
Q9LJC9_ARATH/90-212-----------------VASSKELWDLLKKGN------------------------------------------------
Q5AT23_EMENI/392-511-----------------LETSGDMWAFLMKKY------------------------------------------------
D3IVP8_9POAL/629-752-----------------IKSANKIWTTLADYH------------------------------------------------
COPIA_DROME/74-192-----------------DITARQILENLDAVY------------------------------------------------
D2A543_TRICA/76-194-----------------KTTAYQMWISLEAGF------------------------------------------------
O96968_BOMMO/78-193-----------------ATSAKEMIENLRKIF------------------------------------------------
Q6XMP8_AEDAL/81-199-----------------KGTAKAMWKSLEDTF------------------------------------------------
B0X5G3_CULQU/101-222-----------------KKTAKEMWDTLLGIH------------------------------------------------
Q967L5_AEDAE/76-197-----------------CVNAHDVFGALKAYH------------------------------------------------
Q8WRX6_ANOGA/74-195-----------------CKTAKGTWDALQKHH------------------------------------------------
B2CN78_DAPPU/42-160-----------------CRTAYEMWTRLSAQH------------------------------------------------
A9RF54_PHYPA/34-146-----------------KRQEKKAFGIIATNI------------------------------------------------
Q8H023_ORYSJ/210-330-----------------EKTPKEIWDKLASLY------------------------------------------------
Q7XSZ1_ORYSJ/103-219-----------------ENRSNTDFEADAD..------------------------------------------------
Q7XLX2_ORYSJ/160-253-----------------ETSPKIIWEKLEAQF------------------------------------------------
A5BPQ9_VITVI/512-624-----------------VDYSLNQGAPAGHES------------------------------------------------
A5B864_VITVI/32-156-----------------EESPTTNWLKLESRY------------------------------------------------
Q9AU17_SOLCI/79-196-----------------EESACGIWTKLENLY------------------------------------------------
B1N668_SOLLC/75-192-----------------EETAAGLWLKLESLY------------------------------------------------
Q2AA06_ASPOF/859-977-----------------VTSVMKMWEILNNKY------------------------------------------------
Q69FA7_PHAVU/58-175-----------------ETSAHKLWKALEDKF------------------------------------------------
Q6BCY1_IPOBA/74-193-----------------KKTANEIWDHLNRLY------------------------------------------------
B8YLY5_MEDTR/73-192-----------------KKTAKEIWDTLIKLY------------------------------------------------
Q25A78_ORYSA/77-175-----------------EETAAGLWLKLEQIC------------------------------------------------
Q53QA4_ORYSJ/75-188-----------------EKTSAELWLKLESIC------------------------------------------------
Q94LG0_ORYSJ/79-192-----------------EKTAAELWLKLESIC------------------------------------------------
Q01MJ3_ORYSA/27-111-----------------EETAAGLWLKLEQIC------------------------------------------------
A5BQQ6_VITVI/23-136-----------------EKTVVALWLKLEQLW------------------------------------------------
A5BPL2_VITVI/25-141-----------------EKTVXALWLKLEQLC------------------------------------------------
Q9SJT2_ARATH/93-212-----------------EQSAAAMLGVLDKLY------------------------------------------------
Q9SH77_ARATH/93-212-----------------ESTAAAMLLALDKLY------------------------------------------------
Q9FFM0_ARATH/98-215-----------------QKTAAGMIKVLDQLF------------------------------------------------
Q9LS18_ARATH/107-224-----------------EETAAGMISVLDKLY------------------------------------------------
Q9ZQE4_ARATH/102-211-----------------CETAAAMWSTLKRLY------------------------------------------------
Q9LJS6_ARATH/105-202-----------------CETVAAMWSTLNKLY------------------------------------------------
O81903_ARATH/103-220-----------------CVTAAELWATLNKLF------------------------------------------------
Q9SHR5_ARATH/101-218-----------------YATTADLWATLNKKY------------------------------------------------
Q9LVY5_ARATH/105-222-----------------CKTAATLWELLNELY------------------------------------------------
Q02900_ARATH/97-214-----------------CKSAAEMWKTLNKQY------------------------------------------------
O82196_ARATH/63-180-----------------SKTAAEAWATLDKLY------------------------------------------------
Q9ZPU5_ARATH/68-187-----------------CKTAAEAWETLDRLF------------------------------------------------
Q1KUM3_9ROSI/117-234-----------------ERTAFGIWRKLERLH------------------------------------------------
A5AR03_VITVI/133-256-----------------SSLCQALASRLPGVI------------------------------------------------
A5ARG5_VITVI/22-139-----------------EILASTIWKKLEEIY------------------------------------------------
Q9M3C1_ARATH/26-145-----------------QEEGCEPREGYEGNY------------------------------------------------
A5AJF1_VITVI/465-574-----------------AKSATKLWLKLESLY------------------------------------------------
A5BLL6_VITVI/78-195-----------------AKSAAELWLKLESLY------------------------------------------------
A5BYU4_VITVI/59-176-----------------AKSTVELWLKLESLY------------------------------------------------
A5BPE6_VITVI/78-195-----------------ETTAVGLWRKFESKY------------------------------------------------
Q18L98_CITSI/80-198-----------------EKTALGIWNKVETLC------------------------------------------------
A5B6C0_VITVI/29-150-----------------EDTTTKLWLKLESLY------------------------------------------------
A5AYK3_VITVI/32-152-----------------EDITAKLWLKLESLH------------------------------------------------
A5B8Q0_VITVI/529-644-----------------ENMATKLWLKLESLY------------------------------------------------
Q2AA73_ASPOF/71-191-----------------EKTTADLWSKLEDLY------------------------------------------------
A5AM57_VITVI/98-215-----------------EKTIARVWKKLEGLY------------------------------------------------
A5C6J6_VITVI/77-184-----------------ETTAVKVWERLEALY------------------------------------------------
A5AQ94_VITVI/78-195-----------------ETTAKGVWNKLEQLY------------------------------------------------
A5AKU3_VITVI/615-723-----------------ETIIEGVRNKLELLT------------------------------------------------
C6GFP7_FRAAN/52-171-----------------TMTAKEAWENLESVY------------------------------------------------
A5C6L3_VITVI/78-195-----------------EKTTADLMKALSGMY------------------------------------------------
A5BCL0_VITVI/55-172-----------------EKSTMGLMKVLSDMY------------------------------------------------
A5AL15_VITVI/39-145-----------------HTMYFFLCXRLNATF------------------------------------------------
Q6RZV5_MUSAC/23-145-----------------LGNSGGDPSSLEQDG------------------------------------------------
Q9ZRJ0_TOBAC/76-193-----------------VTHARSLWDKLEELY------------------------------------------------
Q5MG99_IPOBA/76-193-----------------ETHARSLWNKLETLY------------------------------------------------
A5AJF5_VITVI/76-192-----------------EKHARSLWNKLEQLY------------------------------------------------
A5BEP3_VITVI/54-180-----------------EKHAQSLWNKLKQLY------------------------------------------------
B3N452_DROER/17-137-----------------CTTSFEAWTKLREVH------------------------------------------------
B4N7F3_DROWI/52-172-----------------CLTEYEAWTRLRDVY------------------------------------------------
B6V6Z8_DROME/78-198-----------------CTTSADAWKKLCDVH------------------------------------------------
B4NQE5_DROWI/78-198-----------------CGSARDYWLKLEKTF------------------------------------------------
Q45W64_PHACR/80-192-----------------CETAKSAWDTLKNMY------------------------------------------------
Q5JMV2_ORYSJ/12-126-----------------AACRTTADRRLSWCA------------------------------------------------
A5CA63_VITVI/149-269-----------------NDTTNVVWEALKNAY------------------------------------------------
Q8W5F6_ORYSJ/80-197-----------------MTDAKELWDALHTKF------------------------------------------------
Q8LN71_ORYSJ/50-167-----------------MPSGKDMWDALEAKF------------------------------------------------
B7ZXP2_MAIZE/242-358-----------------LPTGKELWDALVGKF------------------------------------------------
Q10LP7_ORYSJ/115-232-----------------HTSARVLRETLEKKY------------------------------------------------
A5BQ76_VITVI/63-180-----------------VKTTKKLWESLEKKY------------------------------------------------
Q0KIN7_SOLDE/84-201-----------------YSSAKKIWKALQSKY------------------------------------------------
Q7Y173_ORYSJ/18-135-----------------SDDVKTYLENIDRNF------------------------------------------------
A5B4U1_VITVI/192-309-----------------HENVRELLKAIDEQF------------------------------------------------
Q2R404_ORYSJ/102-219-----------------SNDIKTYLANIEESF------------------------------------------------
A5BQ76_VITVI/411-528-----------------MDTAYDILENLKEMF------------------------------------------------
Q0KIL6_SOLDE/90-207-----------------MLSAFEFLENLKQMF------------------------------------------------
Q9SZS9_ARATH/2-131-----------------AKKPKQLRNKPRKSF------------------------------------------------
B9SXB7_RICCO/3-127-----------------KARYSRLPARKSSSP------------------------------------------------

PF03564

A7SE42_NEMVE/491-638----------------RSLLVGPARGAVAG--FAL.TAAN-----YQSAI-D--LLKRRYG-QT---EKI--KRAHINEI
Q17051_ASCLU/155-293----------------LSLLEGPAATVAQG--YAM.SESS-----FDLVV-T--ALKSNYG-NP---AVI--IASLHTEL
Q23992_DROME/160-308----------------KSALKGEARNVVTH--LLLGSGEN-----YEATW-E--FLTKRYE-NK---RNI--FSDHMNRL
A7XDH0_DROAN/157-302----------------KSFLVDEAASLVRH--LPI.SETA-----YDNAW-E--RLNERYD-RP---RQI--IHNLLDTF
Q4JS97_ANOGA/133-280----------------LSALKGDAAHQFEH--MQI.TADN-----YYVTW-E--ALLKRYD-NS---KVL--KREYFKAF
Q4EAY5_9RICK/161-306----------------KSLLTDEAANLIAH--LPI.TDSA-----YETAV-S--RLNERYD-RP---RHI--VFSLLEQF

PF13961

Q5AT23_EMENI/319-345------------------------------------LRTQ-----G..CW.S--VVE-----------------------
Q5AT23_EMENI/515-541------------------------------------CQIQ-----G..VW.E--VVE-----------------------
A9RSN5_PHYPA/14-40------------------------------------FEME-----N..LW.D--VVS-----------------------
B0D6P6_LACBS/11-37------------------------------------LVRW-----G..LW.P--MVK-----------------------
B0WQU4_CULQU/10-36------------------------------------LAVE-----D..LW.E--VVM-----------------------
B0WWB7_CULQU/11-37------------------------------------LDTE-----E..LW.D--VIE-----------------------
B4K1A4_DROGR/12-38------------------------------------LVHN-----D..LW.P--IVS-----------------------
B4LA17_DROMO/10-36------------------------------------LVHQ-----E..LW.S--VVS-----------------------
B4LAF9_DROMO/10-36------------------------------------LEMA-----D..LW.E--VVC-----------------------
B4LE08_DROVI/13-41------------------------------------MRIQ-----E..MWPA--VIS-----------------------
B4MX54_DROWI/10-37------------------------------------LVIK-----G..CW.S--VVC-----------------------
B4NQE5_DROWI/11-37------------------------------------LVKN-----D..LW.Q--CVN-----------------------
B4NQR9_DROWI/10-36------------------------------------LVHA-----D..LW.N--VAS-----------------------
B6HA76_PENCW/19-46------------------------------------LKAR-----Q..VW.D--VVS-----------------------
B6QCF0_PENMQ/36-62------------------------------------LETQ-----D..CW.D--VVE-----------------------
B9NDW0_POPTR/15-41------------------------------------LIGE-----D..LW.E--VVS-----------------------
B9RBX9_RICCO/17-43------------------------------------LQAF-----D..LW.N--FVE-----------------------
B9RC68_RICCO/10-37------------------------------------LLAN-----D..LW.D--IVE-----------------------
B9S5P6_RICCO/16-42------------------------------------LKEQ-----E..IL.E--AIN-----------------------
C5GBD9_AJEDR/188-215------------------------------------LVDA-----Q..CW.N--IIE-----------------------
C5WNA6_SORBI/166-192------------------------------------LRAR-----R..LW.N--AID-----------------------
C5XQM0_SORBI/42-68------------------------------------MQAR-----Q..LW.D--AVE-----------------------
C5XUK3_SORBI/137-163------------------------------------MQAR-----D..LW.D--AIE-----------------------
C5Z583_SORBI/42-68------------------------------------LRAR-----K..WW.R--AIE-----------------------
C6JSM1_SORBI/23-49------------------------------------MEDQ-----G..VW.D--VME-----------------------
C7J1L6_ORYSJ/181-207------------------------------------LQVW-----H..MW.E--AVR-----------------------
C7J1U3_ORYSJ/16-44------------------------------------FTAM-----SPKIW.W--IVD-----------------------
C7J5A1_ORYSJ/49-75------------------------------------LQAH-----C..LW.A--AIE-----------------------
C7J6P4_ORYSJ/14-42------------------------------------IMAE-----NYDIW.R--KVS-----------------------
C7J7K5_ORYSJ/83-109------------------------------------LQAQ-----G..LW.S--AIE-----------------------
D0NBZ2_PHYIT/18-44------------------------------------LQRK-----H..LW.Q--YCI-----------------------
D0P386_PHYIT/3-29------------------------------------LQAK-----R..LW.G--IVT-----------------------
D0P4P1_PHYIT/16-42------------------------------------LEVK-----D..VW.S--AVL-----------------------
D0RLQ9_PHYIT/21-47------------------------------------MQRK-----K..LW.K--YCE-----------------------
D2A4C7_TRICA/13-39------------------------------------LIKC-----D..LW.D--YTN-----------------------
D2A543_TRICA/14-40------------------------------------LDHH-----D..VK.R--CIE-----------------------
Q0DA14_ORYSJ/28-54------------------------------------LEAL-----E..LW.D--AVE-----------------------
Q0IZT5_ORYSJ/33-59------------------------------------MEAQ-----G..IW.D--AIE-----------------------
Q0J5Y3_ORYSJ/54-80------------------------------------MEAA-----G..IW.Y--AVE-----------------------
Q16S15_AEDAE/12-38------------------------------------LEEL-----G..LL.H--CIE-----------------------
Q6K285_ORYSJ/82-108------------------------------------LKTR-----A..LW.H--AIE-----------------------
Q75M81_ORYSJ/48-74------------------------------------LQAQ-----G..LW.E--AVD-----------------------
Q7G5Z8_ORYSJ/52-78------------------------------------MQAQ-----G..VW.D--AVE-----------------------
Q7G756_ORYSJ/12-40------------------------------------IMAK-----DLDIW.K--KVS-----------------------
Q7XKY1_ORYSJ/53-79------------------------------------LQVR-----G..LW.E--AVD-----------------------
Q7XMT1_ORYSJ/56-82------------------------------------LQEQ-----G..LW.K--AID-----------------------
Q84Q85_ORYSJ/36-62------------------------------------MEAL-----E..QW.D--AVE-----------------------
Q850T3_ORYSJ/12-40------------------------------------IQAE-----DYDVW.Q--KVA-----------------------
B9GKP2_POPTR/14-39------------------------------------LIGR-----K..LW.R--IV.-----------------------
B9HL08_POPTR/16-42------------------------------------MLAQ-----D..LW.D--FIE-----------------------
D7U4H2_VITVI/8-34------------------------------------LIGQ-----G..LW.D--VVS-----------------------
F6H7D5_VITVI/16-42------------------------------------LKGK-----R..MW.G--YVS-----------------------
F6HTJ6_VITVI/13-39------------------------------------MQGQ-----D..LW.E--VVN-----------------------
F6HVN0_VITVI/97-122------------------------------------LVGQ-----D..LW.E--VC.-----------------------
F6HVN2_VITVI/18-42------------------------------------LVAQ-----D..LW.E--VVK-----------------------
I1Q6P1_ORYGL/57-85------------------------------------LIFL-----HPSIW.K--VVC-----------------------
Q0IZC5_ORYSJ/9-35------------------------------------LLSQ-----G..LW.D--IVE-----------------------
Q0J8A6_ORYSJ/26-52------------------------------------MEDQ-----G..VW.D--AIE-----------------------
Q53L57_ORYSJ/161-185------------------------------------MRGQ-----C..LW.D--V..-----------------------
Q60EK9_ORYSJ/143-168------------------------------------MRAQ-----G..VW.A--AVE-----------------------
Q682G3_ARATH/13-39------------------------------------LGAH-----D..VW.E--IVE-----------------------
Q7X7W1_ORYSJ/19-45------------------------------------LQAR-----S..LW.E--AVN-----------------------
Q852C7_ORYSJ/12-40------------------------------------LQSQ-----GHNVW.N--KVK-----------------------
Q8S5D4_ORYSJ/104-130------------------------------------QQAQ-----G..LW.H--AVE-----------------------
Q8SAX3_ORYSJ/39-67------------------------------------LKSI-----NSSIW.R--IVE-----------------------
Q94GR9_ORYSJ/14-42------------------------------------LKAM-----SFHIW.S--IVD-----------------------
Q9AUM6_ORYSJ/511-536------------------------------------LQAR-----H..MW.D--TV.-----------------------
U5G3M5_POPTR/16-42------------------------------------LIAL-----D..LW.E--VVE-----------------------

PF14893

H0XX29_OTOGA/1-328ELGDWA..........ALVEFADGLNRRLI--PRQI.P.G-----KGGPW-T..VIFLPQA-PD---TDL..QDRLSFPA
M3Z644_MUSPF/1-327DENRNV..........ALVGLTEETSHAVV--PKEI.P.G-----KGGVW-R..VIFKPPG-LD---NEL..LSRLNEFL
F7CY48_HORSE/1-330ELGFRV..........ALVEFTEYLNRSLV--PRQI.P.G-----KGRLW-D..VFFLPQG-PD---SES..RDRPNFPA
M4B0W2_XIPMA/1-317QTQRLT..........VLCECRQKVNAKAC--PLDVLPEG-----SDEPW-R..IFGPSEE-ED---EP...........
F6TXQ3_HORSE/2-329QENANA..........VLLELMEDIDVSVI--PSEV.Q.G-----RGGIW-K..VIFKTPN-QD---TEF..LERLNLFL
D3Z8Y9_RAT/1-327EENAQA..........FLVELARDFDYALV--PREI.E.G-----KGGPW-E..VVVKPPN-SD---DEF..LNRLNHFL
M4AZW3_XIPMA/2-318MSQSLT..........ALCECRETVNAKVI--PAEVTPQG-----SDSRW-R..IIGPSGV-EE---E............
F7AVZ0_XENTR/7-324PRVAASRRDSAGVLLNVLIDSPREIDRERV--PQDIYA.G-----DEGPW-R..VVLPDLS-DD---ADD..LT......
PNMA5_HUMAN/1-322EDNAKA..........VFIELADTVNYTTL--PSHI.P.G-----KGGSW-E..VVVKPRN-PD---DEF..LSRLNYFL
G1PM76_MYOLU/2-362EENAKA..........ALLEVGEGVSLRAV--PREF.P.G-----RGGAW-R..VVCRNPT-QD---AEF..LKNLNEFL
F7D322_HORSE/1-321EDNAKA..........VFIELADTVNYAMM--PSEI.P.G-----KGGAW-Q..VVVKPRN-PD---DEF..ITRLNYFL
G3N1H8_BOVIN/3-317DLGSKI..........ALVEFAEYLSRSLI--PRQI.P.G-----KGGPW-I..VVCLPQA-PD---AES..QDRPNFPA
F1S2C6_PIG/1-333ELGCRV..........ALVEFADSFNRSLI--PQQI.R.G-----RGGPW-T..VVFLPQA-PD---SES..QERPNSPA
H2PX42_PONAB/1-327EENAQA..........ILLELAQDIDYALL--PREI.P.G-----KGGPW-E..VIVKPRN-SD---GEF..LNRLNRFL
G1LQR5_AILME/1-315ELGSRV..........ALVEFAQYLNRSLI--PQQI.P.G-----KGGPW-P..VVFLPQA-PD---SES..QDRPDFPA
PNMA5_MOUSE/1-323EDEAKA..........VLIELPEVVDYTMM--PTHI.P.A-----EGGAW-E..VVVKPRS-PD---DEF..MNKLIYFL
PNML1_BOVIN/3-358QENAKA..........ALVEVGEGVNLRAI--PREF.P.G-----RGGIW-R..VVCRDPT-QD---AEF..LKNLNEFL
G3U141_LOXAF/1-317ELGTRV..........ALVEFADYLNRSLI--PRQI.P.G-----KGGPW-R..VIYLPQA-PH---AEL..QERPAFPI
H0W6U3_CAVPO/1-332ELGARV..........ALVEFAEYLNRNLI--PHQI.P.G-----SGEPW-R..VIFLPQV-PD---SEL..QD....PA
H0VWL7_CAVPO/1-322EDNAKA..........VLIELADTVNYATI--PSCI.P.G-----KGGSW-E..VVVKPRT-ED---EEF..LSRLNYFL
PNML1_PONAB/5-364EENVKA..........ALIEVGEGVNLSTI--PREF.P.G-----RGGVW-R..VVCRDPT-QD---AEF..LKNLNEFL
H0VK73_CAVPO/6-363EENVKA..........ALIEVGEGVNLSAV--PREF.A.G-----RGGIW-K..VACRDPT-QD---AEF..LKNLNEFL
G3U379_LOXAF/1-308EDNAAA..........ALVELAQEVDYALV--PREV.P.G-----SGGPW-R..VVCAPRC-SG---EEV..LGRVFHFL
M4AZA8_XIPMA/3-326STDQIL..........VLCECREKLTNADI--PNEVLTLD-----ESTVW-PIFIVAESSS-AD---EDF..SVKLNTLL
PN6BL_HUMAN/1-326ELGAKA..........ALVEFAEYLNRSLI--PHQI.P.G-----NGGPW-K..VIFLPQV-PV---IEF..QDMPSFPA
D2GZV4_AILME/1-325EENAKA..........ALLELTGAVDYAAI--PREM.P.G-----KGGVW-K..VVFKPPT-SD---AEF..LERLHLFL
F6Z9T2_HORSE/5-364EENAKA..........VLIEVSEGVNLRAI--PREF.P.G-----RGGVW-R..VVCRDPT-QD---AEF..LKNLNEFL
PNML1_MOUSE/6-363QENVKA..........ALVEVSEGVNLSSI--PREF.P.G-----RGGVW-R..VVCRDPT-QD---DDF..LKNLNEFL
F1PIM5_CANFA/1-358EENAKA..........ALIEVGEGVNLRAI--PREF.P.G-----RGGVW-R..VVCRDPT-QD---AEF..LKNLNEFL
F7H8Z7_CALJA/1-318GLGARA..........ALVEFADSLNRSLI--PRQI.P.G-----KGGPW-N..VISLSQA-PD---AEF..QDMASFPA
PNM6B_HUMAN/1-319EDNATA..........ALVELDREVNYALV--PREI.P.G-----TGGPW-N..VVFVPRC-SG---EEFLGLGRVFHFP
G3QYD8_GORGO/1-326DENRKV..........ALVGLTAETSHALV--PKEI.P.G-----KGGIW-R..VIFKPPD-PD---NTF..LSRLNEFL
F6WC96_CALJA/1-321GLGARA..........ALVEFADSLNRSLI--PRQI.P.G-----KGGPW-N..VISLSQA-PD---AEF..QDMASFPA
Q5BJV6_RAT/1-328DENKNV..........ALVGLTVETGSALV--PKEI.P.A-----KGGVW-R..VIFKPPD-AD---SDF..LCRLNEFL

PF14244

A5AE14_VITVI/10-125----------------LRAKKKYGFVDGSI..KQP.DNDS.PE...LEDWWTINSMLVSW.-..---.............
A5AFL1_VITVI/24-172----------------ITGXGKDEYLFSTT..EPP.KKDD...K.RFKVWNTENNLVMSWL-IN---AMDTEIGQNFLFY
A5AL35_VITVI/26-142----------------LEARRKFEFLEGTI..TGP.QPP..YT...QSDWNTVNAMLVSWI-TN---TIDPE........
A5APA9_VITVI/42-180----------------IXGKDKLGYINDDCPPPPP.PQTD...P.SFXKWCTDNAIT....-..---.....LIGNFIRF
A5AR29_VITVI/23-171----------------IRGKEKDDYITGAS..AAP.ETTT...S.TYKKWIAENNMVMSWL-VN---SMTADIGENFLSF
A5ARJ9_VITVI/24-165----------------ICGRGKDNYITSAK..TAL.AKND...A.SYKTWFSKNNMIMSWL-TN---SIETDVGQTFLFY
A5ATA8_VITVI/24-171----------------VAGKDKLGYINGDL..PQP.LTTD...P.XFRRWRTENATVKGWL-IG---SMDPSLIGNFIRF
A5AW26_VITVI/23-156----------------LRSKMKMGYILGTI..KVP.KTTN...P.LFESWDFENSMIMSXL-LN---YMQPEIGKTFLFQ
A5AXC5_VITVI/8-148----------------LKGKXMXGYVSGVL..SKPINDRDEKYIDMLESXEANNSKIXIXI-NN---FXEHSIGIQLAKY
A5AZ64_VITVI/47-175----------------LNAKNKLGFVNGTI..KAP.LEET.HPD.DYATWSRCNDMVHSWI-VN---TLNPEISDFVIYY
A5AZK9_VITVI/143-291----------------LRIKKKMGYILGMI..KAP.KTTN...P.LFELWDSENSMIMSWL-LN---SIQPEIGKPFLFL
A5B0N9_VITVI/37-186----------------IAEREKLSYIRGKT..NPP.KESK...D.GYEKWYAKNQKVKRWL-LM---SMSREIMKRYLRL
A5B3L9_VITVI/16-147----------------IRGKGKIGYLTGST..XTP.LEDD...P.KFQMWDSENFMIISWL-IN---SMESEIGQTYMFL
A5B8L2_VITVI/15-147----------------ISDKEKLGYINDNC..PPP.PQTY...P.SFRKWRIDNMSPFPSI-DQ---AYAHVHI......
A5BAZ3_VITVI/31-163----------------ICGKGKDEYLIGEA..VMP.ETTK...L.GFRKWKIENSMIMSWL-IN---SMNNDI.......
A5BCQ9_VITVI/83-209----------------LSAKDKIGFVTGSI..KPP.SSTD...D.SFPSWQRCNDM.....-..---............H
A5BG06_VITVI/43-189----------------VAGKDKLNYINDDL..PQP.STID...P.FFRRWRNENTTVKGWL-IG---SMDPSLIGNFIRF
A5BJC0_VITVI/21-165----------------LKGKGKIGHRMG....TGP.KLGD...P.HFEAWDEEDFMIMAWL-WN---SMTSEISNTCMFL
A5BKK0_VITVI/191-331----------------ILGKDKPRYINGDL..PQP.LETD...P.YFRKWWIENAIVNGWL-IN---SMESSLVRNFICF
A5BM32_VITVI/27-149----------------LIVKNKIAFVDGSL..VQP.ITND..PH.LRVAWLRANNL.....-..---.............
A5BN45_VITVI/28-176----------------VCGKGKDEYLTGEV..AIL.EKTD...P.KFRVWKTKNHMVMSWL-IN---LMNTDIGENFLLY
A5BNR5_VITVI/308-456----------------LTTKKKIGFVDGTV..EEP.SQED..EPFMFEQWNQCNSMILSWL-TH---AVESDIAEGIIHA
A5BP26_VITVI/33-181----------------LTAKNKISFIDGSI..PCP.ESDD...L.LFGTWIRCNSMVISWI-LN---SVHKDIADSLLYF
A5BQW4_VITVI/215-363----------------IERRGKLGHLTSEV..TKP.TTND...L.FLKKWQSESSLVIAWF-IN---SMELAIGKPYLFL
A5BSG2_VITVI/5-152----------------IVGXKKKGYITGTK..VAP.VEND...P.NYDEWKVEDVLVKSWX-IN---SMIDKLMSHFLXC
A5BT41_VITVI/40-187----------------ISGKDKLGYINGDL..PQP.LQTD...P.AFKKWRTENAMVKGWL-IN---SMDPKLVSNFIRF
A5BVQ3_VITVI/17-164----------------ISGKDKLGYINGDS..PQP.PETD...P.SFRRWRTENAIVKGWL-IN---SMDPSLIANFIXF
A5BWZ5_VITVI/42-189----------------ISGKDKLGYINGDS..PQP.PETD...P.SFRRWRTKNAIVKGWL-IN---SMDPSLIANFIRF
A5BXA9_VITVI/396-529----------------ICGKGKDEYLTGEA..AMP.KTTE...P.GFRKWKIENSMIMSWL-IN---SMNNDIA......
A5C3H8_VITVI/42-155----------------ISGKDKMGYINGDC..PPP.PRAD...P.SFRKWRTTNAIV....-..---.............
A5C4L4_VITVI/24-140----------------LNSKNKLGFVNGSI..KTP.SEEI.DPK.GYATWSRCNDTVHSWI-VN---TLNPEIANSVIYY
A5C4S3_VITVI/27-177----------------LNAKNKLGFIDGTI..SRL.AATD...L.LAGLWSRCNSMVISWL-SN---SVCKEIAESILYH
A5C9I0_VITVI/13-150----------------LTMKNKIGFIDGTI..SRA.AQTN...L.LFNAWNRCNSMVTSWI-IN---SVSKDIVDSLMYI
B9SLN1_RICCO/35-176----------------LNLKNKLRFVEGSC..EPP.SKEK.HPD.SYGSWSRCNDMVHSWI-IN---TLDPKIADNVIYY
O22175_ARATH/27-174----------------LRAKQKLGFIDGSI..PKP.AADP.....ELSLWIAINSMIVGWI-RT---SIDPTIRSTVGFV
O23588_ARATH/73-209----------------LDAKNKLSFVDGSL..PRP.DVSD...R.MFKIWSRCNSMVKTWL-LN---VVT..........
Q0PY40_SOLLC/17-166----------------LLGRRKYGFVTGAC..TRA.LYKD...E.LHEQWETCNAIVLSWL-MN---TVSEELLSGIVYA
Q2HT49_MEDTR/20-168----------------LGAKNKLVFLDGSI..SVP.DIDD...L.NRQAWERCNHLIHSWI-VN---SVTESIAQTIVFH
Q2HU07_MEDTR/24-172----------------LGTKNKFVFIDGSV..PIP.PMDD...L.NRTAWERCNNLILSWI-IN---SVSPQIAQTIVFH
Q6L4J8_SOLDE/13-160----------------FRAKKKLGFIDGLI..TQP.KEEG.FE...LDDWYAVNSMLIVWV-FN---TIDPSLRSTISYM
Q9FIC5_ARATH/29-177----------------LKARKKFGFADGTI..PQP.DETN.PD...FDDWIANNALVVSWM-KL---TIHESLATSMSHL
Q9LGZ8_ARATH/19-166----------------LQAKQKLGFLDGTI..PKP.TTEP.....ALSSWKAANSMIIGWI-RT---SIDPTIRSTVAFV
Q9M0P5_ARATH/20-169----------------LNVRNKLGFIDGTI..PQP.PSTH...R.DAGSWSRCNDMVATWL-MN---SVSKKIGQSLLFM
Q9XIM3_ARATH/23-161----------------LDVKNKSGFIDGTL..PRP.LETD...K.NFCLWSRCNSMIC...-..---.......RSILRM
Q9ZPU4_ARATH/37-185----------------LQAKRKTGFINGTI..PRP.PPND.PN...YENWTAVNSMIVGWI-RT---SIEPKVKATVTFI

PF16297

H0W794_CAVPO/2-110--------------------------------.RWRNPIP-----FPETFNGDTDRLPEFI-VQ---TGSYMFVDDKTFS
D3ZTE6_RAT/24-138--------------------------------RLPSCPVP-----YPSRFSGESGRLPEFV-VQ---TMSYMLVNEEHFC
G1MLQ7_AILME/2-114--------------------------------QRWRNPIP-----FPETFDGDTDRLPEFI-VQ---TGAYMLVDETLFS
F7ASC6_CALJA/2-113--------------------------------RRWRNPIP-----FPETFDGDTDRLPEFI-VQ---MGSYMFMDENTFS
Q9D6I0_MOUSE/2-112--------------------------------GRWQNPIP-----FPELFDGEMEKLPEFI-VQ---TLSYMLVDEKTFD

PF14223

Q0KIL6_SOLDE/91-204----------------------GDQG..Q...SAKQIAMR-----TLMNT----KMVEGTP-VR---DHVLKMIGLLNEL
A5BQ76_VITVI/412-525----------------------GDQT..S...AARQNTLR-----EILTS----KMEEGTQ-VR---THVLKMMSLLNDM
A5AHT8_VITVI/92-205----------------------AANK..K...VETSTILS-----KFVSI----RYKGKEN-IR---EYIMEMSNLVTRL
B8BH64_ORYSI/219-332----------------------ARNE..K...AETSTLLA-----KLISM----RYKGKGN-MR---EYIMEMSHLASKL
A5BI38_VITVI/288-401----------------------VTLD..K...ALANTLVM-----KFSSL----RLTDVSG-VR---EHIMQVRNIAAQL
A5ANU6_VITVI/96-209----------------------KAEE..E...GTKKFLIS-----QYIDF----KFFDEKP-LL---PQIHELQVIVNKL
A5B8Q0_VITVI/530-643----------------------MTKS..L...TNRLYLKK-----RLHTL----HMKKFMS-IK---DLLDEFNKTIMDL
A5AQ94_VITVI/79-192----------------------MQNS..L...SNRLYLKE-----RLYGF----KMQEDRS-IA---DNLDDFAKIVLEM
Q18L98_CITSI/81-195----------------------MKKS..L...AHRLFLKK-----RLYTF----SMREGVT-IQ---DHIDTFNKIILDL
Q1KUM3_9ROSI/118-231----------------------IEQS..L...PNRMYLMQ-----RVSGF----RMDSSRT-IE---ENLDIFQKLLSDL
Q7XTM9_ORYSJ/78-191----------------------MTKD..L...TSKMHLKQ-----KLFLH----KLQDDGS-VM---DHLSAFKEIVADL
Q01M93_ORYSA/78-191----------------------MSKD..L...TSKMQMKM-----KLFTL----KMKEEDS-VI---THIAEFKKIVADL
A5AS33_VITVI/79-194----------------------EKPS..A...NYKVHLMK-----ILFNL----NMTENAS-VA---QHLNEFNTITNQL
Q2AA06_ASPOF/860-974----------------------LTKS..V...ENRLHLLR-----RLFRF----QMSRGTS-LA---AYVNNYTKLLSNL
Q6XMP8_AEDAL/82-196----------------------AKKS..A...GRQTLIRK-----QIARL----HLKDGAS-VR---AHLLQFEDLIRQL
D2A543_TRICA/77-191----------------------QRKG..I...TSQLFLRK-----KLLTM----KLSSNDT-ME---KHFLKFEETIREL
Q9U6V8_DROWI/75-189----------------------ERKS..L...ASQLALRK-----RLLSL----KLSSEMS-LL---SHFHIFDELISEL
A5BIJ4_VITVI/84-197----------------------SLTI..IG..SQILNLKT-----TLART----N.MDTMS-VS---EYLMTIKHMADEL
Q0ZCD8_POPTR/118-230----------------------ASKS..R...SRALQLKE-----ELTLI----K.RDNKT-VQ---EYLHIVKTLADEI
A5B6L3_VITVI/126-238----------------------NSQS..S...AKVMFYKS-----QMHML----K.KDGLT-MR---DYLTKMKNYCDLL
A5BYA6_VITVI/62-174----------------------ASQT..R...AKVKQFKT-----QFQHT----K.KGGST-ID---EYLAKIRVCVDSL
A5BK17_VITVI/103-215----------------------ATQV..R...AKVTQFKT-----QLHNT----K.KGDLS-IS---DYLLKIRNVVDLL
A5CAE5_VITVI/64-176----------------------SAST..K...ARTMQLRL-----AFQTT----K.KGSLT-MM---EYIQKLKHISDSL
A5BJ70_VITVI/81-193----------------------SASS..K...ARIMQLRL-----EFQTT----K.KGGDS-ML---DYILKMKTISDNL
A5BFR8_VITVI/115-227----------------------SSSS..R...ARIMQLRL-----ELQST----K.KGSMS-MI---DYIMKIKGAADNL
Q9SV56_ARATH/103-217----------------------NRVS..A...SRKSDLQR-----RLNPV----S.KNEKS-ML---EYLNCVKQICDQL
Q9SSB1_ARATH/101-216----------------------NRVS..S...SRLFELQR-----RLQTL----E.KKDNT-ME---VFLKDLKHICDQL
D1GEF6_BRARP/107-222----------------------NRPT..S...ARLFELQR-----KLQTT----A.KQDKS-MD---DYLRDIKTICDQL
C0SQ79_PYRYE/115-228----------------------DHET..A...TRRGELEE-----ALATL----RKQPNET-IM---EYVGRTKGIRDDL
A5B3I2_VITVI/89-207----------------------QGTT..RVKRAHLQALRK-----EFELL----HMKAGES-VN---EYFARTLTIANKM
A5B8H9_VITVI/153-271----------------------QGTA..RVQRAQRQALRK-----EFEML----NMKVGES-VN---EYFARTLTIANKM
A5BGM4_VITVI/89-207----------------------QGSM..RTKRQQLQALRS-----EFETL----RMKPGES-VS---DYFSRTMAIINKM
Q9M1C6_ARATH/91-209----------------------QGST..KVKRAQLQALRK-----EFELL----AMKEGEK-ID---TFLGRTLTVVNKM
A5BYF7_VITVI/162-280----------------------QGST..RVKQAQLQALRK-----EFEIL----QMKEGEK-VD---EYFAKGLTIANKM
A5BY31_VITVI/28-146----------------------EGNA..RVKRSILQALRR-----DFETL----EMKSGEC-IT---DYFSRVMSVSNKM
A5BFQ9_VITVI/28-146----------------------EGNA..RVKRSHLQALRR-----EFETL----EMRSGEG-VT---EYFFRVMTMANKM
Q9C7Y1_ARATH/87-205----------------------QGND..RVQSAQLQRLRR-----SFEVL----EMKIGET-IT---GYFSRVMEITNDM
A5AMT2_VITVI/80-198----------------------XGTT..RAKRQQLQALRS-----EFEML----RMTSGEL-VI---DYFSRTIAIVNKI
Q2QXM6_ORYSJ/85-203----------------------QGSQ..KVLAVKLQTLRR-----QFQNL----LMKESEK-VK---DYFSRVIEIVNQM
Q6L3N8_SOLDE/84-202----------------------FGDD..KVITVKLQTLRR-----DFETL----FMNENES-VQ---GYLSRTSAIVNRM
A6YTD9_CUCME/91-209----------------------QGED..KVKMIRLQALRS-----EFDCI----KMKETET-IE---EFFNHILVIVNSL
Q9M2D1_ARATH/89-207----------------------KGAD..QVKKVRLQTLRG-----EFEAL----QMKEGEL-VS---DYFSRVLTVTNNL
A5BLB0_VITVI/283-400----------------------QGDK..RTRSVKLQALRR-----ELENM----KMKENET-LN---EFSSKFMELVNQM
Q9LH44_ARATH/87-205----------------------QGSS..QVKMINLQTLRR-----EYENL----KMEEGET-IN---DFTTKLINLSNQL
Q9ZQE9_ARATH/91-209----------------------QGSP..QVRLVKLQSLRR-----EYENL----KMYDNDN-IK---TFTDKLIVLEIQL
A5B9M8_VITVI/90-208----------------------EGSE..RVKNVRLLTLKR-----EFELM----KMKDDES-VK---DYSGRLMDVVNQM
A5BRD1_VITVI/91-209----------------------EGNE..QVKGMQVLNLIR-----EFEMQ----RMKELET-IK---DYSDRLLSIVNKV
A5B779_VITVI/91-209----------------------QGNE..RTKNMQVLNLIR-----EFEML----KMKETET-IK---DYSDKLLGIVNKV
Q9SEL2_VITVI/89-207----------------------KGDE..RIKNMQVMNLIR-----EFEMK----KMRESDA-VK---DYAAQLLSIANKV
A5BFD6_VITVI/89-207----------------------QGNE..RLRNMQVMNLIR-----EFEMV----RMKESQT-IK---DYAEQLLTIANKV
A5BRW6_VITVI/90-208----------------------QGSD..RTKQMQVLNLKR-----DFKSL----TMKEDET-IT---KYSDRISLIVNKI
Q6L3X6_SOLDE/202-320----------------------QGSD..RTRQMQVLNLKR-----EFECL----NMQDDET-IS---KYADRISLIVNNI
A5ACV7_VITVI/90-208----------------------LGSD..RTRQMQILNLKR-----QFEVL----RMKDNEF-IK---EYVDKLMEVVNKI
Q6L3Y5_SOLDE/89-207----------------------QGSD..RTRQMQILNLRK-----EFEML----RMKETEK-VK---DYIDRIMKIFNQI
Q60EG1_ORYSJ/85-201----------------------VRAD..RVRDARLQTMKG-----EFASM----VMEAGES-LD---QYAGRITTMGVRH
C6JSM1_SORBI/92-210----------------------VGAD..RVKEARLQTLKS-----EFDAM----RMKDEES-LD---QYVGRLTGMSVRY
B6TPM7_MAIZE/94-212----------------------VGAD..RVKTARLATLKG-----EFDKL----YMEDEEA-LD---DYAGKISGMAARY
Q9SHT5_ARATH/47-166----------------------LGAE..RVKEAKLQTLMA-----EFDRL----NMKDNET-ID---EFVGRISEISTKS
Q9ZUF2_ARATH/41-160----------------------LGAE..RVKEAKLKTLMA-----EFDKL----KMKDNET-ID---ECAGRLSEISTKS
Q4ABY7_BRACM/83-202----------------------VGAE..RVREARLQTLMA-----EFDRL----KMKEADT-ID---YFVGKLSEISAKS
Q9LQK3_ARATH/80-199----------------------VGAE..RVKEARLQTLMA-----EFEKI----KMKETEK-ID---DFAGKLSEISTKS
Q9SKV6_ARATH/80-199----------------------VGAD..RVKEARLQTLMA-----EFEKM----KMKESEK-ID---VFAGRLAELATRS
Q9LE43_ARATH/83-202----------------------VGAE..RVKEARLQTLMN-----EFDRL----KMKDSEN-IE---AFSGRLAEIASKS
B6REL9_9BRAS/81-200----------------------LGAE..RVKEARLQTLTY-----EFERL----RMNDSDS-ID---AFSGKLSELASKS
B6REL1_9BRAS/60-179----------------------MGAD..HVREARLQTLNS-----EFDRL----VMKDSDI-ID---NFAGNLFEISSRS
Q7F814_ORYSJ/95-213----------------------MGEE..RVKKARVQTLKR-----ELDGM----YMSNSEK-IN---DFALKVTTIVNEI
B8BA29_ORYSI/100-218----------------------VGGE..RVRVARIQSLHS-----DFDNL----KMSDVES-VD---DFAAKFTALVGRI
D3IVE4_9POAL/219-337----------------------EGVD..RVKEVRLQNLHT-----EFENL----QMGETQS-VD---EFVGKLSSLYNQI
Q7X7K3_ORYSJ/176-294----------------------IGVQ..HVREANAQQLRR-----EFGDI----IFKDGET-VD---DFSMRIGVLANNL
Q0J5Y3_ORYSJ/115-233----------------------VGVE..RVRESKAQQLRR-----EFAAL----TWKEGET-AE---DFSVRITGLANNL
Q7XH44_ORYSJ/165-269----------------------VGTR..RVREANEQLLRR-----EFADA----RFKDGEN-ID---DFSMRIFGIANSI
Q2QYR6_ORYSJ/52-170----------------------VGVE..RVKEANAQKLRQ-----DFAAI----TFKPSER-VE---EFSLRLTGLANEL
Q5TKD7_ORYSJ/109-227----------------------VGVD..RVREAREQALRS-----QYEAI----QFKDGET-VE---DFALRLHALVIDI
Q7XTU6_ORYSJ/114-232----------------------VGVD..RVREAKEQGFRR-----QFESM----RFKERET-PE---EFAMRLTAVVADI
Q8LMZ0_ORYSJ/135-253----------------------VGVA..RVREAKAQTLRN-----EFELI----RMKESES-VD---EFSMRLNAIVNNL
Q7G5Z8_ORYSJ/110-228----------------------MGVE..RVREAKAQSLRK-----EFELI----RMKEGES-VD---DFAMRLTGLVNNI
Q53P77_ORYSJ/86-204----------------------VVND..RIRKASAQKLRS-----EYEAL----AFRDGES-VE---DFAMRLNTVVTQL
Q2QZL2_ORYSJ/49-167----------------------VGND..RIRKASAQKVRA-----EYESL----AFRGDET-VE---DFALRLTTIVNQL
Q7XWP2_ORYSJ/116-231----------------------VGDN..RIRKASAQRVRT-----EYERI----AFRDGES-VE---EFAMWLTSVVNQL
Q10C26_ORYSJ/22-139----------------------VGVD..RVRKSKAQLFLR-----QYDAI----EFKEGES-VE---DFSLRLNNLVTTL
Q7XUD9_ORYSJ/115-233----------------------VGVD..RVRKSKAQMLQK-----QYDAM----EFKDGET-VE---EFSLRLNGLVTNL
Q25AF6_ORYSA/117-235----------------------VGVD..RVRKAKAQQLRR-----EYESI----SFHDGES-ID---DFALRLTSLVSQL
C1IJC5_HORVU/114-232----------------------AGSA..RVRDAKAQNLRG-----EFDQL----RHKSGES-ID---ELAMRLTGMCARL
C5Y7F6_SORBI/35-153----------------------LGAD..RVKEVDAQKLLA-----EFESI----AFKLGEA-ID---DFAVRISKLASDL
Q94I41_ORYSJ/94-212----------------------AGDD..RVKATSVQRLMK-----QFENM----AFRDGEN-VG---DFAMRINGLVASL
C5XUK3_SORBI/218-337----------------------IGVD..RVRRATLQRLRR-----DWENI----SVNPGEQ-VE---DFAMRLSTLHQQL
C5XQM0_SORBI/100-219----------------------IGID..RVRRATLQRLRK-----EWENL----SFRPREQ-IE---DFALRLATLKQQM
Q9AUM6_ORYSJ/569-688----------------------IGSD..RARRSTLQKLRQ-----DWENL----AFKPGED-ID---DFVLRLNSLQQRL
Q2QWI2_ORYSJ/47-166----------------------IGSD..RARKSTLQALRK-----EWENL----AFKPGED-VD---DFALRLNTLLQKM
C5Z583_SORBI/100-218----------------------IGSD..RAKRARIQQLRR-----ELNDS----KFKPGES-VE---DFTLRLQSLATQL
C5WNA6_SORBI/224-342----------------------VGSD..RAKKATAQLLKQ-----EYANL----KFKDRES-VE---EFSLRLSSLISKL
D3IVP8_9POAL/630-749----------------------EGSK..SVKGVHQNQFKK-----EYSKF----EMKPGES-VD---ALFDRFNKIISDL
D3IVT7_9POAL/58-177----------------------EGST..AIKEVRQNQLKK-----EYSKI----EQRPGES-LD---ELWGRFSKILHDL
D3IVI1_9POAL/86-205----------------------EGTT..QIKTVRQDQFKR-----EYNKF----EMLAGES-LD---ECFSRFHKILSNL
Q10PG0_ORYSJ/85-204----------------------EGNN..DIQLVRQNQFHK-----EYQRF----EMHPGES-ID---SYFKRFGEIISKL
D3IVI3_9POAL/99-218----------------------EGSS..QIKQVRQTVFKS-----EYNKF----EMRLGES-ID---DVFSRFNKVINQM
Q5H9X1_ORYSJ/112-231----------------------EGTD..SVRESKVEILKG-----QFERF----VMLDGEI-PS---DMYDRLSKIVNEI
Q10NE5_ORYSJ/129-248----------------------EGSP..AVREAKIELLEG-----RLGRF----MMDDKET-PQ---EMYDRMMILVNKI
C5WYF6_SORBI/63-181----------------------EGVD..KVRKAKIDLMMA-----KLNRF----VIVGDEG-PQ---EMFDRLMVLVGKI
Q8S467_MAIZE/138-257----------------------EGDE..LTKITKRETIEG-----ELGRF----RLRQGEE-PQ---DMYNRLKTLVNQV
Q8H6I4_MAIZE/204-323----------------------EGDP..KAKRHRVEALES-----ELARY----DWTKGES-LQ---SLFDRLMVLVNKI
Q33BC8_ORYSJ/86-203----------------------EGTS..EYKDAKLHFLKI-----QYETF----SMLPHES-VN---DMYGRLNVIVNDL
A2Q5V3_MEDTR/101-218----------------------EGTS..KVKSSRIQLLTT-----KFESL----KMQEDET-IQ---DYYMNVLDIANSF
O65147_SOYBN/76-194----------------------EGTS..KVKMSRLQLLAT-----KFENL----KMKEEEC-IH---EFHMNILEIANAC
A5BZ48_VITVI/103-221----------------------EDTN..AVKVSKLLMLTS-----RFETI----RMEDHEN-FG---EFYAKLMDIVNSS
Q9XEB1_ARATH/433-551----------------------ECTN..NVKRTRLDMLAS-----EFENL----TMEAEES-VD---DFNGKLSSITQEA
Q9FG84_ARATH/101-219----------------------EGTS..SVKRSRIDMLAS-----QFENL----TMDESEN-IE---EFSGKISAIASEA
Q9ZV83_ARATH/82-200----------------------EGTS..SVKRTRLDHIAT-----QFEYL----KMEPDEK-IV---KFSSKISALANEA
A2I5F8_BETVU/104-223----------------------EGTN..EVKRSKIDLLMN-----QYELF----CMKSKES-IR---DMFTRFTNIINEL
A5BW11_VITVI/73-191----------------------EGTN..QVKESKINLLVH-----NYELF----SMKETET-IV---EMITRFTDIVNGL
Q1S5J6_MEDTR/118-236----------------------EGSK..KVKEAKALMLVH-----QYELF----RMKDDES-IE---EMYSRFQTLVSGL
Q9FJT0_ARATH/33-146----------------------VGGP..IFQARKLLDLKK-----EYNNT----TMSDAET-VH---EFTGKLLELVFRM
Q9LJD1_ARATH/93-210----------------------EQATIRRLEQVTIRRLEK-----QLEDL----KMVDKES-GS---SYLDKALEILERL
Q9LJD1_ARATH/509-622----------------------NEQ.......AKLRRLEK-----QFEEL----SMNEGEP-IN---PYIDRVIEIVEQL
Q9LJC8_ARATH/91-202----------------------.GND..T.KEAKLRRLEK-----QFEKL----MMYEGEP-MD---LYLKRVEEITERF
Q9LJC9_ARATH/91-203----------------------.GND..NEEAKKLRRLEK-----QLENL----TMYEGER-MK---SYLKRVEKIIEEF
A9TSN8_PHYPA/23-136----------------------STQT..M...ADVMKILD-----KWENL----SMTDKMT-IS---IFMQNVYDFINDM

PF03732

Q9XX53_CAEEL/210-308----------------------NQVV..............-----NFEELVE--ELRKTFD-NA---VLIRHREQQLRQC
PEG10_MOUSE/174-267----------------------CTYL............MH-----NYTAFMM--ELKHVFE-DP---QRREAAKRKIRRL
Q9AUY8_ARATH/31-127----------------------KGER............VE-----TFKDFED--EFNRMYF-PS---EAWDRLESNFLDL
Q9FWC7_ORYSJ/155-249----------------------NEVN..............-----SWDQFRM--AVATEFE-G.---VVEREKMSALDTL
Q9FE41_ORYSJ/775-871----------------------GENP...........SIG-----NWATMKE--VFKKHFV-A.---MKKDFSIVELSQV
Q9LP90_ARATH/163-253----------------------GDFV..............-----SWLKLKS--GLMLRFG-NL---KLRGPSQS.LFCI
Q9LMV1_ARATH/257-344----------------------SID...............-----SFHQLTS--SFLKHYA-PL---IENQTSNADLWSI
Q9ARZ4_ORYSJ/100-192----------------------SIY...............-----SWEQLRD--VFVLNFR-GT---YEEPKTQQHLLGI
Q9FYC9_ARATH/102-194----------------------IMWRH..........VRH-----DWWNYKL--LLQVRYN-K.---.HVDDSIAKLKLL
Q9SK57_ARATH/214-310----------------------RGDE............VR-----SFADFED--EFNKKYF-PP---EAWDRLECAYLDL
Q9FRJ2_ORYSJ/81-182----------------------NVFDVVYK...PRASAFT-----VWSDIEG--VFRDNAV-Q.---.RSVYLETEFRSI
Q9AV68_ORYSJ/351-443----------------------TIG...............-----SWAELRD--HFIANFQ-GT---FERPGTQFDLYNI
Q9AYB5_ORYSJ/567-664----------------------RITA...........EPI-----TWLEFTA--AFRKTHI-PS---GVVSLKKKEFRSL
O23529_ARATH/90-186----------------------ATKA............SQ-----IWKTLTN--TYAKSSY-D.---.HIKQLRTQIKQL
O82608_ARATH/272-360----------------------SVD...............-----SFQELST--LFLKQYS-VL---IDPSTSDADLWSL
Q9AYC2_ORYSJ/729-826----------------------RPPG...........TEV-----TWVEFCR--SFRKAQV-PD---GVMAQKKREFRAL
Q9FGL3_ARATH/131-241----------------------QIYKSILR....FNDAAE-----IWKDLDT--RFHITNL-P.---.RSYQLTQQIWSL
Q9SQW9_ARATH/264-354----------------------EQIY..............-----TWREFQE--KFMLRFR-P.---SRGSSAVDHLLNV
Q9LNM2_ARATH/83-178----------------------SVD...............-----SFHELST--LFLKQYS-VL---IDPDTSDADLWSL
Q9AYB6_ORYSJ/694-791----------------------QPEG...........QPI-----TWARFTA--AFRRTHV-PA---GVVALKKREFREL
Q9XE67_SORBI/155-252----------------------HENP...........GGI-----TWAEFTE--AFREQHV-PE---GVMDAKVEEFRNI
O49369_ARATH/139-231----------------------MWWKH..........VRH-----DWWSYKL--LLQVRYD-E.---HVNDSIAK.LTQL
Q9ZPF9_ARATH/97-196----------------------KRRLGD........DSIE-----TWNQLKN--IMKRRFV-PS---HYHRELHQRLRNL
Q9XII7_ARATH/126-236----------------------QIYRSILR....MNDASD-----IWRDLNS--RFNVTNL-P.---RTYNLTQE.IQDF
Q9SIM3_ARATH/131-240----------------------NDAT.............D-----IWRDLFD--RFNLTNL-P.---RTYNLTQE.IQDL
Q9MA68_ARATH/89-183----------------------SVD...............-----TWDDCKK--AFLAKFF-SN---SRTARLRNEISGF
Q9M225_ARATH/186-282----------------------RRQA............DM-----SWADFVV--EFNAKYF-LQ---DELDRMEVRFLEL
Q96467_HORVU/82-176----------------------SID...............-----SWDKCKD--AYISKYF-PP---AKIISLRNDIMNF
Q9AXC5_ANTHI/295-388----------------------WKNDM..........TPR-----TWDNFVK--EFYNKYI-P.---....QVRERILEL
Q9M0T9_ARATH/89-183----------------------SII...............-----TWDDCKK--AFLSKFF-SN---ARTARLRNEISGF
Q9SY43_ARATH/188-284----------------------RRQA............DM-----SWADFMA--EFNAKYF-PR---EALDRMEARFLEL
Q9C7H8_ARATH/150-242----------------------GIGLD..........VFF-----NWPEYVK--LLKDRFE-D.---ACDDPMAE.LKKL
Q9ZNW4_SORBI/210-302----------------------SIY...............-----SWENLRD--KILANFQ-GF---AVESLTSTDLFQC
Q9SUN0_ARATH/223-313----------------------SID...............-----NFTQLST--AFLKQYR-VF---IQPGASSSDLWSM
Q9M252_ARATH/163-260----------------------TPVQ...........HVI-----FWEDFRE--EFNRKFF-PQ---EAMDSLEDDFEEL
O93283_TAKRU/149-242----------------------DPRL............SS-----DYSAFRR--EFKAVFE-HP---TYGEDAASRLLAL
Q9ZQQ3_ARATH/198-290----------------------SIS...............-----NFNELSV--VFLKQYS-IL---MDKSISDTDLWNL
Q9ATX2_MAIZE/179-271----------------------TIT...............-----SWQKLKD--MLLTSFQ-GF---QTKPVTAQALFQC
O81471_ARATH/148-242----------------------SLK...............-----IWRSIKI--AFLTNFY-DD---AKSEELRNKLSTF
Q9FW76_ORYSJ/181-275----------------------LAGA..............-----TWFELCD--RVCGRFA-R.---DRKQALIRQWIHI
Q9SKF2_ARATH/107-197----------------------SIT...............-----SWDQCKR--AFLSKFF-ST---TRTARLRNEISSF
Q9SYE8_ARATH/131-230----------------------RRRTRD........YPIK-----TWNQLKF--VMRKRFV-PS---YYHRELHQRLRNL
Q98SV9_TAKRU/117-207----------------------QTPA............SS-----SFPEFTA--ELKRVFD-HP---IQSGEAASQIRSL
Q9SJP0_ARATH/291-382----------------------SID...............-----SVHALTT--SFLKNYG-VF---MEKGASNVDLWTM
Q9XE85_SORBI/114-212----------------------RPNNA..........SPV-----TWLEFCR--DFRARHI-NE---GVMELKQEEFRSL
Q9ZS84_SOLLC/150-247----------------------DVSAGR........PRID-----TWDKLIK--EMRDQFL-PS---NASWLARDKLKRL
O48967_MAIZE/245-337----------------------SIY...............-----SWEELYA--RFVANFA-SA---YQQHGVEAHLHAV
Q9LZG5_ARATH/148-244----------------------EQVG...........CVD-----QWSFFKE--EFTRRYL-PE---ETIDDLEMKFLRL
Q9SX87_ARATH/132-224----------------------DFGVK..........LLS-----NWNMYKL--LLEEHFA-E.---.VLDDPISELKQL
Q9LQH2_ARATH/476-575----------------------RRRAGD........YPIE-----SWTQMKT--IMRKRFV-PS---HYYRELHNRLRNL
Q9FZN9_ARATH/121-215----------------------SIT...............-----SWNDCKK--AFLAKFF-SN---SRTARLRNDISGF
Q9SLQ0_ORYSI/194-290----------------------NPNN...........TPQ-----TWDAMKR--VMRARFV-PS---YHARDLLHKLQQL
Q9UVC2_PASFU/52-153----------------------YLDSNGED...NADGVFK-----SYNHLKH--AMKSVFG-VS---NEIATAVRVIQHL
Q9ZPG6_ARATH/97-191----------------------SIT...............-----SWDDCKK--DFLAKFF-SN---ARTARLRNEISGF
Q9ZUK1_ARATH/211-302----------------------SID...............-----NFKQLST--AFIKQYE-YF---INSDITEAHLWNF
Q9FWB1_ARATH/104-198----------------------NLR...............-----SWEDYKA--AFLTQYF-TQ---SRTAIMRNEISSF
Q9HFY8_COLGL/148-252----------------------WLDNPVEKYSQEVRNIFF-----SFDGYVK--ALQSLFL-DP---DEKRQAERDLSNL

PF14227

A5BY76_VITVI/104-226------------------------EGTNQVKESKINLLVH-----NYELF-...SMKENEA.IV...EMITRFTDIVDGL
A5B9Z7_VITVI/12-134------------------------EGTNQXKESKINILVH-----NYELX-...SMKESES.IV...EMITRFTEIVNXL
A5BSC1_VITVI/688-789------------------------KGYLCVSPRV......-----.....-.................LLIRFTEIVNGL
A5BWL8_VITVI/342-448------------------------.............LRS-----RFDRG-...PVKDNET.IV...EMITWFTDLVNGL
A5BLR1_VITVI/94-215------------------------MTXNDVMVGITXAGLS-----RY.LN-...RRYENET.IV...EMITRFTDIVNRL
A5BLB0_VITVI/282-404------------------------QGDKRTRSVKLQALRR-----ELENM-...KMKENET.LN...EFSSKFMELVNQM
Q9LJC9_ARATH/90-212------------------------DNEEAKKLRRL...EK-----QLENL-...TMYEGER.MK...SYLKRVEKIIEEF
Q5AT23_EMENI/392-511------------------------ERRTQVDVTNA...IR-----KVTRW-...QMDPKMS.LEGAMQQLDQYNAELEDI
D3IVP8_9POAL/629-752------------------------EGSKSVKGVHQNQFKK-----EYSKF-...EMKPGES.VD...ALFDRFNKIISDL
COPIA_DROME/74-192------------------------ERKSLASQLAL...RK-----RLLSL-...KLSSEMS.LL...SHFHIFDELISEL
D2A543_TRICA/76-194------------------------QRKGITSQLFL...RK-----KLLTM-...KLSSNDT.ME...KHFLKFEETIREL
O96968_BOMMO/78-193------------------------KRKSTLSALYV...RK-----KLLTL-...KCDPSVE.LS...DHFNNFDMLIRQL
Q6XMP8_AEDAL/81-199------------------------AKKSAGRQTLI...RK-----QIARL-...HLKDGAS.VR...AHLLQFEDLIRQL
B0X5G3_CULQU/101-222------------------------EVESMNTMMTV...MQ-----KMCSL-...KLQEDGN.LP...EHLKKLTAMHNRL
Q967L5_AEDAE/76-197------------------------EKSTRSVRVSL...LK-----KLCAI-...NLSERGD.LE...QHLFEVDDLFDRL
Q8WRX6_ANOGA/74-195------------------------QKTTMSTKVSL...LK-----KLCKA-...EYDESGD.ME...AHLFRMDELFSSL
B2CN78_DAPPU/42-160------------------------LRNAVENQHVL...QQ-----KFFEY-...QYQPEHD.IM...AHITEVETMASML
A9RF54_PHYPA/34-146------------------------DESNF.........AH-----KFFTV-...KMEEGED.LM...AHVNKVKALANQL
Q8H023_ORYSJ/210-330------------------------MSKSLTSKLYL...KQ-----QLYGL-...QMQEESD.LR...KHVDVFNQLVVDL
Q7XSZ1_ORYSJ/103-219------------------------.SKPMTTSGFP...NS-----TVNS.-...HMQEESD.LR...KHVDVFNQLVVDL
Q7XLX2_ORYSJ/160-253------------------------MSKTLTNKRYL...KQ-----KLYGL-...KMQEGAD.LT...AHVNVFNQLVTDL
A5BPQ9_VITVI/512-624------------------------ADTPSGHESMV.....-----.....-...KMVEGSD.LS...QHINVFNHIISDL
A5B864_VITVI/32-156------------------------MSKLLRNKLYL...KQ-----KLYGL-...KMVEGSN.LS...QYINVLNHIISDL
Q9AU17_SOLCI/79-196------------------------MSKTLTNKLYL...KK-----QLYTL-...HMDEGTN.FL...SHLNVLNGLITQL
B1N668_SOLLC/75-192------------------------MTKSLTNKLLL...KQ-----RLFGL-...RMAEGTQ.LR...EHLEQLNTLLLEL
Q2AA06_ASPOF/859-977------------------------LTKSVENRLHL...LR-----RLFRF-...QMSRGTS.LA...AYVNNYTKLLSNL
Q69FA7_PHAVU/58-175------------------------LKKSGQNKLLM...KK-----RLFRF-...DYQQGTT.MN...AHITMFNQLVAYL
Q6BCY1_IPOBA/74-193------------------------EAKSLHNKIFL...KR-----KLYTL-...RMSESTS.VT...EHLNTLNTLFSQL
B8YLY5_MEDTR/73-192------------------------EVKSLHNRIFL...KR-----RLYTL-...RMGESTS.VT...DHINTLNTLFSQL
Q25A78_ORYSA/77-175------------------------MTKDLT..........-----.....-......NDGS.VM...DHLSVFKEIVADL
Q53QA4_ORYSJ/75-188------------------------MSKDLTSKMQM...KM-----KLFTL-...KMKEEDS.VI...THMAEFKKIVADL
Q94LG0_ORYSJ/79-192------------------------MSKDLTSKMHI...KM-----KLFSH-...KLQESGS.VL...NHISVFKEIVVDL
Q01MJ3_ORYSA/27-111------------------------MSKDLTSKMHL...KQ-----KLFLH-...KLQDDGS.VM...DHLSAFKEIVADL
A5BQQ6_VITVI/23-136------------------------MTKSLTSKLHL...KQ-----RLYSH-...RMKEGMS.LE...DHLIVFKGIVSNL
A5BPL2_VITVI/25-141------------------------IXKSLTXKLHL...KQ-----QLYXH-...HMIEGMS.LE...DHLTVFKEIGSDL
Q9SJT2_ARATH/93-212------------------------MSKALPNRIYQ...KQ-----KLYSF-...KMSENLS.IE...GNIDEFLRIIADL
Q9SH77_ARATH/93-212------------------------MSKALPNRIYP...KQ-----KLYSF-...KMSENLS.VE...GNIDEFLQIITDL
Q9FFM0_ARATH/98-215------------------------MAKSLPNRIYL...KQ-----RLYGY-...KMSENMT.ME...ENVNDFFKLISDL
Q9LS18_ARATH/107-224------------------------LSDPLSSRISL...KR-----KLFEF-...KMSENKA.VE...ENIEDFFRIVEDL
Q9ZQE4_ARATH/102-211------------------------METSLPNRIYL...QL-----KFYTY-...KMTDSRS.ID...GNVDDFLKLVTDL
Q9LJS6_ARATH/105-202------------------------METSLPNRIYL...HL-----KFYTY-...KMTDSKS.ID...GNVDDFLKLVTDL
O81903_ARATH/103-220------------------------METSLPNRIYT...QL-----RLYSF-...KMVDNLS.ID...QNTDEFLRIVAEL
Q9SHR5_ARATH/101-218------------------------METSLPNRIYT...QL-----KLYSF-...KMVSTMT.ID...QNVDEFLRIVAEL
Q9LVY5_ARATH/105-222------------------------METLLPNRIYA...QL-----KFYSF-...RMMTSKT.ID...QNVDDFLRIVAEL
Q02900_ARATH/97-214------------------------METSLPNRIYV...QL-----KFYSF-...KMNDSKS.IN...ENVNEFLKIVAEL
O82196_ARATH/63-180------------------------LVKSLPNRVYL...QL-----KVYNY-...RMQDSKT.LE...ENVDEFQKMISDL
Q9ZPU5_ARATH/68-187------------------------MIRSLPHRVYT...QL-----SFYTF-...KMQENKK.ID...ENIDDFLKIVADL
Q1KUM3_9ROSI/117-234------------------------IEQSLPNRMYL...MQ-----RVSGF-...RMDSSRT.IE...ENLDIFQKLLSDL
A5AR03_VITVI/133-256------------------------AFFSXGSGEHL...KR-----RKKSA-KRDKMHEGKS.ID...ENIDEFTKLVLDL
A5ARG5_VITVI/22-139------------------------MLKSLPNRIYL...KQ-----KFFGF-...KMHEKKS.ID...EIIDEFTKLVVDL
Q9M3C1_ARATH/26-145------------------------QTKTLANMIYL...KH-----KFTSF-...KMVENKS.IE...ENLDTSLKLVADL
A5AJF1_VITVI/465-574------------------------MTKSLANRLHK...KI-----KLYTF-...KMTTGMS.IE...EHLDHFNKIILDL
A5BLL6_VITVI/78-195------------------------MTKSLGNRLHK...KI-----KLYTF-...KMIPGMS.IE...EHLDHFNKIILDL
A5BYU4_VITVI/59-176------------------------MTKSLANQLHK...KV-----KLYTF-...KMTSSMS.IE...EHLDHFNKIILDL
A5BPE6_VITVI/78-195------------------------QKKSLTNRLYQ...KR-----QLHTL-...KMSEGMQ.VR...DHLNNFNRIILDL
Q18L98_CITSI/80-198------------------------MKKSLAHRLFL...KK-----RLYTF-...SMREGVT.IQ...DHIDTFNKIILDL
A5B6C0_VITVI/29-150------------------------MTKSLTNLLNL...KN-----WLYTL-...QMKEGTSTIK...NHLDEFNKTIMDL
A5AYK3_VITVI/32-152------------------------MTKSLKNRLYL...KK-----RLHTL-...QMKESMS.IK...DHFNEFNKTIXDL
A5B8Q0_VITVI/529-644------------------------MTKSLTNRLYL...KK-----RLHTL-...HMKKFMS.IK...DLLDEFNKTIMDL
Q2AA73_ASPOF/71-191------------------------LMKSLTNRLLL...KQ-----RLYTL-...WMSEGTP.IK...SHIGEFNSVITYL
A5AM57_VITVI/98-215------------------------RTRALPNHIYL...KE-----HLYGF-...KIEESKP.ID...DALDEFNKLVLDL
A5C6J6_VITVI/77-184------------------------LKRSLANRLYL...KK-----RSYSL-.................HIDEFNKVILDL
A5AQ94_VITVI/78-195------------------------MQNSLSNRLYL...KE-----RLYGF-...KMQEDRS.IA...DNLDDFAKIVLEM
A5AKU3_VITVI/615-723------------------------LYGELT..........-----.....-...FKQEDRS.IA...DKLDHFAKIVLEM
C6GFP7_FRAAN/52-171------------------------KGKSIGNKLLL...KE-----QLFGL-...KMEEGDD.LN...DHICKFQNCIANL
A5C6L3_VITVI/78-195------------------------EKPSANNKVHL...MK-----KLFNL-...KMAENAS.VA...QHLNEFNTITNQL
A5BCL0_VITVI/55-172------------------------EKLFANNKVFL...MK-----KLFHL-...KIEEDFS.VA...TLLNEFNMIVNQL
A5AL15_VITVI/39-145------------------------ITVAL..KVFL...MN-----KLFHL-...NMREGVS.VA...TRLNEFNMIVXQL
Q6RZV5_MUSAC/23-145------------------------KKRKKRDDHFEGIDLL-----GLVNL-...KFKDGDN.IV...KHISLFQSLANKL
Q9ZRJ0_TOBAC/76-193------------------------ASKTGNNKLFY...LT-----KLMQV-...KYVEGTT.VA...DHLNEIQGIVDQL
Q5MG99_IPOBA/76-193------------------------ASKTGNNKLFL...LK-----QMMNI-...RYREGTL.IN...DHVNDFQGVLDQL
A5AJF5_VITVI/76-192------------------------ARKTGNNKLFL...IK-----KMISL-...KYQDETT.MT...DHLNTFQGIINQL
A5BEP3_VITVI/54-180------------------------AQKTSNNKLFL...IK-----KMISL-...KYQDGTP.MT...DHLNTFQGIINQL
B3N452_DROER/17-137------------------------QPSGPVRKVSL...YK-----TLLGL-...KVEDGQN.VS...SHLNAFNEVLDQL
B4N7F3_DROWI/52-172------------------------QPRGPVQKVSL...YN-----ELLSL-...RMTDGQE.MP...SYINGFSDVLDQL
B6V6Z8_DROME/78-198------------------------LPGGPIRKVQL...YQ-----KLSRL-...RMLEGDN.VV...QYVNKFAETVNKL
B4NQE5_DROWI/78-198------------------------QSKGPVRKASL...LK-----RVALS-...RVCEGSD.AR...HHINDFFDAVKKL
Q45W64_PHACR/80-192------------------------ATQGTMAKVTL...VR-----RLQKY-...EMSEGAD.ME...DELRKLTEMRAEA
Q5JMV2_ORYSJ/12-126------------------------NVHSTPCYLVL...RC-----KWIQT-...RIESD...LR...KHMDVFDQLVKDL
A5CA63_VITVI/149-269------------------------AKDSQEREFTL...RQ-----QVTYL-...RKEDDKT.IG...EHIRTFKSLCDSL
Q8W5F6_ORYSJ/80-197------------------------GATDASNDLYI...ME-----QFHDY-...KMADNHS.VV...EQAHEIQTMAKKL
Q8LN71_ORYSJ/50-167------------------------GVSDAGSELYV...ME-----QFYDY-...KMVDDRS.VV...EQAHEIQMLAKEL
B7ZXP2_MAIZE/242-358------------------------GVTDAGSELYL...ME-----QLYDY-...KMVENRS.VV...EQAHEFQALAKEL
Q10LP7_ORYSJ/115-232------------------------SVPDAGKDLYL...VE-----KYHDF-...KMTNGKS.VV...EQTQELQLLVGEL
A5BQ76_VITVI/63-180------------------------KAEDVGMKKFI...VG-----KFLDY-...KMVDSKT.VT...SQVQELQIILHEL
Q0KIN7_SOLDE/84-201------------------------DTEEAGAKKYA...AS-----RFFRF-...QMVDNKS.VV...DQAQDFIMIVGEL
Q7Y173_ORYSJ/18-135------------------------RSSSKSYASSI...IK-----RLTSM-...RYNYKDG.VR...KHIMQMGAMNGEL
A5B4U1_VITVI/192-309------------------------VTSDKTLASTL...IM-----KFTSL-...KLTAIRG.VH...EHIMEMRDIVAQL
Q2R404_ORYSJ/102-219------------------------EFAPETHANTL...VN-----EMIT.-...SHYDGKSGIR...KHILEMTHMANQL
A5BQ76_VITVI/411-528------------------------GDQTSAARQNT...LR-----EILTS-...KMEEGTQ.VR...THVLKMMSLLNDM
Q0KIL6_SOLDE/90-207------------------------GDQGQSAKQIA...MR-----TLMNT-...KMVEGTP.VR...DHVLKMIGLLNEL
Q9SZS9_ARATH/2-131------------------------STQTFTVVVLVLFVIL-----ILVGL-GIFSLPSTNK.TS...SMPMDLTTIVQTI
B9SXB7_RICCO/3-127------------------------TTMILTMLLMFTFVIL-----ILLAL-GILSVPSNSG.........DKAHDLTTIV

PF03564

A7SE42_NEMVE/491-638MKVR--------------------------------------------------GVTSEKD---AAGL-RRFYDAVETK-
Q17051_ASCLU/155-293QNLP--------------------------------------------------S....DN---GSQL-VATVQALERI-
Q23992_DROME/160-308MDMP--------------------------------------------------N.LNLES---NKQI-KTFIDTINES-
A7XDH0_DROAN/157-302MELP--------------------------------------------------S.TNNGE---VSIL-RSISDGANEV-
Q4JS97_ANOGA/133-280YSLE--------------------------------------------------K.MKTDS---TEEL-ARIVNEANRL-
Q4EAY5_9RICK/161-306TRLP--------------------------------------------------E.TTKID---VSVL-RKVTDGANEI-

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------------------------------------
F6H7D5_VITVI/16-42--------------------------------------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------------------------------------

PF14893

H0XX29_OTOGA/1-328QPQG..QAVARHAAAGGAEAAGG......EEAAGAAGEADAWSRQWSESLKPL.LRS..LA---CQEL-RAFSGREQPG-
M3Z644_MUSPF/1-327EGEG..TRLGELTRARAYGNDPS...DLGQN.MIPEVQAPMLARALEEALQPV.LQY..LK---YKKL-RVFSGSNPPE-
F7CY48_HORSE/1-330QPQR..QAVAGRAEAPGEEGAAG....PGVPAASEEEAAAARSQHWRQTLQSL.LDA..MA---YRAL-RRFSGVEEPG-
M4B0W2_XIPMA/1-317QNSG..SGCNPFVDS.........GQDSPFRTSTPEAIIRAVGEVLQMANPRSSSEG..SP---YRRL-RTFSGVQPTP-
F6TXQ3_HORSE/2-329EKEG..QTVSGMFRALGHEGVSP....AAVPCVSPELLAHLLGQAIAHAPQPL.LP...MR---YRKL-RVFSGSAVPA-
D3Z8Y9_RAT/1-327EEER..RTVSDMNRVLGTHSNYS......PTKTAISADFWAWAQTLGAVMQPL.LEQ..ML---YREL-RVFSGNTISI-
M4AZW3_XIPMA/2-318......STAQTGTDSLQTPELEM.SQNSLFQASSPEAIIRAVGDVLQLTSRPT.SDN..GS---YRRL-RTFSGVLPTP-
F7AVZ0_XENTR/7-324......THVDTLVSQFAVTAPVGVLPSKRLSDSPAEQSQVKILSALGLLTDQLTQQAWNGN---FERL-KVFSGADPVP-
PNMA5_HUMAN/1-322KDEG..RSMTDVARALGCCSLPA...........ESLDAEVMPQVRSPPLEPP.KES..MW---YRKL-KVFSGTASPS-
G1PM76_MYOLU/2-362DAEG..RTWEDVVRLLHLNDAPA..PRNRNQNPPPGSWVEALGALLGTVMQVI........---....-.LHLDSELRN-
F7D322_HORSE/1-321KDEG..RRMVDVAKSLGYSTLTE............GMEPEGLAQVKLPVLQPL.KES..MW---YRKL-KVFSGSVSPG-
G3N1H8_BOVIN/3-317QPQR..RAVVGRVGEGSRRRCWR.................NRTGEWWLALEPV.LEN..MG---YLEL-RTFSGMEEPD-
F1S2C6_PIG/1-333QAQR..QAVAGGADEEGAAGDTG.........AAGVAGSLSMEGAAGEAGAPG.EGAGAMG---YEEL-RAFSGLGEPG-
H2PX42_PONAB/1-327EEER..RTVSDMNRVLGSDTNCS......APRVTISPEFWTWAQTLGAAVQPL.LEQ..ML---YREL-RVFSGNTISI-
G1LQR5_AILME/1-315EPQR..Q..AGAAGEAGAEDEGG.................SWTQQRNQAQQPV.PEN..MA---YGEL-RTFSGLEEPD-
PNMA5_MOUSE/1-323RDEG..RRIVDVAKALGFSTVPT...........GKIELKNLDQDKPKGLKSLCNNS..TC---YKKL-KVFSGSPFPG-
PNML1_BOVIN/3-358DAEE..RTLEDVVHLLELSRASP..PKTQNR..STENWAEALGVLLGAVVQII........---....-.YYMDAEMLS-
G3U141_LOXAF/1-317QPQG..QEVADRAGEAGAADEAD.................AWAQQWRHALQPV.LES..LA---YQEL-RPFSGREEPG-
H0W6U3_CAVPO/1-332QLQGGEETATGVVGMAGAAGEAGPPGEEGAWDVAAATHHRAGAQQWEQALQPV.MEN..MA---YQEL-RAFSGMEELD-
H0VWL7_CAVPO/1-322KDEG..RKIEDVARVLGCRGFSV...........EDEDVGTSGPVSSLPVHPV.KES..LW---YRKL-KVFSGSPSPG-
PNML1_PONAB/5-364DAEG..RTWEDVVRLLQLNHPTL..SQNQHQ..PPENWAEALGVLLGAVVQII........---....-.FCMDAEIRS-
H0VK73_CAVPO/6-363DAEG..RTWEDVIRLLQLNHPPP..PQSANQ..ASENWGEALGVLLGAVVQVI........---....-.LCRDAEIRS-
G3U379_LOXAF/1-308EQQG..QTVESVAGALGLGLRRV.................CWLRSVSQAVQPW.VET..VR---YQRL-GVFSGREEPG-
M4AZA8_XIPMA/3-326QAEG..KTAEDVHALLTGSEPVP.........SPTESLIRAVSDLLDKAAKPA.TEA..GG---FRRL-RTFSGILPTP-
PN6BL_HUMAN/1-326QPQG..QAVAKAAGAAGEAGAVG........EAGGTNVTKAWVQPWRCTLQPV.LEN..RA---YREL-RPFSRREQPG-
D2GZV4_AILME/1-325AREG..WTVQDVARVLGFQNPAP........TPGPDMPAEMLNYILDSVIQPL.VES..IW---YKKL-TLFSGRDIPG-
F6Z9T2_HORSE/5-364DTEG..RTWEDVVHLLQLNHPPA..PQNRDQ..PPESWAEALGVLLGATVQVV........---....-.FYMDAEMRR-
PNML1_MOUSE/6-363DGEG..RTWEDMVRLLKLNPNPP..LPNSNQ..PPPNWAEALGLLLGAVVQVI........---....-.FYMDAAIRS-
F1PIM5_CANFA/1-358DAEG..RTWEDVVRLLQLGHSPR..PQNQ....PRENWAEALGVLLGAVVQII........---....-.IYMDAEIRS-
F7H8Z7_CALJA/1-318QPQG..QAVARGAGEAG................GGAGEVETWTQSWNRALWPL.LKT..VG---HQEL-RHFSGMVQPG-
PNM6B_HUMAN/1-319EQEG..QMVESVAGALGVGLRRV.................CWLRSIGQAVQPW.VEA..VR---YQSL-GVFSGRDQPA-
G3QYD8_GORGO/1-326AGEG..MTVGELTRALGHENGSL...DPEQG.MVPEMWAPMLAQAL.EALQPA.LQC..LK---YKKL-RVFSGRESPE-
F6WC96_CALJA/1-321QPQG..QAVARGAGEAG................GGAGEVETWTQSWNRALWPL.LKT..VG---HQEL-RHFSGMVQPG-
Q5BJV6_RAT/1-328KGEG..MTMGELTRVLGNRNDPL...CLDQNVMIPEIRAPMLAQALDEALKPT.LQY..LR---YKKL-SVFSGRDPPG-

PF14244

A5AE14_VITVI/10-125....-------------------------------ELWEEIK..QQFSIGN...GPRVQQ.---...L-KS..YLVNCK-
A5AFL1_VITVI/24-172DTAH-------------------------------EIWMAAK..ETYSBSDN..TADLLD.---...I-KG..APHDLR-
A5AL35_VITVI/26-142....-------------------------------..........................---...L-KT..SIAKCE-
A5APA9_VITVI/42-180PTTK-------------------------------LVWDAIX..XTYFDGNB..TSQVYE.---...L-RR..RVTRLQ-
A5AR29_VITVI/23-171DTAK-------------------------------EIWDTAK..DTFSDKEN..TSEIIQ.---...I-EG..ILHDLR-
A5ARJ9_VITVI/24-165KTAK-------------------------------EIWDAAK..EMFSDNEN..AVEVFE.---...I-KS..QLRVTA-
A5ATA8_VITVI/24-171PTAK-------------------------------QVWDAIA..TTYFDGSD..ATQVYE.---...L-RR..RVARLR-
A5AW26_VITVI/23-156STAK-------------------------------DIWDVVV..KXHSXKGN..ATRIFE.---...L-KH..AIHETK-
A5AXC5_VITVI/8-148EIAK-------------------------------QVWDHLALXLIFEQCNK.........---....-..........-
A5AZ64_VITVI/47-175ATAH-------------------------------........................E.---...I-QR..EIAYHR-
A5AZK9_VITVI/143-291STAK-------------------------------DIWDAVV..KAYSKKGN..ATRIFE.---...L-KG..AIHETK-
A5B0N9_VITVI/37-186PTTQ-------------------------------EIWSALS..KAFYDGSD.....ELQV---FTLN-KKAFTTKQSG-
A5B3L9_VITVI/16-147PTAK-------------------------------QVWDVVV..ETYSDMEN..SAQVFEI---TNKI-QE........-
A5B8L2_VITVI/15-147....-------------------------------EALQQAV..MSTSDPDN..TSGVVL.---...I-TK..GLKLSS-
A5BAZ3_VITVI/31-163....-------------------------------.....AK..ETYSSSEN..TSELFQ.---...V-ES..ALHDFR-
A5BCQ9_VITVI/83-209QKSG-------------------------------QICENV.....FRQGN...DSRIYQ.---...I-KR..DIVEHR-
A5BG06_VITVI/43-189PTAK-------------------------------QVWDAIA..TTYFNGSD..ATQVYE.---...L-RR..KNAANG-
A5BJC0_VITVI/21-165ATAK-------------------------------DIWDAIQ..QT.VIKTK.....CLED---AVVL-KDFIEQDRVY-
A5BKK0_VITVI/191-331PTTK-------------------------------QVWDSIA..TTYFDGSD..TSQVYD.---...L-RR..RVTRMW-
A5BM32_VITVI/27-149....-------------------------------...EELK..IRYLRSD...GPRVFS.---...L-EK..SLSSIS-
A5BN45_VITVI/28-176GTTK-------------------------------EIWDAAR..ETYSNFEN..TSEIFE.---...I-EA..TLHDLR-
A5BNR5_VITVI/308-456KTAR-------------------------------EVWVDLR..DQFSQKN...APAVFQ.---...I-QK..SIATMS-
A5BP26_VITVI/33-181DTAV-------------------------------GIWNDLR..DRFCQSN...GPRIFQ.---...I-KK..HLIALS-
A5BQW4_VITVI/215-363PTTK-------------------------------YFWANVT..LP...........LLQR---DSDF-MENSNDCACH-
A5BSG2_VITVI/5-152GTAK-------------------------------EVWDXVK..RSYLDVFH..SSQVHE.---...L-MK..KSFQSH-
A5BT41_VITVI/40-187SMAK-------------------------------AVWDNIV..ITYFDGTD..TSQVYD.---...L-KR..RVTRLK-
A5BVQ3_VITVI/17-164PTAK-------------------------------QVWDSAA..ITYFDGTD..TSQVYD.---...L-RR..RVTRMK-
A5BWZ5_VITVI/42-189PTAK-------------------------------QVWDSVA..ITYFDGTD..TSQVYD.---...L-RR..WVTHDR-
A5BXA9_VITVI/396-529....-------------------------------..........TYGQIVE..QKRLFKF---FLGL-NR..ELDDVR-
A5C3H8_VITVI/42-155....-------------------------------.............KGCN..TSQVYE.---...L-RQ..HVTRLQ-
A5C4L4_VITVI/24-140SIA.-------------------------------..........................---....-..........-
A5C4S3_VITVI/27-177ETTI-------------------------------EIWNDLY..ERFHQGS...GPRIFE.---...I-KQ..KILAHT-
A5C9I0_VITVI/13-150AIAA-------------------------------KIWIDLL..DRFRHSN...APRGCS.---...A-SV..NAH...-
B9SLN1_RICCO/35-176ATAY-------------------------------EVWEVLC..DDSHKSQILLHSPLPT.---...V-RQ..SYASIT-
O22175_ARATH/27-174SEAS-------------------------------QLWENLR..RRFSVGN...GVRKTL.---...L-KD..EIAACT-
O23588_ARATH/73-209....-------------------------------EMWNDLF..SRFRVSN...LPRKYQ.---...L-EQ..SIHTLK-
Q0PY40_SOLLC/17-166TNSC-------------------------------SVWNDLK..ERFDKVN...RVRIYQ.---...L-HR..DITTLS-
Q2HT49_MEDTR/20-168DTAL-------------------------------SAWDDLK..ECFSKVD...RVRVLS.---...L-RS..TINNLK-
Q2HU07_MEDTR/24-172EYAI-------------------------------DVWIELQ..ERFSKVD...RIRVAS.---...L-RS..SINNLK-
Q6L4J8_SOLDE/13-160ETVK-------------------------------ELWEDLR..ERFSVAS...GRNLLA.---...I-HVGCTCGAEK-
Q9FIC5_ARATH/29-177DDSH-------------------------------DMWTHIQ..KRFGVKN...GQRIQR.---...L-KT..ELATCR-
Q9LGZ8_ARATH/19-166SDAK-------------------------------DLWDSLK..QRFSNGN...GVRKQL.---...L-KD..EILACK-
Q9M0P5_ARATH/20-169STAE-------------------------------SIWKNLL..SRFKQDD...APRVFE.---...I-EQ..RLGSLQ-
Q9XIM3_ARATH/23-161NDAS-------------------------------DIWRDLN..SRFNMTN...LPRTYN.---...L-TQ..EIQDLR-
Q9ZPU4_ARATH/37-185SDAH-------------------------------LLWKDLK..QRFSVGN...KVRIHQ.---...I-RA..QLSSCR-

PF16297

H0W794_CAVPO/2-110SDAL-------------------------------------------------------------------KVTFLITR-
D3ZTE6_RAT/24-138NDAM-------------------------------------------------------------------KVAFLISL-
G1MLQ7_AILME/2-114SDAL-------------------------------------------------------------------KVTFLITR-
F7ASC6_CALJA/2-113NDAL-------------------------------------------------------------------KVTFLITR-
Q9D6I0_MOUSE/2-112TDKR-------------------------------------------------------------------KVMFLITR-

PF14223

Q0KIL6_SOLDE/91-204EVLG--------------------------------------------------A.EIDND---SQVE-MILQSLP.DS-
A5BQ76_VITVI/412-525EVLG--------------------------------------------------A.EVDKA---TQIE-MVLNTLP.PS-
A5AHT8_VITVI/92-205KALK--------------------------------------------------L.ELSED---ILVH-LVLISLP.TQ-
B8BH64_ORYSI/219-332KALK--------------------------------------------------L.DLSED---LLMH-LILISLP.TQ-
A5BI38_VITVI/288-401KTLE--------------------------------------------------V.EMSDS---FLVH-FILNTFP.QQ-
A5ANU6_VITVI/96-209KVLK--------------------------------------------------I.ELPEA---FQVG-AIVAKLP.SS-
A5B8Q0_VITVI/530-643RNID--------------------------------------------------I.RIDDE---DQAM-TLISSLP.NS-
A5AQ94_VITVI/79-192SNIG--------------------------------------------------I.KVDDE---DKAV-LVLKSLP.GL-
Q18L98_CITSI/81-195EGVE--------------------------------------------------NVKICDE---DKAF-FLLSSLP.KS-
Q1KUM3_9ROSI/118-231HSLN--------------------------------------------------V.KVEEE---YQAV-YLLNSLP.PA-
Q7XTM9_ORYSJ/78-191ESME--------------------------------------------------V.KYDEK---DLAL-ILLCSLP.SS-
Q01M93_ORYSA/78-191VSME--------------------------------------------------V.KYDDE---DLGL-LLLCSLP.NS-
A5AS33_VITVI/79-194SSVK--------------------------------------------------I.DFDDE---ICAL-IVLASLP.NI-
Q2AA06_ASPOF/860-974ANVD--------------------------------------------------E.KISDE---YKTI-ILLGSLPDEE-
Q6XMP8_AEDAL/82-196RMAG--------------------------------------------------S.KLEES---DVCS-SLALTLP.ES-
D2A543_TRICA/77-191KSVG--------------------------------------------------A.KLEEM---DVVC-HLLLTLP.KS-
Q9U6V8_DROWI/75-189LAAG--------------------------------------------------A.KIEEM---DKIS-HLLITLP.SC-
A5BIJ4_VITVI/84-197ALIG--------------------------------------------------A.SLSED---EILL-HVLNGLS.PK-
Q0ZCD8_POPTR/118-230ALID--------------------------------------------------H.PISAD---DLTF-YILNGLG.PD-
A5B6L3_VITVI/126-238ATAG--------------------------------------------------H.KISDT---DHIL-AIMQGLG.DE-
A5BYA6_VITVI/62-174ASIG--------------------------------------------------V.SLSTK---DHVE-SILDGLP.SD-
A5BK17_VITVI/103-215ALVG--------------------------------------------------H.KISVK---DHIB-AIFEGLP.QD-
A5CAE5_VITVI/64-176AAIG--------------------------------------------------E.PVPEK---DQIL-QLLSGLG.AE-
A5BJ70_VITVI/81-193AAVG--------------------------------------------------E.PVKDR---DHIL-QLLGGLG.PD-
A5BFR8_VITVI/115-227AAIG--------------------------------------------------E.PVSEQ---DQVM-NLLGGLG.SD-
Q9SV56_ARATH/103-217DSIG--------------------------------------------------C.PVPEN---EKIF-GVLNGLG.QE-
Q9SSB1_ARATH/101-216ASVG--------------------------------------------------S.PVPEK---MKIF-SALNGLG.RE-
D1GEF6_BRARP/107-222TSIG--------------------------------------------------Q.PVDER---MKIF-AALLGLG.KE-
C0SQ79_PYRYE/115-228ATAG--------------------------------------------------V.NKDEH---SFCL-DILRGLP.AP-
A5B3I2_VITVI/89-207KANG--------------------------------------------------E.NKGDV---VVVE-KILRSMT.PK-
A5B8H9_VITVI/153-271RVHG--------------------------------------------------Q.KMEDV---VVIE-KILRSMT.PK-
A5BGM4_VITVI/89-207RIHG--------------------------------------------------E.KMEDV---TVIE-KILRSMT.PK-
Q9M1C6_ARATH/91-209KTNG--------------------------------------------------E.VMEQS---TIVS-KILRSLT.PK-
A5BYF7_VITVI/162-280KAHE--------------------------------------------------E.RMGQN---VIVE-KILRSMX.PR-
A5BY31_VITVI/28-146RFHG--------------------------------------------------E.QMREV---TIVE-KILRSLT.DN-
A5BFQ9_VITVI/28-146QIYG--------------------------------------------------E.DMQDV---KVVE-KILRSLT.EK-
Q9C7Y1_ARATH/87-205RNLG--------------------------------------------------E.DMPDS---KVVE-KILRTLV.EK-
A5AMT2_VITVI/80-198RIHG--------------------------------------------------D.KTENV---LIVE-KILRSLT.PN-
Q2QXM6_ORYSJ/85-203RLYG--------------------------------------------------E.DINDQ---KVVE-KILISLP.EK-
Q6L3N8_SOLDE/84-202RSYG--------------------------------------------------E.KIDNQ---IVVS-KVLRSLT.TK-
A6YTD9_CUCME/91-209RSNG--------------------------------------------------E.EVGDQ---RVVE-KILRSMP.RK-
Q9M2D1_ARATH/89-207KRNG--------------------------------------------------E.KLDDV---RIME-KVLRSLD.LK-
A5BLB0_VITVI/283-400KSYG--------------------------------------------------E.EISDK---RIVE-KLLISLP.SK-
Q9LH44_ARATH/87-205RVHG--------------------------------------------------E.EKSDY---QVVQ-KILISVP.QQ-
Q9ZQE9_ARATH/91-209TYHG--------------------------------------------------E.KKTNT---QLIQ-KILISLP.AK-
A5B9M8_VITVI/90-208RLLG--------------------------------------------------E.AFTDQ---KVVE-KIMVSVP.QK-
A5BRD1_VITVI/91-209RLLD--------------------------------------------------I.DFSDS---RIVQ-KISITIP.EK-
A5B779_VITVI/91-209RLLG--------------------------------------------------K.DFSDE---RIVQ-KILITLP.EK-
Q9SEL2_VITVI/89-207RLLG--------------------------------------------------K.EFSNE---KIVQ-KILVTLP.KK-
A5BFD6_VITVI/89-207RLLG--------------------------------------------------K.EFSNE---RVVQ-KNFVTLP.EK-
A5BRW6_VITVI/90-208RSLG--------------------------------------------------E.KFPDA---RIVE-KVLVTLP.ER-
Q6L3X6_SOLDE/202-320RLLG--------------------------------------------------E.EFTDK---RIVE-KVLVTLP.ER-
A5ACV7_VITVI/90-208RLLG--------------------------------------------------E.ELTNQ---RVVE-KVLVSLP.ER-
Q6L3Y5_SOLDE/89-207RLLG--------------------------------------------------E.KVEEQ---RIVE-KVIVTLP.EK-
Q60EG1_ORYSJ/85-201SALG--------------------------------------------------A.TLNDA---AMVK-KLFDTVP.EK-
C6JSM1_SORBI/92-210GNLG--------------------------------------------------G.SLEDA---ALVK-KLFDTVP.GR-
B6TPM7_MAIZE/94-212AGLG--------------------------------------------------A.TLDDA---AMVK-KLLDTVP.DR-
Q9SHT5_ARATH/47-166ESLG--------------------------------------------------E.EIEES---KIVK-KFLKSLPRKK-
Q9ZUF2_ARATH/41-160TSLG--------------------------------------------------E.DIEET---KVVK-KFLKSLPTKK-
Q4ABY7_BRACM/83-202ASLG--------------------------------------------------E.IIEEP---KLVK-KFLKSLPRKK-
Q9LQK3_ARATH/80-199AALG--------------------------------------------------V.NIEVP---KLVK-KFLNSLPRKK-
Q9SKV6_ARATH/80-199DALG--------------------------------------------------S.NIETS---KLVK-KFLNALPLRK-
Q9LE43_ARATH/83-202AALG--------------------------------------------------E.NIETE---KLVK-KFLKSLPRKK-
B6REL9_9BRAS/81-200AALG--------------------------------------------------E.VIEEP---KLVK-KFLNSLPRKK-
B6REL1_9BRAS/60-179AALG--------------------------------------------------E.VIEES---KLVK-KFLKSLPRYK-
Q7F814_ORYSJ/95-213RSLG--------------------------------------------------T.KVEET---TVVE-KLLHSVP.DK-
B8BA29_ORYSI/100-218RELG--------------------------------------------------E.AMDEK---YVVK-KKLRAVS.TK-
D3IVE4_9POAL/219-337VSLG--------------------------------------------------D.KIEES---VAVK-KYLRVLL.EN-
Q7X7K3_ORYSJ/176-294RTLG--------------------------------------------------D.NITDA---EVVQ-KLLQVVP.EH-
Q0J5Y3_ORYSJ/115-233RTLG--------------------------------------------------D.NISDA---DVVR-KMLDVVP.EH-
Q7XH44_ORYSJ/165-269RTLG--------------------------------------------------G.DLPEI---DVI.-..........-
Q2QYR6_ORYSJ/52-170RMLG--------------------------------------------------D.PIIDK---DVVK-KMLEVVP.KY-
Q5TKD7_ORYSJ/109-227RDMG--------------------------------------------------G.TLTDE---HMLK-KLLRVVP.FH-
Q7XTU6_ORYSJ/114-232RDMG--------------------------------------------------G.VMEDE---HVNK-KLLRVVP.KK-
Q8LMZ0_ORYSJ/135-253RMLG--------------------------------------------------D.PLEEE---KVVQ-KFLRVVP.SR-
Q7G5Z8_ORYSJ/110-228HTLG--------------------------------------------------A.MMEEE---MVVK-KFLRVVP.SK-
Q53P77_ORYSJ/86-204STLG--------------------------------------------------D.PEPDD---KVVE-KYLCVAR.PR-
Q2QZL2_ORYSJ/49-167ATLG--------------------------------------------------D.PEPAD---KVVE-KYLRVAR.PR-
Q7XWP2_ORYSJ/116-231ATHG--------------------------------------------------D.PEPDD---KVVE-KYLHVAR.PR-
Q10C26_ORYSJ/22-139VTLG--------------------------------------------------A.PIEES---KVVQ-KFLNAVP.EH-
Q7XUD9_ORYSJ/115-233ATLG--------------------------------------------------V.HLEEG---KVVE-KFLNSVP.DH-
Q25AF6_ORYSA/117-235GTLG--------------------------------------------------E.RIEEQ---NVIE-KFLRVVP.ER-
C1IJC5_HORVU/114-232GELG--------------------------------------------------D.AISDK---RAIQ-KWLRIVP.KR-
C5Y7F6_SORBI/35-153RGLG--------------------------------------------------E.TSVDD---TRVV-KFLRVVP.SR-
Q94I41_ORYSJ/94-212RELG--------------------------------------------------E.EMEDS---RVVK-KVLRVVP.KR-
C5XUK3_SORBI/218-337VIHG--------------------------------------------------DKDITEE---RVVE-KFLRTVP.AK-
C5XQM0_SORBI/100-219ILHG--------------------------------------------------ERNLDEE---RAVE-KLLRATP.KK-
Q9AUM6_ORYSJ/569-688AQLG--------------------------------------------------DTTIDEE---RAVE-KLLRVVP.EK-
Q2QWI2_ORYSJ/47-166VQYG--------------------------------------------------DDTYDEE---RAVE-KLFRCVP.EK-
C5Z583_SORBI/100-218ATYR--------------------------------------------------K.KVDDE---DLVT-KLLCTVP.AR-
C5WNA6_SORBI/224-342GSYG--------------------------------------------------V.TINEE---EAVF-KYLHSVP.PK-
D3IVP8_9POAL/630-749QSVD--------------------------------------------------V.IYSDS---DNAR-QILNALDMSV-
D3IVT7_9POAL/58-177HAMD--------------------------------------------------L.VFTKS---ENAH-QLLGALDVKV-
D3IVI1_9POAL/86-205RAVG--------------------------------------------------L.TYPDS---DNAR-QMLTALDLRV-
Q10PG0_ORYSJ/85-204RSVG--------------------------------------------------K.EFSDN---DNAR-HLLNCLDYGV-
D3IVI3_9POAL/99-218RVVD--------------------------------------------------I.EYSQS---ENAT-HLLATINTKE-
Q5H9X1_ORYSJ/112-231KGLG--------------------------------------------------SKDMTDE---VVVK-KMVRAIT.PR-
Q10NE5_ORYSJ/129-248KGLG--------------------------------------------------SEDMTNH---FVVK-RLLRAFG.PR-
C5WYF6_SORBI/63-181RGYG--------------------------------------------------G.DLDDH---RVVK-VMLEAYS.PR-
Q8S467_MAIZE/138-257RNLG--------------------------------------------------SKKWDDH---EVVK-VILRSLI.FL-
Q8H6I4_MAIZE/204-323RVLG--------------------------------------------------SEDWSDS---KVTR-LFMRAYK.EK-
Q33BC8_ORYSJ/86-203KGLG--------------------------------------------------A.TYTDL---EVAQ-KMLRALP.KK-
A2Q5V3_MEDTR/101-218DSLG--------------------------------------------------E.KLSDE---KLVR-KILRS.P.KR-
O65147_SOYBN/76-194TALG--------------------------------------------------E.RMTDE---KLVR-KILRSLP.KR-
A5BZ48_VITVI/103-221FNLG--------------------------------------------------E.PIPNS---KVVR-KILRSLS.ER-
Q9XEB1_ARATH/433-551VVLG--------------------------------------------------K.TYKDK---KMVK-KFLRSLP.DK-
Q9FG84_ARATH/101-219HNLG--------------------------------------------------K.KYKDK---KLVK-KLLRCLP.SR-
Q9ZV83_ARATH/82-200EVMG--------------------------------------------------K.TYKDQ---KLVK-KLLRCLP.PK-
A2I5F8_BETVU/104-223ASLG--------------------------------------------------K.FISSE---EQVR-KVLRSLPKDR-
A5BW11_VITVI/73-191EALG--------------------------------------------------K.TYKES---EKVM-KILRFLP.SK-
Q1S5J6_MEDTR/118-236QILK--------------------------------------------------K.SYVAS---DHVS-KILRSLP.SR-
Q9FJT0_ARATH/33-146KSCG--------------------------------------------------W.KVEEK---ILVK-KILSSLP.PR-
Q9LJD1_ARATH/93-210GRAK--------------------------------------------------L.EKSDY---EICK-NVFTTLS.GS-
Q9LJD1_ARATH/509-622RRFK--------------------------------------------------I.AKSDY---QVIE-KVLATLS.GS-
Q9LJC8_ARATH/91-202EVLG--------------------------------------------------N.PISDD---KVIT-KLLTSLS.WP-
Q9LJC9_ARATH/91-203FVWG--------------------------------------------------N.PISDE---KVIA-KLLTSLP.RP-
A9TSN8_PHYPA/23-136REIN--------------------------------------------------Q.LPSDI---VAVH-KILKILP.AK-

PF03732

Q9XX53_CAEEL/210-308VQKE--------------------------------------------------KENVESF---FERV.EKLVAMTSSG-
PEG10_MOUSE/174-267RQ.G--------------------------------------------------PGPVVDY---SNAF.QMIAQDLD..-
Q9AUY8_ARATH/31-127VQ.G--------------------------------------------------RRTVREY---EEEF.NKLRRYVGR.-
Q9FWC7_ORYSJ/155-249TQ..--------------------------------------------------TGTVTEY---KQQF.DYLVYQIR..-
Q9FE41_ORYSJ/775-871RQWR--------------------------------------------------DEAIDDY---VIRFRNSFVCLARE.-
Q9LP90_ARATH/163-253KQ..--------------------------------------------------TGSVAEY---VQRF.EDLSSQVG..-
Q9LMV1_ARATH/257-344SQGA--------------------------------------------------KESLRSF---VDRF.KLVVTNIT..-
Q9ARZ4_ORYSJ/100-192RQRP--------------------------------------------------GESIREY---MRRF.SQARCQVQD.-
Q9FYC9_ARATH/102-194QE..--------------------------------------------------TEGIEVY---HARF.ESICTRVK..-
Q9SK57_ARATH/214-310VQ.G--------------------------------------------------NRTVREY---DEEF.NRLRRYVGR.-
Q9FRJ2_ORYSJ/81-182NQ.G--------------------------------------------------DMTITQY---TAKL.KQLADGLRDI-
Q9AV68_ORYSJ/351-443VQKS--------------------------------------------------GESLRDY---IRRF.SEQRNKISD.-
Q9AYB5_ORYSJ/567-664TQ.G--------------------------------------------------SRSVTEY---LHEF.NRLARYAPE.-
O23529_ARATH/90-186KK.G--------------------------------------------------TKTIDEY---VLSH.TTLLDQLAIL-
O82608_ARATH/272-360SQQP--------------------------------------------------NEPLRDF---LAKF.RSTLAKVE..-
Q9AYC2_ORYSJ/729-826HQ.G--------------------------------------------------NRTVTEY---LHEF.NRLARYAPE.-
Q9FGL3_ARATH/131-241QQ.G--------------------------------------------------NMSLSDY---YTTL.KTLWDDLDGA-
Q9SQW9_ARATH/264-354RQ..--------------------------------------------------TGTVEEY---RERF.EELTVDLPH.-
Q9LNM2_ARATH/83-178SQQP--------------------------------------------------NEPLRDF---LANQ.RRGGSLCSEE-
Q9AYB6_ORYSJ/694-791KQ.G--------------------------------------------------NRSVMEY---LHEF.NNLARYAPE.-
Q9XE67_SORBI/155-252SQ.G--------------------------------------------------TQKVQEY---ATRF.TRTMRYAPD.-
O49369_ARATH/139-231QE..--------------------------------------------------TEGIEEY---HARF.ELISTRLN..-
Q9ZPF9_ARATH/97-196VQ.G--------------------------------------------------NRTVEEY---FKEM.ETLMLRAD..-
Q9XII7_ARATH/126-236RQ.G--------------------------------------------------TLSLSEY---YTRL.KTLWDQLD..-
Q9SIM3_ARATH/131-240RQ.G--------------------------------------------------TMSLSEY---YTLL.KTLWDQLD..-
Q9MA68_ARATH/89-183NQKN--------------------------------------------------SESFAEA---WERF.KRYSTQCPH.-
Q9M225_ARATH/186-282TL.V--------------------------------------------------ERSVWEY---DREF.NRVLVYAGW.-
Q96467_HORVU/82-176KQLD--------------------------------------------------HEHVAQA---WERM.KLMIRNCPA.-
Q9AXC5_ANTHI/295-388IQ.W--------------------------------------------------SNSVCEY---ESKF.TRLIQYAPH.-
Q9M0T9_ARATH/89-183SQKT--------------------------------------------------GESFCEA---WERF.KGYTNQCPH.-
Q9SY43_ARATH/188-284TQ.G--------------------------------------------------VRSVREY---DRKF.NRLLVYAGR.-
Q9C7H8_ARATH/150-242QE..--------------------------------------------------TDGIVEY---HQQF.ELIKVRLN..-
Q9ZNW4_SORBI/210-302RQNQ--------------------------------------------------GEALREY---FQRF.VQTKARAP..-
Q9SUN0_ARATH/223-313TQEN--------------------------------------------------GETLNDY---LGRF.KEILSSYHHG-
Q9M252_ARATH/163-260RQ.D--------------------------------------------------TKKVREN---EREL.SHLSRFSVR.-
O93283_TAKRU/149-242QQ.G--------------------------------------------------SRSVAEY---TLEF.RILAAESR..-
Q9ZQQ3_ARATH/198-290SQGP--------------------------------------------------NETLRAF---ITKF.KYVLSKLSR.-
Q9ATX2_MAIZE/179-271TQDH--------------------------------------------------EEYLQAY---VRRF.LRLRAQAPT.-
O81471_ARATH/148-242TQGP--------------------------------------------------AEAFKAA---WVRF.KEYQRDCPH.-
Q9FW76_ORYSJ/181-275TQ..--------------------------------------------------TSSVADY---VDRF.DSIMHQLMAY-
Q9SKF2_ARATH/107-197TQRS--------------------------------------------------NESFCEA---WERF.KGYKMQCPH.-
Q9SYE8_ARATH/131-230VQ.G--------------------------------------------------SKTVEEY---FLEM.ETLMLRAD..-
Q98SV9_TAKRU/117-207RQ.G--------------------------------------------------SSSVADY---...F.RILAARSG..-
Q9SJP0_ARATH/291-382AQTA--------------------------------------------------KESLRSF---IGRF.KEIVTSVA..-
Q9XE85_SORBI/114-212RM.G--------------------------------------------------SMTVAEY---HDTF.EQLARYAPN.-
Q9ZS84_SOLLC/150-247RQ..--------------------------------------------------TGSVREY---IKEF.TSVMLDIQN.-
O48967_MAIZE/245-337RQEP--------------------------------------------------RETLRMF---ISRF.TKVQGTIPR.-
Q9LZG5_ARATH/148-244QQ.G--------------------------------------------------TKTVRKY---EKEF.HSLERFERR.-
Q9SX87_ARATH/132-224KE..--------------------------------------------------TNGIEEY---HKKF.ELLRARVN..-
Q9LQH2_ARATH/476-575VQ.G--------------------------------------------------NKSVEEY---YKEM.ETLMLRAD..-
Q9FZN9_ARATH/121-215TQTN--------------------------------------------------NETFCEA---WERF.KGYQTQCPH.-
Q9SLQ0_ORYSI/194-290RQ.G--------------------------------------------------NKSVEEY---YQAL.QIGMLRCG..-
Q9UVC2_PASFU/52-153TQ..--------------------------------------------------KTSTAEY---AAKF.QEYAQLTD..-
Q9ZPG6_ARATH/97-191TQKN--------------------------------------------------NETFFEA---SERF.KSYTTYCPH.-
Q9ZUK1_ARATH/211-302SQSA--------------------------------------------------DEPLRTY---......IYRVQGNH.-
Q9FWB1_ARATH/104-198QQTG--------------------------------------------------TKSFHEA---WERF.KVYYRECPH.-
Q9HFY8_COLGL/148-252RQ..--------------------------------------------------NKSATLY---AAEF.RRLAARLD..-

PF14227

A5BY76_VITVI/104-226KVL.--------------------------------------------------GKTYKES...KKVI-KILRSLPSM..
A5B9Z7_VITVI/12-134EAL.--------------------------------------------------GRVINES...EKVM-KILXSLXSK..
A5BSC1_VITVI/688-789EAL.--------------------------------------------------GRVINES...EKVM-KILRSLPSK..
A5BWL8_VITVI/342-448EAL.--------------------------------------------------GKTYKES...EKGM-KILRSLPSK..
A5BLR1_VITVI/94-215EAL.--------------------------------------------------EKTYKES...EKVM-KILRSLPSK..
A5BLB0_VITVI/282-404KSY.--------------------------------------------------GEEISDK...RIVE-KLLISLPSK..
Q9LJC9_ARATH/90-212FVW.--------------------------------------------------GNPISDE...KVIA-KLLTSLPRP..
Q5AT23_EMENI/392-511SSG.--------------------------------------------------KVKFDSM...AILI-IFLNGLPSK..
D3IVP8_9POAL/629-752QSV.--------------------------------------------------DVIYSDS...DNAR-QILNAL..DMS
COPIA_DROME/74-192LAA.--------------------------------------------------GAKIEEM...DKIS-HLLITLP.SC.
D2A543_TRICA/76-194KSV.--------------------------------------------------GAKLEEM...DVVC-HLLLTLP.KS.
O96968_BOMMO/78-193EET.--------------------------------------------------GSTVNEQ...DKVC-HLLLTMP.DS.
Q6XMP8_AEDAL/81-199RMA.--------------------------------------------------GSKLEES...DVCS-SLALTLP.ES.
B0X5G3_CULQU/101-222EVA.--------------------------------------------------DEGLKPR...QFVA-VILSSLP.MS.
Q967L5_AEDAE/76-197DAA.--------------------------------------------------GTTLDAD...TKIC-LLLRSLP.PS.
Q8WRX6_ANOGA/74-195MNA.--------------------------------------------------GQELDSS...LKVA-MVLKSMP.ES.
B2CN78_DAPPU/42-160SDV.--------------------------------------------------EAPVSEI...QIMT-KILCTLP.PS.
A9RF54_PHYPA/34-146AIV.--------------------------------------------------DKPLLEE...DVVM-TLLSSL...AD
Q8H023_ORYSJ/210-330SKL.--------------------------------------------------DVKLDDE...DKAI-ILLCSLP.PS.
Q7XSZ1_ORYSJ/103-219SKL.--------------------------------------------------DVKLDDE...DKAI-ILLCSLP.PS.
Q7XLX2_ORYSJ/160-253VKM.--------------------------------------------------DVEVDDE...DKAI-VLLCSLP.ES.
A5BPQ9_VITVI/512-624KRI.--------------------------------------------------DVKFEDE...DKAL-MLLNSLL.ASS
A5B864_VITVI/32-156KQI.--------------------------------------------------DVKFEDE...DKAL-MLLNSLP.ASS
Q9AU17_SOLCI/79-196ANL.--------------------------------------------------GVKIEEE...DKRI-VLLNSLP.SS.
B1N668_SOLLC/75-192RNI.--------------------------------------------------DVKIEDE...DAAL-ILLVSLP.MS.
Q2AA06_ASPOF/859-977ANV.--------------------------------------------------DEKISDE...YKTI-ILLGSLPDEE.
Q69FA7_PHAVU/58-175LNL.--------------------------------------------------DVKFEDE...DLAL-MLVSSLP.DE.
Q6BCY1_IPOBA/74-193TSL.--------------------------------------------------SCKIEPQ...ERAE-LLLQSLP.DS.
B8YLY5_MEDTR/73-192TAS.--------------------------------------------------DFKIAEN...ERAE-LLLQSLP.DS.
Q25A78_ORYSA/77-175ESM.--------------------------------------------------EVKYDEE...DLGL-ILLCSLP.SS.
Q53QA4_ORYSJ/75-188VSM.--------------------------------------------------EVKYDDE...DLGL-LLLCSLP.NS.
Q94LG0_ORYSJ/79-192VSI.--------------------------------------------------EVQFDDE...DLGL-LLLCSLP.SS.
Q01MJ3_ORYSA/27-111ESM.--------------------------------------------------E.............-...........
A5BQQ6_VITVI/23-136ETM.--------------------------------------------------EVKYDEE...YLGL-ILLCLLS.SS.
A5BPL2_VITVI/25-141ETM.--------------------------------------------------EVKYDEE...DLGL-ILLLSK.....
Q9SJT2_ARATH/93-212ENT.--------------------------------------------------NVLVSDE...DQAI-LLLMSLP.KP.
Q9SH77_ARATH/93-212ENM.--------------------------------------------------NVIISDE...DQAI-LLLTALP.KA.
Q9FFM0_ARATH/98-215ENV.--------------------------------------------------KVVVPDE...DQAI-VLLMSLP.RQ.
Q9LS18_ARATH/107-224EKL.--------------------------------------------------DVYVSDE...DKAF-MLLLSLP.RK.
Q9ZQE4_ARATH/102-211NNI.--------------------------------------------------GVDVTEE...VQAI-LLLSSL.....
Q9LJS6_ARATH/105-202NNI.--------------------------------------------------GVNVTKE.......-...........
O81903_ARATH/103-220GSL.--------------------------------------------------QIQVGEE...VQAI-LILNSLP.PS.
Q9SHR5_ARATH/101-218GSL.--------------------------------------------------EIQVDEE...VQAI-LILNSLP.AS.
Q9LVY5_ARATH/105-222GSL.--------------------------------------------------DIKVAEE...VQAI-LILNSLP.VT.
Q02900_ARATH/97-214SSL.--------------------------------------------------EINVVEE...VRAI-LFLNGLS.SR.
O82196_ARATH/63-180NNL.--------------------------------------------------QIQVPDE...VQAI-LILSALP.DS.
Q9ZPU5_ARATH/68-187NHL.--------------------------------------------------QIDVTDE...VQAI-LLLSSLP.AR.
Q1KUM3_9ROSI/117-234HSL.--------------------------------------------------NVKVEEE...YQAV-YLLNSLP.PA.
A5AR03_VITVI/133-256ESL.--------------------------------------------------GVRIXDE...DQAV-ILLNSLP.KV.
A5ARG5_VITVI/22-139ESL.--------------------------------------------------CVKIEDE...DQAV-LLLNSLP.KV.
Q9M3C1_ARATH/26-145ASL.--------------------------------------------------DINTSDE...DQAL-QFMAGLP.PQ.
A5AJF1_VITVI/465-574ENI.--------------------------------------------------DITILDE...DKAI-LLLTSLD.AS.
A5BLL6_VITVI/78-195ENI.--------------------------------------------------DIVVLDE...DKAI-MLPTSLD.AS.
A5BYU4_VITVI/59-176KNI.--------------------------------------------------DIIVSNE...DKAI-VLLTSLD.AS.
A5BPE6_VITVI/78-195NGV.--------------------------------------------------GVKVEEE...DQAM-ILLCSLP.SS.
Q18L98_CITSI/80-198EGVE--------------------------------------------------NVKICDE...DKAF-FLLSSLP.KS.
A5B6C0_VITVI/29-150RNI.--------------------------------------------------DVRIDDE...NQTI-ILMCSLS.NS.
A5AYK3_VITVI/32-152RNI.--------------------------------------------------DVKVNYE...DQAI-FLMCSLP.NS.
A5B8Q0_VITVI/529-644RNI.--------------------------------------------------DIRIDDE...DQAM-TLISSLP.NS.
Q2AA73_ASPOF/71-191SKI.--------------------------------------------------DVKINDE...DQAL-LLLCSLL.PS.
A5AM57_VITVI/98-215ESL.--------------------------------------------------DFKVEDE...DKAI-ILLNSLP.KS.
A5C6J6_VITVI/77-184ENI.--------------------------------------------------DIKVEKE...DQAI-LLLSYLP.KV.
A5AQ94_VITVI/78-195SNI.--------------------------------------------------GIKVDDE...DKAV-LVLKSLP.GL.
A5AKU3_VITVI/615-723SNI.--------------------------------------------------GIEVDDE...DKAV-LVLNSLP.SS.
C6GFP7_FRAAN/52-171EKV.--------------------------------------------------GAKMDDE...DTAV-MLLHSLP.PL.
A5C6L3_VITVI/78-195SSV.--------------------------------------------------EIDFDDE...IRAL-IVLASLP.NS.
A5BCL0_VITVI/55-172SSV.--------------------------------------------------EINFNDE...AHTL-ILLTSPP.NS.
A5AL15_VITVI/39-145SSI.--------------------------------------------------EIDFDDE...NYGK-VYLVDV.....
Q6RZV5_MUSAC/23-145VAM.--------------------------------------------------KMNIDDE...IQGL-LLLSSLS.ES.
Q9ZRJ0_TOBAC/76-193SGM.--------------------------------------------------GIKFDDE...VLAL-MVLATLP.ES.
Q5MG99_IPOBA/76-193SGM.--------------------------------------------------GIKFEDE...VLGL-WLLNTLP.DS.
A5AJF5_VITVI/76-192VRM.--------------------------------------------------NIKFEEE...MQGL-WLLGTLS.DS.
A5BEP3_VITVI/54-180VGM.--------------------------------------------------NIKFEEE...VQGL-WLLGTLSDSA.
B3N452_DROER/17-137SSV.--------------------------------------------------GIDISEE...LRSI-ILLSSLP.KD.
B4N7F3_DROWI/52-172AGA.--------------------------------------------------GVQIKEE...LRTI-ILFSSLP.PA.
B6V6Z8_DROME/78-198AEM.--------------------------------------------------DITINDE...LKSI-MLLSSLP.NS.
B4NQE5_DROWI/78-198KEI.--------------------------------------------------GVTIGDD...LLAI-LLLYSLP.DT.
Q45W64_PHACR/80-192AEA.--------------------------------------------------GGKITDE...DFAF-NILSALP.PS.
Q5JMV2_ORYSJ/12-126NYL.--------------------------------------------------DVKLDDK...DKVI-ILLSSLPTP..
A5CA63_VITVI/149-269AAI.--------------------------------------------------AKPVLVK...EKVF-CLLTSLG.PQ.
Q8W5F6_ORYSJ/80-197ELL.--------------------------------------------------KCVLPDK...FVDG-CIIAKLP.PS.
Q8LN71_ORYSJ/50-167ENN.--------------------------------------------------NCELPDK...FVAG-GIIAKLP.PS.
B7ZXP2_MAIZE/242-358ELF.--------------------------------------------------PCPLPDK...FVVG-GIIAKLP.PS.
Q10LP7_ORYSJ/115-232NHS.--------------------------------------------------KIALPDK...FQVG-MVIAKLP.PS.
A5BQ76_VITVI/63-180HAE.--------------------------------------------------KMELSES...FQVA-AIVEKLP.PS.
Q0KIN7_SOLDE/84-201RSE.--------------------------------------------------EVKIGDN...LIVC-GIVDKLP.PS.
Q7Y173_ORYSJ/18-135KSM.--------------------------------------------------DMGINDD...LLVH-FILSSLP.SD.
A5B4U1_VITVI/192-309KKL.--------------------------------------------------EVEMSES...FLVH-FILNTLP.PQ.
Q2R404_ORYSJ/102-219RSM.--------------------------------------------------DMKISDG...FLEH-IIMRSLG.PN.
A5BQ76_VITVI/411-528EVL.--------------------------------------------------GAEVDKA...TQIE-MVLNTLP.PS.
Q0KIL6_SOLDE/90-207EVL.--------------------------------------------------GAEIDND...SQVE-MILQSLP.DS.
Q9SZS9_ARATH/2-131QERE--------------------------------------------------SFGDEEDGNGDRWL-EVISWEP.RAF
B9SXB7_RICCO/3-127HNKE--------------------------------------------------QSFDGDDGKGERWA-EVISWEP.RAF

PF03564

A7SE42_NEMVE/491-638-HRGLQALGVEAAQYESILVPALLEKIPEAVR---LS.ITRGKSHEN---------------------------------
Q17051_ASCLU/155-293-LRQLEQAGENLD..SPLLVFIIEQKLSQRIK---RR.ISEYKALDP---------------------------------
Q23992_DROME/160-308-IYIIKLKAQLPEDVDAIFAHIILRKFNKESL---NLYESHVKKTKE---------------------------------
A7XDH0_DROAN/157-302-IRALDSIGHMDR..DCWVIHLLLNKIDPESR---RKWVDASRASNS---------------------------------
Q4JS97_ANOGA/133-280-VRGLERLNEPVDKWDTPLTSLLFYKLDSKTL---VAWEQYSVDFKT---------------------------------
Q4EAY5_9RICK/161-306-VRALDAIGENTR..DCWIIFLILQKMDAETR---RKWIEDSRDLNS---------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------------------------------------
F6H7D5_VITVI/16-42--------------------------------------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------------------------------------

PF14893

H0XX29_OTOGA/1-328-CGEESFESWLDHAKDMLYLWRHTSERERRRR---LVESLGGPALDL.MCGLLAEHP....DTPAQ.DCLDALEQVFGNN
M3Z644_MUSPF/1-327-PGEEEFESWLFHTTEMMKTWR.VSDMEKRRR---LLESLRGPAFDV.IRVLKTDNP....FITVA.ECLQALEQVFGVI
F7CY48_HORSE/1-330-CGEESFESWLHHANDTLYLWRHMSERERRSR---LVESLGGPALDL.ICGLLEENP....DTPVQ.DCLAALVQVFGSK
M4B0W2_XIPMA/1-317-PGEETLENWIEQARLMIEESD.RPEREMKMR---VMESVKGPALEI.LQAVRFNNH....DATAM.EYLDILESTFGTP
F6TXQ3_HORSE/2-329-PEEEPFEIWLEQATEIVKEWP.VAEAEKKRW---LMESLRGPALDL.MHIVQADNP....SISVE.ECLEAFKQVFGSL
D3Z8Y9_RAT/1-327-PGLLAFDSWLEHTTEMLQMWQ.VPEVEKRRR---LMECLRGPALQV.VNVLRANNA....AITVK.ECLEALRQVFGSV
M4AZW3_XIPMA/2-318-QGEEHLENWLEQARLMIEESD.KPDREKKMR---IMESVKGPAMEI.LQAVRFNNP....DAMPT.EYLNVIENTFGTT
F7AVZ0_XENTR/7-324-SGEESFESWRDSAMVSVRDWA.GPEATMRRK---ILESLRCPAVDV.VKSYLVNHP....DATSG.NLIEVLEVTFAPV
PNMA5_HUMAN/1-322-PGEETFEDWLEQVTEIMPIWQ.VSEVEKRRR---LLESLRGPALSI.MRVLQANND....SITVE.QCLDALKQIFGDK
G1PM76_MYOLU/2-362-QEEA.......RAQEAEEAYALAMAASAAGR---KGPKEPGRAARA.CSVLTMGNPGSWDDVEDEGDPPKPLVRKARAK
F7D322_HORSE/1-321-PGEENFEGWLEQVTDMMQIWQ.VPEVEKMRR---LLESLRGSALSI.MRVLRANND....SMTME.QCLDALKEIFGNK
G3N1H8_BOVIN/3-317-EGEESFESWLDHANDMLYLWRHVTEMERRRR---LVESLGGPALDL.LCSLLEEDP....NLTAQ.DCLTALVEAFGSK
F1S2C6_PIG/1-333-GGEESFESWLDHANDMLYLWRHVSERERRRR---LVESLGGPALDL.LCGLLAQDA....DMAAQ.DCLAALVQVFGDQ
H2PX42_PONAB/1-327-PGALAFDAWLEHTTEMLQMWQ.VPEGEKRRR---LMECLRGPALQV.VSGLRASNA....SITVE.ECLAALQQVFGPV
G1LQR5_AILME/1-315-QEEESFESWLDHANDMLYTWRHVSERERRRQ---LVESLGGPALDL.LCGLLAENP....DMPAQ.DCLAALVQAFGDK
PNMA5_MOUSE/1-323-PGEESFETWLEEVTELMQLWQ.VSEREKKQC---LLESLRGSALSI.MQALWTSND....SLTVE.QCLKALKHIFGNK
PNML1_BOVIN/3-358-QEEA.......RAQDLAKAQAVASLASAAGR---KVKKEPGRAAER.GSALKMENPDGWNDVADGGDGPKPLVRKAGAL
G3U141_LOXAF/1-317-PGEEPFQGWLDHAYDMLYLWRHVSEKEKRRR---LVECLSSPALDL.LYGLLAEDP....DLPAQ.DCLVALVQVFGTQ
H0W6U3_CAVPO/1-332-PEEESFESWLNHANDMLYLWRHVAERERRRR---LVECLDGPALDV.ICELLKAHP....EIPAQ.DCLAALVQVFGNK
H0VWL7_CAVPO/1-322-SGEEPFEAWLEHVTELMQVWQ.VSEAEKRRR---LLESLRGSALAT.MRVLRANDD....SITVV.QCLDALREMFGSK
PNML1_PONAB/5-364-REEA.......RAQEAAEFEEMAAWALAAGK---KVKKEPGLAAEV.GSALKAETPNNWNATEDQHDPPKPLVRRAGAK
H0VK73_CAVPO/6-363-REEA.......RAQEAAEAEEGAAWALAAGK---KVKKEPRLATEV.GLALKMESPTRWKGMEDQGDPPKLIVRRAGAK
G3U379_LOXAF/1-308-PGEEPFEAWLDHAQRTCCTWWHG........---.VPGWRTPARHG.ARSALAENP....ARTAQ.ECLAALVQVFGDT
M4AZA8_XIPMA/3-326-AGEEQFDHWLEQAYMMVEVSE.CSPKEKRRR---IMESLKGPALEV.IKAVRLSDP....DVSPE.ECLEALDSAFGMA
PN6BL_HUMAN/1-326-CEEESFESWVEHAKDMLQLWCHASEREKKRW---LLESLGGPALEV.VSGLLEEDT....NLSAL.DCLAALGQVFRNQ
D2GZV4_AILME/1-325-PGEETFDPWLEHTNEVIEEWQ.VSDVEKRRR---LMESLRGPAADV.IRILKTNNP....SITTA.ECLKALEQVFGSV
F6Z9T2_HORSE/5-364-REEA.......RAQEAAEAGVVAVLASAAGR---KIKKEPGQAAEV.SSALKMENPDSWHDMGDEGDPPKPFFHKAGAK
PNML1_MOUSE/6-363-RDEEA......RAEEAAEAELMEAWASTARK---RVKKEPGLGVEV.GSAFKMEDRNYWKNTEDHGDPPKPLVRRPGGK
F1PIM5_CANFA/1-358-REEA.......RVQEVADAQAVATSASAARR---KIKKEPGRAAEI.GSALKIENPDCWHDPGDEGDPPKPVVLRAGAK
F7H8Z7_CALJA/1-318-CMEDSFESWLEHVNDMLQLWCDASESERRRR---VLSSLRGAALEI.VNGLLEEEP....SFSTL.DCLAALGHAFRNR
PNM6B_HUMAN/1-319-PGEESFEVWLDHTTEMLHVWQGVSERERRRR---LLEGLRGTALQL.VHALLAENP....ARTAQ.DCLAALAQVFGDN
G3QYD8_GORGO/1-326-PGEEEFGRWMFHTTQMIKAWQ.VPDVEKRRR---LLESLRGPALDV.IRVLKINNP....LITVD.ECLQALEEVFGVT
F6WC96_CALJA/1-321-CMEDSFESWLEHVNDMLQLWCDASESERRRR---VLSSLRGAALEILVHALLAENP....TRSAAQDCLTALVQVFGDN
Q5BJV6_RAT/1-328-PGEEEFESWMFHTSQVMKTWQ.VSDVEKRRR---LMESLRGPAFEI.IRVLKINNP....FITVA.ECLKTLETIFGII

PF14244

A5AE14_VITVI/10-125-.QE.GQGIIVYYGK.LKS.LW..DELNNYDS---..IPVCTCTRCK---------------------------------
A5AFL1_VITVI/24-172-.QG.EMIVTHYYNT.LSR.FWQQLDVFETMD---WE.....CXXDA---------------------------------
A5AL35_VITVI/26-142-.QSKSMSVTTYYGK.LNV.LW..EELFKHEP---..LISCTCCSSC---------------------------------
A5APA9_VITVI/42-180-.QG.NGSLEKFYTE..LQGLWWEIDFRHP..---...NPMERATDI---------------------------------
A5AR29_VITVI/23-171-.QG.NLTVTEYFNT.LTR.LWRQLDTFEVHN---WN.....CVTDG---------------------------------
A5ARJ9_VITVI/24-165-.RG.PQCDPI.........LQHSLPILAKTG---HP.....SNWKS---------------------------------
A5ATA8_VITVI/24-171-.QG.SGSLEKYYND..LQGLWREIDFRRP..---...NPMQCPADI---------------------------------
A5AW26_VITVI/23-156-QR..DLDVLSYFNK.................---.....LKNPRDV---------------------------------
A5AXC5_VITVI/8-148-....RMSTQEFYST.MSDLWDQLELTEXASL---QSNVEYLTRRER---------------------------------
A5AZ64_VITVI/47-175-.QE.QLSISVYYTK.LKS.LW..DELASYND---..A...SSGAQQ---------------------------------
A5AZK9_VITVI/143-291-.QQ.GLNVLSYFN..KLKILWEELDVHQHWE---IE.....SPRDA---------------------------------
A5B0N9_VITVI/37-186-.....RSLSEYYGE.......LIEFFCELDH---RDKVVMKDPEDI---------------------------------
A5B3L9_VITVI/16-147-...................LKQELDMFYNLE---WT.....CVTDS---------------------------------
A5B8L2_VITVI/15-147-.TN.TNSIA.......VSSHGKSTTAFKS..---...QTVPDGMKC---------------------------------
A5BAZ3_VITVI/31-163-.QG.EQSVTQYYNT.LTR.YWQQLDLFETHS---WK.....CSDDA---------------------------------
A5BCQ9_VITVI/83-209-.QG.QQSISVYYTK.LKA.FW..DELSSYHE---..VLSCSCGGLE---------------------------------
A5BG06_VITVI/43-189-.TG.KAAIASTESQ..LSLIPTTI.VDLD..---...TGMSFLGTN---------------------------------
A5BJC0_VITVI/21-165-..............DFLVGLNPEFDQVRIYI---LGKQEVPCFNEV---------------------------------
A5BKK0_VITVI/191-331-.QG.GESIEKYYND........AYAHVRR..---...EDTRQVVMI---------------------------------
A5BM32_VITVI/27-149-.QN.SKSITEYFSE.FKA.LW..DEYISYRP---..IPSCRCGNLN---------------------------------
A5BN45_VITVI/28-176-.QG.DLSVTQYFNI.LSC.HWQHLDMFEVHT---WK.....CPEDT---------------------------------
A5BNR5_VITVI/308-456-.QG.TMTVAAYFTK.IKA.LW..DELETYRS---....PLTCNQRQ---------------------------------
A5BP26_VITVI/33-181-.QG.SLDVSTYYTR.LKI.LW..DELKGFQP---..LPECACGTMK---------------------------------
A5BQW4_VITVI/215-363-.EKKEKNDQVYMFL.....ISLNQNLDEVRE---WILGRKPLPSIR---------------------------------
A5BSG2_VITVI/5-152-.QG.XCPLTKYYNE..LNSIYMELDYQRS..---...NDMTCVVDI---------------------------------
A5BT41_VITVI/40-187-.QE.GGSIKTYYNN..LQGLWREIDFRRS..---...NPMEYDIDI---------------------------------
A5BVQ3_VITVI/17-164-.QA.GGSIEKYYND..LQGLWREIDFRRP..---...NPMECAIDI---------------------------------
A5BWZ5_VITVI/42-189-LDK.TGSDVLQIKP..FPTVEQAYAFVRR..---...EEVSHK.DD---------------------------------
A5BXA9_VITVI/396-529-..D.RIMGIKPLPS.LRE.DFSEVRREESRK---KV.....MMGSK---------------------------------
A5C3H8_VITVI/42-155-.QG.SGSLEKFYIK..LQGLWREIDLRRP..---...NPMECATDI---------------------------------
A5C4L4_VITVI/24-140-..Q.QLFISAYYTK.LKG.LW..DELASYNA---..A...AYGAQQ---------------------------------
A5C4S3_VITVI/27-177-.QG.LAYVNTYYTR.QKS.LW..DELREFKA---..IPVCNCGGMR---------------------------------
A5C9I0_VITVI/13-150-..........IGNS.ASK.GK..RLVELFNH---..FTLENVLYVP---------------------------------
B9SLN1_RICCO/35-176-.QA.EKQIQISYVA...............NE---..SV.AAMAVKN---------------------------------
O22175_ARATH/27-174-.QD.GQPVLAYYGR.LIK.LW..EELQNYKS---..GRECKCEAAS---------------------------------
O23588_ARATH/73-209-.QG.NLDLSTYYTK.KKT.LW..EQLANTRV---LTVRKCNCEHVK---------------------------------
Q0PY40_SOLLC/17-166-.QG.TDSVSHYFSK.LKT.LW..NEYDVIVP---..SPCSTCSQSK---------------------------------
Q2HT49_MEDTR/20-168-.QG.TKSVLDYFIE.LCT.LW..DELNSHRP---..IPNCTCIHPC---------------------------------
Q2HU07_MEDTR/24-172-.QG.DKSVLDYFTS.IKS.LW..EELNSHRP---..MPMCTCPYPC---------------------------------
Q6L4J8_SOLDE/13-160-.KL.TQEREKEKVH.QFS.MG..LDDKVFGT---..TH...SNILS---------------------------------
Q9FIC5_ARATH/29-177-.QK.GTPIETYYGK.LSQ.LW..RSLADYQQ---..AKTMEEVRKE---------------------------------
Q9LGZ8_ARATH/19-166-.QD.GQSVLVYYGR.LTK.LW..EELQNYKT---..SRTCTCEAAP---------------------------------
Q9M0P5_ARATH/20-169-.QG.SMDVSTYYTE.LVT.LW..EEYKNYIE---..LPLCTCGRCE---------------------------------
Q9XIM3_ARATH/23-161-.QG.TLSLSEYYTR.LKT.LW..DQLDSTEE---LDDPCTRQKRAK---------------------------------
Q9ZPU4_ARATH/37-185-.QD.GQAVIEYYGR.LSN.LW..EEYNIYKP---..VTVCTCGLCR---------------------------------

PF16297

H0W794_CAVPO/2-110-LTGRALEWVMPYIQKDSPLLNNYRAFLAEMK---LVFGWEDDEEDF---------------------------------
D3ZTE6_RAT/24-138-LSGEAEEWVMPYIESNSYILGDYRAFVNEMK---QYFGWDTDDEDD---------------------------------
G1MLQ7_AILME/2-114-LTGPALQWVIPYIRKESPLLNDYRGFLAEMK---RVFGWV.EDEDF---------------------------------
F7ASC6_CALJA/2-113-LTGPTLQWMIPYIKKQSPLLNDYWGFLAEMK---RVFGCQ.EDKDF---------------------------------
Q9D6I0_MOUSE/2-112-LKGRALQWAMRYLQTDSPMLNNYSGFLNEMK---EEFGWE.EDEDF---------------------------------

PF14223

Q0KIL6_SOLDE/91-204-FQQFCLNYNMN..KMSL...SLAQLLNELQA---AETLV.KKASSM---------------------------------
A5BQ76_VITVI/412-525-FQQFRLNYNMN..KMDF...TLSKLLNELVA---AQTII.KQGAAP---------------------------------
A5AHT8_VITVI/92-205-FSPFKISYNTQ..KEKW...TLNELIAQCVQ---EEERL.KEEKIE---------------------------------
B8BH64_ORYSI/219-332-FNQFKVSYNCQ..KDKW...TVNKLITHCVQ---EEERL.KQDRIE---------------------------------
A5BI38_VITVI/288-401-YGPFKISYNTH..KDKW...SINELLTMCVQ---EEGRL.KMELDE---------------------------------
A5ANU6_VITVI/96-209-WKGYRKRILHK..SEDY...SLEEIQKHLRI---EEESR.SRDKMV---------------------------------
A5B8Q0_VITVI/530-643-YGHFVDTMMYG..RDTL...SIEDVREALNL---RELKK.RVSESR---------------------------------
A5AQ94_VITVI/79-192-YSNFKETMKYG..RKTL...TLEEVQSALRS---KELEL.KKKGSN---------------------------------
Q18L98_CITSI/81-195-YEGFVDTMLYG..RTTL...TLEDVKASLSS---KEIQK.NCELET---------------------------------
Q1KUM3_9ROSI/118-231-YEQLREVLKYS..RATI...SVEEVKAAARM---KELEL.LAQGTL---------------------------------
Q7XTM9_ORYSJ/78-191-YANFRDTILYS..RDTL...TLKEVYDALHA---KEKMK.KMVPSE---------------------------------
Q01M93_ORYSA/78-191-YANFRDTILLS..RDEL...TLKEVYDALQN---KEKMK.IMVQND---------------------------------
A5AS33_VITVI/79-194-WETMRMVVRNSTGKEKL...KYNDIQDLILA---EEIHQ.RDAGKT---------------------------------
Q2AA06_ASPOF/860-974-YDTFLLTLLNG..RPSI...SYSEITNALTN---YDLRR.KDKETS---------------------------------
Q6XMP8_AEDAL/82-196-YDALVTALENL..PENEL..TYEVMKTRLID---EESKR.NERSYT---------------------------------
D2A543_TRICA/77-191-FDPLVTALETM..EPSKL..TLDFVKGKLLD---CELKR.KNQCSE---------------------------------
Q9U6V8_DROWI/75-189-YDGIITAIETL..SEENL..TLAFVKNRLLD---QEIKI.KNDHND---------------------------------
A5BIJ4_VITVI/84-197-YKELGVVMCVR..DTPI...SFEELHDKLIE---HEIYL.KRDMEM---------------------------------
Q0ZCD8_POPTR/118-230-FREIAAPIRAR..EKSL...TFEELHDLLVS---HEAYL.RRLETA---------------------------------
A5B6L3_VITVI/126-238-YESVIAVISSK..KSSP...SLQYVTSTLIA---HEGRI.AHKISS---------------------------------
A5BYA6_VITVI/62-174-YESFVTSITLR..NDDF...SVEEIEVLLMA---HESRV.EKNNSS---------------------------------
A5BK17_VITVI/103-215-YETFIISVNSR..LDPY...TVEEIEALLLA---QESRI.EKNIKI---------------------------------
A5CAE5_VITVI/64-176-YNPIVASLTAR..DDDI...QLHAVHSILLT---HEQRL.HLQTTA---------------------------------
A5BJ70_VITVI/81-193-YNSIVASLTAR..EDDL...SLHSVHNILLT---HEQRL.HLQHSS---------------------------------
A5BFR8_VITVI/115-227-YNAVVTAINIR..DDKI...SLEAIHSMLLA---FEHRL.EQQSSI---------------------------------
Q9SV56_ARATH/103-217-YMLVSTMIKGS..MDTYPM.SFEDVVFKLIN---FDDKL.QNGQSG---------------------------------
Q9SSB1_ARATH/101-216-YEPIKTTIENS..VDSNPSLSLDEVASKLRG---YDDRL.QSYVTE---------------------------------
D1GEF6_BRARP/107-222-YEPIKTSIEGS..MDTQYHPSFEDVVPRLVA---FEDRL.KSYTTD---------------------------------
C0SQ79_PYRYE/115-228-FKTIRTVLRNS..GKLL...TLPTITNRLME---TELRA.ESDDDV---------------------------------
A5B3I2_VITVI/89-207-FDYVVCSIEES..KDTNT.LTIDELQSSLLV---HEQRM.SSHVEE---------------------------------
A5B8H9_VITVI/153-271-FNCVVCSIEES..NDLDT.LSIDVLQSSLLV---HEQRM.NDHLVE---------------------------------
A5BGM4_VITVI/89-207-FNYVVCSIEES..KDLDE.LSIDELQGSLLV---HEQKI.IQEDKE---------------------------------
Q9M1C6_ARATH/91-209-FNYVVCSIEES..NDLST.LSIDELHGSLLV---HEQRL.NGHVQE---------------------------------
A5BYF7_VITVI/162-280-LDYVVYSIEES..NNVDM.MTTDELXSSLLV---HEQRM.NCHSGN---------------------------------
A5BY31_VITVI/28-146-FNYIVCSIEES..KDTDT.LTIDELQSSLIV---HEQKF.HKKPVE---------------------------------
A5BFQ9_VITVI/28-146-FNYVVCSIEEL..KDIDV.LTIDELKSSLIV---HEQKF.QRRNGE---------------------------------
Q9C7Y1_ARATH/87-205-FTYVVCAIEES..NNIKE.LTVDGLQSSLMV---HEQNL.SRHDVE---------------------------------
A5AMT2_VITVI/80-198-FNFIVCSIEEA..NDVGL.LSIDELQIELIE---EEEEA.EVGVEE---------------------------------
Q2QXM6_ORYSJ/85-203-YEYIVAAIEES..KDLST.LTIQQLMSSLES---HEERK.LQREGS---------------------------------
Q6L3N8_SOLDE/84-202-FEHVVTAIEES..KDLST.YSFDELMSSLLA---HEDRL.NRSREK---------------------------------
A6YTD9_CUCME/91-209-FEHIVVAIEES..KDLST.LSINSLMGSLQS---HELRL.KQFDVN---------------------------------
Q9M2D1_ARATH/89-207-FEHIVTVIEET..KDLEA.MTIEQLLGSLQA---YEEKK.KKKEDI---------------------------------
A5BLB0_VITVI/283-400-FDPIVAVIEET..KDLSL.LSAQELFG.FKN---NQQAS.CAEEKE---------------------------------
Q9LH44_ARATH/87-205-FDSIVGVLEQT..KDLST.LSVTELIGTLKA---HERRL.NLREDR---------------------------------
Q9ZQE9_ARATH/91-209-FDSIVSVLEQT..RDLDA.LTMSELLGILKA---QEARV.TAREES---------------------------------
A5B9M8_VITVI/90-208-FEAKISAIEES..CDLQT.LTIVELTSKLHA---QEQRV.LMRGDE---------------------------------
A5BRD1_VITVI/91-209-FETTISSLENS..KDVSS.ITLAKLLNALQT---QEQRR.LMRQEG---------------------------------
A5B779_VITVI/91-209-YESKISSLEES..KDLSS.ISLAELVNALQA---QEQRR.MIRKEE---------------------------------
Q9SEL2_VITVI/89-207-YEATISSLENS..KDLST.ISLTELLHSLEA---VEQRR.LMRQGD---------------------------------
A5BFD6_VITVI/89-207-YEATISSLENT..KDLSS.ITLAELLNALQA---LEQRR.LMRQGS---------------------------------
A5BRW6_VITVI/90-208-FESKISSLEES..RDLSQ.ISLAEIINALQA---QEQRR.ALKQEN---------------------------------
Q6L3X6_SOLDE/202-320-FESKISSFEKS..KDLGK.LSLGELMGALQA---QEQRR.NMRRDK---------------------------------
A5ACV7_VITVI/90-208-FESKISSLENS..KDLTK.ISLAELVHAFQA---QEQRR.SMRQEE---------------------------------
Q6L3Y5_SOLDE/89-207-FEAKISSIEDT..WDMSR.VTLNELSNALLA---VEKRK.AFRKEE---------------------------------
Q60EG1_ORYSJ/85-201-FPSRRD..REF..YNVDD.MPFEEAVGRLKA---YDERV.RKKKAA---------------------------------
C6JSM1_SORBI/92-210-YIHVIAGIEQF..YDLQT.MKFEDAVGRLKA---YEERT.RRGVGE---------------------------------
B6TPM7_MAIZE/94-212-LFPVVAGIEQF..CDVET.MPFEEALGRLKA---FDERS.RRRTHA---------------------------------
Q9SHT5_ARATH/47-166-YIHIIAALEQI..LDLNT.TGFEDIVGRMKT---YEDRV.CDEDDS---------------------------------
Q9ZUF2_ARATH/41-160-YIHIVAALEQV..LDLKN.TTFKDIVGRIKT---YEDKI.WVLITC---------------------------------
Q4ABY7_BRACM/83-202-YIHMVASLEQV..LDLNS.TSFEDIVGRLKA---YEERI.CEDEEE---------------------------------
Q9LQK3_ARATH/80-199-YIHIIASLEQV..LDLNN.TSFEDIIGRMKV---YEDRV.CDDDEP---------------------------------
Q9SKV6_ARATH/80-199-YIHIIASLEQV..LDLNN.TSFEDIVGRIKV---YEERV.WDGEEQ---------------------------------
Q9LE43_ARATH/83-202-YIQIVASLEQV..LDLKN.TSFEDIVGRIKV---YEERV.WDEEDE---------------------------------
B6REL9_9BRAS/81-200-YIHIIASLEQV..LNLNE.TGFEDIVGRLKA---YEERV.LDDEKQ---------------------------------
B6REL1_9BRAS/60-179-FIHIIASFEQV..LDLNT.TGNEDIVGRLKA---YEERN.GEETQR---------------------------------
Q7F814_ORYSJ/95-213-FQPLISTIEQW..GDVSE.MTVTETIGRLRA---FEESS.KGQRRD---------------------------------
B8BA29_ORYSI/100-218-FISVASSLMLF..SNINK.MAMEEAIVSLKA---HEELV.KGREIQ---------------------------------
D3IVE4_9POAL/219-337-FVPVVTTLIYS..PDLEE.KKIEEITGSLKA---HEELL.KGYQSR---------------------------------
Q7X7K3_ORYSJ/176-294-LQQIAISIETL..LDVNE.LSLEEVTGSLRS---VEQRK.QRKAVA---------------------------------
Q0J5Y3_ORYSJ/115-233-LEQIAVAVETL..LDLNT.VSVEEVTGRLRA---VEQRR.HRSAPV---------------------------------
Q7XH44_ORYSJ/165-269-....AISIETL..LDIRD.LSIKEVTVRLRS---VEKCK.AKPKEV---------------------------------
Q2QYR6_ORYSJ/52-170-LEQVAISIETL..LDLAT.VSIEEVIGRLRA---VEQRK.KPASSE---------------------------------
Q5TKD7_ORYSJ/109-227-YHQLALSIEQM..LDLKT.MPLEELVGRLAA---IESYK.PEWTAR---------------------------------
Q7XTU6_ORYSJ/114-232-YKPVAISLEQL..LDVKT.MALEELVGRLST---VDSYS.DDEEGS---------------------------------
Q8LMZ0_ORYSJ/135-253-FVQVAIAIEQL..LDLKT.LSIEEVTGRLRT---VEERY.RPGDND---------------------------------
Q7G5Z8_ORYSJ/110-228-YTQVAISIEQL..IDLKT.LSVEELTGRLKS---VEERY.EIDGNG---------------------------------
Q53P77_ORYSJ/86-204-FSQLVLSIETL..LDIST.LTLEEVTGRLKA---VEDSG.QSSSSS---------------------------------
Q2QZL2_ORYSJ/49-167-FNQLILSIETL..LDIST.LSMEEVTGRLKA---AEDSG.QSSSHT---------------------------------
Q7XWP2_ORYSJ/116-231-FSQLAAE.......DYQTPPSSQNTDGKLYL---TEEEWLEHHKKE---------------------------------
Q10C26_ORYSJ/22-139-LQQIALSIETL..LDVEE.LSLEEVTGHW.A---KDCRQ.PRKNTE---------------------------------
Q7XUD9_ORYSJ/115-233-LSQIALSIETL..LDLDE.LTLEEVTGRLRN---AEEKL.PAKSSA---------------------------------
Q25AF6_ORYSA/117-235-FSQIAVSIETL..LDLST.LTIEDVTRRLKV---AEERQ.PAPTST---------------------------------
C1IJC5_HORVU/114-232-YSQLVLSIDNL..VDLDT.TSIEEVIGRFKA---AEERY.ELDVEE---------------------------------
C5Y7F6_SORBI/35-153-YNQVAVAIEMS..SDLKT.LSIDEFVGCLRA---AEDRF.EPFVEQ---------------------------------
Q94I41_ORYSJ/94-212-LKQVAVAIEML..ADIDT.MEIEELVGRLQV---AEDAD.AEDQAA---------------------------------
C5XUK3_SORBI/218-337-YAQIVVAIEQF..LDFEA.LTLEEVTGRLKA---VDNRE.EQALTE---------------------------------
C5XQM0_SORBI/100-219-YAQLKIAIETL..LDFQD.LTIEDVIGRLKT---VDDLD.DEPTHE---------------------------------
Q9AUM6_ORYSJ/569-688-YTQLALSIETL..LDFTE.LTIEEVMGRLKA---VDNRK.QLPPSE---------------------------------
Q2QWI2_ORYSJ/47-166-YRQIARSIESL..LDLST.MTIEEALGRLKV---VDSDE.PQPLSG---------------------------------
C5Z583_SORBI/100-218-YSQLAMSIETM..LDIST.LSLEDVAGRLRV---AESRT.TPAPEK---------------------------------
C5WNA6_SORBI/224-342-YIQIALSIETM..LDLST.LIIEDVTGRLRA---VDERM.EQATTT---------------------------------
D3IVP8_9POAL/630-749-WEVLVTTINHS..VNMET.LTLNDLYSKIKT---HDIDI.LARINK---------------------------------
D3IVT7_9POAL/58-177-WGIKITSINDN..TVMSE.LTMDKLYSRLKT---HEIDF.TLRLPK---------------------------------
D3IVI1_9POAL/86-205-WEMKVTTIKDT..TDLST.LTLDALYSRLKT---HEIDI.VSRKSK---------------------------------
Q10PG0_ORYSJ/85-204-WEMKVTSITES..APLSD.LTMDKLYSKLKT---HEMDV.FHRKGL---------------------------------
D3IVI3_9POAL/99-218-WEMKATTIEEN..INLSD.LILELLYSKLKT---HEIKR.VDYPKK---------------------------------
Q5H9X1_ORYSJ/112-231-NSTLVTIIRER..PDYKT.LTPYDLLGRILA---HDMLV.QDSKDV---------------------------------
Q10NE5_ORYSJ/129-248-YPTLVSMIRER..KDFKR.LTPSDILGRIVS---HEMQE.EEAREV---------------------------------
C5WYF6_SORBI/63-181-NETVVTLIRDK..KNFEH.FTPSDVLGRLLT---FDMQR.LKKFDM---------------------------------
Q8S467_MAIZE/138-257-NPTQVQLIRGN..PRYTL.MTPEEVIGNFVS---FECMI.KGSKKI---------------------------------
Q8H6I4_MAIZE/204-323-DKSLARMIRDR..DDYED.MTPHQLFAKIQQ---HESEE.APIKTR---------------------------------
Q33BC8_ORYSJ/86-203-YETLVTMLINS...DMSR.MTPASLLGKINT---NDMYK.LKKKEM---------------------------------
A2Q5V3_MEDTR/101-218-FYMKVTAIEEA..QEVSN.MQVEELIGSLQN---YELVV.DNRTEK---------------------------------
O65147_SOYBN/76-194-FDMKVTAIEEA..QDICN.MRVDELIGSLQT---FELGL.SDRTEK---------------------------------
A5BZ48_VITVI/103-221-FRAKVTAIEES..KDVDS.LKVDELVGSLQT---FEMTL.GSPRKS---------------------------------
Q9XEB1_ARATH/433-551-FQSHKSAIDVS..LNSDQ.LKFDQVVGMMQA---YDTDK.EEILNS---------------------------------
Q9FG84_ARATH/101-219-FESKRTAMGTS..LDTDT.IDFEEVVGMLQA---YELEI.TSGKGG---------------------------------
Q9ZV83_ARATH/82-200-FAAHKAVMRVA..GNTDK.ISFVDLVGMLKL---EEMKA.DQDKVK---------------------------------
A2I5F8_BETVU/104-223-WMTKVTALQET..KDFTK.FNLEQLAGSLMT---HELHL.DTEYGE---------------------------------
A5BW11_VITVI/73-191-WHTKLTAIQEA..KDLTK.LPMEELVGSLMT---YEINL.TKKLQE---------------------------------
Q1S5J6_MEDTR/118-236-WRPKVTAIEEA..KDLNT.LSVEDLVSSLKV---HEMSL.NEHEIS---------------------------------
Q9FJT0_ARATH/33-146-FDKVLVEVAEK........LSVNVIIDCLLV---HEYNM.RPDQES---------------------------------
Q9LJD1_ARATH/93-210-FDGLDSMLEEL..IDVHK.MTSKSLVEYFY.---..YRV.HESSTE---------------------------------
Q9LJD1_ARATH/509-622-YDDVAPVLGDL..VDLKN.MSLKSFVELFYV---YDSIT.EESIHL---------------------------------
Q9LJC8_ARATH/91-202-YDDSIPVLKEF..MTLPD.LTLRDLLKAFEL---FGSHP....ETM---------------------------------
Q9LJC9_ARATH/91-203-YDDSITVLKEF..MTLPD.LTHRDLLKAFEM---FGSNP....KTM---------------------------------
A9TSN8_PHYPA/23-136-FETFVRVLRSE..KDAP...TLENLASRLYI---EEMAF.KQRKEQ---------------------------------

PF03732

Q9XX53_CAEEL/210-308-KSIDYIQ...................STALH---TFLEGLGD-------------------------------------
PEG10_MOUSE/174-267-....WTE...................PALMD---QFQEGLNP-------------------------------------
Q9AUY8_ARATH/31-127-..ELEDE...................AVQVR---RFLRGLRV-------------------------------------
Q9FWC7_ORYSJ/155-249-...VFDPSV...............GGKMLVT---RFMNGLTE-------------------------------------
Q9FE41_ORYSJ/775-871-....MHL...................EDAIE---MCVHGMQQ-------------------------------------
Q9LP90_ARATH/163-253-...GLDD...................QKLEG---IFLNGLTG-------------------------------------
Q9LMV1_ARATH/257-344-....VPD...................EAAIV---A....LRN-------------------------------------
Q9ARZ4_ORYSJ/100-192-....ITE...................ASVIN---AASAGLLE-------------------------------------
Q9FYC9_ARATH/102-194-....LDE...................DFLVS---LYLTGLKT-------------------------------------
Q9SK57_ARATH/214-310-..ELEEE...................QAQLR---RFIRGLRI-------------------------------------
Q9FRJ2_ORYSJ/81-182-.NMPVSE...................PSQVL---NLLRGLNT-------------------------------------
Q9AV68_ORYSJ/351-443-....ITD...................DVIIA---AFTKGIRH-------------------------------------
Q9AYB5_ORYSJ/567-664-..DLRND...................EERQE---KFLGGLND-------------------------------------
O23529_ARATH/90-186-.GKPMEH...................EEQVE---RILEGLPE-------------------------------------
O82608_ARATH/272-360-..GINDL...................AALST---.....LKK-------------------------------------
Q9AYC2_ORYSJ/729-826-..DVRTD...................AEKQE---KFMAGLDD-------------------------------------
Q9FGL3_ARATH/131-241-.SCVNTCRNCKCCS.....ATASVNEHSKIV---KFLAGLND-------------------------------------
Q9SQW9_ARATH/264-354-....VTS...................DILES---AFLNGLRR-------------------------------------
Q9LNM2_ARATH/83-178-.STVADK...................PQGEA---ARGRG.RG-------------------------------------
Q9AYB6_ORYSJ/694-791-..DVRED...................EEKQE---KFLAGMDP-------------------------------------
Q9XE67_SORBI/155-252-..ESNTE...................KKKMY---FFKKGLST-------------------------------------
O49369_ARATH/139-231-....FAE...................DYLVS---VYLAGLRT-------------------------------------
Q9ZPF9_ARATH/97-196-..VQEEC...................EATMS---RFMGGLNR-------------------------------------
Q9XII7_ARATH/126-236-....STEALDEPCTCGKAMRLQQKAEQAKIV---KFLAGLNE-------------------------------------
Q9SIM3_ARATH/131-240-....STEALDDPCTCGKAVRLYQKAEKAKIM---KFLAGLNE-------------------------------------
Q9MA68_ARATH/89-183-..HGFKK...................ASLLS---TLYRGALP-------------------------------------
Q9M225_ARATH/186-282-..GMKDG...................QAELR---RFMRGLRP-------------------------------------
Q96467_HORVU/82-176-..NGLSL...................WMIIQ---IFYAGLNF-------------------------------------
Q9AXC5_ANTHI/295-388-..YLEDE...................GRKAR---KFIEGLKL-------------------------------------
Q9M0T9_ARATH/89-183-..HGFTK...................ASMLS---TLYRGVLP-------------------------------------
Q9SY43_ARATH/188-284-..GMEDD...................QAQMR---RFLRGLRP-------------------------------------
Q9C7H8_ARATH/150-242-....LSE...................EYLVS---VYLAGLRT-------------------------------------
Q9ZNW4_SORBI/210-302-...GVPK...................EVAIE---AAIKGLRI-------------------------------------
Q9SUN0_ARATH/223-313-..RSRGK...................QARND---R.....RR-------------------------------------
Q9M252_ARATH/163-260-..AGRGE...................QSMIR---RLMRGLRP-------------------------------------
O93283_TAKRU/149-242-....WGE...................TALRS---AYRRGLSE-------------------------------------
Q9ZQQ3_ARATH/198-290-....ISQ...................QSALS---ALRKGLWY-------------------------------------
Q9ATX2_MAIZE/179-271-....VPN...................EIVIE---AMIKGLRP-------------------------------------
O81471_ARATH/148-242-..HSFSE...................VQLLG---TFFRGVDW-------------------------------------
Q9FW76_ORYSJ/181-275-.GGSNDP...................AYFVT---KFVDGLKD-------------------------------------
Q9SKF2_ARATH/107-197-..HGFSK...................ESILK---N....LAQ-------------------------------------
Q9SYE8_ARATH/131-230-..LQEDG...................EAVMS---RFMGGLNR-------------------------------------
Q98SV9_TAKRU/117-207-....WND...................TALRG---VFTQGLAE-------------------------------------
Q9SJP0_ARATH/291-382-....TPD...................DAAIA---ALRNALWH-------------------------------------
Q9XE85_SORBI/114-212-..DVRED...................ADKQR---LFMKGLYY-------------------------------------
Q9ZS84_SOLLC/150-247-....MSD...................EDKLH---NFISGMQG-------------------------------------
O48967_MAIZE/245-337-....ISD...................ASIIT---AFRQGVRD-------------------------------------
Q9LZG5_ARATH/148-244-...KRGE...................HELIH---KFISGLRV-------------------------------------
Q9SX87_ARATH/132-224-....LSE...................DYLVR---VYLDGLHP-------------------------------------
Q9LQH2_ARATH/476-575-..IQEDN...................EAIMS---RFMGGLNR-------------------------------------
Q9FZN9_ARATH/121-215-..HGFSK...................ASLLS---TLYRGVLP-------------------------------------
Q9SLQ0_ORYSI/194-290-..LVEND...................DAGMA---RFMGGLNR-------------------------------------
Q9UVC2_PASFU/52-153-....WDD...................EALQV---MYRRGLKE-------------------------------------
Q9ZPG6_ARATH/97-191-..HGFKK...................ASLLR---TLYRGALP-------------------------------------
Q9ZUK1_ARATH/211-302-..VNRPET.................IQDALH---RATNWINA-------------------------------------
Q9FWB1_ARATH/104-198-..HGFRY...................ATLIN---TFYMGVDK-------------------------------------
Q9HFY8_COLGL/148-252-....MTD...................ESKVF---AFYQGLKD-------------------------------------

PF14227

A5BY76_VITVI/104-226.WHTKVTT...IQEVKDLTKLPMEELIGSLMT...YEINLAKKLQEGED-------------------------------
A5B9Z7_VITVI/12-134.WHTKVTA...IQXAKDLTKLPMEELLRSLMT...YEISLTKQLQKSED-------------------------------
A5BSC1_VITVI/688-789.WHTKVTA...IQEAKDLTKLPMEELLGSLMT...YEISLTKQLQESED-------------------------------
A5BWL8_VITVI/342-448.WHTKVTA...IQEAKDLTKLPLEKLIGSLMT...YEINLAKKQQESED-------------------------------
A5BLR1_VITVI/94-215.WHTKVTT...IQEAKDLTKLPMEELIGSLMT...YEINLAKKLQEGED-------------------------------
A5BLB0_VITVI/282-404.FDPIVAV...IEETKDLSLLSAQELFGFKNN...QQASCAEEKEADEN-------------------------------
Q9LJC9_ARATH/90-212.YDDSITV...LKEFMTLPDLTHRDLLKAFEMFGSNPKTMPQELMKFIN-------------------------------
Q5AT23_EMENI/392-511.YDSMKFS......LPVHEDLTRGVVLSRLQQ...QDSMMSTAKENWIV-------------------------------
D3IVP8_9POAL/629-752VWEVLVTT...INHSVNMETLTLNDLYSKIKT...HDIDILARINKPNS-------------------------------
COPIA_DROME/74-192.YDGIITA....IETLSEENLTLAFVKNRLLD...QEIKIKNDHNDTSK-------------------------------
D2A543_TRICA/76-194.FDPLVTA....LETMEPSKLTLDFVKGKLLD...CELKRKNQCSEIEV-------------------------------
O96968_BOMMO/78-193.YNTTITA...LETTN..VELTTEYVKSKLLD...AE..LKNQNNSMES-------------------------------
Q6XMP8_AEDAL/81-199.YDALVTA....LENLPENELTYEVMKTRLID...EESKRNERSYTVGD-------------------------------
B0X5G3_CULQU/101-222.YGTLINV....IEGYPREQITVDFVKSKLRDEWRRRQECQEFQSGPSD-------------------------------
Q967L5_AEDAE/76-197.FDGLVTA....LDSRSQDDITLEVVKSKLMDEFLRRLERDGHPVKKEK-------------------------------
Q8WRX6_ANOGA/74-195.YDHLTTT....LETRSDDDLTMELVKSKLLDEAQKRMEKSHQSESILR-------------------------------
B2CN78_DAPPU/42-160.YRSFTTA....WDSVPAHEKTIALLTSRLLK...EETMAKRWTRGQKD-------------------------------
A9RF54_PHYPA/34-146FYSSLIVA....LESISRKDLTLDYQGCAKDE...EEPPFEDEEVHYQS-------------------------------
Q8H023_ORYSJ/210-330.FEHVVTT...LTHGK..DTVKTEEIISSLLARDLRRSKKNEAMEASQA-------------------------------
Q7XSZ1_ORYSJ/103-219.YEHVVTT...LMHGK..DTIKTEEIISSLLARDLRRSKKNEAMEASQA-------------------------------
Q7XLX2_ORYSJ/160-253.YEHV................................MRKNKEGETSQA-------------------------------
A5BPQ9_VITVI/512-624TYENLVTT...LMWGK..ETLDLEDITSILLG...FNKKKKANNESSRG-------------------------------
A5B864_VITVI/32-156TYEIWSVN...YGYVLMNNNVSCKVTRIGNIKIKMFDGVVRTLCDVRHV-------------------------------
Q9AU17_SOLCI/79-196.YDTLSTT...ILHGK..DSIQLKDVTSALLL...NEKMRKKPENHGQV-------------------------------
B1N668_SOLLC/75-192.FENFVQS...FIVGK..DTVSLEEVRSALHS...RELRHKANGTSTDI-------------------------------
Q2AA06_ASPOF/859-977.YDTFLLT...LLNGR..PSISYSEITNALTN...YDLRRKDKETSHAS-------------------------------
Q69FA7_PHAVU/58-175.FEHLETT...LLHGK..DNVSLDVVCSALYS...HELRKQDKMKTKST-------------------------------
Q6BCY1_IPOBA/74-193.YDQLIIN...LTNNILTDYLVFDDVAAAVLE...EESRRKNKEDRQVN-------------------------------
B8YLY5_MEDTR/73-192.YDQLIIN...ITNNNIADTLHFDDVAGAILE...EESRRKNKEERSES-------------------------------
Q25A78_ORYSA/77-175.YANFRDT...ILYSR..DTLTLKEVYDALHA...K....EKMKKMVPS-------------------------------
Q53QA4_ORYSJ/75-188.YANFRDT...ILLSR..DELTLKEVYDALQN...K....EKMKIMVQN-------------------------------
Q94LG0_ORYSJ/79-192.YANFRDT...ILLSR..DELTLAEVYEALQN...R....EKMKGMVQS-------------------------------
Q01MJ3_ORYSA/27-111..............DK..DKRTGKYVPKGKKE...E....EGKAAVVTD-------------------------------
A5BQQ6_VITVI/23-136.YVTFRDT...ILYSR..DTLTLKEVFDALFS...K....EKMKQLVVR-------------------------------
A5BPL2_VITVI/25-141.XAML......MGNNASYKIVGIGTVKIKMFDGIVTTLSDVRRILDLKR-------------------------------
Q9SJT2_ARATH/93-212.FDQLRDT...LKYGLGRVTLSLDEVVAAIYS...KELELGSNKKSIKG-------------------------------
Q9SH77_ARATH/93-212.FDQLKDT...LKYSSGKSILTLDEVAAAIYS...KELELGSVKKSIKV-------------------------------
Q9FFM0_ARATH/98-215.FDQLKET...LKY..CKTTLHLEEITSAIRS...KILELGASGKLLKN-------------------------------
Q9LS18_ARATH/107-224.LEQLKYS...LDY..CEEPLTLGRVMTAIYK...KELEVAQIERQTEE-------------------------------
Q9ZQE4_ARATH/102-211.YDRKENS..........QKVESSQSEGLYVE...QEADQRRGLKKEKA-------------------------------
Q9LJS6_ARATH/105-202...RIKES..........GKLSKTQSEGLYVE...TRGRLEKRFDKGKG-------------------------------
O81903_ARATH/103-220.YIQLKHT...LKY..GNKTLSVQDVVSSAKS...LERELSEQKETIRA-------------------------------
Q9SHR5_ARATH/101-218.HIQLKHT...LKY..GNKTLTVQDVTSSAKS...LERELAEAVDLDKG-------------------------------
Q9LVY5_ARATH/105-222.YDQLKHT...LKY..GNKTLSVKDVVSSSKS...LEREMAELKENTKV-------------------------------
Q02900_ARATH/97-214.YSQLKHT...LKY..GNKALSLQDVISSARS...LERELDEQKETDKN-------------------------------
O82196_ARATH/63-180.YDMLKET...LKY..GREGIKLDDVISAAKS...KELELRDSSGGSRP-------------------------------
Q9ZPU5_ARATH/68-187.YDGLVET...MKYSNSREKLRLDDVMVAARD...KERELSQNNRPVVE-------------------------------
Q1KUM3_9ROSI/117-234.YEQLREV...LKY..SRATISVEEVKAAARM...KELELLAQGTLTRG-------------------------------
A5AR03_VITVI/133-256.FDQLRDN...LKY..SKYMLSLECVEXHHKRECPKRKPKKNDQBSESX-------------------------------
A5ARG5_VITVI/22-139.FDQLRDT...LKY..SKDSLSLEGVVSAIHA...KKMDIRVERIGTTS-------------------------------
Q9M3C1_ARATH/26-145.YDSLVDT...LKYGSGKDTLTLNAVISSAYS...KEIELKEKGLLNVS-------------------------------
A5AJF1_VITVI/465-574.YTNMKEA...IMYGR..DSLTFD...........EETKHSQENREWGD-------------------------------
A5BLL6_VITVI/78-195.YTNMKEA...IMYER..DNMTFDEVQSILHA...RELQKQEESKEKSG-------------------------------
A5BYU4_VITVI/59-176.YTNLKEA...IMYGI..DSLTFDDLQSILYA...RELQKQEESKDESD-------------------------------
A5BPE6_VITVI/78-195.YENFVDT...MMYGR..BSISXNDVKDALQS...KELQKLVSGSEEGS-------------------------------
Q18L98_CITSI/80-198.YEGFVDT...MLYGR..TTLTLEDVKASLSS...KEIQKNCELETSNG-------------------------------
A5B6C0_VITVI/29-150.YEHFLNT...MVYGR..DTIYIENVRAALNSRELKNKVFKSREDDSSE-------------------------------
A5AYK3_VITVI/32-152.YEHFVDI...MMYGR..GTLFIKDVRVALNSRELKKMVFKSRKYDSGE-------------------------------
A5B8Q0_VITVI/529-644.YGHFVDT...MMYGR..DTLSIEDVREALNL...RE..LKKRVSESRK-------------------------------
Q2AA73_ASPOF/71-191.YKHFRDT...MIYGR..DSIGIKDAKENLLNTEKINKELTTSESGDKA-------------------------------
A5AM57_VITVI/98-215.LKHFKET...LKY..GRDAITFDDVQNALNA...KVAPIICVQEINGG-------------------------------
A5C6J6_VITVI/77-184.YDHFLET...LLHGK..QTLTMSKVKEGHYK...KECPERKKKAEKLN-------------------------------
A5AQ94_VITVI/78-195.YSNFKET...MKYGR..KTLTLEEVQSALRS...KELELKKKGSNGEG-------------------------------
A5AKU3_VITVI/615-723.YSSFKEX...MKYGR..KTLTLEEVQNGEGLFIKGRXDKRNNKGKASS-------------------------------
C6GFP7_FRAAN/52-171.FKHFKTT...MIFK...ELITLSKVCENPKSYIRLEREEDSSQARGLY-------------------------------
A5C6L3_VITVI/78-195.WEAMRMA...VSNSTGKEKLKYNDIRDLILA...EE..IRRRDAGETS-------------------------------
A5BCL0_VITVI/55-172.WEPKRAT...VNNSIDSAKLKFNDVKDQILI...DK..VRRIDLGKAS-------------------------------
A5AL15_VITVI/39-145...............KLLDTVGVGDIHLKMLNGFIWKIHKVRHVPKLMH-------------------------------
Q6RZV5_MUSAC/23-145.WETFVVT...ICNSTLEGTLTIDMVKDSLLN...EDARRKEQGESSFG-------------------------------
Q9ZRJ0_TOBAC/76-193.WETLKVS...ITNSAPNGVVNMETVKSGILN...EE..MRRRSQGTSS-------------------------------
Q5MG99_IPOBA/76-193.WETFRVS...LTNSAPNGVVTMEYVKSGILN...EE..ARRRSQDTST-------------------------------
A5AJF5_VITVI/76-192.WETFRTS...LSNSAPDGTMNMDLVKSCVLN...EE..MGRKSQG.SS-------------------------------
A5BEP3_VITVI/54-180.YKYCRQLKRDMKQGKVNDKKNDNGGEDDRVATTTSNFLIVYENFFTSY-------------------------------
B3N452_DROER/17-137.YENFVVA....IETR.DTLPDFEVLRIKVKEKGERRCQFGPSDMQAQA-------------------------------
B4N7F3_DROWI/52-172.YENFVVA....IETR.DDMPSFEILRIKLKEEAERKRLTVTKENGQEA-------------------------------
B6V6Z8_DROME/78-198.WENFVVA....IETR.DTLPTFETVKVKLLEEGARKQERDDREGSVQA-------------------------------
B4NQE5_DROWI/78-198.YETFRCA....IETR.DELPSPDILRVKILEESEARQAKKAREEQSAV-------------------------------
Q45W64_PHACR/80-192.WESFVAA........QNNVEKSSDVIGRVLS...EN..LRRQSKGDTT-------------------------------
Q5JMV2_ORYSJ/12-126.HEHVVTT...MTYGKVKHDNDTGTSKGK......EKRVMRPRLKTTGA-------------------------------
A5CA63_VITVI/149-269.YETFTTT..MLKPPRPSYSELVSQLQSLDQR...RNWFSNHANATHAT-------------------------------
Q8W5F6_ORYSJ/80-197.WRSFGTA...LKHKR..QEYSVEGLIASLDV...EEKTREKYAASKGD-------------------------------
Q8LN71_ORYSJ/50-167.WSDFATS...LKHNR..QEFSVPDLIGSLGV...EEKARAKDVQGKKV-------------------------------
B7ZXP2_MAIZE/242-358.WKDFATS...LKHKR..QEFNVEELIGTLDV...EERARTKDN.GKGV-------------------------------
Q10LP7_ORYSJ/115-232.WRDFATA...LKHRM..EEMTMDDLVASLDV...EEKARAKDAPLVNE-------------------------------
A5BQ76_VITVI/63-180.WKDFKNY...LKHKH..KEMGLEDLIVRLKI...EEDNHVFEKKVGKH-------------------------------
Q0KIN7_SOLDE/84-201.WKEFQKT...MRHKQ..KETSLETLIMKIRM...EEEARGQDALLQTE-------------------------------
Q7Y173_ORYSJ/18-135.FESFI.....INYNNQRDKCKKKFYQGESSN...SQNKKKKPNTPSTQ-------------------------------
A5B4U1_VITVI/192-309.YGPFK.....ISYNTHKDKWSINELMTMCVQ...EEGSLIYKSECVGN-------------------------------
Q2R404_ORYSJ/102-219.YDPFK.....IKYNTQKEEWTIQELILHSVE...EEERQKAGKQKVKD-------------------------------
A5BQ76_VITVI/411-528.FQQFR.....LNYNMNKMDFTLSKLLNELVA...AQTIIKQGAAPVVL-------------------------------
Q0KIL6_SOLDE/90-207.FQQFC.....LNYNMNKMSLSLAQLLNELQA...AETLVKKASSMALN-------------------------------
Q9SZS9_ARATH/2-131VYHNFLTN........EECEHLISLAKPSMMKSKVVDVKTGKSIDSRFC-------------------------------
B9SXB7_RICCO/3-127VYHNFLTK........EECEYLINLAKPNMQKSTVVDSETGRSKDSRVR-------------------------------

PF03564

A7SE42_NEMVE/491-638--------------------------------------------------------------------------------
Q17051_ASCLU/155-293--------------------------------------------------------------------------------
Q23992_DROME/160-308--------------------------------------------------------------------------------
A7XDH0_DROAN/157-302--------------------------------------------------------------------------------
Q4JS97_ANOGA/133-280--------------------------------------------------------------------------------
Q4EAY5_9RICK/161-306--------------------------------------------------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------------------------------------
F6H7D5_VITVI/16-42--------------------------------------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------------------------------------

PF14893

H0XX29_OTOGA/1-328DTR...VTAR...............................LKLLTCSQQPRESLFAYVMRLEGLLHVAMEQ........
M3Z644_MUSPF/1-327DNP...RELQ...............................IKYLTTYQKDEEKLSAYVLRLEPLLQKLVER........
F7CY48_HORSE/1-330DAQ...MTAR...............................LKFLTCAQRPQEALFAYVMRLEGLLQAALEK........
M4B0W2_XIPMA/1-317ETG...EDLY...............................FTFRQLCQQPNEKLSEFLRRMERVLNKVVKK........
F6TXQ3_HORSE/2-329ESR...RTSQ...............................VKYLKTYQEEGEKVSAYVLRLETLLRRAVEK........
D3Z8Y9_RAT/1-327ENR...KIAQ...............................LKFCKAYQEPGEKVSSFVVRLETLLQKALEK........
M4AZW3_XIPMA/2-318ETG...EELY...............................FAFRMMTQHPAEKLSEFLRRMERVLNKVVQR........
F7AVZ0_XENTR/7-324AST...TEML...............................HNFHSTFQREKEALSAYLVRVEQGLRLLVSR........
PNMA5_HUMAN/1-322EDF...RASQ...............................FRFLQTSPKIGEKVSTFLLRLEPLLQKAVHK........
G1PM76_MYOLU/2-362TRSRRRKQKKSPRQEPVPWKKPTGHHSNSPASSEGPEADD.GENGEVPEYPRSSRKPRAKPEAAAGKKPVEKCPWKAPRH
F7D322_HORSE/1-321EDW...RTSQ...............................FKFLQTFQKTGEKISVFLLRLEPLLQRAVQQ........
G3N1H8_BOVIN/3-317DPR...VTAR...............................LKFMMCAQRPQESLFAFVMRLEGLLQLALGK........
F1S2C6_PIG/1-333DSP...VTAR...............................LRFATCAQRPQETLFAYVMRLEGLLQAAVET........
H2PX42_PONAB/1-327ESH...KIAQ...............................VKLCKAYQEAGEKVSSFVLRLEPLLQRAVEN........
G1LQR5_AILME/1-315DTR...VTAR...............................LKFLTCAQRPRETLFAYVMRLEGLLQSAVEK........
PNMA5_MOUSE/1-323EDS...KVLQ...............................FRFLQSSQKPAEKVSDYLLRLEPLLQKAVQQ........
PNML1_BOVIN/3-358THSRRKRQKKTPKQEPVPWKKSQGSHSHSSASLKHPEADD.GKNRERLEHVRNNKKPCVKQEGSALKKAPVKCAWKFPSN
G3U141_LOXAF/1-317DTR...MTAR...............................LKFLTCAQEPGESLFAYVMRQEGLLQTAMEK........
H0W6U3_CAVPO/1-332DIR...VAAR...............................LKFLICSQWPEETLIAYVTRLEGLLQAAVEK........
H0VWL7_CAVPO/1-322EDA...KTEQ...............................HLFLQMQHKSEEKVSAFLLRLEPLLQKVARQ........
PNML1_PONAB/5-364SRSRRKKQKKNPKQEAVPWKKPKGINSSSTANLEDPEVGD.AESMAISEPIKGSRKPCVKQEELALKKPMAKCAWKGPRE
H0VK73_CAVPO/6-363ARSRRKKQKKTPKQEPVLWKKPKGSHGSSSAYLEGFGVGD.VERMEIREFGKSLRKQ.AEQEEPPLRKPMGTSAWKVPRE
G3U379_LOXAF/1-308DSE...AATR...............................LRCLTAQQRRGERLSAFVLRLEVLLQKAIEK........
M4AZA8_XIPMA/3-326ESG...DDLY...............................FAFRLMQQQSGEKLSDFLRRLERSLSKVVQK........
PN6BL_HUMAN/1-326DTR...MTSR...............................LKFLTCTQGPQEGLFAFVVRLEGLLQRAVEK........
D2GZV4_AILME/1-325ESS...RDAQ...............................VRFLNTYQNPGEKLSAYVIRLEPLLQKVVEK........
F6Z9T2_HORSE/5-364TGSRRKKQKNHPQQEPGPWKKAKGNCSNSSASLEGPEAGD.AENMEISEYIRSKKKPCVKQEESAWKKPVGKCVWKAPSN
PNML1_MOUSE/6-363IRSRRRKQKKNLKQEPICWRKSQGSNYNSNYNKVNLEAGEAAQSSEIPESVKSNKKPFVKQEETVWKK...KRVWRDPSD
F1PIM5_CANFA/1-358NRSRRKKQRKNPKQESVPWKKPKGQHSNSSGSLEDLEADG.AEDMEVSEYIRSKKKPCVKQEESALKKPMAKCAWKAPST
F7H8Z7_CALJA/1-318DTW...VTTR...............................LKFLTCTQGPQEELFAFVVRLEGLLQKAMEK........
PNM6B_HUMAN/1-319ESQ...ATIR...............................VKCLTAQQQSGERLSAFVLRLEVLLQKAMEK........
G3QYD8_GORGO/1-326DNP...RELQ...............................VKYLTTYQKDEEKLSAYVLRLEPLLQKLVQR........
F6WC96_CALJA/1-321EPYPLPPTSR...............................PKYLTAQQQSGQFVLAVALWLE.VLQKAMEK........
Q5BJV6_RAT/1-328DNP...RALQ...............................VRYLTTYQKSGEKLSAYVLRLEPLLQKLVQK........

PF14244

A5AE14_VITVI/10-125--------------------------------------------------------------------------------
A5AFL1_VITVI/24-172--------------------------------------------------------------------------------
A5AL35_VITVI/26-142--------------------------------------------------------------------------------
A5APA9_VITVI/42-180--------------------------------------------------------------------------------
A5AR29_VITVI/23-171--------------------------------------------------------------------------------
A5ARJ9_VITVI/24-165--------------------------------------------------------------------------------
A5ATA8_VITVI/24-171--------------------------------------------------------------------------------
A5AW26_VITVI/23-156--------------------------------------------------------------------------------
A5AXC5_VITVI/8-148--------------------------------------------------------------------------------
A5AZ64_VITVI/47-175--------------------------------------------------------------------------------
A5AZK9_VITVI/143-291--------------------------------------------------------------------------------
A5B0N9_VITVI/37-186--------------------------------------------------------------------------------
A5B3L9_VITVI/16-147--------------------------------------------------------------------------------
A5B8L2_VITVI/15-147--------------------------------------------------------------------------------
A5BAZ3_VITVI/31-163--------------------------------------------------------------------------------
A5BCQ9_VITVI/83-209--------------------------------------------------------------------------------
A5BG06_VITVI/43-189--------------------------------------------------------------------------------
A5BJC0_VITVI/21-165--------------------------------------------------------------------------------
A5BKK0_VITVI/191-331--------------------------------------------------------------------------------
A5BM32_VITVI/27-149--------------------------------------------------------------------------------
A5BN45_VITVI/28-176--------------------------------------------------------------------------------
A5BNR5_VITVI/308-456--------------------------------------------------------------------------------
A5BP26_VITVI/33-181--------------------------------------------------------------------------------
A5BQW4_VITVI/215-363--------------------------------------------------------------------------------
A5BSG2_VITVI/5-152--------------------------------------------------------------------------------
A5BT41_VITVI/40-187--------------------------------------------------------------------------------
A5BVQ3_VITVI/17-164--------------------------------------------------------------------------------
A5BWZ5_VITVI/42-189--------------------------------------------------------------------------------
A5BXA9_VITVI/396-529--------------------------------------------------------------------------------
A5C3H8_VITVI/42-155--------------------------------------------------------------------------------
A5C4L4_VITVI/24-140--------------------------------------------------------------------------------
A5C4S3_VITVI/27-177--------------------------------------------------------------------------------
A5C9I0_VITVI/13-150--------------------------------------------------------------------------------
B9SLN1_RICCO/35-176--------------------------------------------------------------------------------
O22175_ARATH/27-174--------------------------------------------------------------------------------
O23588_ARATH/73-209--------------------------------------------------------------------------------
Q0PY40_SOLLC/17-166--------------------------------------------------------------------------------
Q2HT49_MEDTR/20-168--------------------------------------------------------------------------------
Q2HU07_MEDTR/24-172--------------------------------------------------------------------------------
Q6L4J8_SOLDE/13-160--------------------------------------------------------------------------------
Q9FIC5_ARATH/29-177--------------------------------------------------------------------------------
Q9LGZ8_ARATH/19-166--------------------------------------------------------------------------------
Q9M0P5_ARATH/20-169--------------------------------------------------------------------------------
Q9XIM3_ARATH/23-161--------------------------------------------------------------------------------
Q9ZPU4_ARATH/37-185--------------------------------------------------------------------------------

PF16297

H0W794_CAVPO/2-110--------------------------------------------------------------------------------
D3ZTE6_RAT/24-138--------------------------------------------------------------------------------
G1MLQ7_AILME/2-114--------------------------------------------------------------------------------
F7ASC6_CALJA/2-113--------------------------------------------------------------------------------
Q9D6I0_MOUSE/2-112--------------------------------------------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204--------------------------------------------------------------------------------
A5BQ76_VITVI/412-525--------------------------------------------------------------------------------
A5AHT8_VITVI/92-205--------------------------------------------------------------------------------
B8BH64_ORYSI/219-332--------------------------------------------------------------------------------
A5BI38_VITVI/288-401--------------------------------------------------------------------------------
A5ANU6_VITVI/96-209--------------------------------------------------------------------------------
A5B8Q0_VITVI/530-643--------------------------------------------------------------------------------
A5AQ94_VITVI/79-192--------------------------------------------------------------------------------
Q18L98_CITSI/81-195--------------------------------------------------------------------------------
Q1KUM3_9ROSI/118-231--------------------------------------------------------------------------------
Q7XTM9_ORYSJ/78-191--------------------------------------------------------------------------------
Q01M93_ORYSA/78-191--------------------------------------------------------------------------------
A5AS33_VITVI/79-194--------------------------------------------------------------------------------
Q2AA06_ASPOF/860-974--------------------------------------------------------------------------------
Q6XMP8_AEDAL/82-196--------------------------------------------------------------------------------
D2A543_TRICA/77-191--------------------------------------------------------------------------------
Q9U6V8_DROWI/75-189--------------------------------------------------------------------------------
A5BIJ4_VITVI/84-197--------------------------------------------------------------------------------
Q0ZCD8_POPTR/118-230--------------------------------------------------------------------------------
A5B6L3_VITVI/126-238--------------------------------------------------------------------------------
A5BYA6_VITVI/62-174--------------------------------------------------------------------------------
A5BK17_VITVI/103-215--------------------------------------------------------------------------------
A5CAE5_VITVI/64-176--------------------------------------------------------------------------------
A5BJ70_VITVI/81-193--------------------------------------------------------------------------------
A5BFR8_VITVI/115-227--------------------------------------------------------------------------------
Q9SV56_ARATH/103-217--------------------------------------------------------------------------------
Q9SSB1_ARATH/101-216--------------------------------------------------------------------------------
D1GEF6_BRARP/107-222--------------------------------------------------------------------------------
C0SQ79_PYRYE/115-228--------------------------------------------------------------------------------
A5B3I2_VITVI/89-207--------------------------------------------------------------------------------
A5B8H9_VITVI/153-271--------------------------------------------------------------------------------
A5BGM4_VITVI/89-207--------------------------------------------------------------------------------
Q9M1C6_ARATH/91-209--------------------------------------------------------------------------------
A5BYF7_VITVI/162-280--------------------------------------------------------------------------------
A5BY31_VITVI/28-146--------------------------------------------------------------------------------
A5BFQ9_VITVI/28-146--------------------------------------------------------------------------------
Q9C7Y1_ARATH/87-205--------------------------------------------------------------------------------
A5AMT2_VITVI/80-198--------------------------------------------------------------------------------
Q2QXM6_ORYSJ/85-203--------------------------------------------------------------------------------
Q6L3N8_SOLDE/84-202--------------------------------------------------------------------------------
A6YTD9_CUCME/91-209--------------------------------------------------------------------------------
Q9M2D1_ARATH/89-207--------------------------------------------------------------------------------
A5BLB0_VITVI/283-400--------------------------------------------------------------------------------
Q9LH44_ARATH/87-205--------------------------------------------------------------------------------
Q9ZQE9_ARATH/91-209--------------------------------------------------------------------------------
A5B9M8_VITVI/90-208--------------------------------------------------------------------------------
A5BRD1_VITVI/91-209--------------------------------------------------------------------------------
A5B779_VITVI/91-209--------------------------------------------------------------------------------
Q9SEL2_VITVI/89-207--------------------------------------------------------------------------------
A5BFD6_VITVI/89-207--------------------------------------------------------------------------------
A5BRW6_VITVI/90-208--------------------------------------------------------------------------------
Q6L3X6_SOLDE/202-320--------------------------------------------------------------------------------
A5ACV7_VITVI/90-208--------------------------------------------------------------------------------
Q6L3Y5_SOLDE/89-207--------------------------------------------------------------------------------
Q60EG1_ORYSJ/85-201--------------------------------------------------------------------------------
C6JSM1_SORBI/92-210--------------------------------------------------------------------------------
B6TPM7_MAIZE/94-212--------------------------------------------------------------------------------
Q9SHT5_ARATH/47-166--------------------------------------------------------------------------------
Q9ZUF2_ARATH/41-160--------------------------------------------------------------------------------
Q4ABY7_BRACM/83-202--------------------------------------------------------------------------------
Q9LQK3_ARATH/80-199--------------------------------------------------------------------------------
Q9SKV6_ARATH/80-199--------------------------------------------------------------------------------
Q9LE43_ARATH/83-202--------------------------------------------------------------------------------
B6REL9_9BRAS/81-200--------------------------------------------------------------------------------
B6REL1_9BRAS/60-179--------------------------------------------------------------------------------
Q7F814_ORYSJ/95-213--------------------------------------------------------------------------------
B8BA29_ORYSI/100-218--------------------------------------------------------------------------------
D3IVE4_9POAL/219-337--------------------------------------------------------------------------------
Q7X7K3_ORYSJ/176-294--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/115-233--------------------------------------------------------------------------------
Q7XH44_ORYSJ/165-269--------------------------------------------------------------------------------
Q2QYR6_ORYSJ/52-170--------------------------------------------------------------------------------
Q5TKD7_ORYSJ/109-227--------------------------------------------------------------------------------
Q7XTU6_ORYSJ/114-232--------------------------------------------------------------------------------
Q8LMZ0_ORYSJ/135-253--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/110-228--------------------------------------------------------------------------------
Q53P77_ORYSJ/86-204--------------------------------------------------------------------------------
Q2QZL2_ORYSJ/49-167--------------------------------------------------------------------------------
Q7XWP2_ORYSJ/116-231--------------------------------------------------------------------------------
Q10C26_ORYSJ/22-139--------------------------------------------------------------------------------
Q7XUD9_ORYSJ/115-233--------------------------------------------------------------------------------
Q25AF6_ORYSA/117-235--------------------------------------------------------------------------------
C1IJC5_HORVU/114-232--------------------------------------------------------------------------------
C5Y7F6_SORBI/35-153--------------------------------------------------------------------------------
Q94I41_ORYSJ/94-212--------------------------------------------------------------------------------
C5XUK3_SORBI/218-337--------------------------------------------------------------------------------
C5XQM0_SORBI/100-219--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/569-688--------------------------------------------------------------------------------
Q2QWI2_ORYSJ/47-166--------------------------------------------------------------------------------
C5Z583_SORBI/100-218--------------------------------------------------------------------------------
C5WNA6_SORBI/224-342--------------------------------------------------------------------------------
D3IVP8_9POAL/630-749--------------------------------------------------------------------------------
D3IVT7_9POAL/58-177--------------------------------------------------------------------------------
D3IVI1_9POAL/86-205--------------------------------------------------------------------------------
Q10PG0_ORYSJ/85-204--------------------------------------------------------------------------------
D3IVI3_9POAL/99-218--------------------------------------------------------------------------------
Q5H9X1_ORYSJ/112-231--------------------------------------------------------------------------------
Q10NE5_ORYSJ/129-248--------------------------------------------------------------------------------
C5WYF6_SORBI/63-181--------------------------------------------------------------------------------
Q8S467_MAIZE/138-257--------------------------------------------------------------------------------
Q8H6I4_MAIZE/204-323--------------------------------------------------------------------------------
Q33BC8_ORYSJ/86-203--------------------------------------------------------------------------------
A2Q5V3_MEDTR/101-218--------------------------------------------------------------------------------
O65147_SOYBN/76-194--------------------------------------------------------------------------------
A5BZ48_VITVI/103-221--------------------------------------------------------------------------------
Q9XEB1_ARATH/433-551--------------------------------------------------------------------------------
Q9FG84_ARATH/101-219--------------------------------------------------------------------------------
Q9ZV83_ARATH/82-200--------------------------------------------------------------------------------
A2I5F8_BETVU/104-223--------------------------------------------------------------------------------
A5BW11_VITVI/73-191--------------------------------------------------------------------------------
Q1S5J6_MEDTR/118-236--------------------------------------------------------------------------------
Q9FJT0_ARATH/33-146--------------------------------------------------------------------------------
Q9LJD1_ARATH/93-210--------------------------------------------------------------------------------
Q9LJD1_ARATH/509-622--------------------------------------------------------------------------------
Q9LJC8_ARATH/91-202--------------------------------------------------------------------------------
Q9LJC9_ARATH/91-203--------------------------------------------------------------------------------
A9TSN8_PHYPA/23-136--------------------------------------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------------------------------------------------------------
PEG10_MOUSE/174-267--------------------------------------------------------------------------------
Q9AUY8_ARATH/31-127--------------------------------------------------------------------------------
Q9FWC7_ORYSJ/155-249--------------------------------------------------------------------------------
Q9FE41_ORYSJ/775-871--------------------------------------------------------------------------------
Q9LP90_ARATH/163-253--------------------------------------------------------------------------------
Q9LMV1_ARATH/257-344--------------------------------------------------------------------------------
Q9ARZ4_ORYSJ/100-192--------------------------------------------------------------------------------
Q9FYC9_ARATH/102-194--------------------------------------------------------------------------------
Q9SK57_ARATH/214-310--------------------------------------------------------------------------------
Q9FRJ2_ORYSJ/81-182--------------------------------------------------------------------------------
Q9AV68_ORYSJ/351-443--------------------------------------------------------------------------------
Q9AYB5_ORYSJ/567-664--------------------------------------------------------------------------------
O23529_ARATH/90-186--------------------------------------------------------------------------------
O82608_ARATH/272-360--------------------------------------------------------------------------------
Q9AYC2_ORYSJ/729-826--------------------------------------------------------------------------------
Q9FGL3_ARATH/131-241--------------------------------------------------------------------------------
Q9SQW9_ARATH/264-354--------------------------------------------------------------------------------
Q9LNM2_ARATH/83-178--------------------------------------------------------------------------------
Q9AYB6_ORYSJ/694-791--------------------------------------------------------------------------------
Q9XE67_SORBI/155-252--------------------------------------------------------------------------------
O49369_ARATH/139-231--------------------------------------------------------------------------------
Q9ZPF9_ARATH/97-196--------------------------------------------------------------------------------
Q9XII7_ARATH/126-236--------------------------------------------------------------------------------
Q9SIM3_ARATH/131-240--------------------------------------------------------------------------------
Q9MA68_ARATH/89-183--------------------------------------------------------------------------------
Q9M225_ARATH/186-282--------------------------------------------------------------------------------
Q96467_HORVU/82-176--------------------------------------------------------------------------------
Q9AXC5_ANTHI/295-388--------------------------------------------------------------------------------
Q9M0T9_ARATH/89-183--------------------------------------------------------------------------------
Q9SY43_ARATH/188-284--------------------------------------------------------------------------------
Q9C7H8_ARATH/150-242--------------------------------------------------------------------------------
Q9ZNW4_SORBI/210-302--------------------------------------------------------------------------------
Q9SUN0_ARATH/223-313--------------------------------------------------------------------------------
Q9M252_ARATH/163-260--------------------------------------------------------------------------------
O93283_TAKRU/149-242--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/198-290--------------------------------------------------------------------------------
Q9ATX2_MAIZE/179-271--------------------------------------------------------------------------------
O81471_ARATH/148-242--------------------------------------------------------------------------------
Q9FW76_ORYSJ/181-275--------------------------------------------------------------------------------
Q9SKF2_ARATH/107-197--------------------------------------------------------------------------------
Q9SYE8_ARATH/131-230--------------------------------------------------------------------------------
Q98SV9_TAKRU/117-207--------------------------------------------------------------------------------
Q9SJP0_ARATH/291-382--------------------------------------------------------------------------------
Q9XE85_SORBI/114-212--------------------------------------------------------------------------------
Q9ZS84_SOLLC/150-247--------------------------------------------------------------------------------
O48967_MAIZE/245-337--------------------------------------------------------------------------------
Q9LZG5_ARATH/148-244--------------------------------------------------------------------------------
Q9SX87_ARATH/132-224--------------------------------------------------------------------------------
Q9LQH2_ARATH/476-575--------------------------------------------------------------------------------
Q9FZN9_ARATH/121-215--------------------------------------------------------------------------------
Q9SLQ0_ORYSI/194-290--------------------------------------------------------------------------------
Q9UVC2_PASFU/52-153--------------------------------------------------------------------------------
Q9ZPG6_ARATH/97-191--------------------------------------------------------------------------------
Q9ZUK1_ARATH/211-302--------------------------------------------------------------------------------
Q9FWB1_ARATH/104-198--------------------------------------------------------------------------------
Q9HFY8_COLGL/148-252--------------------------------------------------------------------------------

PF14227

A5BY76_VITVI/104-226--------------------------------------------------------------------------------
A5B9Z7_VITVI/12-134--------------------------------------------------------------------------------
A5BSC1_VITVI/688-789--------------------------------------------------------------------------------
A5BWL8_VITVI/342-448--------------------------------------------------------------------------------
A5BLR1_VITVI/94-215--------------------------------------------------------------------------------
A5BLB0_VITVI/282-404--------------------------------------------------------------------------------
Q9LJC9_ARATH/90-212--------------------------------------------------------------------------------
Q5AT23_EMENI/392-511--------------------------------------------------------------------------------
D3IVP8_9POAL/629-752--------------------------------------------------------------------------------
COPIA_DROME/74-192--------------------------------------------------------------------------------
D2A543_TRICA/76-194--------------------------------------------------------------------------------
O96968_BOMMO/78-193--------------------------------------------------------------------------------
Q6XMP8_AEDAL/81-199--------------------------------------------------------------------------------
B0X5G3_CULQU/101-222--------------------------------------------------------------------------------
Q967L5_AEDAE/76-197--------------------------------------------------------------------------------
Q8WRX6_ANOGA/74-195--------------------------------------------------------------------------------
B2CN78_DAPPU/42-160--------------------------------------------------------------------------------
A9RF54_PHYPA/34-146--------------------------------------------------------------------------------
Q8H023_ORYSJ/210-330--------------------------------------------------------------------------------
Q7XSZ1_ORYSJ/103-219--------------------------------------------------------------------------------
Q7XLX2_ORYSJ/160-253--------------------------------------------------------------------------------
A5BPQ9_VITVI/512-624--------------------------------------------------------------------------------
A5B864_VITVI/32-156--------------------------------------------------------------------------------
Q9AU17_SOLCI/79-196--------------------------------------------------------------------------------
B1N668_SOLLC/75-192--------------------------------------------------------------------------------
Q2AA06_ASPOF/859-977--------------------------------------------------------------------------------
Q69FA7_PHAVU/58-175--------------------------------------------------------------------------------
Q6BCY1_IPOBA/74-193--------------------------------------------------------------------------------
B8YLY5_MEDTR/73-192--------------------------------------------------------------------------------
Q25A78_ORYSA/77-175--------------------------------------------------------------------------------
Q53QA4_ORYSJ/75-188--------------------------------------------------------------------------------
Q94LG0_ORYSJ/79-192--------------------------------------------------------------------------------
Q01MJ3_ORYSA/27-111--------------------------------------------------------------------------------
A5BQQ6_VITVI/23-136--------------------------------------------------------------------------------
A5BPL2_VITVI/25-141--------------------------------------------------------------------------------
Q9SJT2_ARATH/93-212--------------------------------------------------------------------------------
Q9SH77_ARATH/93-212--------------------------------------------------------------------------------
Q9FFM0_ARATH/98-215--------------------------------------------------------------------------------
Q9LS18_ARATH/107-224--------------------------------------------------------------------------------
Q9ZQE4_ARATH/102-211--------------------------------------------------------------------------------
Q9LJS6_ARATH/105-202--------------------------------------------------------------------------------
O81903_ARATH/103-220--------------------------------------------------------------------------------
Q9SHR5_ARATH/101-218--------------------------------------------------------------------------------
Q9LVY5_ARATH/105-222--------------------------------------------------------------------------------
Q02900_ARATH/97-214--------------------------------------------------------------------------------
O82196_ARATH/63-180--------------------------------------------------------------------------------
Q9ZPU5_ARATH/68-187--------------------------------------------------------------------------------
Q1KUM3_9ROSI/117-234--------------------------------------------------------------------------------
A5AR03_VITVI/133-256--------------------------------------------------------------------------------
A5ARG5_VITVI/22-139--------------------------------------------------------------------------------
Q9M3C1_ARATH/26-145--------------------------------------------------------------------------------
A5AJF1_VITVI/465-574--------------------------------------------------------------------------------
A5BLL6_VITVI/78-195--------------------------------------------------------------------------------
A5BYU4_VITVI/59-176--------------------------------------------------------------------------------
A5BPE6_VITVI/78-195--------------------------------------------------------------------------------
Q18L98_CITSI/80-198--------------------------------------------------------------------------------
A5B6C0_VITVI/29-150--------------------------------------------------------------------------------
A5AYK3_VITVI/32-152--------------------------------------------------------------------------------
A5B8Q0_VITVI/529-644--------------------------------------------------------------------------------
Q2AA73_ASPOF/71-191--------------------------------------------------------------------------------
A5AM57_VITVI/98-215--------------------------------------------------------------------------------
A5C6J6_VITVI/77-184--------------------------------------------------------------------------------
A5AQ94_VITVI/78-195--------------------------------------------------------------------------------
A5AKU3_VITVI/615-723--------------------------------------------------------------------------------
C6GFP7_FRAAN/52-171--------------------------------------------------------------------------------
A5C6L3_VITVI/78-195--------------------------------------------------------------------------------
A5BCL0_VITVI/55-172--------------------------------------------------------------------------------
A5AL15_VITVI/39-145--------------------------------------------------------------------------------
Q6RZV5_MUSAC/23-145--------------------------------------------------------------------------------
Q9ZRJ0_TOBAC/76-193--------------------------------------------------------------------------------
Q5MG99_IPOBA/76-193--------------------------------------------------------------------------------
A5AJF5_VITVI/76-192--------------------------------------------------------------------------------
A5BEP3_VITVI/54-180--------------------------------------------------------------------------------
B3N452_DROER/17-137--------------------------------------------------------------------------------
B4N7F3_DROWI/52-172--------------------------------------------------------------------------------
B6V6Z8_DROME/78-198--------------------------------------------------------------------------------
B4NQE5_DROWI/78-198--------------------------------------------------------------------------------
Q45W64_PHACR/80-192--------------------------------------------------------------------------------
Q5JMV2_ORYSJ/12-126--------------------------------------------------------------------------------
A5CA63_VITVI/149-269--------------------------------------------------------------------------------
Q8W5F6_ORYSJ/80-197--------------------------------------------------------------------------------
Q8LN71_ORYSJ/50-167--------------------------------------------------------------------------------
B7ZXP2_MAIZE/242-358--------------------------------------------------------------------------------
Q10LP7_ORYSJ/115-232--------------------------------------------------------------------------------
A5BQ76_VITVI/63-180--------------------------------------------------------------------------------
Q0KIN7_SOLDE/84-201--------------------------------------------------------------------------------
Q7Y173_ORYSJ/18-135--------------------------------------------------------------------------------
A5B4U1_VITVI/192-309--------------------------------------------------------------------------------
Q2R404_ORYSJ/102-219--------------------------------------------------------------------------------
A5BQ76_VITVI/411-528--------------------------------------------------------------------------------
Q0KIL6_SOLDE/90-207--------------------------------------------------------------------------------
Q9SZS9_ARATH/2-131--------------------------------------------------------------------------------
B9SXB7_RICCO/3-127--------------------------------------------------------------------------------

PF03564

A7SE42_NEMVE/491-638--------------------------------------------------
Q17051_ASCLU/155-293--------------------------------------------------
Q23992_DROME/160-308--------------------------------------------------
A7XDH0_DROAN/157-302--------------------------------------------------
Q4JS97_ANOGA/133-280--------------------------------------------------
Q4EAY5_9RICK/161-306--------------------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------
F6H7D5_VITVI/16-42--------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------

PF14893

H0XX29_OTOGA/1-328...GAVHPAMADQMRAGQVLLQARPNATLQDKLRRMWLERQL.PGFLGLL
M3Z644_MUSPF/1-327...GVIEKDVVNQARLDQILAGA.VCRTLRRKLAL..PQGGPAPGLLQLL
F7CY48_HORSE/1-330...GAIRPAIADQLRARQVLMGARPNETLENKLRRMRLERRP.PGFLGML
M4B0W2_XIPMA/1-317...GGLQSATANQARIDQLIKGGTRSDLMMLNLRLRERRQNP.PPFLQLL
F6TXQ3_HORSE/2-329...RAIPRNIADQVRLEQVMAGASLSEILWCRLRELKDQGPP.PSFLELM
D3Z8Y9_RAT/1-327...NAISRKNVNQTRLKRILGGAILSAKLREKLKMLKQRRRP.PGFLALV
M4AZW3_XIPMA/2-318...GGLPPLSKDKARIEQLIKGATRSDMMMLSLRLRERRSSP.PAFLELL
F7AVZ0_XENTR/7-324...GVIQSSEMDSLRIRQMRRGTLNSDPVAVTIRAYYQETLT.PGYVALM
PNMA5_HUMAN/1-322...SPLSVRSTDMIRLKHLLARVAMTPALRGKLELLDQRGCP.PNFLELM
G1PM76_MYOLU/2-362APQDARAEAAGPEVASESDQDDGPEEPPKKKAMGWASAKS...PGCMRR.
F7D322_HORSE/1-321...SPFSMHSTDMIRLKHILARASMTTTLRGKLEILDQRGHP.PTFLELV
G3N1H8_BOVIN/3-317...GAVHPAIADQLRARQVLMRARPNNLMQNKLKRMRMERRP.PSFVAML
F1S2C6_PIG/1-333...EAIHPATADQARARQVLMRARPNDTLQTKLRRLRLERRP.PGFVGLL
H2PX42_PONAB/1-327...NVVSRRNVNQTRLKRVLSGATLPDKLRDKLKLMKQRRKP.PGFLALV
G1LQR5_AILME/1-315...GAFHPVIADQVRARQVLMRARPNEMLQNKLRRMRLERRP.PGFVGML
PNMA5_MOUSE/1-323...SPLSAHSADSIRLKHVLSQVSMTTGLRGKLSLLDQQGCP.PTFLELM
PNML1_BOVIN/3-358LPH....VAASRGVASESDQDGGLEGPPKKKAMGWVSAKS...PAYMRKK
G3U141_LOXAF/1-317...GAVHPAIADQVRARQVLMRAHPNPTLYNKLRRMRVEGRP.PGFVGLL
H0W6U3_CAVPO/1-332...GAIHPATADQMRARQVLMRARPNWTLQKRLRRMRLERRP.PGFQALL
H0VWL7_CAVPO/1-322...SPFRVQGTDMVRLKHVLAQASVTGALRGKLELLEQQGCP.PSFLELV
PNML1_PONAB/5-364PPQDAQAEAESPGGASESDQDGGHESPPKKKAMAWVSAKN...PAPMRKK
H0VK73_CAVPO/6-363PSPDTLGGAESPEGTSKSDQGGGQGRPLKKKATGWASGKS...LGPVRKK
G3U379_LOXAF/1-308...GALARASADHLRLRQVLTKATLVEPLDEALRKLRLVGRA.PSFLEML
M4AZA8_XIPMA/3-326...DGLPASSMNKARIEQLLKGAVGSDLMLIQLRLRERKGNP.PTFLELL
PN6BL_HUMAN/1-326...GAVCPALANYLRLQQVLSWARPSEALQDTLRGMQLEKRP.PGFLGLL
D2GZV4_AILME/1-325...GAIDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAAEGPAPNLFQLL
F6Z9T2_HORSE/5-364PPPGARSAAASPGVASESEQAGGREGPPKKKAVGWASAKR...PAPTKKN
PNML1_MOUSE/6-363LPRSALPAADSPGNLEDSDQDGGPENPAKKKAMTWASNKI...PVPTRKK
F1PIM5_CANFA/1-358PSHDPPSEAVSPGVALESDQDGGQEGPPKKKAMSWALAKS...SAPMRKK
F7H8Z7_CALJA/1-318...GAFHPAMANHFRLRQVLSRARPSEALQDTLKQMQLDRRP.PGFLRLL
PNM6B_HUMAN/1-319...EALARASADRVRLRQMLTRAHLTEPLDEALRKLRMAGRS.PSFLEML
G3QYD8_GORGO/1-326...GAIERDAVNQARLDQVIAGA.VHKTIRRELNL..PEDGPAPGFLQLL
F6WC96_CALJA/1-321...WALARASADCVSLRRMLTRANLTEPLDEALRKL.MGGRS.PSFLEML
Q5BJV6_RAT/1-328...GAIEKEVVNQARLDQVIAGA.IHKSVRRELGL..PEGSPAPGLLQLL

PF14244

A5AE14_VITVI/10-125--------------------------------------------------
A5AFL1_VITVI/24-172--------------------------------------------------
A5AL35_VITVI/26-142--------------------------------------------------
A5APA9_VITVI/42-180--------------------------------------------------
A5AR29_VITVI/23-171--------------------------------------------------
A5ARJ9_VITVI/24-165--------------------------------------------------
A5ATA8_VITVI/24-171--------------------------------------------------
A5AW26_VITVI/23-156--------------------------------------------------
A5AXC5_VITVI/8-148--------------------------------------------------
A5AZ64_VITVI/47-175--------------------------------------------------
A5AZK9_VITVI/143-291--------------------------------------------------
A5B0N9_VITVI/37-186--------------------------------------------------
A5B3L9_VITVI/16-147--------------------------------------------------
A5B8L2_VITVI/15-147--------------------------------------------------
A5BAZ3_VITVI/31-163--------------------------------------------------
A5BCQ9_VITVI/83-209--------------------------------------------------
A5BG06_VITVI/43-189--------------------------------------------------
A5BJC0_VITVI/21-165--------------------------------------------------
A5BKK0_VITVI/191-331--------------------------------------------------
A5BM32_VITVI/27-149--------------------------------------------------
A5BN45_VITVI/28-176--------------------------------------------------
A5BNR5_VITVI/308-456--------------------------------------------------
A5BP26_VITVI/33-181--------------------------------------------------
A5BQW4_VITVI/215-363--------------------------------------------------
A5BSG2_VITVI/5-152--------------------------------------------------
A5BT41_VITVI/40-187--------------------------------------------------
A5BVQ3_VITVI/17-164--------------------------------------------------
A5BWZ5_VITVI/42-189--------------------------------------------------
A5BXA9_VITVI/396-529--------------------------------------------------
A5C3H8_VITVI/42-155--------------------------------------------------
A5C4L4_VITVI/24-140--------------------------------------------------
A5C4S3_VITVI/27-177--------------------------------------------------
A5C9I0_VITVI/13-150--------------------------------------------------
B9SLN1_RICCO/35-176--------------------------------------------------
O22175_ARATH/27-174--------------------------------------------------
O23588_ARATH/73-209--------------------------------------------------
Q0PY40_SOLLC/17-166--------------------------------------------------
Q2HT49_MEDTR/20-168--------------------------------------------------
Q2HU07_MEDTR/24-172--------------------------------------------------
Q6L4J8_SOLDE/13-160--------------------------------------------------
Q9FIC5_ARATH/29-177--------------------------------------------------
Q9LGZ8_ARATH/19-166--------------------------------------------------
Q9M0P5_ARATH/20-169--------------------------------------------------
Q9XIM3_ARATH/23-161--------------------------------------------------
Q9ZPU4_ARATH/37-185--------------------------------------------------

PF16297

H0W794_CAVPO/2-110--------------------------------------------------
D3ZTE6_RAT/24-138--------------------------------------------------
G1MLQ7_AILME/2-114--------------------------------------------------
F7ASC6_CALJA/2-113--------------------------------------------------
Q9D6I0_MOUSE/2-112--------------------------------------------------

PF14223

Q0KIL6_SOLDE/91-204--------------------------------------------------
A5BQ76_VITVI/412-525--------------------------------------------------
A5AHT8_VITVI/92-205--------------------------------------------------
B8BH64_ORYSI/219-332--------------------------------------------------
A5BI38_VITVI/288-401--------------------------------------------------
A5ANU6_VITVI/96-209--------------------------------------------------
A5B8Q0_VITVI/530-643--------------------------------------------------
A5AQ94_VITVI/79-192--------------------------------------------------
Q18L98_CITSI/81-195--------------------------------------------------
Q1KUM3_9ROSI/118-231--------------------------------------------------
Q7XTM9_ORYSJ/78-191--------------------------------------------------
Q01M93_ORYSA/78-191--------------------------------------------------
A5AS33_VITVI/79-194--------------------------------------------------
Q2AA06_ASPOF/860-974--------------------------------------------------
Q6XMP8_AEDAL/82-196--------------------------------------------------
D2A543_TRICA/77-191--------------------------------------------------
Q9U6V8_DROWI/75-189--------------------------------------------------
A5BIJ4_VITVI/84-197--------------------------------------------------
Q0ZCD8_POPTR/118-230--------------------------------------------------
A5B6L3_VITVI/126-238--------------------------------------------------
A5BYA6_VITVI/62-174--------------------------------------------------
A5BK17_VITVI/103-215--------------------------------------------------
A5CAE5_VITVI/64-176--------------------------------------------------
A5BJ70_VITVI/81-193--------------------------------------------------
A5BFR8_VITVI/115-227--------------------------------------------------
Q9SV56_ARATH/103-217--------------------------------------------------
Q9SSB1_ARATH/101-216--------------------------------------------------
D1GEF6_BRARP/107-222--------------------------------------------------
C0SQ79_PYRYE/115-228--------------------------------------------------
A5B3I2_VITVI/89-207--------------------------------------------------
A5B8H9_VITVI/153-271--------------------------------------------------
A5BGM4_VITVI/89-207--------------------------------------------------
Q9M1C6_ARATH/91-209--------------------------------------------------
A5BYF7_VITVI/162-280--------------------------------------------------
A5BY31_VITVI/28-146--------------------------------------------------
A5BFQ9_VITVI/28-146--------------------------------------------------
Q9C7Y1_ARATH/87-205--------------------------------------------------
A5AMT2_VITVI/80-198--------------------------------------------------
Q2QXM6_ORYSJ/85-203--------------------------------------------------
Q6L3N8_SOLDE/84-202--------------------------------------------------
A6YTD9_CUCME/91-209--------------------------------------------------
Q9M2D1_ARATH/89-207--------------------------------------------------
A5BLB0_VITVI/283-400--------------------------------------------------
Q9LH44_ARATH/87-205--------------------------------------------------
Q9ZQE9_ARATH/91-209--------------------------------------------------
A5B9M8_VITVI/90-208--------------------------------------------------
A5BRD1_VITVI/91-209--------------------------------------------------
A5B779_VITVI/91-209--------------------------------------------------
Q9SEL2_VITVI/89-207--------------------------------------------------
A5BFD6_VITVI/89-207--------------------------------------------------
A5BRW6_VITVI/90-208--------------------------------------------------
Q6L3X6_SOLDE/202-320--------------------------------------------------
A5ACV7_VITVI/90-208--------------------------------------------------
Q6L3Y5_SOLDE/89-207--------------------------------------------------
Q60EG1_ORYSJ/85-201--------------------------------------------------
C6JSM1_SORBI/92-210--------------------------------------------------
B6TPM7_MAIZE/94-212--------------------------------------------------
Q9SHT5_ARATH/47-166--------------------------------------------------
Q9ZUF2_ARATH/41-160--------------------------------------------------
Q4ABY7_BRACM/83-202--------------------------------------------------
Q9LQK3_ARATH/80-199--------------------------------------------------
Q9SKV6_ARATH/80-199--------------------------------------------------
Q9LE43_ARATH/83-202--------------------------------------------------
B6REL9_9BRAS/81-200--------------------------------------------------
B6REL1_9BRAS/60-179--------------------------------------------------
Q7F814_ORYSJ/95-213--------------------------------------------------
B8BA29_ORYSI/100-218--------------------------------------------------
D3IVE4_9POAL/219-337--------------------------------------------------
Q7X7K3_ORYSJ/176-294--------------------------------------------------
Q0J5Y3_ORYSJ/115-233--------------------------------------------------
Q7XH44_ORYSJ/165-269--------------------------------------------------
Q2QYR6_ORYSJ/52-170--------------------------------------------------
Q5TKD7_ORYSJ/109-227--------------------------------------------------
Q7XTU6_ORYSJ/114-232--------------------------------------------------
Q8LMZ0_ORYSJ/135-253--------------------------------------------------
Q7G5Z8_ORYSJ/110-228--------------------------------------------------
Q53P77_ORYSJ/86-204--------------------------------------------------
Q2QZL2_ORYSJ/49-167--------------------------------------------------
Q7XWP2_ORYSJ/116-231--------------------------------------------------
Q10C26_ORYSJ/22-139--------------------------------------------------
Q7XUD9_ORYSJ/115-233--------------------------------------------------
Q25AF6_ORYSA/117-235--------------------------------------------------
C1IJC5_HORVU/114-232--------------------------------------------------
C5Y7F6_SORBI/35-153--------------------------------------------------
Q94I41_ORYSJ/94-212--------------------------------------------------
C5XUK3_SORBI/218-337--------------------------------------------------
C5XQM0_SORBI/100-219--------------------------------------------------
Q9AUM6_ORYSJ/569-688--------------------------------------------------
Q2QWI2_ORYSJ/47-166--------------------------------------------------
C5Z583_SORBI/100-218--------------------------------------------------
C5WNA6_SORBI/224-342--------------------------------------------------
D3IVP8_9POAL/630-749--------------------------------------------------
D3IVT7_9POAL/58-177--------------------------------------------------
D3IVI1_9POAL/86-205--------------------------------------------------
Q10PG0_ORYSJ/85-204--------------------------------------------------
D3IVI3_9POAL/99-218--------------------------------------------------
Q5H9X1_ORYSJ/112-231--------------------------------------------------
Q10NE5_ORYSJ/129-248--------------------------------------------------
C5WYF6_SORBI/63-181--------------------------------------------------
Q8S467_MAIZE/138-257--------------------------------------------------
Q8H6I4_MAIZE/204-323--------------------------------------------------
Q33BC8_ORYSJ/86-203--------------------------------------------------
A2Q5V3_MEDTR/101-218--------------------------------------------------
O65147_SOYBN/76-194--------------------------------------------------
A5BZ48_VITVI/103-221--------------------------------------------------
Q9XEB1_ARATH/433-551--------------------------------------------------
Q9FG84_ARATH/101-219--------------------------------------------------
Q9ZV83_ARATH/82-200--------------------------------------------------
A2I5F8_BETVU/104-223--------------------------------------------------
A5BW11_VITVI/73-191--------------------------------------------------
Q1S5J6_MEDTR/118-236--------------------------------------------------
Q9FJT0_ARATH/33-146--------------------------------------------------
Q9LJD1_ARATH/93-210--------------------------------------------------
Q9LJD1_ARATH/509-622--------------------------------------------------
Q9LJC8_ARATH/91-202--------------------------------------------------
Q9LJC9_ARATH/91-203--------------------------------------------------
A9TSN8_PHYPA/23-136--------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------------------------------
PEG10_MOUSE/174-267--------------------------------------------------
Q9AUY8_ARATH/31-127--------------------------------------------------
Q9FWC7_ORYSJ/155-249--------------------------------------------------
Q9FE41_ORYSJ/775-871--------------------------------------------------
Q9LP90_ARATH/163-253--------------------------------------------------
Q9LMV1_ARATH/257-344--------------------------------------------------
Q9ARZ4_ORYSJ/100-192--------------------------------------------------
Q9FYC9_ARATH/102-194--------------------------------------------------
Q9SK57_ARATH/214-310--------------------------------------------------
Q9FRJ2_ORYSJ/81-182--------------------------------------------------
Q9AV68_ORYSJ/351-443--------------------------------------------------
Q9AYB5_ORYSJ/567-664--------------------------------------------------
O23529_ARATH/90-186--------------------------------------------------
O82608_ARATH/272-360--------------------------------------------------
Q9AYC2_ORYSJ/729-826--------------------------------------------------
Q9FGL3_ARATH/131-241--------------------------------------------------
Q9SQW9_ARATH/264-354--------------------------------------------------
Q9LNM2_ARATH/83-178--------------------------------------------------
Q9AYB6_ORYSJ/694-791--------------------------------------------------
Q9XE67_SORBI/155-252--------------------------------------------------
O49369_ARATH/139-231--------------------------------------------------
Q9ZPF9_ARATH/97-196--------------------------------------------------
Q9XII7_ARATH/126-236--------------------------------------------------
Q9SIM3_ARATH/131-240--------------------------------------------------
Q9MA68_ARATH/89-183--------------------------------------------------
Q9M225_ARATH/186-282--------------------------------------------------
Q96467_HORVU/82-176--------------------------------------------------
Q9AXC5_ANTHI/295-388--------------------------------------------------
Q9M0T9_ARATH/89-183--------------------------------------------------
Q9SY43_ARATH/188-284--------------------------------------------------
Q9C7H8_ARATH/150-242--------------------------------------------------
Q9ZNW4_SORBI/210-302--------------------------------------------------
Q9SUN0_ARATH/223-313--------------------------------------------------
Q9M252_ARATH/163-260--------------------------------------------------
O93283_TAKRU/149-242--------------------------------------------------
Q9ZQQ3_ARATH/198-290--------------------------------------------------
Q9ATX2_MAIZE/179-271--------------------------------------------------
O81471_ARATH/148-242--------------------------------------------------
Q9FW76_ORYSJ/181-275--------------------------------------------------
Q9SKF2_ARATH/107-197--------------------------------------------------
Q9SYE8_ARATH/131-230--------------------------------------------------
Q98SV9_TAKRU/117-207--------------------------------------------------
Q9SJP0_ARATH/291-382--------------------------------------------------
Q9XE85_SORBI/114-212--------------------------------------------------
Q9ZS84_SOLLC/150-247--------------------------------------------------
O48967_MAIZE/245-337--------------------------------------------------
Q9LZG5_ARATH/148-244--------------------------------------------------
Q9SX87_ARATH/132-224--------------------------------------------------
Q9LQH2_ARATH/476-575--------------------------------------------------
Q9FZN9_ARATH/121-215--------------------------------------------------
Q9SLQ0_ORYSI/194-290--------------------------------------------------
Q9UVC2_PASFU/52-153--------------------------------------------------
Q9ZPG6_ARATH/97-191--------------------------------------------------
Q9ZUK1_ARATH/211-302--------------------------------------------------
Q9FWB1_ARATH/104-198--------------------------------------------------
Q9HFY8_COLGL/148-252--------------------------------------------------

PF14227

A5BY76_VITVI/104-226--------------------------------------------------
A5B9Z7_VITVI/12-134--------------------------------------------------
A5BSC1_VITVI/688-789--------------------------------------------------
A5BWL8_VITVI/342-448--------------------------------------------------
A5BLR1_VITVI/94-215--------------------------------------------------
A5BLB0_VITVI/282-404--------------------------------------------------
Q9LJC9_ARATH/90-212--------------------------------------------------
Q5AT23_EMENI/392-511--------------------------------------------------
D3IVP8_9POAL/629-752--------------------------------------------------
COPIA_DROME/74-192--------------------------------------------------
D2A543_TRICA/76-194--------------------------------------------------
O96968_BOMMO/78-193--------------------------------------------------
Q6XMP8_AEDAL/81-199--------------------------------------------------
B0X5G3_CULQU/101-222--------------------------------------------------
Q967L5_AEDAE/76-197--------------------------------------------------
Q8WRX6_ANOGA/74-195--------------------------------------------------
B2CN78_DAPPU/42-160--------------------------------------------------
A9RF54_PHYPA/34-146--------------------------------------------------
Q8H023_ORYSJ/210-330--------------------------------------------------
Q7XSZ1_ORYSJ/103-219--------------------------------------------------
Q7XLX2_ORYSJ/160-253--------------------------------------------------
A5BPQ9_VITVI/512-624--------------------------------------------------
A5B864_VITVI/32-156--------------------------------------------------
Q9AU17_SOLCI/79-196--------------------------------------------------
B1N668_SOLLC/75-192--------------------------------------------------
Q2AA06_ASPOF/859-977--------------------------------------------------
Q69FA7_PHAVU/58-175--------------------------------------------------
Q6BCY1_IPOBA/74-193--------------------------------------------------
B8YLY5_MEDTR/73-192--------------------------------------------------
Q25A78_ORYSA/77-175--------------------------------------------------
Q53QA4_ORYSJ/75-188--------------------------------------------------
Q94LG0_ORYSJ/79-192--------------------------------------------------
Q01MJ3_ORYSA/27-111--------------------------------------------------
A5BQQ6_VITVI/23-136--------------------------------------------------
A5BPL2_VITVI/25-141--------------------------------------------------
Q9SJT2_ARATH/93-212--------------------------------------------------
Q9SH77_ARATH/93-212--------------------------------------------------
Q9FFM0_ARATH/98-215--------------------------------------------------
Q9LS18_ARATH/107-224--------------------------------------------------
Q9ZQE4_ARATH/102-211--------------------------------------------------
Q9LJS6_ARATH/105-202--------------------------------------------------
O81903_ARATH/103-220--------------------------------------------------
Q9SHR5_ARATH/101-218--------------------------------------------------
Q9LVY5_ARATH/105-222--------------------------------------------------
Q02900_ARATH/97-214--------------------------------------------------
O82196_ARATH/63-180--------------------------------------------------
Q9ZPU5_ARATH/68-187--------------------------------------------------
Q1KUM3_9ROSI/117-234--------------------------------------------------
A5AR03_VITVI/133-256--------------------------------------------------
A5ARG5_VITVI/22-139--------------------------------------------------
Q9M3C1_ARATH/26-145--------------------------------------------------
A5AJF1_VITVI/465-574--------------------------------------------------
A5BLL6_VITVI/78-195--------------------------------------------------
A5BYU4_VITVI/59-176--------------------------------------------------
A5BPE6_VITVI/78-195--------------------------------------------------
Q18L98_CITSI/80-198--------------------------------------------------
A5B6C0_VITVI/29-150--------------------------------------------------
A5AYK3_VITVI/32-152--------------------------------------------------
A5B8Q0_VITVI/529-644--------------------------------------------------
Q2AA73_ASPOF/71-191--------------------------------------------------
A5AM57_VITVI/98-215--------------------------------------------------
A5C6J6_VITVI/77-184--------------------------------------------------
A5AQ94_VITVI/78-195--------------------------------------------------
A5AKU3_VITVI/615-723--------------------------------------------------
C6GFP7_FRAAN/52-171--------------------------------------------------
A5C6L3_VITVI/78-195--------------------------------------------------
A5BCL0_VITVI/55-172--------------------------------------------------
A5AL15_VITVI/39-145--------------------------------------------------
Q6RZV5_MUSAC/23-145--------------------------------------------------
Q9ZRJ0_TOBAC/76-193--------------------------------------------------
Q5MG99_IPOBA/76-193--------------------------------------------------
A5AJF5_VITVI/76-192--------------------------------------------------
A5BEP3_VITVI/54-180--------------------------------------------------
B3N452_DROER/17-137--------------------------------------------------
B4N7F3_DROWI/52-172--------------------------------------------------
B6V6Z8_DROME/78-198--------------------------------------------------
B4NQE5_DROWI/78-198--------------------------------------------------
Q45W64_PHACR/80-192--------------------------------------------------
Q5JMV2_ORYSJ/12-126--------------------------------------------------
A5CA63_VITVI/149-269--------------------------------------------------
Q8W5F6_ORYSJ/80-197--------------------------------------------------
Q8LN71_ORYSJ/50-167--------------------------------------------------
B7ZXP2_MAIZE/242-358--------------------------------------------------
Q10LP7_ORYSJ/115-232--------------------------------------------------
A5BQ76_VITVI/63-180--------------------------------------------------
Q0KIN7_SOLDE/84-201--------------------------------------------------
Q7Y173_ORYSJ/18-135--------------------------------------------------
A5B4U1_VITVI/192-309--------------------------------------------------
Q2R404_ORYSJ/102-219--------------------------------------------------
A5BQ76_VITVI/411-528--------------------------------------------------
Q0KIL6_SOLDE/90-207--------------------------------------------------
Q9SZS9_ARATH/2-131--------------------------------------------------
B9SXB7_RICCO/3-127--------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window