Sequence alignment for CL0523

PF03732

Q9XX53_CAEEL/210-308-------------------------------------------------------RKFLTFLEGRARNKA----------
PEG10_MOUSE/174-267-------------------------------------------------------CFVTSMLIGRAARWA----------
Q9AUY8_ARATH/31-127-------------------------------------------------------DIAIHLLEGDAHNWW----------
Q9FWC7_ORYSJ/155-249-------------------------------------------------------SAVVLHMSGNAAQWY----------
Q9FE41_ORYSJ/775-871-------------------------------------------------------APAHVTAEGDPRQHA----------
Q9LP90_ARATH/163-253-------------------------------------------------------ALVSVSVSGEALSWY----------
Q9LMV1_ARATH/257-344-------------------------------------------------------QIFIEHLTGPAHNWF----------
Q9ARZ4_ORYSJ/100-192-------------------------------------------------------KVIHLTLDGIARSWY----------
Q9FYC9_ARATH/102-194-------------------------------------------------------DIASIHFDDIDATWH----------
Q9SK57_ARATH/214-310-------------------------------------------------------DIAVHFLEGDAHNWW----------
Q9FRJ2_ORYSJ/81-182-------------------------------------------------------RRADHCV....VNWL----------
Q9AV68_ORYSJ/351-443-------------------------------------------------------NYLPVALADSARSWL----------
Q9AYB5_ORYSJ/567-664-------------------------------------------------------SFASHQLLGPASEWW----------
O23529_ARATH/90-186-------------------------------------------------------RLIFSALIGAISPPV----------
O82608_ARATH/272-360-------------------------------------------------------HLFVEHLKGPALNWF----------
Q9AYC2_ORYSJ/729-826-------------------------------------------------------AFATHQLQGPASAWW----------
Q9FGL3_ARATH/131-241-------------------------------------------------------SMV........KSWI----------
Q9SQW9_ARATH/264-354-------------------------------------------------------EKAVSCLTGASVTWW----------
Q9LNM2_ARATH/83-178-------------------------------------------------------HLFVEHLKGPALDWF----------
Q9AYB6_ORYSJ/694-791-------------------------------------------------------IFAAHQLQGPASLWW----------
Q9XE67_SORBI/155-252-------------------------------------------------------GVAAHQLTGAARAWW----------
Q9ZPF9_ARATH/97-196-------------------------------------------------------KVAATEFYDYALSWW----------
Q9XII7_ARATH/126-236-------------------------------------------------------SMV........KSWL----------
Q9SIM3_ARATH/131-240-------------------------------------------------------MVKSWLLNSVSPQIY----------
Q9MA68_ARATH/89-183-------------------------------------------------------RLFPFSLGDEAHLWE----------
Q9M225_ARATH/186-282-------------------------------------------------------DLAVHFLEEDAHLWW----------
Q96467_HORVU/82-176-------------------------------------------------------KLFPFSLRDRAKTWF----------
Q9AXC5_ANTHI/295-388-------------------------------------------------------NFAAFRLEDAARHWW----------
Q9M0T9_ARATH/89-183-------------------------------------------------------RLFPFSLGDKAHIWE----------
Q9SY43_ARATH/188-284-------------------------------------------------------DLTVHFLEGDAHLWW----------
Q9C7H8_ARATH/150-242-------------------------------------------------------KMVAIHFDSHAATWH----------
Q9ZNW4_SORBI/210-302-------------------------------------------------------KSFVIAAEGDALAWY----------
Q9SUN0_ARATH/223-313-------------------------------------------------------QLFVEGLTGNALTCF----------
Q9M252_ARATH/163-260-------------------------------------------------------DIIVHFLREEASHWW----------
O93283_TAKRU/149-242-------------------------------------------------------GFITSLLADKALSWA----------
Q9ZQQ3_ARATH/198-290-------------------------------------------------------KLFSENLCGQALMWF----------
Q9ATX2_MAIZE/179-271-------------------------------------------------------KSFVMAVRSVAQTWY----------
O81471_ARATH/148-242-------------------------------------------------------KLFPYSLAGEAASWL----------
Q9FW76_ORYSJ/181-275-------------------------------------------------------KIATLNFCGNAAFWL----------
Q9SKF2_ARATH/107-197-------------------------------------------------------RLFPFSLGDRARIWE----------
Q9SYE8_ARATH/131-230-------------------------------------------------------KIAATKFYNYALSWW----------
Q98SV9_TAKRU/117-207-------------------------------------------------------AFVVNLLSGRAAQWA----------
Q9SJP0_ARATH/291-382-------------------------------------------------------QLFVKHLSGAALTWF----------
Q9XE85_SORBI/114-212-------------------------------------------------------LYASGQLQGAAQTWW----------
Q9ZS84_SOLLC/150-247-------------------------------------------------------NITTMYLSGDAKLWW----------
O48967_MAIZE/245-337-------------------------------------------------------TYFHVALSGPARTWL----------
Q9LZG5_ARATH/148-244-------------------------------------------------------DLASCYLRGEAQEWW----------
Q9SX87_ARATH/132-224-------------------------------------------------------SIASTLCDGAAAKWY----------
Q9LQH2_ARATH/476-575-------------------------------------------------------KVAPTEFQNYALSWW----------
Q9FZN9_ARATH/121-215-------------------------------------------------------RLFPFSLGDKAHQWE----------
Q9SLQ0_ORYSI/194-290-------------------------------------------------------RAATSEFTDFASIWW----------
Q9UVC2_PASFU/52-153-------------------------------------------------------IFATTFLRGRAQHWV----------
Q9ZPG6_ARATH/97-191-------------------------------------------------------RLFPFSLGDKAHHWK----------
Q9ZUK1_ARATH/211-302-------------------------------------------------------KLFSENLFGLALTWF----------
Q9FWB1_ARATH/104-198-------------------------------------------------------KLFSFSLADKTHRLF----------
Q9HFY8_COLGL/148-252-------------------------------------------------------VHAATFLRGRALAWF----------

PF14223

C6JSM1_SORBI/65-207-------------------------------------------------AKKKDTKAKAHLLQCLPDDLL----------
Q5TKD7_ORYSJ/82-224-------------------------------------------------EFREDRQAMAALLQAVPKEML----------
C5XUK3_SORBI/191-334-------------------------------------------------QFRDDRRALEVIVGAVPKEMG----------
Q7FAB9_ORYSJ/122-264-------------------------------------------------PLHEDRMALDAICSAVPPEMI----------
Q53P77_ORYSJ/59-201-------------------------------------------------ELHEDRMTLDAICSVVPAEMI----------
U5G3M5_POPTR/78-220-------------------------------------------------EKIKNAKALSLIQGALTDDLF----------
M1B1W5_SOLTU/38-180-------------------------------------------------RKTRKSKAKACLFSAISSSIF----------
Q75K50_ORYSJ/66-213-------------------------------------------------EFEQNCKARNILLSGISRSDY----------
Q7XL83_ORYSJ/59-200-------------------------------------------------NLQLNAQAMNALFNSLSQEEF----------
K4A379_SETIT/105-236-------------------------------------------------DYFCNAQVVRVIIGSLCAQEF----------
Q7XWR8_ORYSJ/85-228-------------------------------------------------NKHKNAQAANAILSALSGSEF----------
Q53LJ7_ORYSJ/949-1092-------------------------------------------------LIHRNAQASNAILSALSSDEF----------
K4AQP1_SOLLC/29-171-------------------------------------------------RFKDHHKAKSMLFSAISYIEY----------
W1NQ11_AMBTC/80-222-------------------------------------------------MLSKNAKAKYALICGLDRDIF----------
J9KKF0_ACYPI/70-208-------------------------------------------------WTKADNKCQKIIVTSIENGPM----------
X1WMG8_ACYPI/69-207-------------------------------------------------KGQIDNKAKKCIVTSLDEQPL----------
X1XSG1_ACYPI/1016-1154-------------------------------------------------WKRADNKAQKYIVTSVDEQPL----------
E5SZD6_TRISP/22-165-------------------------------------------------FEKEDTLAQLILVSSMNDANV----------
K7J7F1_NASVI/67-205-------------------------------------------------WIKNDAKARYLITAAMEPEQM----------
K7JBX1_NASVI/56-194-------------------------------------------------WVKEDAKAMFLISSAMETEQM----------
K7JBR0_NASVI/56-192-------------------------------------------------WIRENAKAMFLISSAMEYPQL----------
F4WZJ7_ACREC/51-189-------------------------------------------------WKKKDALARSLLSKSLDDAHF----------
K7JSP6_NASVI/56-194-------------------------------------------------YNISVSRVKTIILCSINQKLR----------
Q6AUV8_ORYSJ/140-277-------------------------------------------------FEASDCLFRGALISILADNIV----------
Q5KQJ6_ORYSJ/54-191-------------------------------------------------FEEATTLFVGCILSVLSDRLV----------
F6HMS3_VITVI/69-206-------------------------------------------------REEDELICRGHILNALSDKLY----------
U5GQH9_POPTR/36-171-------------------------------------------------RHVDDDEQTACVMLAIISYKI----------
D0P4M1_PHYIT/31-154-------------------------------------------------........TVFFMTTLSDEMV----------
U7E2P1_POPTR/73-196-------------------------------------------------WRKADRLLR............----------
U5FM44_POPTR/75-204-------------------------------------------------WQKSDRLLRGWIIGTLSEEAL----------
K7MSY7_SOYBN/76-212-------------------------------------------------WRKKDNLLRGWIIGTLFEEAL----------
U5GX94_POPTR/76-212-------------------------------------------------WRKADRLLRWWIIGTLSEETL----------
U7DWS5_POPTR/76-203-------------------------------------------------WRKSDRLLRGWIIGTLSEEAL----------
K7JMW1_NASVI/53-191-------------------------------------------------WNKSNDKARVRIGLSVEDDQL----------
K7JZ52_NASVI/48-186-------------------------------------------------WIKKDNQARTIIILSMEDDQL----------
E5RYC0_TRISP/55-187-------------------------------------------------WSRKECKAIAAICLTVEDDQL----------
M7ZB77_TRIUA/364-501-------------------------------------------------WEELQLKAARTIRLFLSDQVI----------
Q8H023_ORYSJ/184-321-------------------------------------------------WVEMKAQATAIIRLSLSDFVM----------
U5GTK8_POPTR/27-149-------------------------------------------------WQELETRIVATIRLCLYDDVM----------
U5GAW6_POPTR/1-122-------------------------------------------------............MSGISFEKL----------
K4D0A3_SOLLC/29-166-------------------------------------------------WYEMDEKAASTIRLHLTDDVV----------
J3N766_ORYBR/276-405-------------------------------------------------WEDLDQKALSAMQLSLSTDVL----------
K4C212_SOLLC/50-190-------------------------------------------------WKEIDEQARSLIYLYLADEIL----------
Q53QA4_ORYSJ/49-186-------------------------------------------------EIRKDQKALALIQLHLHNDIL----------
I1R349_ORYGL/53-190-------------------------------------------------EKRKDRKALSLIQLHLSNDIL----------
Q8LNW7_ORYSJ/86-223-------------------------------------------------EKKKDRKAMSYIHLHLSNNIL----------
B9GES3_POPTR/51-190-------------------------------------------------WNGLNRKATANVRKWVSSKSI----------
K4BHD1_SOLLC/28-167-------------------------------------------------WEFEHLQVCGYIRQWVEYNVR----------
I1HDH1_BRADI/50-189-------------------------------------------------WKVLHHQACGFIRQWVDDNVL----------
K4APP6_SOLLC/9-118-------------------------------------------------WNLKDRQDLGLILLTLSRNVA----------
D6WYA2_TRICA/60-197-------------------------------------------------WIKNDQKAKSEMILSISSTEL----------
E1ZV45_CAMFO/58-195-------------------------------------------------WDIQDKKAKADIILSIKSSEL----------
T1HSX1_RHOPR/55-192-------------------------------------------------WVRNDSKATSDIILNISPPEL----------
F4WEW2_ACREC/61-198-------------------------------------------------WDDNDNKAMSDLILSIHPSEL----------
E2AJT1_CAMFO/8-145-------------------------------------------------WERNDQKARSDIILSISPSEL----------
T1IKQ2_STRMM/62-199-------------------------------------------------WDKNDEIAKATILLMIKQSEV----------
E2A5G7_CAMFO/57-194-------------------------------------------------WITGDRKAKSDLILSMNPSEL----------
B4NQE5_DROWI/52-189-------------------------------------------------WQAQDEKARADIMLSISTAEL----------
B4N7F3_DROWI/26-163-------------------------------------------------LGGLGRKALASITLSVKPSQL----------
E2AMM3_CAMFO/51-188-------------------------------------------------WTTRDEKALALIVLSVSKAEL----------
T1J9B0_STRMM/91-207-------------------------------------------------DATKELQALATIALGVQEHVY----------
I1F6R0_AMPQE/28-159-------------------------------------------------FESRRDKAIAIIILSIEPSLL----------
I1EHE8_AMPQE/27-156-------------------------------------------------FQTRKDRALATIILSIDPSLL----------
I1FHD8_AMPQE/25-162-------------------------------------------------RCSNEDRALAIVVLSVDPTLL----------
I1E7Y8_AMPQE/59-197-------------------------------------------------YAARKDKALATIVLSVDPSLL----------
I1GAG6_AMPQE/26-163-------------------------------------------------LAVCRDRALATIVLSLDPSLL----------
I1FXX0_AMPQE/30-175-------------------------------------------------FMVRYNRALATIVLTVDPALL----------
I1FA02_AMPQE/58-195-------------------------------------------------YKSKKDKALATIVLSIEPSLL----------
A9RF54_PHYPA/33-140-------------------------------------------------FKRQEKKAFGIIATNIDES..----------
H3H865_PHYRM/30-162-------------------------------------------------FREHE.......LLEIAEGKL----------
H3H7I3_PHYRM/74-190-------------------------------------------------FKRKSRKALAIICLAMEDSQL----------
H3H4T3_PHYRM/256-393-------------------------------------------------FKRKSRKALAIICLAMEDSQL----------
I1FL57_AMPQE/42-163-------------------------------------------------FKKWQEKTFSIVALAISPAQL----------
H3H8S0_PHYRM/58-195-------------------------------------------------YVKSSNIAFGLMLLHMDADYH----------
K3WFC4_PYTUL/54-191-------------------------------------------------YVRTNNVAFGLLLLHIDAEYH----------
X1XSQ9_ACYPI/36-160-------------------------------------------------LE..............SNSHL----------
J9KWH3_ACYPI/52-189-------------------------------------------------FDKTDAKATNLIIQCTADTHV----------
D2A543_TRICA/50-188-------------------------------------------------FLKMDKKCKSLIIQCIANSHL----------
X1WUQ9_ACYPI/53-190-------------------------------------------------WNINDKKCMSLLVQCIADTHL----------
H9JTX7_BOMMO/22-158-------------------------------------------------.KTADAAAKALIVKCVPDKYL----------
K7JW30_NASVI/49-187-------------------------------------------------WDDNDLKAINIIYCAIPNKQL----------
K7JWT6_NASVI/101-239-------------------------------------------------WKKKEIRAKNYIVNSMTNTQL----------
H3H572_PHYRM/51-187-------------------------------------------------WLLNDMKALGLIAQGVAVEHH----------
H3H7F9_PHYRM/48-184-------------------------------------------------WLVNDAKALGIIAQGVELQHQ----------
M4B777_HYAAE/28-150-------------------------------------------------WKVNDMKAFANVCTMINPSLQ----------
M5BUS0_THACB/75-214-------------------------------------------------WKKRDREAYAQITLNMEDEAM----------
T1ILJ6_STRMM/60-198-------------------------------------------------YNKRKAKARVFLCNSVVDRLK----------
T1IMI2_STRMM/102-238-------------------------------------------------FNKAKLKSRAILIQSIAERHR----------
T1ILE6_STRMM/56-194-------------------------------------------------FNINKSKAGGMIFLGIEDKLK----------
M2Q9R4_CERS8/111-253-------------------------------------------------WRKKEAKARDLLARLVPDSVL----------
F8PLK7_SERL3/29-165-------------------------------------------------WSKKEYCAKNILGCMVSDLTL----------
H3GVH0_PHYRM/36-172-------------------------------------------------TSSKEQQAHAAIVLSLNDSQL----------
H3GKE9_PHYRM/34-170-------------------------------------------------STAKEQQAHAAIVLNLNDSQL----------

PF03564

A7SE42_NEMVE/491-638FAGSVGEWQEFWDGFES------------------------SIHSNPRLATVDKFNYLRSLLVGPARGAV----------
Q17051_ASCLU/155-293FSGNPKEWTGFWETFNS------------------------AV...GHLPKIQCLNYLLSLLEGPAATVA----------
Q23992_DROME/160-308FFGDSKEWDLFNELFTE------------------------LIHVREDLSPSLKFNYLKSALKGEARNVV----------
A7XDH0_DROAN/157-302FGGIYKEWPAFKALYIS------------------------TVHSKQHLGKIQKYHYLKSFLVDEAASLV----------
Q4JS97_ANOGA/133-280FDGEITKWLTFKDRFSS------------------------MVHDSTEMPEVLKLQYLLSALKGDAAHQF----------
Q4EAY5_9RICK/161-306FSGDYKEWPAFWDIYKS------------------------TIHKKRQLSDTQKFHYLKSLLTDEAANLI----------

PF14893

H0XX29_OTOGA/1-328MALAMLQDWCGWMGANAQRALLILGIPDDCQEDEF......RAALHAALWPLGRHRVLSKVFRKELGDWA..........
M3Z644_MUSPF/1-327MTLRLLEDWCRGMDVDPRRAVLVAGIPPTCTVAEI......EEALRAGLAPLGECRLLGRMFRRDENRNV..........
F7CY48_HORSE/1-330MPLVMLQDWCRWSGANAQRSLLILGIPEDCEDREF......QEAVRAALWPLGRYRVLGNVFRKELGFRV..........
M4B0W2_XIPMA/1-317MGMAQLRHWCKGEGIDPEYAILVKNVPEEVEVNTI......EETLQ.SIKALGRVKVRGRMYDPQTQRLT..........
F6TXQ3_HORSE/2-329MALALLEDWCRIMSVDDQKSLMVMGIPVDCDEAEI......QEVLQETLKSLGRYRLLGKIFRKQENANA..........
D3Z8Y9_RAT/1-327MPLNLLQDWCRGEHLNIQRSMLILGIPEDCTEDEF......EETLHEALKHLGRYRIIGRMFRREENAQA..........
M4AZW3_XIPMA/2-318..MTQLLHWCKGEGINPLHAVLVKDIPEETEVSVI......EDTLQ.TIKALGRVRVRGRMYDPMSQSLT..........
F7AVZ0_XENTR/7-324........WCNALGLNPQKVAVVGPMMPRVKEDSI......YEILDGE...........PIFFRPRVAASRRDSAGVLLN
PNMA5_HUMAN/1-322MALTLLEDWCKGMDMDPRKALLIVGIPMECSEVEI......QDTVKAGLQPLCAYRVLGRMFRREDNAKA..........
G1PM76_MYOLU/2-362MTMTLLEDWCRGMDVDIHRALLVTGIPQDCGPEEM......EETLSRVLSPLGPYRVLNRIFVREENAKA..........
F7D322_HORSE/1-321MAVTLLEDWCKGMDLDPRKALLIVGIPVECSEAEI......KETVKAGLQPLCAYKVLGRMFRREDNAKA..........
G3N1H8_BOVIN/3-317..LALLRDWCRWMGVNEERSVLLLGIPDDCEDQEF......RDAVQAALGPLGRYRVLGKVFRKDLGSKI..........
F1S2C6_PIG/1-333MALAMLRDWCRWMGVKAQRALLILGIPDDCEDQEFLEDQEFQEAVRAALRPLGRYRVLGKVFRKELGCRV..........
H2PX42_PONAB/1-327MPLTLLQDWCRGEHLNTQRCMLILGIPEDCGEDEF......EETLQEACRPLGRYRVIGRMFRREENAQA..........
G1LQR5_AILME/1-315MALAMLRDWCRWMGVNAHRSLLILGIPDDCGEEEF......QKAVHAALWPLGGYRVLGKVFRKELGSRV..........
PNMA5_MOUSE/1-323MAVALLDDWCKGMDLDPKKAVLIVGIPVQYTEAAI......NDALKEGLPPLCAYKVIGRMFRREDEAKA..........
PNML1_BOVIN/3-358MAANLLEDWCRGMEADIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGPYSVLNKIFLRQENAKA..........
G3U141_LOXAF/1-317MALAMLRDWCRWMGVNAQRSLLLLGIPDDCDENEF......QEAVRAALWPLGRYRVQGKVFRKELGTRV..........
H0W6U3_CAVPO/1-332MGLSMLRDWCRWMGVNAQRCLLIMGIPDDCEEDEF......QERVQAALRPLGRYRVLCRVFRKELGARV..........
H0VWL7_CAVPO/1-322MAVVLLEDWCKGMDLDPRKALLIVGIPVECSEAEI......KETVQEGLYPLSMYRIVGRMFRREDNAKA..........
PNML1_PONAB/5-364MAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLAPLGPYRVLNKIFVREENVKA..........
H0VK73_CAVPO/6-363.AMNLLEDWCRGMEVDVHRSLLVTGIPEDCGQAEL......EETLNGVLAPLGTYRVLNKIFLREENVKA..........
G3U379_LOXAF/1-308MAVAMLRDWCRWMGVSARRGLLVLGIPEDCEEAEV......HEALEAALWPLGRFSVLGRVFREEDNAAA..........
M4AZA8_XIPMA/3-326..VTKLKNWCLGEGINESHALLTK.VPQNTEVAQI......EETLQ.TIKCLGRVRVRGRMFDESTDQIL..........
D2GZV4_AILME/1-325MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI......EETLQAAM.PQVRYRVLGRMFWREENAKA..........
F6Z9T2_HORSE/5-364MAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGQYLVLNKIFLREENAKA..........
PNML1_MOUSE/6-363.AMTLLEDWCRGMGMDIHRSLLVTGIPEYCSHAEI......EETLNGVLLPLGTYRVLNKIFLRQENVKA..........
F1PIM5_CANFA/1-358MAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEI......EETLNGVLSPLGPYFVLNKIFLREENAKA..........
F7H8Z7_CALJA/1-318MARAMIQDWCRWMGVNAERSLLILGIPDDCEEHEF......QEAVRAALSPLGRYRVLTKVFRRGLGARA..........
PNM6B_HUMAN/1-319MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEF......QESLEAALRPMGHFTVLGKVFREEDNATA..........
G3QYD8_GORGO/1-326MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEI......EEALQAGLAPLGEYRLLGRMFRRDENRKV..........
F6WC96_CALJA/1-321MARAMIQDWCRWMGVNAERSLLILGIPDDCEEHEF......QEAVRAALSPLGRYRVLTKVFRRGLGARA..........
Q5BJV6_RAT/1-328MTLRLLEDWCRGMDMNPRKALLVAGIPPTCGVADI......EEALQVGLAPLGEHRLLGRMFRRDENKNV..........

PF16297

H0W794_CAVPO/2-110-------------------------------------------------------DGR.EQLTKVFMGWP----------
D3ZTE6_RAT/24-138-------------------------------------------------------NQLLKQLRILVCERA----------
G1MLQ7_AILME/2-114-------------------------------------------------------DGRPSALIKALLALP----------
F7ASC6_CALJA/2-113-------------------------------------------------------DGR.VQLMKALLAWP----------
Q9D6I0_MOUSE/2-112-------------------------------------------------------DRR.IKLIMALMAWP----------

PF14244

B9SYP2_RICCO/12-59-------------------------------------------------------EIEPNTSLRLTSVLL----------
U5FIT1_POPTR/2-49-------------------------------------------------------ATEKDDSLQLVSVRL----------
F6H7D5_VITVI/2-49-------------------------------------------------------VGERDDSLQSISVRL----------
M1B3X1_SOLTU/18-62-------------------------------------------------------HASDMPGTALIAVQL----------
K7L0W9_SOYBN/14-61-------------------------------------------------------HSLDNPGLMLVSHLL----------
B9S0Y3_RICCO/33-80-------------------------------------------------------HHSDHPGMILVSKTL----------
B9S242_RICCO/33-80-------------------------------------------------------HPSDHLGLVFVTTPS----------
K7LQ32_SOYBN/26-73-------------------------------------------------------HPGESPGMVLASPPL----------
U7DX79_POPTR/501-548-------------------------------------------------------HHSDQPGAVLVPQPL----------
B9RHL9_RICCO/34-81-------------------------------------------------------HHSDQTGGALIPISL----------
Q84JT5_ARATH/26-70-------------------------------------------------------HPSD...FSIQKLSK----------
M1DJS2_SOLTU/28-75-------------------------------------------------------HPFENAGSSLLPGVF----------
M1BMN2_SOLTU/26-72-------------------------------------------------------HPSDSPGMVLVSVQF----------
B9T813_RICCO/29-76-------------------------------------------------------HHTENHSSVILTPEL----------
B9SUJ8_RICCO/31-74-------------------------------------------------------HHAENHSPVIVSPEL----------
B9T3E3_RICCO/35-82-------------------------------------------------------QNNDSPGMPLISTLM----------
M4EME5_BRARP/24-71-------------------------------------------------------FSADNPGALITSVQL----------
T1J2U7_STRMM/119-166-------------------------------------------------------KMATDSGTTVKFEGL----------
K7JVV9_NASVI/23-68-------------------------------------------------------KEWEKESQNITK..L----------

PF13961

Q5AT23_EMENI/319-345---------------------------------------------------------------------L----------
Q5AT23_EMENI/515-541---------------------------------------------------------------------L----------
A9RSN5_PHYPA/14-40---------------------------------------------------------------------F----------
B0D6P6_LACBS/11-37---------------------------------------------------------------------L----------
B0WQU4_CULQU/10-36---------------------------------------------------------------------L----------
B0WWB7_CULQU/11-37---------------------------------------------------------------------L----------
B4K1A4_DROGR/12-38---------------------------------------------------------------------L----------
B4LA17_DROMO/10-36---------------------------------------------------------------------L----------
B4LAF9_DROMO/10-36---------------------------------------------------------------------L----------
B4LE08_DROVI/13-41---------------------------------------------------------------------L----------
B4MX54_DROWI/10-37---------------------------------------------------------------------L----------
B4NQE5_DROWI/11-37---------------------------------------------------------------------L----------
B4NQR9_DROWI/10-36---------------------------------------------------------------------L----------
B6HA76_PENCW/19-46---------------------------------------------------------------------L----------
B6QCF0_PENMQ/36-62---------------------------------------------------------------------A----------
B9NDW0_POPTR/15-41---------------------------------------------------------------------L----------
B9RBX9_RICCO/17-43---------------------------------------------------------------------L----------
B9RC68_RICCO/10-37---------------------------------------------------------------------L----------
B9S5P6_RICCO/16-42---------------------------------------------------------------------L----------
C5GBD9_AJEDR/188-215---------------------------------------------------------------------L----------
C5WNA6_SORBI/166-192---------------------------------------------------------------------L----------
C5XQM0_SORBI/42-68---------------------------------------------------------------------L----------
C5XUK3_SORBI/137-163---------------------------------------------------------------------L----------
C5Z583_SORBI/42-68---------------------------------------------------------------------L----------
C6JSM1_SORBI/23-49---------------------------------------------------------------------L----------
C7J1L6_ORYSJ/181-207---------------------------------------------------------------------L----------
C7J1U3_ORYSJ/16-44---------------------------------------------------------------------F----------
C7J5A1_ORYSJ/49-75---------------------------------------------------------------------L----------
C7J6P4_ORYSJ/14-42---------------------------------------------------------------------F----------
C7J7K5_ORYSJ/83-109---------------------------------------------------------------------L----------
D0NBZ2_PHYIT/18-44---------------------------------------------------------------------F----------
D0P386_PHYIT/3-29---------------------------------------------------------------------F----------
D0P4P1_PHYIT/16-42---------------------------------------------------------------------F----------
D0RLQ9_PHYIT/21-47---------------------------------------------------------------------F----------
D2A4C7_TRICA/13-39---------------------------------------------------------------------L----------
D2A543_TRICA/14-40---------------------------------------------------------------------F----------
Q0DA14_ORYSJ/28-54---------------------------------------------------------------------L----------
Q0IZT5_ORYSJ/33-59---------------------------------------------------------------------L----------
Q0J5Y3_ORYSJ/54-80---------------------------------------------------------------------L----------
Q16S15_AEDAE/12-38---------------------------------------------------------------------F----------
Q6K285_ORYSJ/82-108---------------------------------------------------------------------L----------
Q75M81_ORYSJ/48-74---------------------------------------------------------------------L----------
Q7G5Z8_ORYSJ/52-78---------------------------------------------------------------------L----------
Q7G756_ORYSJ/12-40---------------------------------------------------------------------F----------
Q7XKY1_ORYSJ/53-79---------------------------------------------------------------------L----------
Q7XMT1_ORYSJ/56-82---------------------------------------------------------------------L----------
Q84Q85_ORYSJ/36-62---------------------------------------------------------------------L----------
Q850T3_ORYSJ/12-40---------------------------------------------------------------------F----------
B9GKP2_POPTR/14-39---------------------------------------------------------------------L----------
B9HL08_POPTR/16-42---------------------------------------------------------------------L----------
D7U4H2_VITVI/8-34---------------------------------------------------------------------L----------
F6HTJ6_VITVI/13-39---------------------------------------------------------------------L----------
F6HVN0_VITVI/97-122---------------------------------------------------------------------L----------
F6HVN2_VITVI/18-42---------------------------------------------------------------------.----------
I1Q6P1_ORYGL/57-85---------------------------------------------------------------------F----------
Q0IZC5_ORYSJ/9-35---------------------------------------------------------------------F----------
Q0J8A6_ORYSJ/26-52---------------------------------------------------------------------L----------
Q53L57_ORYSJ/161-185---------------------------------------------------------------------F----------
Q60EK9_ORYSJ/143-168---------------------------------------------------------------------.----------
Q682G3_ARATH/13-39---------------------------------------------------------------------L----------
Q7X7W1_ORYSJ/19-45---------------------------------------------------------------------L----------
Q852C7_ORYSJ/12-40---------------------------------------------------------------------F----------
Q8S5D4_ORYSJ/104-130---------------------------------------------------------------------L----------
Q8SAX3_ORYSJ/39-67---------------------------------------------------------------------F----------
Q94GR9_ORYSJ/14-42---------------------------------------------------------------------F----------
Q9AUM6_ORYSJ/511-536---------------------------------------------------------------------L----------
U5G3M5_POPTR/16-42---------------------------------------------------------------------F----------

PF03732

Q9XX53_CAEEL/210-308GEILA-KNQVV..............NF-------------------------------EELVEELRKTFDNAVL------
PEG10_MOUSE/174-267TAKLQ-RCTYL............MHNY-------------------------------TAFMMELKHVFEDPQR------
Q9AUY8_ARATH/31-127LAVDK-RKGER............VETF-------------------------------KDFEDEFNRMYFPSEA------
Q9FWC7_ORYSJ/155-249HSYKL-VNEVN..............SW-------------------------------DQFRMAVATEFEG.VV------
Q9FE41_ORYSJ/775-871RQHAP-RGENP...........SIGNW-------------------------------ATMKEVFKKHFVA.MK------
Q9LP90_ARATH/163-253NWAIS-RGDFV..............SW-------------------------------LKLKSGLMLRFGNLKL------
Q9LMV1_ARATH/257-344SRLKP-NSID...............SF-------------------------------HQLTSSFLKHYAPLIE------
Q9ARZ4_ORYSJ/100-192FNLPA-NSIY...............SW-------------------------------EQLRDVFVLNFRGTYE------
Q9FYC9_ARATH/102-194QSIVQ-SIMWRH..........VRHDW-------------------------------WNYKLLLQVRYNK..H------
Q9SK57_ARATH/214-310LTVEK-RRGDE............VRSF-------------------------------ADFEDEFNKKYFPPEA------
Q9FRJ2_ORYSJ/81-182HNSIA-KNVFDVVYK...PRASAFTVW-------------------------------SDIEGVFRDNAVQ..R------
Q9AV68_ORYSJ/351-443HGLPR-RTIG...............SW-------------------------------AELRDHFIANFQGTFE------
Q9AYB5_ORYSJ/567-664DHFRL-NRITA...........EPITW-------------------------------LEFTAAFRKTHIPSGV------
O23529_ARATH/90-186QPLVS-RATKA............SQIW-------------------------------KTLTNTYAKSSYD..H------
O82608_ARATH/272-360TRLKG-NSVD...............SF-------------------------------QELSTLFLKQYSVLID------
Q9AYC2_ORYSJ/729-826DNHMA-TRPPG...........TEVTW-------------------------------VEFCRSFRKAQVPDGV------
Q9FGL3_ARATH/131-241LNSVT-KQIYKSILR....FNDAAEIW-------------------------------KDLDTRFHITNLP..R------
Q9SQW9_ARATH/264-354RCSKD-REQIY..............TW-------------------------------REFQEKFMLRFRP.SR------
Q9LNM2_ARATH/83-178SRLEG-NSVD...............SF-------------------------------HELSTLFLKQYSVLID------
Q9AYB6_ORYSJ/694-791DHFQA-TQPEG...........QPITW-------------------------------ARFTAAFRRTHVPAGV------
Q9XE67_SORBI/155-252DSYSD-THENP...........GGITW-------------------------------AEFTEAFREQHVPEGV------
Q9ZPF9_ARATH/97-196DQVVT-TKRRLGD........DSIETW-------------------------------NQLKNIMKRRFVPSHY------
Q9XII7_ARATH/126-236LNSVS-PQIYRSILR....MNDASDIW-------------------------------RDLNSRFNVTNLP.RT------
Q9SIM3_ARATH/131-240RSILR-LNDAT.............DIW-------------------------------RDLFDRFNLTNLP.RT------
Q9MA68_ARATH/89-183KTLLV-DSVD...............TW-------------------------------DDCKKAFLAKFFSNSR------
Q9M225_ARATH/186-282KSVTA-RRRQA............DMSW-------------------------------ADFVVEFNAKYFLQDE------
Q96467_HORVU/82-176SSLPK-SSID...............SW-------------------------------DKCKDAYISKYFPPAK------
Q9AXC5_ANTHI/295-388RILDQ-RWKNDM..........TPRTW-------------------------------DNFVKEFYNKYIP...------
Q9M0T9_ARATH/89-183KNLPH-DSII...............TW-------------------------------DDCKKAFLSKFFSNAR------
Q9SY43_ARATH/188-284RSVTA-RRRQA............DMSW-------------------------------ADFMAEFNAKYFPREA------
Q9C7H8_ARATH/150-242HSFIQ-SGIGLD..........VFFNW-------------------------------PEYVKLLKDRFED.AC------
Q9ZNW4_SORBI/210-302SMLRP-GSIY...............SW-------------------------------ENLRDKILANFQGFAV------
Q9SUN0_ARATH/223-313SRLEA-NSID...............NF-------------------------------TQLSTAFLKQYRVFIQ------
Q9M252_ARATH/163-260DGVLG-NTPVQ...........HVIFW-------------------------------EDFREEFNRKFFPQEA------
O93283_TAKRU/149-242IAAVD-LDPRL............SSDY-------------------------------SAFRREFKAVFEHPTY------
Q9ZQQ3_ARATH/198-290TQLEP-GSIS...............NF-------------------------------NELSVVFLKQYSILMD------
Q9ATX2_MAIZE/179-271SSLRP-GTIT...............SW-------------------------------QKLKDMLLTSFQGFQT------
O81471_ARATH/148-242KQLKA-GSLK...............IW-------------------------------RSIKIAFLTNFYDDAK------
Q9FW76_ORYSJ/181-275QSVRS-QLAGA..............TW-------------------------------FELCDRVCGRFAR.DR------
Q9SKF2_ARATH/107-197KNLPQ-RSIT...............SW-------------------------------DQCKRAFLSKFFSTTR------
Q9SYE8_ARATH/131-230DQLVT-SRRRTRD........YPIKTW-------------------------------NQLKFVMRKRFVPSYY------
Q98SV9_TAKRU/117-207TAVLE-NQTPA............SSSF-------------------------------PEFTAELKRVFDHPIQ------
Q9SJP0_ARATH/291-382SRLEA-NSID...............SV-------------------------------HALTTSFLKNYGVFME------
Q9XE85_SORBI/114-212ESYQA-ARPNNA..........SPVTW-------------------------------LEFCRDFRARHINEGV------
Q9ZS84_SOLLC/150-247RTRNA-DDVSAGR........PRIDTW-------------------------------DKLIKEMRDQFLPSNA------
O48967_MAIZE/245-337MNLSP-GSIY...............SW-------------------------------EELYARFVANFASAYQ------
Q9LZG5_ARATH/148-244ERVKQ-REQVG...........CVDQW-------------------------------SFFKEEFTRRYLPEET------
Q9SX87_ARATH/132-224KSLFE-SDFGVK..........LLSNW-------------------------------NMYKLLLEEHFAE..V------
Q9LQH2_ARATH/476-575DQLVT-TRRRAGD........YPIESW-------------------------------TQMKTIMRKRFVPSHY------
Q9FZN9_ARATH/121-215KSLLQ-GSIT...............SW-------------------------------NDCKKAFLAKFFSNSR------
Q9SLQ0_ORYSI/194-290SEFVR-SNPNN...........TPQTW-------------------------------DAMKRVMRARFVPSYH------
Q9UVC2_PASFU/52-153KPFLR-KYLDSNGED...NADGVFKSY-------------------------------NHLKHAMKSVFGVSNE------
Q9ZPG6_ARATH/97-191KTLPP-DSIT...............SW-------------------------------DDCKKDFLAKFFSNAR------
Q9ZUK1_ARATH/211-302TQLEE-GSID...............NF-------------------------------KQLSTAFIKQYEYFIN------
Q9FWB1_ARATH/104-198KSMNP-ENLR...............SW-------------------------------EDYKAAFLTQYFTQSR------
Q9HFY8_COLGL/148-252EPLQQ-EWLDNPVEKYSQEVRNIFFSF-------------------------------DGYVKALQSLFLDPDE------

PF14223

C6JSM1_SORBI/65-207MQVA.-GKKTG------------KEVW.------------------------------DALKARHVGADRVKEAR-----
Q5TKD7_ORYSJ/82-224RPLS.-KKDTA------------KEVW.------------------------------DAIKTMRVGVDRVREAR-----
C5XUK3_SORBI/191-334IPLL.-DKATA------------KEAW.------------------------------DAIAATRIGVDRVRRAT-----
Q7FAB9_ORYSJ/122-264GTLA.-TKASA------------REAW.------------------------------ECIKTMRVGNDRIRKAS-----
Q53P77_ORYSJ/59-201STLA.-TKETA------------KAAW.------------------------------DCIKTMRVVNDRIRKAS-----
U5G3M5_POPTR/78-220PRIR.-NEKTA------------KEAW.------------------------------DILSREFRGDKKVRAVK-----
M1B1W5_SOLTU/38-180TRIM.-SLKSA------------KAIW.------------------------------DYLKVEYEGDEMIRGMQ-----
Q75K50_ORYSJ/66-213DRVA.-HLRTA------------HEIW.------------------------------NALSNFHQGTNNIKELR-----
Q7XL83_ORYSJ/59-200DRVS.-NLETA------------YEIW.------------------------------NKLAEIHEGTSEYKDAK-----
K4A379_SETIT/105-236NKIR.-SVEIA------------KVIW.------------------------------DTLKEAHEGTN......-----
Q7XWR8_ORYSJ/85-228NRVD.-GIESA------------KVIW.------------------------------DTLRNLHEGTDSVRESK-----
Q53LJ7_ORYSJ/949-1092NKVD.-GLEKA------------KEMW.------------------------------DNLQLAHEGSPAVREAK-----
K4AQP1_SOLLC/29-171EKIS.-DKETA------------KSIF.------------------------------DSLVMTHEGNEEVKETK-----
W1NQ11_AMBTC/80-222KNIE.-QASTA------------YDMW.------------------------------KMLEVTHQGTSAMKETK-----
J9KKF0_ACYPI/70-208QYLI.-NCESA------------YQMW.------------------------------EKLLSVYEQKSEVNLY.-----
X1WMG8_ACYPI/69-207QYIM.-NCDTE------------NGMW.------------------------------NKLLSVYEQMSDTSIT.-----
X1XSG1_ACYPI/1016-1154LFIM.-NCETA------------KEMW.------------------------------DKLLNIYEQKSATSIS.-----
E5SZD6_TRISP/22-165ELTA.-TSKSS------------AEIW.------------------------------QKLTAVYEQSSGQRVD.-----
K7J7F1_NASVI/67-205VSLL.-TCETS------------MEMW.------------------------------DRLLTIHEQKSASHKL.-----
K7JBX1_NASVI/56-194ENLL.-VCETA------------RNMW.------------------------------ERLTSVHKMKSQTHKL.-----
K7JBR0_NASVI/56-192EGLL.-VYTTV------------KEMW.------------------------------DSLKLVYEQKSASNKL.-----
F4WZJ7_ACREC/51-189NLVV.-ACKSS------------ADMW.------------------------------KTLVGHYDEVSNTTKL.-----
K7JSP6_NASVI/56-194CTLI.-NCTSV------------TKMW.------------------------------EKFNELYGDTSADAKQ.-----
Q6AUV8_ORYSJ/140-277DVYM.-HMPSG------------KDMW.------------------------------DALEAKFGVSDAGSEL.-----
Q5KQJ6_ORYSJ/54-191EVYM.-HMTDA------------KELW.------------------------------DALNTKFGATDASIDV.-----
F6HMS3_VITVI/69-206DPYT.-NTYSA------------REIW.------------------------------EALENKYKAEEEGTKK.-----
U5GQH9_POPTR/36-171QRQH.-ENMNA------------YTII.------------------------------MHLKELFDETSRTNRY.-----
D0P4M1_PHYIT/31-154VAVN.-NKRYA------------YEIF.------------------------------EHLEKTYEPRSWGCLC.-----
U7E2P1_POPTR/73-196.LAV.-GLDIA------------FAVW.------------------------------SALKNEYAEDSQEREF.-----
U5FM44_POPTR/75-204GLVI.-GLDIA------------LA...------------------------------.........DSQEQEF.-----
K7MSY7_SOYBN/76-212RLVV.-GLDTT------------HAIW.------------------------------TALKDSYAEDSQEYEF.-----
U5GX94_POPTR/76-212SLVV.-GLDTA------------HAVW.------------------------------EAFKNAYAQDSQEREF.-----
U7DWS5_POPTR/76-203SHVV.-GLETT------------SAVW.------------------------------EALKNAYAKDSQEREF.-----
K7JMW1_NASVI/53-191IHIR.-SAKTA------------KEAW.------------------------------SALKEYHQKATLTSKV.-----
K7JZ52_NASVI/48-186LHIK.-GTSTA------------REIW.------------------------------LKLKHHHQRSTTLSKV.-----
E5RYC0_TRISP/55-187IHLA.-QLETA------------REMW.------------------------------QTLQRLHERASIGSKL.-----
M7ZB77_TRIUA/364-501YHVM.-DENSP------------KKIW.------------------------------EKLESQFMSKTAMTKV.-----
Q8H023_ORYSJ/184-321YQVM.-DEKTP------------KEIW.------------------------------DKLASLYMSKSLTSKL.-----
U5GTK8_POPTR/27-149YHVM.-NEESP------------VTVW.------------------------------AKLESRYISLSLSNKL.-----
U5GAW6_POPTR/1-122GIIKF-DELNN------------LGLWL------------------------------RRVKDMLVQQD......-----
K4D0A3_SOLLC/29-166NNII.-DEEST------------CGIW.------------------------------IKLENLYMSKMLTNKL.-----
J3N766_ORYBR/276-405REVI.-NETSV------------FSLW.------------------------------KKLEALYMKKSLANKL.-----
K4C212_SOLLC/50-190RQVI.-EEKTA------------KQVW.------------------------------DKLEALHLENIRVNKL.-----
Q53QA4_ORYSJ/49-186QECL.-TEKTS------------AELW.------------------------------LKLESICMSKDLTSKM.-----
I1R349_ORYGL/53-190QEVL.-QEKTA------------AELW.------------------------------LKLESICMSKDLTSKM.-----
Q8LNW7_ORYSJ/86-223QEVL.-KEETA------------AGLW.------------------------------LKLEQICMTKDLTSKM.-----
B9GES3_POPTR/51-190NHIS.-QEHDC------------YTVW.------------------------------KLLEETFAKESAQNKV.-----
K4BHD1_SOLLC/28-167NHIV.-NETHA------------KSLW.------------------------------DKLETLYASKTGNNKL.-----
I1HDH1_BRADI/50-189NHII.-DETHA------------RTLW.------------------------------QKLKELFARKEGTNKM.-----
K4APP6_SOLLC/9-118FNIV.-KEKTT------------SGLL.------------------------------KALSNMYEKPSVMN...-----
D6WYA2_TRICA/60-197RQIK.-NCVTS------------REMW.------------------------------CKLEECYQSKGPARKA.-----
E1ZV45_CAMFO/58-195KQIK.-GCCTS------------REVW.------------------------------LKLKSIYQSSGPARKA.-----
T1HSX1_RHOPR/55-192KQIK.-NCSTS------------RDVW.------------------------------LKLQDIYQSKGPARKA.-----
F4WEW2_ACREC/61-198KQIK.-GCTSS------------REIW.------------------------------LRLEGIYQSKGPARKA.-----
E2AJT1_CAMFO/8-145KQVK.-NCATS------------HDMW.------------------------------VRLEEIYQSKGPARKA.-----
T1IKQ2_STRMM/62-199QTTQ.-GCTTS------------ASLW.------------------------------KKLHEIYQSKRPARKA.-----
E2A5G7_CAMFO/57-194KQIK.-GCETS------------KDVW.------------------------------DKLESIYASKGPARKA.-----
B4NQE5_DROWI/52-189GLIE.-SCGSA------------RDYW.------------------------------LKLEKTFQSKGPVRKA.-----
B4N7F3_DROWI/26-163AYIK.-NCLTE------------YEAW.------------------------------TRLRDVYQPRGPVQKV.-----
E2AMM3_CAMFO/51-188GHIR.-KATTS------------KQAW.------------------------------DELAKIHSSKGPVRKA.-----
T1J9B0_STRMM/91-207QEVL.-GHATA------------KAAW.------------------------------ENLAKIYQNT.......-----
I1F6R0_AMPQE/28-159YLLGE-NPDDP------------VKVW.------------------------------KALQDQFQRESWANKL.-----
I1EHE8_AMPQE/27-156YLVG.-EPDDP------------VEVW.------------------------------RLLSNHFQKKTWANRL.-----
I1FHD8_AMPQE/25-162YILG.-EPTDP------------VEVW.------------------------------KTLSEQYQKKTWTNRL.-----
I1E7Y8_AMPQE/59-197YLVGA-DPDDP------------VIVW.------------------------------NKLKEQFQKKSWVNRL.-----
I1GAG6_AMPQE/26-163YLIG.-DPTDP------------AVAW.------------------------------DKLYFYICRKTWANRL.-----
I1FXX0_AMPQE/30-175YLLG.-EPDSP------------VTVW.------------------------------EKLASEFQKMTWANKL.-----
I1FA02_AMPQE/58-195YIIG.-EPDDP------------VVVW.------------------------------QKLADQFQKKTWANKL.-----
A9RF54_PHYPA/33-140.....-.....------------.....------------------------------.................-----
H3H865_PHYRM/30-162TRAEL-TSQES------------EAAFD------------------------------KKLEGHFKKKSLANKL.-----
H3H7I3_PHYRM/74-190PLVR.-SAKDA------------HDAW.------------------------------SRLEGHFEKKSLANKL.-----
H3H4T3_PHYRM/256-393PLVR.-SAKDA------------HDAW.------------------------------SRLEGHFEKKSLANKL.-----
I1FL57_AMPQE/42-163NLIT.-SYDKP------------KPAW.------------------------------YALCEHFEKDTFANKL.-----
H3H8S0_PHYRM/58-195HVVD.-DCEEA------------WVAW.------------------------------TRLKTLYGGSQKAGRI.-----
K3WFC4_PYTUL/54-191HVVD.-DCEEA------------WVAW.------------------------------ARLKVLYQGSQKAGRI.-----
X1XSQ9_ACYPI/36-160EYVR.-EGTTA------------KQKW.------------------------------DKLIATFERKGVSSRL.-----
J9KWH3_ACYPI/52-189EYV..-RGESA------------KEIW.------------------------------NKLKTTFERKGTSSRL.-----
D2A543_TRICA/50-188QYVK.-DKTTA------------YQMW.------------------------------ISLEAGFQRKGITSQL.-----
X1WUQ9_ACYPI/53-190EYV..-RGKAS------------KEAW.------------------------------DCLAATFERKGIAGQL.-----
H9JTX7_BOMMO/22-158DIIK.-DATTS------------YTML.------------------------------ASLDKVFERKGIFTKL.-----
K7JW30_NASVI/49-187KFVC.-EETTA------------FEII.------------------------------KNFDSMYMKESTALQI.-----
K7JWT6_NASVI/101-239ELII.-SEEIA------------KKMI.------------------------------DKLDENYLIKSSAVKL.-----
H3H572_PHYRM/51-187TKIR.-SATSA------------IMAW.------------------------------NTLRDFYNRTTMHNRV.-----
H3H7F9_PHYRM/48-184TKIR.-SATRA------------IQAW.------------------------------GTLREFYNRTTLHNRV.-----
M4B777_HYAAE/28-150SMVR.-IAATT------------AESW.------------------------------GILKSFFLRRSIHNRV.-----
M5BUS0_THACB/75-214ADVM.-RTRTA------------RDAW.------------------------------KKVIERWEGKGVQSLS.-----
T1ILJ6_STRMM/60-198PSLL.-KLPTC------------KEVW.------------------------------DHLAKLFEPTSIARNA.-----
T1IMI2_STRMM/102-238KAAD.-KHPTT------------KLVW.------------------------------ERLKTVFEPSSRARKA.-----
T1ILE6_STRMM/56-194CILD.-GISEP------------DKHW.------------------------------DKLAKTYEPKSKARIA.-----
M2Q9R4_CERS8/111-253RRMKR-NGDSV------------ADMW.------------------------------IWICSEFEDKTPLVQS.-----
F8PLK7_SERL3/29-165QQIL.-HKDTV------------VEMW.------------------------------DLIHQENKNKTKLIQA.-----
H3GVH0_PHYRM/36-172MHVV.-TAKSA------------KEAW.------------------------------DKLEKFHRAQDVANRL.-----
H3GKE9_PHYRM/34-170MHVV.-TSTTA------------KEAW.------------------------------DTLKKFHKTQDMANRL.-----

PF03564

A7SE42_NEMVE/491-638AGFAL.TAANY------------QSAI-------------------------------DLLKRRYGQTEKIKRAH-----
Q17051_ASCLU/155-293QGYAM.SESSF------------DLVV-------------------------------TALKSNYGNPAVIIASL-----
Q23992_DROME/160-308THLLLGSGENY------------EATW-------------------------------EFLTKRYENKRNIFSDH-----
A7XDH0_DROAN/157-302RHLPI.SETAY------------DNAW-------------------------------ERLNERYDRPRQIIHNL-----
Q4JS97_ANOGA/133-280EHMQI.TADNY------------YVTW-------------------------------EALLKRYDNSKVLKREY-----
Q4EAY5_9RICK/161-306AHLPI.TDSAY------------ETAV-------------------------------SRLNERYDRPRHIVFSL-----

PF14893

H0XX29_OTOGA/1-328ALVEFADGLNRRLIPRQI.P.GKGGPWT..VIFLPQAPDTDL..QDRLSFPAQPQG..QAVARHAAAGGAEAAGG.....
M3Z644_MUSPF/1-327ALVGLTEETSHAVVPKEI.P.GKGGVWR..VIFKPPGLDNEL..LSRLNEFLEGEG..TRLGELTRARAYGNDPS...DL
F7CY48_HORSE/1-330ALVEFTEYLNRSLVPRQI.P.GKGRLWD..VFFLPQGPDSES..RDRPNFPAQPQR..QAVAGRAEAPGEEGAAG....P
M4B0W2_XIPMA/1-317VLCECRQKVNAKACPLDVLPEGSDEPWR..IFGPSEEEDEP...........QNSG..SGCNPFVDS.........GQDS
F6TXQ3_HORSE/2-329VLLELMEDIDVSVIPSEV.Q.GRGGIWK..VIFKTPNQDTEF..LERLNLFLEKEG..QTVSGMFRALGHEGVSP....A
D3Z8Y9_RAT/1-327FLVELARDFDYALVPREI.E.GKGGPWE..VVVKPPNSDDEF..LNRLNHFLEEER..RTVSDMNRVLGTHSNYS.....
M4AZW3_XIPMA/2-318ALCECRETVNAKVIPAEVTPQGSDSRWR..IIGPSGVEEE..................STAQTGTDSLQTPELEM.SQNS
F7AVZ0_XENTR/7-324VLIDSPREIDRERVPQDIYA.GDEGPWR..VVLPDLSDDADD..LT............THVDTLVSQFAVTAPVGVLPSK
PNMA5_HUMAN/1-322VFIELADTVNYTTLPSHI.P.GKGGSWE..VVVKPRNPDDEF..LSRLNYFLKDEG..RSMTDVARALGCCSLPA.....
G1PM76_MYOLU/2-362ALLEVGEGVSLRAVPREF.P.GRGGAWR..VVCRNPTQDAEF..LKNLNEFLDAEG..RTWEDVVRLLHLNDAPA..PRN
F7D322_HORSE/1-321VFIELADTVNYAMMPSEI.P.GKGGAWQ..VVVKPRNPDDEF..ITRLNYFLKDEG..RRMVDVAKSLGYSTLTE.....
G3N1H8_BOVIN/3-317ALVEFAEYLSRSLIPRQI.P.GKGGPWI..VVCLPQAPDAES..QDRPNFPAQPQR..RAVVGRVGEGSRRRCWR.....
F1S2C6_PIG/1-333ALVEFADSFNRSLIPQQI.R.GRGGPWT..VVFLPQAPDSES..QERPNSPAQAQR..QAVAGGADEEGAAGDTG.....
H2PX42_PONAB/1-327ILLELAQDIDYALLPREI.P.GKGGPWE..VIVKPRNSDGEF..LNRLNRFLEEER..RTVSDMNRVLGSDTNCS.....
G1LQR5_AILME/1-315ALVEFAQYLNRSLIPQQI.P.GKGGPWP..VVFLPQAPDSES..QDRPDFPAEPQR..Q..AGAAGEAGAEDEGG.....
PNMA5_MOUSE/1-323VLIELPEVVDYTMMPTHI.P.AEGGAWE..VVVKPRSPDDEF..MNKLIYFLRDEG..RRIVDVAKALGFSTVPT.....
PNML1_BOVIN/3-358ALVEVGEGVNLRAIPREF.P.GRGGIWR..VVCRDPTQDAEF..LKNLNEFLDAEE..RTLEDVVHLLELSRASP..PKT
G3U141_LOXAF/1-317ALVEFADYLNRSLIPRQI.P.GKGGPWR..VIYLPQAPHAEL..QERPAFPIQPQG..QEVADRAGEAGAADEAD.....
H0W6U3_CAVPO/1-332ALVEFAEYLNRNLIPHQI.P.GSGEPWR..VIFLPQVPDSEL..QD....PAQLQGGEETATGVVGMAGAAGEAGPPGEE
H0VWL7_CAVPO/1-322VLIELADTVNYATIPSCI.P.GKGGSWE..VVVKPRTEDEEF..LSRLNYFLKDEG..RKIEDVARVLGCRGFSV.....
PNML1_PONAB/5-364ALIEVGEGVNLSTIPREF.P.GRGGVWR..VVCRDPTQDAEF..LKNLNEFLDAEG..RTWEDVVRLLQLNHPTL..SQN
H0VK73_CAVPO/6-363ALIEVGEGVNLSAVPREF.A.GRGGIWK..VACRDPTQDAEF..LKNLNEFLDAEG..RTWEDVIRLLQLNHPPP..PQS
G3U379_LOXAF/1-308ALVELAQEVDYALVPREV.P.GSGGPWR..VVCAPRCSGEEV..LGRVFHFLEQQG..QTVESVAGALGLGLRRV.....
M4AZA8_XIPMA/3-326VLCECREKLTNADIPNEVLTLDESTVWPIFIVAESSSADEDF..SVKLNTLLQAEG..KTAEDVHALLTGSEPVP.....
D2GZV4_AILME/1-325ALLELTGAVDYAAIPREM.P.GKGGVWK..VVFKPPTSDAEF..LERLHLFLAREG..WTVQDVARVLGFQNPAP.....
F6Z9T2_HORSE/5-364VLIEVSEGVNLRAIPREF.P.GRGGVWR..VVCRDPTQDAEF..LKNLNEFLDTEG..RTWEDVVHLLQLNHPPA..PQN
PNML1_MOUSE/6-363ALVEVSEGVNLSSIPREF.P.GRGGVWR..VVCRDPTQDDDF..LKNLNEFLDGEG..RTWEDMVRLLKLNPNPP..LPN
F1PIM5_CANFA/1-358ALIEVGEGVNLRAIPREF.P.GRGGVWR..VVCRDPTQDAEF..LKNLNEFLDAEG..RTWEDVVRLLQLGHSPR..PQN
F7H8Z7_CALJA/1-318ALVEFADSLNRSLIPRQI.P.GKGGPWN..VISLSQAPDAEF..QDMASFPAQPQG..QAVARGAGEAG...........
PNM6B_HUMAN/1-319ALVELDREVNYALVPREI.P.GTGGPWN..VVFVPRCSGEEFLGLGRVFHFPEQEG..QMVESVAGALGVGLRRV.....
G3QYD8_GORGO/1-326ALVGLTAETSHALVPKEI.P.GKGGIWR..VIFKPPDPDNTF..LSRLNEFLAGEG..MTVGELTRALGHENGSL...DP
F6WC96_CALJA/1-321ALVEFADSLNRSLIPRQI.P.GKGGPWN..VISLSQAPDAEF..QDMASFPAQPQG..QAVARGAGEAG...........
Q5BJV6_RAT/1-328ALVGLTVETGSALVPKEI.P.AKGGVWR..VIFKPPDADSDF..LCRLNEFLKGEG..MTMGELTRVLGNRNDPL...CL

PF16297

H0W794_CAVPO/2-110RP...------------------..RW-------------------------------RNPIPFPETFNGDTDR------
D3ZTE6_RAT/24-138RLLRQ------------------VRLP-------------------------------SCPVPYPSRFSGESGR------
G1MLQ7_AILME/2-114LR.PQ------------------TQRW-------------------------------RNPIPFPETFDGDTDR------
F7ASC6_CALJA/2-113LL.PA------------------RRRW-------------------------------RNPIPFPETFDGDTDR------
Q9D6I0_MOUSE/2-112EL..R------------------KGRW-------------------------------QNPIPFPELFDGEMEK------

PF14244

B9SYP2_RICCO/12-59------NG.FN------------YVSW-----------------------------------------------------
U5FIT1_POPTR/2-49------DG.KN------------YLYW-----------------------------------------------------
F6H7D5_VITVI/2-49------DG.NN------------YSYW-----------------------------------------------------
M1B3X1_SOLTU/18-62------TGPAN------------YSLW-----------------------------------------------------
K7L0W9_SOYBN/14-61------LG.DN------------YSSW-----------------------------------------------------
B9S0Y3_RICCO/33-80------NG.DN------------YPGS-----------------------------------------------------
B9S242_RICCO/33-80------TR.EN------------FASW-----------------------------------------------------
K7LQ32_SOYBN/26-73------NA.NN------------YHTW-----------------------------------------------------
U7DX79_POPTR/501-548------VE.DN------------YSTW-----------------------------------------------------
B9RHL9_RICCO/34-81------EE.DN------------YQTW-----------------------------------------------------
Q84JT5_ARATH/26-70------DE.DN------------YVAW-----------------------------------------------------
M1DJS2_SOLTU/28-75------DG.TG------------YRSW-----------------------------------------------------
M1BMN2_SOLTU/26-72------DG.IG------------YRSW-----------------------------------------------------
B9T813_RICCO/29-76------TA.IN------------YTSW-----------------------------------------------------
B9SUJ8_RICCO/31-74------TS.MN------------FASW-----------------------------------------------------
B9T3E3_RICCO/35-82------NE.NN------------YIPW-----------------------------------------------------
M4EME5_BRARP/24-71------KG.EN------------YSEW-----------------------------------------------------
T1J2U7_STRMM/119-166------GK.TN------------FDTW-----------------------------------------------------
K7JVV9_NASVI/23-68------DG.KN------------FTIW-----------------------------------------------------

PF13961

Q5AT23_EMENI/319-345------DR.TN------------VSSW-----------------------------------------------------
Q5AT23_EMENI/515-541------TK.TN------------VTTW-----------------------------------------------------
A9RSN5_PHYPA/14-40------DG.SW------------YSIW-----------------------------------------------------
B0D6P6_LACBS/11-37------NN.SN------------YAEW-----------------------------------------------------
B0WQU4_CULQU/10-36------DG.TN------------WPVW-----------------------------------------------------
B0WWB7_CULQU/11-37------NE.AN------------WSTW-----------------------------------------------------
B4K1A4_DROGR/12-38------DG.EN------------YVVW-----------------------------------------------------
B4LA17_DROMO/10-36------DE.GN------------YDTW-----------------------------------------------------
B4LAF9_DROMO/10-36------DE.NN------------YGVW-----------------------------------------------------
B4LE08_DROVI/13-41------SGRDN------------YKEW-----------------------------------------------------
B4MX54_DROWI/10-37------RGREN------------YDVW-----------------------------------------------------
B4NQE5_DROWI/11-37------NA.EN------------YDTW-----------------------------------------------------
B4NQR9_DROWI/10-36------ED.SN------------YDWW-----------------------------------------------------
B6HA76_PENCW/19-46------TGSDN------------FATW-----------------------------------------------------
B6QCF0_PENMQ/36-62------GR.SN------------IKNW-----------------------------------------------------
B9NDW0_POPTR/15-41------IE.SN------------YKVW-----------------------------------------------------
B9RBX9_RICCO/17-43------TG.DN------------YSKW-----------------------------------------------------
B9RC68_RICCO/10-37------GSYNN------------YANW-----------------------------------------------------
B9S5P6_RICCO/16-42------DS.DH------------YNIW-----------------------------------------------------
C5GBD9_AJEDR/188-215------TGTSN------------YTTW-----------------------------------------------------
C5WNA6_SORBI/166-192------TR.TN------------YGEW-----------------------------------------------------
C5XQM0_SORBI/42-68------TK.SN------------YHEW-----------------------------------------------------
C5XUK3_SORBI/137-163------DK.SN------------YYEW-----------------------------------------------------
C5Z583_SORBI/42-68------TR.TN------------YGEW-----------------------------------------------------
C6JSM1_SORBI/23-49------TA.NN------------YISW-----------------------------------------------------
C7J1L6_ORYSJ/181-207------TK.TN------------YIEW-----------------------------------------------------
C7J1U3_ORYSJ/16-44------DG.TN------------YAQW-----------------------------------------------------
C7J5A1_ORYSJ/49-75------TK.TN------------YNDW-----------------------------------------------------
C7J6P4_ORYSJ/14-42------DG.TD------------FPHW-----------------------------------------------------
C7J7K5_ORYSJ/83-109------TR.TN------------YTDW-----------------------------------------------------
D0NBZ2_PHYIT/18-44------DG.AD------------FEMW-----------------------------------------------------
D0P386_PHYIT/3-29------NG.KN------------YAPW-----------------------------------------------------
D0P4P1_PHYIT/16-42------DG.TG------------YRVW-----------------------------------------------------
D0RLQ9_PHYIT/21-47------DG.KD------------YEVW-----------------------------------------------------
D2A4C7_TRICA/13-39------NK.EN------------YDTW-----------------------------------------------------
D2A543_TRICA/14-40------NG.KD------------YDHW-----------------------------------------------------
Q0DA14_ORYSJ/28-54------TR.AN------------YHQW-----------------------------------------------------
Q0IZT5_ORYSJ/33-59------TS.TN------------YSTW-----------------------------------------------------
Q0J5Y3_ORYSJ/54-80------TR.TN------------YDEW-----------------------------------------------------
Q16S15_AEDAE/12-38------DG.TN------------FSNW-----------------------------------------------------
Q6K285_ORYSJ/82-108------TK.TN------------YSNW-----------------------------------------------------
Q75M81_ORYSJ/48-74------TR.SN------------YSDW-----------------------------------------------------
Q7G5Z8_ORYSJ/52-78------TS.SN------------YIEW-----------------------------------------------------
Q7G756_ORYSJ/12-40------DG.TD------------FPYW-----------------------------------------------------
Q7XKY1_ORYSJ/53-79------TK.TN------------YSDW-----------------------------------------------------
Q7XMT1_ORYSJ/56-82------SR.TN------------YPDW-----------------------------------------------------
Q84Q85_ORYSJ/36-62------TR.TN------------YHEW-----------------------------------------------------
Q850T3_ORYSJ/12-40------DE.TG------------FSYW-----------------------------------------------------
B9GKP2_POPTR/14-39------SG.SN------------YNLW-----------------------------------------------------
B9HL08_POPTR/16-42------RG.DN------------YDDW-----------------------------------------------------
D7U4H2_VITVI/8-34------TE.DN------------YENW-----------------------------------------------------
F6HTJ6_VITVI/13-39------NN.QN------------YNTW-----------------------------------------------------
F6HVN0_VITVI/97-122------TE.NN------------YENW-----------------------------------------------------
F6HVN2_VITVI/18-42------.E.GN------------YENW-----------------------------------------------------
I1Q6P1_ORYGL/57-85------DG.TH------------YAAW-----------------------------------------------------
Q0IZC5_ORYSJ/9-35------AG.EN------------YDIW-----------------------------------------------------
Q0J8A6_ORYSJ/26-52------TA.TN------------YTSW-----------------------------------------------------
Q53L57_ORYSJ/161-185------DG.IN------------YNHW-----------------------------------------------------
Q60EK9_ORYSJ/143-168------EE.NN------------YGVW-----------------------------------------------------
Q682G3_ARATH/13-39------TK.SN------------YDNW-----------------------------------------------------
Q7X7W1_ORYSJ/19-45------TK.TN------------YGDW-----------------------------------------------------
Q852C7_ORYSJ/12-40------DG.HN------------FVIW-----------------------------------------------------
Q8S5D4_ORYSJ/104-130------TR.TN------------YEEC-----------------------------------------------------
Q8SAX3_ORYSJ/39-67------NG.TD------------YAAW-----------------------------------------------------
Q94GR9_ORYSJ/14-42------NG.TN------------YSTW-----------------------------------------------------
Q9AUM6_ORYSJ/511-536------TK.TN------------YAEW-----------------------------------------------------
U5G3M5_POPTR/16-42------NG.TN------------YDFW-----------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------IRHREQQLRQCVQKEKE--------NVE-SFFERV.EKLVAMTSS----GKSI-
PEG10_MOUSE/174-267--------------------------REAAKRKIRRLRQ.GPG--------PVV-DYSNAF.QMIAQDLD.----....-
Q9AUY8_ARATH/31-127--------------------------WDRLESNFLDLVQ.GRR--------TVR-EYEEEF.NKLRRYVGR----...E-
Q9FWC7_ORYSJ/155-249--------------------------EREKMSALDTLTQ..TG--------TVT-EYKQQF.DYLVYQIR.----....-
Q9FE41_ORYSJ/775-871--------------------------KDFSIVELSQVRQWRDE--------AID-DYVIRFRNSFVCLARE----....-
Q9LP90_ARATH/163-253--------------------------RGPSQS.LFCIKQ..TG--------SVA-EYVQRF.EDLSSQVG.----....-
Q9LMV1_ARATH/257-344--------------------------NQTSNADLWSISQGAKE--------SLR-SFVDRF.KLVVTNIT.----....-
Q9ARZ4_ORYSJ/100-192--------------------------EPKTQQHLLGIRQRPGE--------SIR-EYMRRF.SQARCQVQD----....-
Q9FYC9_ARATH/102-194--------------------------VDDSIAKLKLLQE..TE--------GIE-VYHARF.ESICTRVK.----....-
Q9SK57_ARATH/214-310--------------------------WDRLECAYLDLVQ.GNR--------TVR-EYDEEF.NRLRRYVGR----...E-
Q9FRJ2_ORYSJ/81-182--------------------------SVYLETEFRSINQ.GDM--------TIT-QYTAKL.KQLADGLRD----I.NM-
Q9AV68_ORYSJ/351-443--------------------------RPGTQFDLYNIVQKSGE--------SLR-DYIRRF.SEQRNKISD----....-
Q9AYB5_ORYSJ/567-664--------------------------VSLKKKEFRSLTQ.GSR--------SVT-EYLHEF.NRLARYAPE----...D-
O23529_ARATH/90-186--------------------------IKQLRTQIKQLKK.GTK--------TID-EYVLSH.TTLLDQLAI----L.GK-
O82608_ARATH/272-360--------------------------PSTSDADLWSLSQQPNE--------PLR-DFLAKF.RSTLAKVE.----...G-
Q9AYC2_ORYSJ/729-826--------------------------MAQKKREFRALHQ.GNR--------TVT-EYLHEF.NRLARYAPE----...D-
Q9FGL3_ARATH/131-241--------------------------SYQLTQQIWSLQQ.GNM--------SLS-DYYTTL.KTLWDDLDG----A.SC-
Q9SQW9_ARATH/264-354--------------------------GSSAVDHLLNVRQ..TG--------TVE-EYRERF.EELTVDLPH----....-
Q9LNM2_ARATH/83-178--------------------------PDTSDADLWSLSQQPNE--------PLR-DFLANQ.RRGGSLCSE----E.ST-
Q9AYB6_ORYSJ/694-791--------------------------VALKKREFRELKQ.GNR--------SVM-EYLHEF.NNLARYAPE----...D-
Q9XE67_SORBI/155-252--------------------------MDAKVEEFRNISQ.GTQ--------KVQ-EYATRF.TRTMRYAPD----...E-
Q9ZPF9_ARATH/97-196--------------------------HRELHQRLRNLVQ.GNR--------TVE-EYFKEM.ETLMLRAD.----...V-
Q9XII7_ARATH/126-236--------------------------YNLTQE.IQDFRQ.GTL--------SLS-EYYTRL.KTLWDQLD.----....-
Q9SIM3_ARATH/131-240--------------------------YNLTQE.IQDLRQ.GTM--------SLS-EYYTLL.KTLWDQLD.----....-
Q9MA68_ARATH/89-183--------------------------TARLRNEISGFNQKNSE--------SFA-EAWERF.KRYSTQCPH----...H-
Q9M225_ARATH/186-282--------------------------LDRMEVRFLELTL.VER--------SVW-EYDREF.NRVLVYAGW----...G-
Q96467_HORVU/82-176--------------------------IISLRNDIMNFKQLDHE--------HVA-QAWERM.KLMIRNCPA----...N-
Q9AXC5_ANTHI/295-388--------------------------..QVRERILELIQ.WSN--------SVC-EYESKF.TRLIQYAPH----...Y-
Q9M0T9_ARATH/89-183--------------------------TARLRNEISGFSQKTGE--------SFC-EAWERF.KGYTNQCPH----...H-
Q9SY43_ARATH/188-284--------------------------LDRMEARFLELTQ.GVR--------SVR-EYDRKF.NRLLVYAGR----...G-
Q9C7H8_ARATH/150-242--------------------------DDPMAE.LKKLQE..TD--------GIV-EYHQQF.ELIKVRLN.----....-
Q9ZNW4_SORBI/210-302--------------------------ESLTSTDLFQCRQNQGE--------ALR-EYFQRF.VQTKARAP.----....-
Q9SUN0_ARATH/223-313--------------------------PGASSSDLWSMTQENGE--------TLN-DYLGRF.KEILSSYHH----G..R-
Q9M252_ARATH/163-260--------------------------MDSLEDDFEELRQ.DTK--------KVR-ENEREL.SHLSRFSVR----...A-
O93283_TAKRU/149-242--------------------------GEDAASRLLALQQ.GSR--------SVA-EYTLEF.RILAAESR.----....-
Q9ZQQ3_ARATH/198-290--------------------------KSISDTDLWNLSQGPNE--------TLR-AFITKF.KYVLSKLSR----....-
Q9ATX2_MAIZE/179-271--------------------------KPVTAQALFQCTQDHEE--------YLQ-AYVRRF.LRLRAQAPT----....-
O81471_ARATH/148-242--------------------------SEELRNKLSTFTQGPAE--------AFK-AAWVRF.KEYQRDCPH----...H-
Q9FW76_ORYSJ/181-275--------------------------KQALIRQWIHITQ..TS--------SVA-DYVDRF.DSIMHQLMA----Y.GG-
Q9SKF2_ARATH/107-197--------------------------TARLRNEISSFTQRSNE--------SFC-EAWERF.KGYKMQCPH----...H-
Q9SYE8_ARATH/131-230--------------------------HRELHQRLRNLVQ.GSK--------TVE-EYFLEM.ETLMLRAD.----...L-
Q98SV9_TAKRU/117-207--------------------------SGEAASQIRSLRQ.GSS--------SVA-DY...F.RILAARSG.----....-
Q9SJP0_ARATH/291-382--------------------------KGASNVDLWTMAQTAKE--------SLR-SFIGRF.KEIVTSVA.----....-
Q9XE85_SORBI/114-212--------------------------MELKQEEFRSLRM.GSM--------TVA-EYHDTF.EQLARYAPN----...D-
Q9ZS84_SOLLC/150-247--------------------------SWLARDKLKRLRQ..TG--------SVR-EYIKEF.TSVMLDIQN----....-
O48967_MAIZE/245-337--------------------------QHGVEAHLHAVRQEPRE--------TLR-MFISRF.TKVQGTIPR----....-
Q9LZG5_ARATH/148-244--------------------------IDDLEMKFLRLQQ.GTK--------TVR-KYEKEF.HSLERFERR----....-
Q9SX87_ARATH/132-224--------------------------LDDPISELKQLKE..TN--------GIE-EYHKKF.ELLRARVN.----....-
Q9LQH2_ARATH/476-575--------------------------YRELHNRLRNLVQ.GNK--------SVE-EYYKEM.ETLMLRAD.----...I-
Q9FZN9_ARATH/121-215--------------------------TARLRNDISGFTQTNNE--------TFC-EAWERF.KGYQTQCPH----...H-
Q9SLQ0_ORYSI/194-290--------------------------ARDLLHKLQQLRQ.GNK--------SVE-EYYQAL.QIGMLRCG.----...L-
Q9UVC2_PASFU/52-153--------------------------IATAVRVIQHLTQ..KT--------STA-EYAAKF.QEYAQLTD.----....-
Q9ZPG6_ARATH/97-191--------------------------TARLRNEISGFTQKNNE--------TFF-EASERF.KSYTTYCPH----...H-
Q9ZUK1_ARATH/211-302--------------------------SDITEAHLWNFSQSADE--------PLR-TY......IYRVQGNH----...V-
Q9FWB1_ARATH/104-198--------------------------TAIMRNEISSFQQTGTK--------SFH-EAWERF.KVYYRECPH----...H-
Q9HFY8_COLGL/148-252--------------------------KRQAERDLSNLRQ..NK--------SAT-LYAAEF.RRLAARLD.----....-

PF14223

C6JSM1_SORBI/65-207--------------------------LQTLKSEFDAMRMKDEE........SLD-QYVGRL-TGMSVRYGN.....LGG.
Q5TKD7_ORYSJ/82-224--------------------------EQALRSQYEAIQFKDGE........TVE-DFALRL-HALVIDIRD.....MGG.
C5XUK3_SORBI/191-334--------------------------LQRLRRDWENISVNPGE........QVE-DFAMRL-STLHQQLVI.....HGD.
Q7FAB9_ORYSJ/122-264--------------------------AQKVRAEYESLAFRGDE........TVE-DFALRL-TTIVNQLAT.....LGD.
Q53P77_ORYSJ/59-201--------------------------AQKLRSEYEALAFRDGE........SVE-DFAMRL-NTVVTQLST.....LGD.
U5G3M5_POPTR/78-220--------------------------LQGVRADFEYLRMTESE........SLD-GYLAKF-FATINNLKS.....LGE.
M1B1W5_SOLTU/38-180--------------------------VLNLIRDFEIQKMKETE........TIK-DYSERL-LNIANRVRL.....LGS.
Q75K50_ORYSJ/66-213--------------------------RDLFKKEYIKFEMKPGE........ALD-DYLVRF-NKMLSDIRS.....VDSS
Q7XL83_ORYSJ/59-200--------------------------LHFLKIQYETFSMLPHE........SVN-DMYGRL-NVIVNDLKG.....LGA.
K4A379_SETIT/105-236--------------------------......QLEHFIMLEEE........TVT-QMFDRL-MLLVSDIRT.....LGS.
Q7XWR8_ORYSJ/85-228--------------------------VEIFKGQFERFVMLDGE........SPS-DMYDRL-SKIVNEIKG.....LGS.
Q53LJ7_ORYSJ/949-1092--------------------------IELLEGRLGRFVMDDKE........TSQ-QMYDRM-MILVNKIKG.....LGS.
K4AQP1_SOLLC/29-171--------------------------ALALIQQYEQFKMESGE........TIE-EMHSRF-QTLIAGIRV.....LNK.
W1NQ11_AMBTC/80-222--------------------------IQIYSTQYENFKMKSDE........TIA-NMYTRF-TTITNGLNS.....LGK.
J9KKF0_ACYPI/70-208--------------------------..LLQQKFFSYVKIPTD........NIS-AHIFKL-EKLANDLKL.....AGE.
X1WMG8_ACYPI/69-207--------------------------..IVQQKFYRYTMDPKD........NIA-SHISKL-ENLSRQLKQ.....LGE.
X1XSG1_ACYPI/1016-1154--------------------------..LLQEKFYGYVMDPVE........SMA-GHISKL-ENLSKQLAQ.....SRE.
E5SZD6_TRISP/22-165--------------------------..RLMEEFFKCAKAETE........DMA-RYVARL-QKLFSDLNDELERLTGT.
K7J7F1_NASVI/67-205--------------------------..LVSQRFHEYRMNPKD........TVV-QHVSKV-QNLASQLLD.....LGE.
K7JBX1_NASVI/56-194--------------------------..LMSQRFHEYRMDPND........TIV-QHISKV-QNLARQLID.....IGE.
K7JBR0_NASVI/56-192--------------------------..MLTQRFHAYTMDPTD........TVI-QHIAKV-QNMAMQLLD.....LGE.
F4WZJ7_ACREC/51-189--------------------------..AALEAYNDYHWKNDM........TVT-SYISGL-MLIENKLKA.....QKL.
K7JSP6_NASVI/56-194--------------------------..AAWKKLYAFHITEDK........TVR-MHLERF-ESIVKKLEE.....VDK.
Q6AUV8_ORYSJ/140-277--------------------------..YVMEQFYDYKMVDDR........SVV-EQAHEI-QMLAKELEN.....NNC.
Q5KQJ6_ORYSJ/54-191--------------------------..YIMEQFHDYRMADNR........SVV-EQAHEI-QTMAKELEL.....LKC.
F6HMS3_VITVI/69-206--------------------------..FLISQYIDFKFFDEK........PLL-PQIHEL-QVIVNKLKV.....LKI.
U5GQH9_POPTR/36-171--------------------------..QTSKELFRCKMTKGS........SMN-THVLKM-NGYIEKLEQ.....LGF.
D0P4M1_PHYIT/31-154--------------------------..ALREQFVALKYQDGA........DML-THINGL-KTLAGRLSN.....QGK.
U7E2P1_POPTR/73-196--------------------------..TIRQQVTYFRKEDNR........TIG-EHIRIF-KGLCDDLAA.....IGK.
U5FM44_POPTR/75-204--------------------------..TLRQQLTYLCKDDNR........TIG-DHIRIF-KGLCDNLAG.....IGK.
K7MSY7_SOYBN/76-212--------------------------..TLHQQITYLRKEDDQ........SIG-EHIRTF-QGLCDNLAA.....IGK.
U5GX94_POPTR/76-212--------------------------..TLRQQVTYFRKEEDQ........TIG-EHIQKF-KRLCDSLAA.....IGK.
U7DWS5_POPTR/76-203--------------------------..TLRQQVTYFRIHENH........SME-EHIRTF-TSLCDSLVA.....IGK.
K7JMW1_NASVI/53-191--------------------------..LLLKRLCRTVLGEDG........DME-AHITNF-SKTVNLLVA.....LGT.
K7JZ52_NASVI/48-186--------------------------..HLMRRPFNIKMSSDG........DVE-SHITEM-LTMLNKLTV.....MGQ.
E5RYC0_TRISP/55-187--------------------------..YLMRKLYGMRFTHG.........TMK-SHINGI-LEIVTQLRG.....LGK.
M7ZB77_TRIUA/364-501--------------------------..YLKQKLHGMRIQEGS........DLV-EYMNAF-NQVVTDLAR.....LGA.
Q8H023_ORYSJ/184-321--------------------------..YLKQQLYGLQMQEES........DLR-KHVDVF-NQLVVDLSK.....LDV.
U5GTK8_POPTR/27-149--------------------------..YLKHKLFGLKMSEGT........DLN-RHFN..-..................
U5GAW6_POPTR/1-122--------------------------....MEKLFGLKISEDT........DMN-QHINMS-NQIVSDSKQ.....IDV.
K4D0A3_SOLLC/29-166--------------------------..YLKKQLHALHMGEGT........NFL-SHLNVL-NGLITQLAN.....LRV.
J3N766_ORYBR/276-405--------------------------..RLKKRLSTIRMAEGT........SIR-SHLNEF-NSLIIDLEK.....LDV.
K4C212_SOLLC/50-190--------------------------..LKKHCLYSLRMKKGTT.....TASVT-SHINDF-ESIVTDLEN.....LDE.
Q53QA4_ORYSJ/49-186--------------------------..QMKMKLFTLKMKEED........SVI-THMAEF-KKIVADLVS.....MEV.
I1R349_ORYGL/53-190--------------------------..HIKMKLFLHKLQESG........SVL-NHISVF-KEIVADLVS.....MEV.
Q8LNW7_ORYSJ/86-223--------------------------..HLKQKLFLHKLQDDG........SVM-DHLSTF-KEIVADLES.....IEV.
B9GES3_POPTR/51-190--------------------------..FVIRDLVNLKYRDGE........DAS-VHINVF-QGFLNQLSL.....MNL.
K4BHD1_SOLLC/28-167--------------------------..FLLKQLMNIRYKEGT........SIS-DHTNDF-QGVLDQLSG.....MGV.
I1HDH1_BRADI/50-189--------------------------..FLIKQLMRLRYKEGT........PIA-DHVNEF-QGTINQLSS.....MGI.
K4APP6_SOLLC/9-118--------------------------............................-......-....SQLNS.....VDI.
D6WYA2_TRICA/60-197--------------------------..TLLKILILCKMSDSD........DVR-SHLNNF-FASVDKLVE.....MNV.
E1ZV45_CAMFO/58-195--------------------------..TLLKQLTLHKMNDGG........DVR-DHLRRF-FDTIDKLSE.....MDV.
T1HSX1_RHOPR/55-192--------------------------..TLLKQLILQKMQEGE........DIR-EHLRKF-FDAVDKLND.....MEV.
F4WEW2_ACREC/61-198--------------------------..TLLKRLALQKMADGE........DVR-EHIRTF-FDAVDKLTE.....MEV.
E2AJT1_CAMFO/8-145--------------------------..TLLKRLTLQKMADNG........DIR-IHLNDF-FDSVDKLSD.....MGV.
T1IKQ2_STRMM/62-199--------------------------..TLLKRMILHKMAKGE........SAQ-DHVRGF-FEAERKLSD.....MGV.
E2A5G7_CAMFO/57-194--------------------------..TLLKSLMLRKMPDDG........DVK-DHLNDL-FDAVDKLQS.....MNV.
B4NQE5_DROWI/52-189--------------------------..SLLKRVALSRVCEGS........DAR-HHINDF-FDAVKKLKE.....IGV.
B4N7F3_DROWI/26-163--------------------------..SLYNELLSLRMTDGQ........EMP-SYINGF-SDVLDQLAG.....AGV.
E2AMM3_CAMFO/51-188--------------------------..VLYRQLYNLKKNPSE........PMS-QYINNF-QEKINLLED.....AGI.
T1J9B0_STRMM/91-207--------------------------.........................SFR-SQVALL-TELINQLND.....MDL.
I1F6R0_AMPQE/28-159--------------------------..SLRRKLYSLKLREQD........SVQ-DHIKSM-IEIFNELSI.....VGD.
I1EHE8_AMPQE/27-156--------------------------..ALRCKLHSLRLEKGQ........SVQ-EHIKSM-TEVFSELSV.....IGD.
I1FHD8_AMPQE/25-162--------------------------..NLRRRLHSLKLKDGE........SVQ-SHIKEM-TEIFNDLAI.....VGD.
I1E7Y8_AMPQE/59-197--------------------------..NLRRKLHSLKLNDSE........SVQ-EHIKTM-METFHELSV.....VGD.
I1GAG6_AMPQE/26-163--------------------------..TLRRRLHSLKLKEGQ........SAH-NHVTNI-IKTFNELPI.....VED.
I1FXX0_AMPQE/30-175--------------------------..TLWKKLYSFRLKEGDSFRLKEGDSIH-DHIKAM-TEIFNELSV.....IGA.
I1FA02_AMPQE/58-195--------------------------..VLRRKLQSLKLKDGG........SVQ-QHIREM-TETFNELSV.....MGV.
A9RF54_PHYPA/33-140--------------------------..NFAHKFFTVKMEEGE........DLM-AHVNKV-KALANQLAI.....VDK.
H3H865_PHYRM/30-162--------------------------..FLRRRFFTTMMDEGD........DVL-EHINKL-KTLAEQLDA.....VGA.
H3H7I3_PHYRM/74-190--------------------------..FLRRRFFTTMMDEGD........DVL-EHINKL-KTLAEQLDA.....VGA.
H3H4T3_PHYRM/256-393--------------------------..FLRRRFFTTMMDEGD........DVL-EHINKL-KTLAEQLDA.....VGA.
I1FL57_AMPQE/42-163--------------------------..LFKKQY....LKDGT........SIE-NHMNEL-KEIADRLAV.....LGV.
H3H8S0_PHYRM/58-195--------------------------..YLKRQLFSMEMSEGG........NVL-HHCNEV-LNISAKLSS.....IGA.
K3WFC4_PYTUL/54-191--------------------------..YLKRQLFSIEMKESD........NLL-HHCNEV-LNIHAKLVS.....IGA.
X1XSQ9_ACYPI/36-160--------------------------..YLLKRLLTIKYNEEE........PIE-NYLIRF-DDLVRQLKS.....AGG.
J9KWH3_ACYPI/52-189--------------------------..YLLKKLITMKFDDNE........SME-THLSQF-DDLLRQVRL.....SGG.
D2A543_TRICA/50-188--------------------------..FLRKKLLTMKLSSND........TME-KHFLKF-EETIRELKS.....VGA.
X1WUQ9_ACYPI/53-190--------------------------..YLRKRLLTLRLAEGD........PLE-EHFVIF-DSRVRQLKT.....SGA.
H9JTX7_BOMMO/22-158--------------------------..HLRRKLLSLKLRDD.........KLE-DYFMRF-ESLIREIEN.....IDK.
K7JW30_NASVI/49-187--------------------------..VCRNKLEKLKLEKYS........DTA-TFFSDF-EKAVNELKG.....AGA.
K7JWT6_NASVI/101-239--------------------------..LCKRKLLDLKMEESE........NPT-DFYNNF-EKLVNELKN.....AGE.
H3H572_PHYRM/51-187--------------------------..TMTRRLHEFKMEGGV........TMA-KHLDDF-DELIVGLQT.....LGE.
H3H7F9_PHYRM/48-184--------------------------..TMTRRLHDFKMDDGT........SMA-KHLDDF-DELVVGLQT.....MGE.
M4B777_HYAAE/28-150--------------------------..QRRRQLHKFKMQKGA........SVM-DHFLKF-DELGMSIQA.....IGD.
M5BUS0_THACB/75-214--------------------------..FLYQQLTTAKIEEDE........DIA-TAFNNI-RSLAKKMET.....LGE.
T1ILJ6_STRMM/60-198--------------------------..KLYENFYLIQRNENE........KLE-TFINLI-QQAADDLAA.....IKV.
T1IMI2_STRMM/102-238--------------------------..MLREKFHSLRIDVNE........AMD-DFIERV-DSAAKDLET.....VNV.
T1ILE6_STRMM/56-194--------------------------..RLLGQFHLAQMQPNK........SII-LFLNRI-RQLSRDLEL.....VGK.
M2Q9R4_CERS8/111-253--------------------------..NMLERFQTTRCSEHG........DVS-KHLDTL-GEMVEELSA.....IGV.
F8PLK7_SERL3/29-165--------------------------..ELQDKLAALHCPKKG........NMH-THIDKI-RDMWEQLSA.....AGV.
H3GVH0_PHYRM/36-172--------------------------..WLKEKFSSFKYTTS.........SVS-KHVTEL-EQLVLEMKS.....AGC.
H3GKE9_PHYRM/34-170--------------------------..WLKEKFSAFKFTAS.........SVS-KHVTEL-EKLVMEMKN.....AGC.

PF03564

A7SE42_NEMVE/491-638--------------------------INEIMKVRGVTSEKDAA--------GLR-RFYDAV-ETKHRGLQA-----LGV-
Q17051_ASCLU/155-293--------------------------HTELQNLPS....DNGS--------QLV-ATVQAL-ERILRQLEQ-----AGE-
Q23992_DROME/160-308--------------------------MNRLMDMPN.LNLESNK--------QIK-TFIDTI-NESIYIIKL-----KAQ-
A7XDH0_DROAN/157-302--------------------------LDTFMELPS.TNNGEVS--------ILR-SISDGA-NEVIRALDS-----IGH-
Q4JS97_ANOGA/133-280--------------------------FKAFYSLEK.MKTDSTE--------ELA-RIVNEA-NRLVRGLER-----LNE-
Q4EAY5_9RICK/161-306--------------------------LEQFTRLPE.TTKIDVS--------VLR-KVTDGA-NEIVRALDA-----IGE-

PF14893

H0XX29_OTOGA/1-328.EEAAGAAGEADAWSRQWSESLKPL.LRS..LACQELRAFSGREQPGCGEESFE-SWLDHA-KDMLYLWRHTSERERRR-
M3Z644_MUSPF/1-327GQN.MIPEVQAPMLARALEEALQPV.LQY..LKYKKLRVFSGSNPPEPGEEEFE-SWLFHT-TEMMKTWR.VSDMEKRR-
F7CY48_HORSE/1-330GVPAASEEEAAAARSQHWRQTLQSL.LDA..MAYRALRRFSGVEEPGCGEESFE-SWLHHA-NDTLYLWRHMSERERRS-
M4B0W2_XIPMA/1-317PFRTSTPEAIIRAVGEVLQMANPRSSSEG..SPYRRLRTFSGVQPTPPGEETLE-NWIEQA-RLMIEESD.RPEREMKM-
F6TXQ3_HORSE/2-329AVPCVSPELLAHLLGQAIAHAPQPL.LP...MRYRKLRVFSGSAVPAPEEEPFE-IWLEQA-TEIVKEWP.VAEAEKKR-
D3Z8Y9_RAT/1-327.PTKTAISADFWAWAQTLGAVMQPL.LEQ..MLYRELRVFSGNTISIPGLLAFD-SWLEHT-TEMLQMWQ.VPEVEKRR-
M4AZW3_XIPMA/2-318LFQASSPEAIIRAVGDVLQLTSRPT.SDN..GSYRRLRTFSGVLPTPQGEEHLE-NWLEQA-RLMIEESD.KPDREKKM-
F7AVZ0_XENTR/7-324RLSDSPAEQSQVKILSALGLLTDQLTQQAWNGNFERLKVFSGADPVPSGEESFE-SWRDSA-MVSVRDWA.GPEATMRR-
PNMA5_HUMAN/1-322......ESLDAEVMPQVRSPPLEPP.KES..MWYRKLKVFSGTASPSPGEETFE-DWLEQV-TEIMPIWQ.VSEVEKRR-
G1PM76_MYOLU/2-362RNQNPPPGSWVEALGALLGTVMQVI.............LHLDSELRNQEEA...-....RA-QEAEEAYALAMAASAAG-
F7D322_HORSE/1-321.......GMEPEGLAQVKLPVLQPL.KES..MWYRKLKVFSGSVSPGPGEENFE-GWLEQV-TDMMQIWQ.VPEVEKMR-
G3N1H8_BOVIN/3-317............NRTGEWWLALEPV.LEN..MGYLELRTFSGMEEPDEGEESFE-SWLDHA-NDMLYLWRHVTEMERRR-
F1S2C6_PIG/1-333....AAGVAGSLSMEGAAGEAGAPG.EGAGAMGYEELRAFSGLGEPGGGEESFE-SWLDHA-NDMLYLWRHVSERERRR-
H2PX42_PONAB/1-327.APRVTISPEFWTWAQTLGAAVQPL.LEQ..MLYRELRVFSGNTISIPGALAFD-AWLEHT-TEMLQMWQ.VPEGEKRR-
G1LQR5_AILME/1-315............SWTQQRNQAQQPV.PEN..MAYGELRTFSGLEEPDQEEESFE-SWLDHA-NDMLYTWRHVSERERRR-
PNMA5_MOUSE/1-323......GKIELKNLDQDKPKGLKSLCNNS..TCYKKLKVFSGSPFPGPGEESFE-TWLEEV-TELMQLWQ.VSEREKKQ-
PNML1_BOVIN/3-358QNR..STENWAEALGVLLGAVVQII.............YYMDAEMLSQEEA...-....RA-QDLAKAQAVASLASAAG-
G3U141_LOXAF/1-317............AWAQQWRHALQPV.LES..LAYQELRPFSGREEPGPGEEPFQ-GWLDHA-YDMLYLWRHVSEKEKRR-
H0W6U3_CAVPO/1-332GAWDVAAATHHRAGAQQWEQALQPV.MEN..MAYQELRAFSGMEELDPEEESFE-SWLNHA-NDMLYLWRHVAERERRR-
H0VWL7_CAVPO/1-322......EDEDVGTSGPVSSLPVHPV.KES..LWYRKLKVFSGSPSPGSGEEPFE-AWLEHV-TELMQVWQ.VSEAEKRR-
PNML1_PONAB/5-364QHQ..PPENWAEALGVLLGAVVQII.............FCMDAEIRSREEA...-....RA-QEAAEFEEMAAWALAAG-
H0VK73_CAVPO/6-363ANQ..ASENWGEALGVLLGAVVQVI.............LCRDAEIRSREEA...-....RA-QEAAEAEEGAAWALAAG-
G3U379_LOXAF/1-308............CWLRSVSQAVQPW.VET..VRYQRLGVFSGREEPGPGEEPFE-AWLDHA-QRTCCTWWHG.......-
M4AZA8_XIPMA/3-326....SPTESLIRAVSDLLDKAAKPA.TEA..GGFRRLRTFSGILPTPAGEEQFD-HWLEQA-YMMVEVSE.CSPKEKRR-
D2GZV4_AILME/1-325...TPGPDMPAEMLNYILDSVIQPL.VES..IWYKKLTLFSGRDIPGPGEETFD-PWLEHT-NEVIEEWQ.VSDVEKRR-
F6Z9T2_HORSE/5-364RDQ..PPESWAEALGVLLGATVQVV.............FYMDAEMRRREEA...-....RA-QEAAEAGVVAVLASAAG-
PNML1_MOUSE/6-363SNQ..PPPNWAEALGLLLGAVVQVI.............FYMDAAIRSRDEEA..-....RA-EEAAEAELMEAWASTAR-
F1PIM5_CANFA/1-358Q....PRENWAEALGVLLGAVVQII.............IYMDAEIRSREEA...-....RV-QEVADAQAVATSASAAR-
F7H8Z7_CALJA/1-318.....GGAGEVETWTQSWNRALWPL.LKT..VGHQELRHFSGMVQPGCMEDSFE-SWLEHV-NDMLQLWCDASESERRR-
PNM6B_HUMAN/1-319............CWLRSIGQAVQPW.VEA..VRYQSLGVFSGRDQPAPGEESFE-VWLDHT-TEMLHVWQGVSERERRR-
G3QYD8_GORGO/1-326EQG.MVPEMWAPMLAQAL.EALQPA.LQC..LKYKKLRVFSGRESPEPGEEEFG-RWMFHT-TQMIKAWQ.VPDVEKRR-
F6WC96_CALJA/1-321.....GGAGEVETWTQSWNRALWPL.LKT..VGHQELRHFSGMVQPGCMEDSFE-SWLEHV-NDMLQLWCDASESERRR-
Q5BJV6_RAT/1-328DQNVMIPEIRAPMLAQALDEALKPT.LQY..LRYKKLSVFSGRDPPGPGEEEFE-SWMFHT-SQVMKTWQ.VSDVEKRR-

PF16297

H0W794_CAVPO/2-110--------------------------LPEFIVQTGSYMFVDDK--------TFS-SDALKV-TFLITRLTG---------
D3ZTE6_RAT/24-138--------------------------LPEFVVQTMSYMLVNEE--------HFC-NDAMKV-AFLISLLSG---------
G1MLQ7_AILME/2-114--------------------------LPEFIVQTGAYMLVDET--------LFS-SDALKV-TFLITRLTG---------
F7ASC6_CALJA/2-113--------------------------LPEFIVQMGSYMFMDEN--------TFS-NDALKV-TFLITRLTG---------
Q9D6I0_MOUSE/2-112--------------------------LPEFIVQTLSYMLVDEK--------TFD-TDKRKV-MFLITRLKG---------

PF14244

B9SYP2_RICCO/12-59------------------------------SRAASLALLGRS----------KL-SYVNGK-------------------
U5FIT1_POPTR/2-49------------------------------SYVIRNFIKGKK----------MW-GYVSGT-------------------
F6H7D5_VITVI/2-49------------------------------SYVMRNFLKGKR----------MW-GYVSGV-------------------
M1B3X1_SOLTU/18-62------------------------------SRLLRLALLVKK----------SL-DLL...-------------------
K7L0W9_SOYBN/14-61------------------------------KKAMEMSLLGKN----------KF-GFVDGS-------------------
B9S0Y3_RICCO/33-80------------------------------KRAMTLALNSKN----------KL-GFVDGF-------------------
B9S242_RICCO/33-80------------------------------KNSMETALYAKS----------KG-GFIDGS-------------------
K7LQ32_SOYBN/26-73------------------------------SKGMFSALWSKN----------KL-KFIDGT-------------------
U7DX79_POPTR/501-548------------------------------SQSMTMALTVKN----------KI-GFIDGS-------------------
B9RHL9_RICCO/34-81------------------------------QEAIIDALDVKN----------KA-GFIDGT-------------------
Q84JT5_ARATH/26-70------------------------------KIRFRSFLRVTK----------KF-GFIDGT-------------------
M1DJS2_SOLTU/28-75------------------------------RRAIFRALSVKS----------KT-GFINGK-------------------
M1BMN2_SOLTU/26-72------------------------------RRGVMRALSVKN----------KL-GFIDGS-------------------
B9T813_RICCO/29-76------------------------------RSSFLLAISIRN----------KQ-DFLNGS-------------------
B9SUJ8_RICCO/31-74------------------------------KRSFLLVVSIRN----------K.-...QVS-------------------
B9T3E3_RICCO/35-82------------------------------SRSVKLALGAKD----------KL-GYINGE-------------------
M4EME5_BRARP/24-71------------------------------ATEMMNALQAKR----------KT-GFIDGT-------------------
T1J2U7_STRMM/119-166------------------------------KIHMMAQLTIKK----------LL-KYVDGR-------------------
K7JVV9_NASVI/23-68------------------------------KFGTVIALRAKQ----------LY-GFVDGS-------------------

PF13961

Q5AT23_EMENI/319-345------------------------------KVQYKLFLRTQG.--------.CW.SVVE---------------------
Q5AT23_EMENI/515-541------------------------------KSDVREFCQIQG.--------.VW.EVVE---------------------
A9RSN5_PHYPA/14-40------------------------------KKKIQMKFEMEN.--------.LW.DVVS---------------------
B0D6P6_LACBS/11-37------------------------------SVRMEAILVRWG.--------.LW.PMVK---------------------
B0WQU4_CULQU/10-36------------------------------EMRVEALLAVED.--------.LW.EVVM---------------------
B0WWB7_CULQU/11-37------------------------------KLRMEALLDTEE.--------.LW.DVIE---------------------
B4K1A4_DROGR/12-38------------------------------SVHMKSVLVHND.--------.LW.PIVS---------------------
B4LA17_DROMO/10-36------------------------------RVQMRSVLVHQE.--------.LW.SVVS---------------------
B4LAF9_DROMO/10-36------------------------------HMAMESVLEMAD.--------.LW.EVVC---------------------
B4LE08_DROVI/13-41------------------------------SHKVELHMRIQE.--------.MWPAVIS---------------------
B4MX54_DROWI/10-37------------------------------KRQAQSYLVIKG.--------.CW.SVVC---------------------
B4NQE5_DROWI/11-37------------------------------KLRMRAILVKND.--------.LW.QCVN---------------------
B4NQR9_DROWI/10-36------------------------------CIQMKSVLVHAD.--------.LW.NVAS---------------------
B6HA76_PENCW/19-46------------------------------KRLMTSYLKARQ.--------.VW.DVVS---------------------
B6QCF0_PENMQ/36-62------------------------------KLRMQIFLETQD.--------.CW.DVVE---------------------
B9NDW0_POPTR/15-41------------------------------RTCLESYLIGED.--------.LW.EVVS---------------------
B9RBX9_RICCO/17-43------------------------------AVKMQCYLQAFD.--------.LW.NFVE---------------------
B9RC68_RICCO/10-37------------------------------SACMKSYLLAND.--------.LW.DIVE---------------------
B9S5P6_RICCO/16-42------------------------------HLKMHYVLKEQE.--------.IL.EAIN---------------------
C5GBD9_AJEDR/188-215------------------------------SISMKLKLVDAQ.--------.CW.NIIE---------------------
C5WNA6_SORBI/166-192------------------------------AVTMKVKLRARR.--------.LW.NAID---------------------
C5XQM0_SORBI/42-68------------------------------STLMRLKMQARQ.--------.LW.DAVE---------------------
C5XUK3_SORBI/137-163------------------------------SQTMKLRMQARD.--------.LW.DAIE---------------------
C5Z583_SORBI/42-68------------------------------ATQMKWKLRARK.--------.WW.RAIE---------------------
C6JSM1_SORBI/23-49------------------------------SIRVRAIMEDQG.--------.VW.DVME---------------------
C7J1L6_ORYSJ/181-207------------------------------AAVMRVRLQVWH.--------.MW.EAVR---------------------
C7J1U3_ORYSJ/16-44------------------------------KIHMISYFTAMSP--------KIW.WIVD---------------------
C7J5A1_ORYSJ/49-75------------------------------ALLMKIKLQAHC.--------.LW.AAIE---------------------
C7J6P4_ORYSJ/14-42------------------------------CCKMQSYIMAENY--------DIW.RKVS---------------------
C7J7K5_ORYSJ/83-109------------------------------ALVMRVNLQAQG.--------.LW.SAIE---------------------
D0NBZ2_PHYIT/18-44------------------------------LERVKLKLQRKH.--------.LW.QYCI---------------------
D0P386_PHYIT/3-29------------------------------KARIKTLLQAKR.--------.LW.GIVT---------------------
D0P4P1_PHYIT/16-42------------------------------ARQLQLYLEVKD.--------.VW.SAVL---------------------
D0RLQ9_PHYIT/21-47------------------------------HERVKLKMQRKK.--------.LW.KYCE---------------------
D2A4C7_TRICA/13-39------------------------------KIQMQAVLIKCD.--------.LW.DYTN---------------------
D2A543_TRICA/14-40------------------------------KFRMEIILDHHD.--------.VK.RCIE---------------------
Q0DA14_ORYSJ/28-54------------------------------ALVMRVSLEALE.--------.LW.DAVE---------------------
Q0IZT5_ORYSJ/33-59------------------------------AIKMEANMEAQG.--------.IW.DAIE---------------------
Q0J5Y3_ORYSJ/54-80------------------------------AMLMQVNMEAAG.--------.IW.YAVE---------------------
Q16S15_AEDAE/12-38------------------------------SFRMESYLEELG.--------.LL.HCIE---------------------
Q6K285_ORYSJ/82-108------------------------------ELLMKVKLKTRA.--------.LW.HAIE---------------------
Q75M81_ORYSJ/48-74------------------------------AVLMRVNLQAQG.--------.LW.EAVD---------------------
Q7G5Z8_ORYSJ/52-78------------------------------SLLMKVNMQAQG.--------.VW.DAVE---------------------
Q7G756_ORYSJ/12-40------------------------------CSKMQSYIMAKDL--------DIW.KKVS---------------------
Q7XKY1_ORYSJ/53-79------------------------------SLLMRAMLQVRG.--------.LW.EAVD---------------------
Q7XMT1_ORYSJ/56-82------------------------------ALLMRVNLQEQG.--------.LW.KAID---------------------
Q84Q85_ORYSJ/36-62------------------------------SLVMQVSMEALE.--------.QW.DAVE---------------------
Q850T3_ORYSJ/12-40------------------------------CSKMQSYIQAEDY--------DVW.QKVA---------------------
B9GKP2_POPTR/14-39------------------------------IQGMKSFLIGRK.--------.LW.RIV.---------------------
B9HL08_POPTR/16-42------------------------------SACMKSYMLAQD.--------.LW.DFIE---------------------
D7U4H2_VITVI/8-34------------------------------KACLQSYLIGQG.--------.LW.DVVS---------------------
F6HTJ6_VITVI/13-39------------------------------STCMMSYMQGQD.--------.LW.EVVN---------------------
F6HVN0_VITVI/97-122------------------------------STCVKWYLVGQD.--------.LW.EVC.---------------------
F6HVN2_VITVI/18-42------------------------------RTCIKRYLVAQD.--------.LW.EVVK---------------------
I1Q6P1_ORYGL/57-85------------------------------KHKMKLHLIFLHP--------SIW.KVVC---------------------
Q0IZC5_ORYSJ/9-35------------------------------SIKMRTLLLSQG.--------.LW.DIVE---------------------
Q0J8A6_ORYSJ/26-52------------------------------CIRVQAMMEDQG.--------.VW.DAIE---------------------
Q53L57_ORYSJ/161-185------------------------------AQHMHLNMRGQC.--------.LW.DV..---------------------
Q60EK9_ORYSJ/143-168------------------------------AVKMKIFMRAQG.--------.VW.AAVE---------------------
Q682G3_ARATH/13-39------------------------------SLRMKAILGAHD.--------.VW.EIVE---------------------
Q7X7W1_ORYSJ/19-45------------------------------ALMMKVMLQARS.--------.LW.EAVN---------------------
Q852C7_ORYSJ/12-40------------------------------KARMEAYLQSQGH--------NVW.NKVK---------------------
Q8S5D4_ORYSJ/104-130------------------------------ALFMTVNQQAQG.--------.LW.HAVE---------------------
Q8SAX3_ORYSJ/39-67------------------------------KHKMKMHLKSINS--------SIW.RIVE---------------------
Q94GR9_ORYSJ/14-42------------------------------KIKMSTHLKAMSF--------HIW.SIVD---------------------
Q9AUM6_ORYSJ/511-536------------------------------AMVMKVKLQARH.--------.MW.DTV.---------------------
U5G3M5_POPTR/16-42------------------------------AVKMKTVLIALD.--------.LW.EVVE---------------------

PF03732

Q9XX53_CAEEL/210-308---DYIQ...................ST--ALHTF-LEGLGD--------------------------------------
PEG10_MOUSE/174-267---.WTE...................PA--LMDQF-QEGLNP--------------------------------------
Q9AUY8_ARATH/31-127---LEDE...................AV--QVRRF-LRGLRV--------------------------------------
Q9FWC7_ORYSJ/155-249---VFDPSV...............GGKM--LVTRF-MNGLTE--------------------------------------
Q9FE41_ORYSJ/775-871---.MHL...................ED--AIEMC-VHGMQQ--------------------------------------
Q9LP90_ARATH/163-253---GLDD...................QK--LEGIF-LNGLTG--------------------------------------
Q9LMV1_ARATH/257-344---.VPD...................EA--AIVA.-...LRN--------------------------------------
Q9ARZ4_ORYSJ/100-192---.ITE...................AS--VINAA-SAGLLE--------------------------------------
Q9FYC9_ARATH/102-194---.LDE...................DF--LVSLY-LTGLKT--------------------------------------
Q9SK57_ARATH/214-310---LEEE...................QA--QLRRF-IRGLRI--------------------------------------
Q9FRJ2_ORYSJ/81-182---PVSE...................PS--QVLNL-LRGLNT--------------------------------------
Q9AV68_ORYSJ/351-443---.ITD...................DV--IIAAF-TKGIRH--------------------------------------
Q9AYB5_ORYSJ/567-664---LRND...................EE--RQEKF-LGGLND--------------------------------------
O23529_ARATH/90-186---PMEH...................EE--QVERI-LEGLPE--------------------------------------
O82608_ARATH/272-360---INDL...................AA--LST..-...LKK--------------------------------------
Q9AYC2_ORYSJ/729-826---VRTD...................AE--KQEKF-MAGLDD--------------------------------------
Q9FGL3_ARATH/131-241---VNTCRNCKCCS.....ATASVNEHS--KIVKF-LAGLND--------------------------------------
Q9SQW9_ARATH/264-354---.VTS...................DI--LESAF-LNGLRR--------------------------------------
Q9LNM2_ARATH/83-178---VADK...................PQ--GEAAR-GRG.RG--------------------------------------
Q9AYB6_ORYSJ/694-791---VRED...................EE--KQEKF-LAGMDP--------------------------------------
Q9XE67_SORBI/155-252---SNTE...................KK--KMYFF-KKGLST--------------------------------------
Q9ZPF9_ARATH/97-196---QEEC...................EA--TMSRF-MGGLNR--------------------------------------
Q9XII7_ARATH/126-236---.STEALDEPCTCGKAMRLQQKAEQA--KIVKF-LAGLNE--------------------------------------
Q9SIM3_ARATH/131-240---.STEALDDPCTCGKAVRLYQKAEKA--KIMKF-LAGLNE--------------------------------------
Q9MA68_ARATH/89-183---GFKK...................AS--LLSTL-YRGALP--------------------------------------
Q9M225_ARATH/186-282---MKDG...................QA--ELRRF-MRGLRP--------------------------------------
Q96467_HORVU/82-176---GLSL...................WM--IIQIF-YAGLNF--------------------------------------
Q9AXC5_ANTHI/295-388---LEDE...................GR--KARKF-IEGLKL--------------------------------------
Q9M0T9_ARATH/89-183---GFTK...................AS--MLSTL-YRGVLP--------------------------------------
Q9SY43_ARATH/188-284---MEDD...................QA--QMRRF-LRGLRP--------------------------------------
Q9C7H8_ARATH/150-242---.LSE...................EY--LVSVY-LAGLRT--------------------------------------
Q9ZNW4_SORBI/210-302---GVPK...................EV--AIEAA-IKGLRI--------------------------------------
Q9SUN0_ARATH/223-313---SRGK...................QA--RNDR.-....RR--------------------------------------
Q9M252_ARATH/163-260---GRGE...................QS--MIRRL-MRGLRP--------------------------------------
O93283_TAKRU/149-242---.WGE...................TA--LRSAY-RRGLSE--------------------------------------
Q9ZQQ3_ARATH/198-290---.ISQ...................QS--ALSAL-RKGLWY--------------------------------------
Q9ATX2_MAIZE/179-271---.VPN...................EI--VIEAM-IKGLRP--------------------------------------
O81471_ARATH/148-242---SFSE...................VQ--LLGTF-FRGVDW--------------------------------------
Q9FW76_ORYSJ/181-275---SNDP...................AY--FVTKF-VDGLKD--------------------------------------
Q9SKF2_ARATH/107-197---GFSK...................ES--ILKN.-...LAQ--------------------------------------
Q9SYE8_ARATH/131-230---QEDG...................EA--VMSRF-MGGLNR--------------------------------------
Q98SV9_TAKRU/117-207---.WND...................TA--LRGVF-TQGLAE--------------------------------------
Q9SJP0_ARATH/291-382---.TPD...................DA--AIAAL-RNALWH--------------------------------------
Q9XE85_SORBI/114-212---VRED...................AD--KQRLF-MKGLYY--------------------------------------
Q9ZS84_SOLLC/150-247---.MSD...................ED--KLHNF-ISGMQG--------------------------------------
O48967_MAIZE/245-337---.ISD...................AS--IITAF-RQGVRD--------------------------------------
Q9LZG5_ARATH/148-244---KRGE...................HE--LIHKF-ISGLRV--------------------------------------
Q9SX87_ARATH/132-224---.LSE...................DY--LVRVY-LDGLHP--------------------------------------
Q9LQH2_ARATH/476-575---QEDN...................EA--IMSRF-MGGLNR--------------------------------------
Q9FZN9_ARATH/121-215---GFSK...................AS--LLSTL-YRGVLP--------------------------------------
Q9SLQ0_ORYSI/194-290---VEND...................DA--GMARF-MGGLNR--------------------------------------
Q9UVC2_PASFU/52-153---.WDD...................EA--LQVMY-RRGLKE--------------------------------------
Q9ZPG6_ARATH/97-191---GFKK...................AS--LLRTL-YRGALP--------------------------------------
Q9ZUK1_ARATH/211-302---NRPET.................IQD--ALHRA-TNWINA--------------------------------------
Q9FWB1_ARATH/104-198---GFRY...................AT--LINTF-YMGVDK--------------------------------------
Q9HFY8_COLGL/148-252---.MTD...................ES--KVFAF-YQGLKD--------------------------------------

PF14223

C6JSM1_SORBI/65-207...SLED-------------------AA..LVKKL-FDTVPGR..-----------------------------------
Q5TKD7_ORYSJ/82-224...TLTD-------------------EH..MLKKL-LRVVPFH..-----------------------------------
C5XUK3_SORBI/191-334..KDITE-------------------ER..VVEKF-LRTVPAK..-----------------------------------
Q7FAB9_ORYSJ/122-264...PEPA-------------------DK..VVEKY-LRVARPR..-----------------------------------
Q53P77_ORYSJ/59-201...PEPD-------------------DK..VVEKY-LCVARPR..-----------------------------------
U5G3M5_POPTR/78-220...DVSE-------------------NR..IVQKL-LMSLSRR..-----------------------------------
M1B1W5_SOLTU/38-180...VLND-------------------SR..IVEKI-LVTVPER..-----------------------------------
Q75K50_ORYSJ/66-213YDTNYPQ-------------------SE..ISRHF-LNGLDIS.I-----------------------------------
Q7XL83_ORYSJ/59-200...NYTD-------------------LE..VAQKM-LRALSEK..-----------------------------------
K4A379_SETIT/105-236..TDWDD-------------------HK..VTKKM-LRAFTPR..-----------------------------------
Q7XWR8_ORYSJ/85-228..KDMTD-------------------EV..VVKKM-VRAITPR..-----------------------------------
Q53LJ7_ORYSJ/949-1092..VDMTN-------------------HF..VVKRL-LCAFGPR..-----------------------------------
K4AQP1_SOLLC/29-171...GYST-------------------GD..HVKKI-IRSLPKE..-----------------------------------
W1NQ11_AMBTC/80-222...VLTQ-------------------KD..MVTKI-LRSLTKA..-----------------------------------
J9KKF0_ACYPI/70-208...NISD-------------------DM..LITKM-LMTLPNS..-----------------------------------
X1WMG8_ACYPI/69-207...PISE-------------------SM..LITTI-LMTLPDS..-----------------------------------
X1XSG1_ACYPI/1016-1154...PISD-------------------SM..LMTKI-LMTLPDT..-----------------------------------
E5SZD6_TRISP/22-165...QLPD-------------------LL..LMSRI-MSTLPQD..-----------------------------------
K7J7F1_NASVI/67-205...NIPD-------------------IV..VISKI-IASLPTK..-----------------------------------
K7JBX1_NASVI/56-194...NIPD-------------------LV..IMAKI-LASLPAK..-----------------------------------
K7JBR0_NASVI/56-192...NVSQ-------------------VT..IMAKI-LASLTSK..-----------------------------------
F4WZJ7_ACREC/51-189...NIEK-------------------EM..IITKI-VRGLPQK..-----------------------------------
K7JSP6_NASVI/56-194...KPPK-------------------EA..IVSKL-LNSLPEK..-----------------------------------
Q6AUV8_ORYSJ/140-277...ELSD-------------------KF..VAGGI-IAKLPPS..-----------------------------------
Q5KQJ6_ORYSJ/54-191...VLPD-------------------KF..VAGCI-IAKLPPS..-----------------------------------
F6HMS3_VITVI/69-206...ELLE-------------------AF..QVGAI-VAKLPSS..-----------------------------------
U5GQH9_POPTR/36-171...VMDR-------------------KL..SVELV-LQSLPQN..-----------------------------------
D0P4M1_PHYIT/31-154...PVDD-------------------TE..KVDQL-LSSLPRS..-----------------------------------
U7E2P1_POPTR/73-196...PISD-------------------KE..KIFCL-LTSLGPQ..-----------------------------------
U5FM44_POPTR/75-204...PLPY-------------------KE..KVFCL-LTSLGPQ..-----------------------------------
K7MSY7_SOYBN/76-212...PVPD-------------------KE..KVFYL-LTSLGHE..-----------------------------------
U5GX94_POPTR/76-212...PVPD-------------------KE..KVFYL-LTSFGPQ..-----------------------------------
U7DWS5_POPTR/76-203...PVSD-------------------NE..KVFCL-LTSLGPQ..-----------------------------------
K7JMW1_NASVI/53-191...DLAD-------------------DL..LAAML-LGSLPES..-----------------------------------
K7JZ52_NASVI/48-186...ELDD-------------------TL..KAALV-LNSMPES..-----------------------------------
E5RYC0_TRISP/55-187...NIED-------------------ED..LVAIM-LCSLPDS..-----------------------------------
M7ZB77_TRIUA/364-501...TVDD-------------------ED..MAILL-LCSLPSS..-----------------------------------
Q8H023_ORYSJ/184-321...KLDD-------------------ED..KAIIL-LCSLPPS..-----------------------------------
U5GTK8_POPTR/27-149......N-------------------ED..EALML-LNSLPFSLT-----------------------------------
U5GAW6_POPTR/1-122...KFNN-------------------ED..KTLML-LNFLPTSPI-----------------------------------
K4D0A3_SOLLC/29-166...KIED-------------------ED..KAIVL-LNSLPSS..-----------------------------------
J3N766_ORYBR/276-405...KIDD-------------------ED..KAILL-VVSLPAT..-----------------------------------
K4C212_SOLLC/50-190...KIDD-------------------ET..KALLL-LRTLPCS..-----------------------------------
Q53QA4_ORYSJ/49-186...KYDD-------------------ED..LGLLL-LCSLPNS..-----------------------------------
I1R349_ORYGL/53-190...QFDD-------------------ED..LGLLL-LCSLPSS..-----------------------------------
Q8LNW7_ORYSJ/86-223...KYDE-------------------ED..LGLIL-LCSLPSS..-----------------------------------
B9GES3_POPTR/51-190...ELAD-------------------EM..QALIL-LSSLPDS..-----------------------------------
K4BHD1_SOLLC/28-167...KFDD-------------------EI..QGLWL-LNTLPDS..-----------------------------------
I1HDH1_BRADI/50-189...TFED-------------------EV..RALLL-FGSLPDT..-----------------------------------
K4APP6_SOLLC/9-118...NFED-------------------EI..KAIIL-MSSLPES..-----------------------------------
D6WYA2_TRICA/60-197...DINP-------------------DL..LAILM-LYSLPPN..-----------------------------------
E1ZV45_CAMFO/58-195...DINA-------------------DL..LTIML-LYSLPLT..-----------------------------------
T1HSX1_RHOPR/55-192...TINP-------------------DL..LAILL-IYSLPIS..-----------------------------------
F4WEW2_ACREC/61-198...IINP-------------------DL..LAILL-LYSLPSQ..-----------------------------------
E2AJT1_CAMFO/8-145...DINE-------------------DL..LTILL-LYSLPAS..-----------------------------------
T1IKQ2_STRMM/62-199...KIDL-------------------DI..TTILL-LYSLPQL..-----------------------------------
E2A5G7_CAMFO/57-194...EING-------------------DM..LAVII-LYSLPES..-----------------------------------
B4NQE5_DROWI/52-189...TIGD-------------------DL..LAILL-LYSLPDT..-----------------------------------
B4N7F3_DROWI/26-163...QIKE-------------------EL..RTIIL-FSSLPPA..-----------------------------------
E2AMM3_CAMFO/51-188...EIPS-------------------EL..QSIML-LNSLPED..-----------------------------------
T1J9B0_STRMM/91-207...KLDD-------------------KI..MAAIL-LASLPAE..-----------------------------------
I1F6R0_AMPQE/28-159...AISE-------------------ED..QVVHL-LASLPDY..-----------------------------------
I1EHE8_AMPQE/27-156...NISD-------------------EDHVHVVYL-LASLPES..-----------------------------------
I1FHD8_AMPQE/25-162...TIVD-------------------DD..PVVYL-LASLPES..-----------------------------------
I1E7Y8_AMPQE/59-197...AVED-------------------DD..KVVFL-LASLPHS..-----------------------------------
I1GAG6_AMPQE/26-163...EFSN-------------------ED..RVVYL-LASLLDS..-----------------------------------
I1FXX0_AMPQE/30-175...EMTE-------------------ED..RVVHL-LASLPDS..-----------------------------------
I1FA02_AMPQE/58-195...AMDD-------------------ED..RVVQL-LASLPES..-----------------------------------
A9RF54_PHYPA/33-140...PLLE-------------------ED..VVMTL-LSSLADF..-----------------------------------
H3H865_PHYRM/30-162...PVSE-------------------DD..LVITL-LGSLSES..-----------------------------------
H3H7I3_PHYRM/74-190.....PS-------------------ER.......-VVPVPDH..-----------------------------------
H3H4T3_PHYRM/256-393...PVSE-------------------DD..LVITL-LGSLSES..-----------------------------------
I1FL57_AMPQE/42-163...AVSE-------------------ED..QVVTL-LGSLPPS..-----------------------------------
H3H8S0_PHYRM/58-195...KMED-------------------ED..VAICL-LRSLPKS..-----------------------------------
K3WFC4_PYTUL/54-191...KMED-------------------ED..VAICL-LRSLPKS..-----------------------------------
X1XSQ9_ACYPI/36-160...KIEE-------------------DF..LACLL-LLSLPES..-----------------------------------
J9KWH3_ACYPI/52-189...KLDD-------------------DL..IACML-LLTLPDS..-----------------------------------
D2A543_TRICA/50-188...KLEE-------------------MD..VVCHL-LLTLPKS..-----------------------------------
X1WUQ9_ACYPI/53-190...KLDE-------------------LD..VVCNL-LLTLPSS..-----------------------------------
H9JTX7_BOMMO/22-158...KMDE-------------------ED..KICYL-LTGMSEK..-----------------------------------
K7JW30_NASVI/49-187...KINE-------------------KE..KLNYM-LNTLPNQ..-----------------------------------
K7JWT6_NASVI/101-239...NVTK-------------------ED..RLNYF-LLALPES..-----------------------------------
H3H572_PHYRM/51-187...PLDE-------------------AR..QLVIL-LSSLPTE..-----------------------------------
H3H7F9_PHYRM/48-184...PVDE-------------------AR..QLVVL-LSSLPAE..-----------------------------------
M4B777_HYAAE/28-150...KVAH-------------------DE..RLVIL-LESLSDE..-----------------------------------
M5BUS0_THACB/75-214...PISD-------------------LM..LAQMM-MTALPPS..-----------------------------------
T1ILJ6_STRMM/60-198...TVDD-------------------GI..KAYML-LNRVGKE..-----------------------------------
T1IMI2_STRMM/102-238...KIDD-------------------DE..KAFMH-LNRCGAE.C-----------------------------------
T1ILE6_STRMM/56-194...KIDD-------------------SD..LAYQM-LCTLPPQ..-----------------------------------
M2Q9R4_CERS8/111-253...EVSD-------------------QD..YCAQI-LKSVPSQ..-----------------------------------
F8PLK7_SERL3/29-165...YLTD-------------------KE..KALNM-LRSLSST..-----------------------------------
H3GVH0_PHYRM/36-172...EPSD-------------------ED..VCATL-LRSLPAS..-----------------------------------
H3GKE9_PHYRM/34-170...EPTE-------------------ED..VCATM-LRSLPSS..-----------------------------------

PF03564

A7SE42_NEMVE/491-638---EAAQ-------------------YESILVPAL-LEKIPEA-------------------------------------
Q17051_ASCLU/155-293---NLD.-------------------.SPLLVFII-EQKLSQR-------------------------------------
Q23992_DROME/160-308---LPED-------------------VDAIFAHII-LRKFNKE-------------------------------------
A7XDH0_DROAN/157-302---MDR.-------------------.DCWVIHLL-LNKIDPE-------------------------------------
Q4JS97_ANOGA/133-280---PVDK-------------------WDTPLTSLL-FYKLDSK-------------------------------------
Q4EAY5_9RICK/161-306---NTR.-------------------.DCWIIFLI-LQKMDAE-------------------------------------

PF14893

H0XX29_OTOGA/1-328---RLVE-------------------SLGGPALDL.MCGLLAEHP....DTPAQ.DCLDALEQVFGNNDTR...VTAR..
M3Z644_MUSPF/1-327---RLLE-------------------SLRGPAFDV.IRVLKTDNP....FITVA.ECLQALEQVFGVIDNP...RELQ..
F7CY48_HORSE/1-330---RLVE-------------------SLGGPALDL.ICGLLEENP....DTPVQ.DCLAALVQVFGSKDAQ...MTAR..
M4B0W2_XIPMA/1-317---RVME-------------------SVKGPALEI.LQAVRFNNH....DATAM.EYLDILESTFGTPETG...EDLY..
F6TXQ3_HORSE/2-329---WLME-------------------SLRGPALDL.MHIVQADNP....SISVE.ECLEAFKQVFGSLESR...RTSQ..
D3Z8Y9_RAT/1-327---RLME-------------------CLRGPALQV.VNVLRANNA....AITVK.ECLEALRQVFGSVENR...KIAQ..
M4AZW3_XIPMA/2-318---RIME-------------------SVKGPAMEI.LQAVRFNNP....DAMPT.EYLNVIENTFGTTETG...EELY..
F7AVZ0_XENTR/7-324---KILE-------------------SLRCPAVDV.VKSYLVNHP....DATSG.NLIEVLEVTFAPVAST...TEML..
PNMA5_HUMAN/1-322---RLLE-------------------SLRGPALSI.MRVLQANND....SITVE.QCLDALKQIFGDKEDF...RASQ..
G1PM76_MYOLU/2-362---RKGP-------------------KEPGRAARA.CSVLTMGNPGSWDDVEDEGDPPKPLVRKARAKTRSRRRKQKKSP
F7D322_HORSE/1-321---RLLE-------------------SLRGSALSI.MRVLRANND....SMTME.QCLDALKEIFGNKEDW...RTSQ..
G3N1H8_BOVIN/3-317---RLVE-------------------SLGGPALDL.LCSLLEEDP....NLTAQ.DCLTALVEAFGSKDPR...VTAR..
F1S2C6_PIG/1-333---RLVE-------------------SLGGPALDL.LCGLLAQDA....DMAAQ.DCLAALVQVFGDQDSP...VTAR..
H2PX42_PONAB/1-327---RLME-------------------CLRGPALQV.VSGLRASNA....SITVE.ECLAALQQVFGPVESH...KIAQ..
G1LQR5_AILME/1-315---QLVE-------------------SLGGPALDL.LCGLLAENP....DMPAQ.DCLAALVQAFGDKDTR...VTAR..
PNMA5_MOUSE/1-323---CLLE-------------------SLRGSALSI.MQALWTSND....SLTVE.QCLKALKHIFGNKEDS...KVLQ..
PNML1_BOVIN/3-358---RKVK-------------------KEPGRAAER.GSALKMENPDGWNDVADGGDGPKPLVRKAGALTHSRRKRQKKTP
G3U141_LOXAF/1-317---RLVE-------------------CLSSPALDL.LYGLLAEDP....DLPAQ.DCLVALVQVFGTQDTR...MTAR..
H0W6U3_CAVPO/1-332---RLVE-------------------CLDGPALDV.ICELLKAHP....EIPAQ.DCLAALVQVFGNKDIR...VAAR..
H0VWL7_CAVPO/1-322---RLLE-------------------SLRGSALAT.MRVLRANDD....SITVV.QCLDALREMFGSKEDA...KTEQ..
PNML1_PONAB/5-364---KKVK-------------------KEPGLAAEV.GSALKAETPNNWNATEDQHDPPKPLVRRAGAKSRSRRKKQKKNP
H0VK73_CAVPO/6-363---KKVK-------------------KEPRLATEV.GLALKMESPTRWKGMEDQGDPPKLIVRRAGAKARSRRKKQKKTP
G3U379_LOXAF/1-308---..VP-------------------GWRTPARHG.ARSALAENP....ARTAQ.ECLAALVQVFGDTDSE...AATR..
M4AZA8_XIPMA/3-326---RIME-------------------SLKGPALEV.IKAVRLSDP....DVSPE.ECLEALDSAFGMAESG...DDLY..
D2GZV4_AILME/1-325---RLME-------------------SLRGPAADV.IRILKTNNP....SITTA.ECLKALEQVFGSVESS...RDAQ..
F6Z9T2_HORSE/5-364---RKIK-------------------KEPGQAAEV.SSALKMENPDSWHDMGDEGDPPKPFFHKAGAKTGSRRKKQKNHP
PNML1_MOUSE/6-363---KRVK-------------------KEPGLGVEV.GSAFKMEDRNYWKNTEDHGDPPKPLVRRPGGKIRSRRRKQKKNL
F1PIM5_CANFA/1-358---RKIK-------------------KEPGRAAEI.GSALKIENPDCWHDPGDEGDPPKPVVLRAGAKNRSRRKKQRKNP
F7H8Z7_CALJA/1-318---RVLS-------------------SLRGAALEI.VNGLLEEEP....SFSTL.DCLAALGHAFRNRDTW...VTTR..
PNM6B_HUMAN/1-319---RLLE-------------------GLRGTALQL.VHALLAENP....ARTAQ.DCLAALAQVFGDNESQ...ATIR..
G3QYD8_GORGO/1-326---RLLE-------------------SLRGPALDV.IRVLKINNP....LITVD.ECLQALEEVFGVTDNP...RELQ..
F6WC96_CALJA/1-321---RVLS-------------------SLRGAALEILVHALLAENP....TRSAAQDCLTALVQVFGDNEPYPLPPTSR..
Q5BJV6_RAT/1-328---RLME-------------------SLRGPAFEI.IRVLKINNP....FITVA.ECLKTLETIFGIIDNP...RALQ..

PF16297

H0W794_CAVPO/2-110---RALE-----------------------WVMPY-IQKDSPL-------------------------------------
D3ZTE6_RAT/24-138---EAEE-----------------------WVMPY-IESNSYI-------------------------------------
G1MLQ7_AILME/2-114---PALQ-----------------------WVIPY-IRKESPL-------------------------------------
F7ASC6_CALJA/2-113---PTLQ-----------------------WMIPY-IKKQSPL-------------------------------------
Q9D6I0_MOUSE/2-112---RALQ-----------------------WAMRY-LQTDSPM-------------------------------------

PF14244

B9SYP2_RICCO/12-59------------------------------KEAPK---------------------------------------------
U5FIT1_POPTR/2-49------------------------------YVIPK---------------------------------------------
F6H7D5_VITVI/2-49------------------------------LSKPI---------------------------------------------
M1B3X1_SOLTU/18-62------------------------------.MDPA---------------------------------------------
K7L0W9_SOYBN/14-61------------------------------IVEPA---------------------------------------------
B9S0Y3_RICCO/33-80------------------------------CEPPS---------------------------------------------
B9S242_RICCO/33-80------------------------------LQLPK---------------------------------------------
K7LQ32_SOYBN/26-73------------------------------LPMPK---------------------------------------------
U7DX79_POPTR/501-548------------------------------MKEPD---------------------------------------------
B9RHL9_RICCO/34-81------------------------------QKKPE---------------------------------------------
Q84JT5_ARATH/26-70------------------------------LPKPD---------------------------------------------
M1DJS2_SOLTU/28-75------------------------------VVKPN---------------------------------------------
M1BMN2_SOLTU/26-72------------------------------C.GPT---------------------------------------------
B9T813_RICCO/29-76------------------------------TIKPP---------------------------------------------
B9SUJ8_RICCO/31-74------------------------------ISKPA---------------------------------------------
B9T3E3_RICCO/35-82------------------------------IAKPA---------------------------------------------
M4EME5_BRARP/24-71------------------------------LKKPP---------------------------------------------
T1J2U7_STRMM/119-166------------------------------LKRPK---------------------------------------------
K7JVV9_NASVI/23-68------------------------------EKKSA---------------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------------------------------------------------------------
PEG10_MOUSE/174-267--------------------------------------------------------------------------------
Q9AUY8_ARATH/31-127--------------------------------------------------------------------------------
Q9FWC7_ORYSJ/155-249--------------------------------------------------------------------------------
Q9FE41_ORYSJ/775-871--------------------------------------------------------------------------------
Q9LP90_ARATH/163-253--------------------------------------------------------------------------------
Q9LMV1_ARATH/257-344--------------------------------------------------------------------------------
Q9ARZ4_ORYSJ/100-192--------------------------------------------------------------------------------
Q9FYC9_ARATH/102-194--------------------------------------------------------------------------------
Q9SK57_ARATH/214-310--------------------------------------------------------------------------------
Q9FRJ2_ORYSJ/81-182--------------------------------------------------------------------------------
Q9AV68_ORYSJ/351-443--------------------------------------------------------------------------------
Q9AYB5_ORYSJ/567-664--------------------------------------------------------------------------------
O23529_ARATH/90-186--------------------------------------------------------------------------------
O82608_ARATH/272-360--------------------------------------------------------------------------------
Q9AYC2_ORYSJ/729-826--------------------------------------------------------------------------------
Q9FGL3_ARATH/131-241--------------------------------------------------------------------------------
Q9SQW9_ARATH/264-354--------------------------------------------------------------------------------
Q9LNM2_ARATH/83-178--------------------------------------------------------------------------------
Q9AYB6_ORYSJ/694-791--------------------------------------------------------------------------------
Q9XE67_SORBI/155-252--------------------------------------------------------------------------------
Q9ZPF9_ARATH/97-196--------------------------------------------------------------------------------
Q9XII7_ARATH/126-236--------------------------------------------------------------------------------
Q9SIM3_ARATH/131-240--------------------------------------------------------------------------------
Q9MA68_ARATH/89-183--------------------------------------------------------------------------------
Q9M225_ARATH/186-282--------------------------------------------------------------------------------
Q96467_HORVU/82-176--------------------------------------------------------------------------------
Q9AXC5_ANTHI/295-388--------------------------------------------------------------------------------
Q9M0T9_ARATH/89-183--------------------------------------------------------------------------------
Q9SY43_ARATH/188-284--------------------------------------------------------------------------------
Q9C7H8_ARATH/150-242--------------------------------------------------------------------------------
Q9ZNW4_SORBI/210-302--------------------------------------------------------------------------------
Q9SUN0_ARATH/223-313--------------------------------------------------------------------------------
Q9M252_ARATH/163-260--------------------------------------------------------------------------------
O93283_TAKRU/149-242--------------------------------------------------------------------------------
Q9ZQQ3_ARATH/198-290--------------------------------------------------------------------------------
Q9ATX2_MAIZE/179-271--------------------------------------------------------------------------------
O81471_ARATH/148-242--------------------------------------------------------------------------------
Q9FW76_ORYSJ/181-275--------------------------------------------------------------------------------
Q9SKF2_ARATH/107-197--------------------------------------------------------------------------------
Q9SYE8_ARATH/131-230--------------------------------------------------------------------------------
Q98SV9_TAKRU/117-207--------------------------------------------------------------------------------
Q9SJP0_ARATH/291-382--------------------------------------------------------------------------------
Q9XE85_SORBI/114-212--------------------------------------------------------------------------------
Q9ZS84_SOLLC/150-247--------------------------------------------------------------------------------
O48967_MAIZE/245-337--------------------------------------------------------------------------------
Q9LZG5_ARATH/148-244--------------------------------------------------------------------------------
Q9SX87_ARATH/132-224--------------------------------------------------------------------------------
Q9LQH2_ARATH/476-575--------------------------------------------------------------------------------
Q9FZN9_ARATH/121-215--------------------------------------------------------------------------------
Q9SLQ0_ORYSI/194-290--------------------------------------------------------------------------------
Q9UVC2_PASFU/52-153--------------------------------------------------------------------------------
Q9ZPG6_ARATH/97-191--------------------------------------------------------------------------------
Q9ZUK1_ARATH/211-302--------------------------------------------------------------------------------
Q9FWB1_ARATH/104-198--------------------------------------------------------------------------------
Q9HFY8_COLGL/148-252--------------------------------------------------------------------------------

PF14223

C6JSM1_SORBI/65-207-----------------------------YIHVIAGIEQFY..DLQTMKFEDAVGRLKAY--------------------
Q5TKD7_ORYSJ/82-224-----------------------------YHQLALSIEQML..DLKTMPLEELVGRLAAI--------------------
C5XUK3_SORBI/191-334-----------------------------YAQIVVAIEQFL..DFEALTLEEVTGRLKAV--------------------
Q7FAB9_ORYSJ/122-264-----------------------------FNQLILSIETLL..DISTLSMEEVTGRLKAA--------------------
Q53P77_ORYSJ/59-201-----------------------------FSQLVLSIETLL..DISTLTLEEVTGRLKAV--------------------
U5G3M5_POPTR/78-220-----------------------------YKSIVSIIEETR..DLEVLRAEEVIASVKVY--------------------
M1B1W5_SOLTU/38-180-----------------------------FEATINTLENTK..DLSKITFAELLNALQAH--------------------
Q75K50_ORYSJ/66-213-----------------------------WEMKVTSIQESV..NITTLTLDSLYTKLKTH--------------------
Q7XL83_ORYSJ/59-200-----------------------------YETLVTMLINS...DMSRMTPASLLGKINTN--------------------
K4A379_SETIT/105-236-----------------------------NPTLATMIRRDP..SFETKTPNQLLGEILPQ--------------------
Q7XWR8_ORYSJ/85-228-----------------------------NSTLVTIIRERP..DYKTLTPHDLLGRILAH--------------------
Q53LJ7_ORYSJ/949-1092-----------------------------NPTLVSMIQEMK..DFKRLTPSDILGRIVSH--------------------
K4AQP1_SOLLC/29-171-----------------------------WRAFVTALKLSR..NLNSLKLEELVSHLRSH--------------------
W1NQ11_AMBTC/80-222-----------------------------YQGKVVAIQEAK..DLSTLPLEELIGSLMNH--------------------
J9KKF0_ACYPI/70-208-----------------------------YQHFYSAWGSMQ...SVNKKVNNLTGRLLLE--------------------
X1WMG8_ACYPI/69-207-----------------------------YRHFYSAWDSMN...SANRTLEQLTTRLMVE--------------------
X1XSG1_ACYPI/1016-1154-----------------------------YKHFYSAWDSMS...SENKTLTNFTSRLMVE--------------------
E5SZD6_TRISP/22-165-----------------------------YFEFKTVWESVP...VGERSVNLLIERLRLI--------------------
K7J7F1_NASVI/67-205-----------------------------YRHFRSAWSSVA...PERQTIEYLQERLVEE--------------------
K7JBX1_NASVI/56-194-----------------------------YRHFRTSWGVME...STRQTIELLQDRLIEE--------------------
K7JBR0_NASVI/56-192-----------------------------FNHFQTASDS.....VDPDRLEYLKERLIQE--------------------
F4WZJ7_ACREC/51-189-----------------------------FDNFKQVWRICP...TKDITVEQLQAKLLDV--------------------
K7JSP6_NASVI/56-194-----------------------------FKLFTIAWKCTP...KDDRTQKTLIARLIKE--------------------
Q6AUV8_ORYSJ/140-277-----------------------------WSDFATSLKH....KRQEFSVSDLIGSLGVE--------------------
Q5KQJ6_ORYSJ/54-191-----------------------------WRSFGTALKH....KRQEYSIEGLIASLDIE--------------------
F6HMS3_VITVI/69-206-----------------------------WKVYRKRILH....KSEDYSLEEIQKHLHIE--------------------
U5GQH9_POPTR/36-171-----------------------------FSQFIMNYHM....NKLDSTLPELFNML..R--------------------
D0P4M1_PHYIT/31-154-----------------------------GDSFKSHYYI..........QETLIAWISME--------------------
U7E2P1_POPTR/73-196-----------------------------YETFTTTMLK.....PPRPSYPELDGTRVTS--------------------
U5FM44_POPTR/75-204-----------------------------YETFTTMMVSCM.FYPMHQKHTSLIDSNLTL--------------------
K7MSY7_SOYBN/76-212-----------------------------YETFTKTMLK.....PPRPSYSELISQLQSH--------------------
U5GX94_POPTR/76-212-----------------------------YKNFTTTMLK.....PPRPSYTELVSQIQNL--------------------
U7DWS5_POPTR/76-203-----------------------------YDNFTTTMLK.....PPRSLFRVGFAT....--------------------
K7JMW1_NASVI/53-191-----------------------------YDTLVTALESRP...EKDITSQSWLEEIRCE--------------------
K7JZ52_NASVI/48-186-----------------------------YDVLTSTLRCQN...EKDFTLASVKGRLLDE--------------------
E5RYC0_TRISP/55-187-----------------------------YSALVTALEGRD...EADLTVEY.....HQR--------------------
M7ZB77_TRIUA/364-501-----------------------------YDHLITTLTH....GKETIKNEDITAALLSY--------------------
Q8H023_ORYSJ/184-321-----------------------------FEHVVTTLTH....GKDTVKTEEIISSLLAR--------------------
U5GTK8_POPTR/27-149-----------------------------YENLVITPMW....EKETLILKKIISALLSF--------------------
U5GAW6_POPTR/1-122-----------------------------YKNLVTTLMQ....GEETLMLEEIISALLSF--------------------
K4D0A3_SOLLC/29-166-----------------------------NDTLATTILH....GKDSIELKDVTSALLLN--------------------
J3N766_ORYBR/276-405-----------------------------FKHFKEIMIY............DLFKRVILL--------------------
K4C212_SOLLC/50-190-----------------------------YEDFVDEIVD....GKDAISFDEVKSSLLKI--------------------
Q53QA4_ORYSJ/49-186-----------------------------YANFRDTILL....SRDELTLKEVYDALQNK--------------------
I1R349_ORYGL/53-190-----------------------------YANFRDTILL....SRDELTLAEVYEALQNR--------------------
Q8LNW7_ORYSJ/86-223-----------------------------YANFRDTILY....SHDTLILKEVYDALHAK--------------------
B9GES3_POPTR/51-190-----------------------------WETLVVSLSNST..PNGKLTLKTVKDCILNE--------------------
K4BHD1_SOLLC/28-167-----------------------------WETFQVSLTNSA..PSGVVTMEYTKSNVLNE--------------------
I1HDH1_BRADI/50-189-----------------------------WETFKVTVCNSA..PNGVVTWNLVKTRVLNE--------------------
K4APP6_SOLLC/9-118-----------------------------WDTIVAAIHSSC..GSMKLKFDETRDVVVSE--------------------
D6WYA2_TRICA/60-197-----------------------------FDNFRCAIES....RDNLPTPEALRIKIIEE--------------------
E1ZV45_CAMFO/58-195-----------------------------FDNFRCAIES....RDELPSPETLRIKIIEE--------------------
T1HSX1_RHOPR/55-192-----------------------------FENFRCAIES....RDQLPDPESLRIKIIEE--------------------
F4WEW2_ACREC/61-198-----------------------------YENFRCAIES....RDELPTPEALRIKIIEE--------------------
E2AJT1_CAMFO/8-145-----------------------------FENFRCAIES....RDELPKPEALRVKIVEE--------------------
T1IKQ2_STRMM/62-199-----------------------------FENFRCAIES....RDDLPKPEILKIKIIEE--------------------
E2A5G7_CAMFO/57-194-----------------------------YDTFRCAIES....RDDLPDVETLKIKIFEE--------------------
B4NQE5_DROWI/52-189-----------------------------YETFRCAIET....RDELPSPDILRVKILEE--------------------
B4N7F3_DROWI/26-163-----------------------------YENFVVAIET....RDDMPSFEILRIKLKEE--------------------
E2AMM3_CAMFO/51-188-----------------------------YENFCVAIES....RDQIPTVEFIKGKLIEE--------------------
T1J9B0_STRMM/91-207-----------------------------FKPMIMAIES....CTTVIKTEAVKVRLLQE--------------------
I1F6R0_AMPQE/28-159-----------------------------FGVLVTAPES....NSEVPKMQLVTERLL..--------------------
I1EHE8_AMPQE/27-156-----------------------------FDMLVTAFEA....NSDVPNLETVIKKL...--------------------
I1FHD8_AMPQE/25-162-----------------------------YDVLVTALEA....NETFPGMKTVIESLTHE--------------------
I1E7Y8_AMPQE/59-197-----------------------------YTTLVTALEA....SATVPEMDVVIEKLLHE--------------------
I1GAG6_AMPQE/26-163-----------------------------FDELVTALEA....SSTVPEMETVIEHLLRE--------------------
I1FXX0_AMPQE/30-175-----------------------------YSTLVTALEA....RPDVPKIDTVIEKLVYE--------------------
I1FA02_AMPQE/58-195-----------------------------YSTIVTALEA....NEKVPSLEVVTERLLHE--------------------
A9RF54_PHYPA/33-140-----------------------------YSSLIVALESIS...RKDLTLDYQGCAKDEE--------------------
H3H865_PHYRM/30-162-----------------------------YQFLITALES....RADSLSWELVTSRLLHE--------------------
H3H7I3_PHYRM/74-190-----------------------------....GVGVES..............RLAVVGT--------------------
H3H4T3_PHYRM/256-393-----------------------------YQFLITALES....RADSLSWELVTSRLLHE--------------------
I1FL57_AMPQE/42-163-----------------------------FHMPVTTFELVMNCYLTTFS...........--------------------
H3H8S0_PHYRM/58-195-----------------------------YENVVLNLEM....SSAELRSQDVVKVLTNE--------------------
K3WFC4_PYTUL/54-191-----------------------------YENVVLHIEM....SNADLKTQDVIRVLNNE--------------------
X1XSQ9_ACYPI/36-160-----------------------------YGIVVTAIETLS...NNSITVDFVKCRLMDE--------------------
J9KWH3_ACYPI/52-189-----------------------------FNMVITAIETLS...SDKITLEFVKSRLLDE--------------------
D2A543_TRICA/50-188-----------------------------FDPLVTALETME...PSKLTLDFVKGKLLDC--------------------
X1WUQ9_ACYPI/53-190-----------------------------FDNVVTAIETLS...PDKLKIDFIKSRLLDD--------------------
H9JTX7_BOMMO/22-158-----------------------------YNTVITAIETMS...ADKIDMEFVKARLLDE--------------------
K7JW30_NASVI/49-187-----------------------------YSYIGDLIDTFS...EIEQTAKHVKNKIQIA--------------------
K7JWT6_NASVI/101-239-----------------------------LSHIVDIVDALP...EKDKTVEFVKSKLELE--------------------
H3H572_PHYRM/51-187-----------------------------YELICSIVEN.....AKDFTLIEVKEKLLKE--------------------
H3H7F9_PHYRM/48-184-----------------------------YEMITSIIEN.....AKDITLIEVKEKLLKE--------------------
M4B777_HYAAE/28-150-----------------------------YYQIIKIIENMR...................--------------------
M5BUS0_THACB/75-214-----------------------------YSVVTSVIQTTN..QASAVNPDMVQDTVLAE--------------------
T1ILJ6_STRMM/60-198-----------------------------FDQQIQNIYQWS...DTDFTFDKVSASLQTE--------------------
T1IMI2_STRMM/102-238-----------------------------FRVFINRI......PEKALWCRRVKTSEKNE--------------------
T1ILE6_STRMM/56-194-----------------------------YDVIVSQIYKWP...NGDMIPTKVEEALIEE--------------------
M2Q9R4_CERS8/111-253-----------------------------YADFLSGMMNAGRLLGTFITPDQAIQYLKQE--------------------
F8PLK7_SERL3/29-165-----------------------------CAIFVSQLSVSAHMNGKSINPETLIVNLLQE--------------------
H3GVH0_PHYRM/36-172-----------------------------YESLVQAFRM....SMTELKLTDLVGKSIAE--------------------
H3GKE9_PHYRM/34-170-----------------------------YEALAQAFRM....SVSEFKLADLVSKLIAE--------------------

PF03564

A7SE42_NEMVE/491-638-----------------------------------------------------VRLS.IT--------------------
Q17051_ASCLU/155-293-----------------------------------------------------IKRR.IS--------------------
Q23992_DROME/160-308-----------------------------------------------------SLNLYES--------------------
A7XDH0_DROAN/157-302-----------------------------------------------------SRRKWVD--------------------
Q4JS97_ANOGA/133-280-----------------------------------------------------TLVAWEQ--------------------
Q4EAY5_9RICK/161-306-----------------------------------------------------TRRKWIE--------------------

PF14893

H0XX29_OTOGA/1-328.............................LKLLTCSQQPRESLFAYVMRLEGLLHVAMEQ...........GAVHPAMAD
M3Z644_MUSPF/1-327.............................IKYLTTYQKDEEKLSAYVLRLEPLLQKLVER...........GVIEKDVVN
F7CY48_HORSE/1-330.............................LKFLTCAQRPQEALFAYVMRLEGLLQAALEK...........GAIRPAIAD
M4B0W2_XIPMA/1-317.............................FTFRQLCQQPNEKLSEFLRRMERVLNKVVKK...........GGLQSATAN
F6TXQ3_HORSE/2-329.............................VKYLKTYQEEGEKVSAYVLRLETLLRRAVEK...........RAIPRNIAD
D3Z8Y9_RAT/1-327.............................LKFCKAYQEPGEKVSSFVVRLETLLQKALEK...........NAISRKNVN
M4AZW3_XIPMA/2-318.............................FAFRMMTQHPAEKLSEFLRRMERVLNKVVQR...........GGLPPLSKD
F7AVZ0_XENTR/7-324.............................HNFHSTFQREKEALSAYLVRVEQGLRLLVSR...........GVIQSSEMD
PNMA5_HUMAN/1-322.............................FRFLQTSPKIGEKVSTFLLRLEPLLQKAVHK...........SPLSVRSTD
G1PM76_MYOLU/2-362RQEPVPWKKPTGHHSNSPASSEGPEADD.GENGEVPEYPRSSRKPRAKPEAAAGKKPVEKCPWKAPRHAPQDARAEAAGP
F7D322_HORSE/1-321.............................FKFLQTFQKTGEKISVFLLRLEPLLQRAVQQ...........SPFSMHSTD
G3N1H8_BOVIN/3-317.............................LKFMMCAQRPQESLFAFVMRLEGLLQLALGK...........GAVHPAIAD
F1S2C6_PIG/1-333.............................LRFATCAQRPQETLFAYVMRLEGLLQAAVET...........EAIHPATAD
H2PX42_PONAB/1-327.............................VKLCKAYQEAGEKVSSFVLRLEPLLQRAVEN...........NVVSRRNVN
G1LQR5_AILME/1-315.............................LKFLTCAQRPRETLFAYVMRLEGLLQSAVEK...........GAFHPVIAD
PNMA5_MOUSE/1-323.............................FRFLQSSQKPAEKVSDYLLRLEPLLQKAVQQ...........SPLSAHSAD
PNML1_BOVIN/3-358KQEPVPWKKSQGSHSHSSASLKHPEADD.GKNRERLEHVRNNKKPCVKQEGSALKKAPVKCAWKFPSNLPH....VAASR
G3U141_LOXAF/1-317.............................LKFLTCAQEPGESLFAYVMRQEGLLQTAMEK...........GAVHPAIAD
H0W6U3_CAVPO/1-332.............................LKFLICSQWPEETLIAYVTRLEGLLQAAVEK...........GAIHPATAD
H0VWL7_CAVPO/1-322.............................HLFLQMQHKSEEKVSAFLLRLEPLLQKVARQ...........SPFRVQGTD
PNML1_PONAB/5-364KQEAVPWKKPKGINSSSTANLEDPEVGD.AESMAISEPIKGSRKPCVKQEELALKKPMAKCAWKGPREPPQDAQAEAESP
H0VK73_CAVPO/6-363KQEPVLWKKPKGSHGSSSAYLEGFGVGD.VERMEIREFGKSLRKQ.AEQEEPPLRKPMGTSAWKVPREPSPDTLGGAESP
G3U379_LOXAF/1-308.............................LRCLTAQQRRGERLSAFVLRLEVLLQKAIEK...........GALARASAD
M4AZA8_XIPMA/3-326.............................FAFRLMQQQSGEKLSDFLRRLERSLSKVVQK...........DGLPASSMN
D2GZV4_AILME/1-325.............................VRFLNTYQNPGEKLSAYVIRLEPLLQKVVEK...........GAIDKDNVN
F6Z9T2_HORSE/5-364QQEPGPWKKAKGNCSNSSASLEGPEAGD.AENMEISEYIRSKKKPCVKQEESAWKKPVGKCVWKAPSNPPPGARSAAASP
PNML1_MOUSE/6-363KQEPICWRKSQGSNYNSNYNKVNLEAGEAAQSSEIPESVKSNKKPFVKQEETVWKK...KRVWRDPSDLPRSALPAADSP
F1PIM5_CANFA/1-358KQESVPWKKPKGQHSNSSGSLEDLEADG.AEDMEVSEYIRSKKKPCVKQEESALKKPMAKCAWKAPSTPSHDPPSEAVSP
F7H8Z7_CALJA/1-318.............................LKFLTCTQGPQEELFAFVVRLEGLLQKAMEK...........GAFHPAMAN
PNM6B_HUMAN/1-319.............................VKCLTAQQQSGERLSAFVLRLEVLLQKAMEK...........EALARASAD
G3QYD8_GORGO/1-326.............................VKYLTTYQKDEEKLSAYVLRLEPLLQKLVQR...........GAIERDAVN
F6WC96_CALJA/1-321.............................PKYLTAQQQSGQFVLAVALWLE.VLQKAMEK...........WALARASAD
Q5BJV6_RAT/1-328.............................VRYLTTYQKSGEKLSAYVLRLEPLLQKLVQK...........GAIEKEVVN

PF16297

H0W794_CAVPO/2-110-----------------------------LNNYRAFLAEMKLVFGWEDDEEDF---------------------------
D3ZTE6_RAT/24-138-----------------------------LGDYRAFVNEMKQYFGWDTDDEDD---------------------------
G1MLQ7_AILME/2-114-----------------------------LNDYRGFLAEMKRVFGWV.EDEDF---------------------------
F7ASC6_CALJA/2-113-----------------------------LNDYWGFLAEMKRVFGCQ.EDKDF---------------------------
Q9D6I0_MOUSE/2-112-----------------------------LNNYSGFLNEMKEEFGWE.EDEDF---------------------------

PF14244

B9SYP2_RICCO/12-59--------------------------------------------------------------------------------
U5FIT1_POPTR/2-49--------------------------------------------------------------------------------
F6H7D5_VITVI/2-49--------------------------------------------------------------------------------
M1B3X1_SOLTU/18-62--------------------------------------------------------------------------------
K7L0W9_SOYBN/14-61--------------------------------------------------------------------------------
B9S0Y3_RICCO/33-80--------------------------------------------------------------------------------
B9S242_RICCO/33-80--------------------------------------------------------------------------------
K7LQ32_SOYBN/26-73--------------------------------------------------------------------------------
U7DX79_POPTR/501-548--------------------------------------------------------------------------------
B9RHL9_RICCO/34-81--------------------------------------------------------------------------------
Q84JT5_ARATH/26-70--------------------------------------------------------------------------------
M1DJS2_SOLTU/28-75--------------------------------------------------------------------------------
M1BMN2_SOLTU/26-72--------------------------------------------------------------------------------
B9T813_RICCO/29-76--------------------------------------------------------------------------------
B9SUJ8_RICCO/31-74--------------------------------------------------------------------------------
B9T3E3_RICCO/35-82--------------------------------------------------------------------------------
M4EME5_BRARP/24-71--------------------------------------------------------------------------------
T1J2U7_STRMM/119-166--------------------------------------------------------------------------------
K7JVV9_NASVI/23-68--------------------------------------------------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------------------------------------------------
Q5AT23_EMENI/515-541--------------------------------------------------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------------------------------------------------
B0D6P6_LACBS/11-37--------------------------------------------------------------------------------
B0WQU4_CULQU/10-36--------------------------------------------------------------------------------
B0WWB7_CULQU/11-37--------------------------------------------------------------------------------
B4K1A4_DROGR/12-38--------------------------------------------------------------------------------
B4LA17_DROMO/10-36--------------------------------------------------------------------------------
B4LAF9_DROMO/10-36--------------------------------------------------------------------------------
B4LE08_DROVI/13-41--------------------------------------------------------------------------------
B4MX54_DROWI/10-37--------------------------------------------------------------------------------
B4NQE5_DROWI/11-37--------------------------------------------------------------------------------
B4NQR9_DROWI/10-36--------------------------------------------------------------------------------
B6HA76_PENCW/19-46--------------------------------------------------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------------------------------------------------
B9NDW0_POPTR/15-41--------------------------------------------------------------------------------
B9RBX9_RICCO/17-43--------------------------------------------------------------------------------
B9RC68_RICCO/10-37--------------------------------------------------------------------------------
B9S5P6_RICCO/16-42--------------------------------------------------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------------------------------------------------
C5WNA6_SORBI/166-192--------------------------------------------------------------------------------
C5XQM0_SORBI/42-68--------------------------------------------------------------------------------
C5XUK3_SORBI/137-163--------------------------------------------------------------------------------
C5Z583_SORBI/42-68--------------------------------------------------------------------------------
C6JSM1_SORBI/23-49--------------------------------------------------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------------------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------------------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------------------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------------------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------------------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------------------------------------------------
D0P386_PHYIT/3-29--------------------------------------------------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------------------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------------------------------------------------
D2A4C7_TRICA/13-39--------------------------------------------------------------------------------
D2A543_TRICA/14-40--------------------------------------------------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------------------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------------------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------------------------------------------------
Q16S15_AEDAE/12-38--------------------------------------------------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------------------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------------------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------------------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------------------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------------------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------------------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------------------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------------------------------------------------
B9GKP2_POPTR/14-39--------------------------------------------------------------------------------
B9HL08_POPTR/16-42--------------------------------------------------------------------------------
D7U4H2_VITVI/8-34--------------------------------------------------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------------------------------------------------
F6HVN0_VITVI/97-122--------------------------------------------------------------------------------
F6HVN2_VITVI/18-42--------------------------------------------------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------------------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------------------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------------------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------------------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------------------------------------------------
Q682G3_ARATH/13-39--------------------------------------------------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------------------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------------------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------------------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------------------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------------------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------------------------------------------------
U5G3M5_POPTR/16-42--------------------------------------------------------------------------------

PF03732

Q9XX53_CAEEL/210-308--------------------------------------
PEG10_MOUSE/174-267--------------------------------------
Q9AUY8_ARATH/31-127--------------------------------------
Q9FWC7_ORYSJ/155-249--------------------------------------
Q9FE41_ORYSJ/775-871--------------------------------------
Q9LP90_ARATH/163-253--------------------------------------
Q9LMV1_ARATH/257-344--------------------------------------
Q9ARZ4_ORYSJ/100-192--------------------------------------
Q9FYC9_ARATH/102-194--------------------------------------
Q9SK57_ARATH/214-310--------------------------------------
Q9FRJ2_ORYSJ/81-182--------------------------------------
Q9AV68_ORYSJ/351-443--------------------------------------
Q9AYB5_ORYSJ/567-664--------------------------------------
O23529_ARATH/90-186--------------------------------------
O82608_ARATH/272-360--------------------------------------
Q9AYC2_ORYSJ/729-826--------------------------------------
Q9FGL3_ARATH/131-241--------------------------------------
Q9SQW9_ARATH/264-354--------------------------------------
Q9LNM2_ARATH/83-178--------------------------------------
Q9AYB6_ORYSJ/694-791--------------------------------------
Q9XE67_SORBI/155-252--------------------------------------
Q9ZPF9_ARATH/97-196--------------------------------------
Q9XII7_ARATH/126-236--------------------------------------
Q9SIM3_ARATH/131-240--------------------------------------
Q9MA68_ARATH/89-183--------------------------------------
Q9M225_ARATH/186-282--------------------------------------
Q96467_HORVU/82-176--------------------------------------
Q9AXC5_ANTHI/295-388--------------------------------------
Q9M0T9_ARATH/89-183--------------------------------------
Q9SY43_ARATH/188-284--------------------------------------
Q9C7H8_ARATH/150-242--------------------------------------
Q9ZNW4_SORBI/210-302--------------------------------------
Q9SUN0_ARATH/223-313--------------------------------------
Q9M252_ARATH/163-260--------------------------------------
O93283_TAKRU/149-242--------------------------------------
Q9ZQQ3_ARATH/198-290--------------------------------------
Q9ATX2_MAIZE/179-271--------------------------------------
O81471_ARATH/148-242--------------------------------------
Q9FW76_ORYSJ/181-275--------------------------------------
Q9SKF2_ARATH/107-197--------------------------------------
Q9SYE8_ARATH/131-230--------------------------------------
Q98SV9_TAKRU/117-207--------------------------------------
Q9SJP0_ARATH/291-382--------------------------------------
Q9XE85_SORBI/114-212--------------------------------------
Q9ZS84_SOLLC/150-247--------------------------------------
O48967_MAIZE/245-337--------------------------------------
Q9LZG5_ARATH/148-244--------------------------------------
Q9SX87_ARATH/132-224--------------------------------------
Q9LQH2_ARATH/476-575--------------------------------------
Q9FZN9_ARATH/121-215--------------------------------------
Q9SLQ0_ORYSI/194-290--------------------------------------
Q9UVC2_PASFU/52-153--------------------------------------
Q9ZPG6_ARATH/97-191--------------------------------------
Q9ZUK1_ARATH/211-302--------------------------------------
Q9FWB1_ARATH/104-198--------------------------------------
Q9HFY8_COLGL/148-252--------------------------------------

PF14223

C6JSM1_SORBI/65-207-------------------------------EERTRRG
Q5TKD7_ORYSJ/82-224-------------------------------ESYKPEW
C5XUK3_SORBI/191-334-------------------------------DNREEQA
Q7FAB9_ORYSJ/122-264-------------------------------EDSGQSS
Q53P77_ORYSJ/59-201-------------------------------EDSGQSS
U5G3M5_POPTR/78-220-------------------------------DKREDLH
M1B1W5_SOLTU/38-180-------------------------------EQRRVMR
Q75K50_ORYSJ/66-213-------------------------------EMNVLSR
Q7XL83_ORYSJ/59-200-------------------------------DMYKLKK
K4A379_SETIT/105-236-------------------------------ELVDRDV
Q7XWR8_ORYSJ/85-228-------------------------------DILVQES
Q53LJ7_ORYSJ/949-1092-------------------------------EMQEEEA
K4AQP1_SOLLC/29-171-------------------------------EIELKGD
W1NQ11_AMBTC/80-222-------------------------------EIFMSAQ
J9KKF0_ACYPI/70-208-------------------------------EARLVHL
X1WMG8_ACYPI/69-207-------------------------------ETRQVQG
X1XSG1_ACYPI/1016-1154-------------------------------ESRQPQG
E5SZD6_TRISP/22-165-------------------------------EMRLPEK
K7J7F1_NASVI/67-205-------------------------------ESYRDAE
K7JBX1_NASVI/56-194-------------------------------EAYKTAE
K7JBR0_NASVI/56-192-------------------------------ENRLSRE
F4WZJ7_ACREC/51-189-------------------------------ERDVNVT
K7JSP6_NASVI/56-194-------------------------------DNRLAEK
Q6AUV8_ORYSJ/140-277-------------------------------EKARAKD
Q5KQJ6_ORYSJ/54-191-------------------------------EKAREKD
F6HMS3_VITVI/69-206-------------------------------EESRLRD
U5GQH9_POPTR/36-171-------------------------------PCLFSGK
D0P4M1_PHYIT/31-154-------------------------------TNVMAEA
U7E2P1_POPTR/73-196-------------------------------MLYPPCL
U5FM44_POPTR/75-204-------------------------------QIFGTNA
K7MSY7_SOYBN/76-212-------------------------------DQRRNWF
U5GX94_POPTR/76-212-------------------------------DQQRSWF
U7DWS5_POPTR/76-203-------------------------------.....SK
K7JMW1_NASVI/53-191-------------------------------RRAVLTI
K7JZ52_NASVI/48-186-------------------------------YHRRKDV
E5RYC0_TRISP/55-187-------------------------------EKNEKAR
M7ZB77_TRIUA/364-501-------------------------------DMRKKNA
Q8H023_ORYSJ/184-321-------------------------------DLRRSKK
U5GTK8_POPTR/27-149-------------------------------NLRKKTS
U5GAW6_POPTR/1-122-------------------------------NMWKKA.
K4D0A3_SOLLC/29-166-------------------------------KKMRKRL
J3N766_ORYBR/276-405-------------------------------DQSPDLN
K4C212_SOLLC/50-190-------------------------------SSTESSS
Q53QA4_ORYSJ/49-186-------------------------------EKMKIMV
I1R349_ORYGL/53-190-------------------------------EKMKGMV
Q8LNW7_ORYSJ/86-223-------------------------------EKMKKMV
B9GES3_POPTR/51-190-------------------------------EKRRKGT
K4BHD1_SOLLC/28-167-------------------------------EMRRRSQ
I1HDH1_BRADI/50-189-------------------------------ESRKVAE
K4APP6_SOLLC/9-118-------------------------------SIHKREV
D6WYA2_TRICA/60-197-------------------------------SDARKGN
E1ZV45_CAMFO/58-195-------------------------------YDARKND
T1HSX1_RHOPR/55-192-------------------------------SDARNNS
F4WEW2_ACREC/61-198-------------------------------SDARKKD
E2AJT1_CAMFO/8-145-------------------------------NDARKSE
T1IKQ2_STRMM/62-199-------------------------------ADACGIE
E2A5G7_CAMFO/57-194-------------------------------SEARKRK
B4NQE5_DROWI/52-189-------------------------------SEARQAK
B4N7F3_DROWI/26-163-------------------------------AERKRLT
E2AMM3_CAMFO/51-188-------------------------------EARRQGS
T1J9B0_STRMM/91-207-------------------------------AQKRESE
I1F6R0_AMPQE/28-159-------------------------------.....GN
I1EHE8_AMPQE/27-156-------------------------------.......
I1FHD8_AMPQE/25-162-------------------------------EKKLQDC
I1E7Y8_AMPQE/59-197-------------------------------ERKHKER
I1GAG6_AMPQE/26-163-------------------------------EQKLKEK
I1FXX0_AMPQE/30-175-------------------------------EQKSNDR
I1FA02_AMPQE/58-195-------------------------------ERKLNER
A9RF54_PHYPA/33-140-------------------------------EPPFEDE
H3H865_PHYRM/30-162-------------------------------DMKRKEQ
H3H7I3_PHYRM/74-190-------------------------------RDVSAAA
H3H4T3_PHYRM/256-393-------------------------------DMKRKEQ
I1FL57_AMPQE/42-163-------------------------------.....SH
H3H8S0_PHYRM/58-195-------------------------------HIKRQGE
K3WFC4_PYTUL/54-191-------------------------------HVKRSGE
X1XSQ9_ACYPI/36-160-------------------------------YLKRINS
J9KWH3_ACYPI/52-189-------------------------------EIKRNSR
D2A543_TRICA/50-188-------------------------------ELKRKNQ
X1WUQ9_ACYPI/53-190-------------------------------EEKCKNK
H9JTX7_BOMMO/22-158-------------------------------ELKLNNK
K7JW30_NASVI/49-187-------------------------------EMKNGNE
K7JWT6_NASVI/101-239-------------------------------FMKRNGD
H3H572_PHYRM/51-187-------------------------------YERLDKK
H3H7F9_PHYRM/48-184-------------------------------HERLEKK
M4B777_HYAAE/28-150-------------------------------DIDLFQE
M5BUS0_THACB/75-214-------------------------------EERRRKG
T1ILJ6_STRMM/60-198-------------------------------NVRRRFA
T1IMI2_STRMM/102-238-------------------------------AYIARKD
T1ILE6_STRMM/56-194-------------------------------YENLKSR
M2Q9R4_CERS8/111-253-------------------------------YERKRLP
F8PLK7_SERL3/29-165-------------------------------Y.....D
H3GVH0_PHYRM/36-172-------------------------------EVRQKDS
H3GKE9_PHYRM/34-170-------------------------------EVRQKDS

PF03564

A7SE42_NEMVE/491-638-------------------------------RGKSHEN
Q17051_ASCLU/155-293-------------------------------EYKALDP
Q23992_DROME/160-308-------------------------------HVKKTKE
A7XDH0_DROAN/157-302-------------------------------ASRASNS
Q4JS97_ANOGA/133-280-------------------------------YSVDFKT
Q4EAY5_9RICK/161-306-------------------------------DSRDLNS

PF14893

H0XX29_OTOGA/1-328QMRAGQVLLQARPNATLQDKLRRMWLERQL.PGFLGLL
M3Z644_MUSPF/1-327QARLDQILAGA.VCRTLRRKLAL..PQGGPAPGLLQLL
F7CY48_HORSE/1-330QLRARQVLMGARPNETLENKLRRMRLERRP.PGFLGML
M4B0W2_XIPMA/1-317QARIDQLIKGGTRSDLMMLNLRLRERRQNP.PPFLQLL
F6TXQ3_HORSE/2-329QVRLEQVMAGASLSEILWCRLRELKDQGPP.PSFLELM
D3Z8Y9_RAT/1-327QTRLKRILGGAILSAKLREKLKMLKQRRRP.PGFLALV
M4AZW3_XIPMA/2-318KARIEQLIKGATRSDMMMLSLRLRERRSSP.PAFLELL
F7AVZ0_XENTR/7-324SLRIRQMRRGTLNSDPVAVTIRAYYQETLT.PGYVALM
PNMA5_HUMAN/1-322MIRLKHLLARVAMTPALRGKLELLDQRGCP.PNFLELM
G1PM76_MYOLU/2-362EVASESDQDDGPEEPPKKKAMGWASAKS...PGCMRR.
F7D322_HORSE/1-321MIRLKHILARASMTTTLRGKLEILDQRGHP.PTFLELV
G3N1H8_BOVIN/3-317QLRARQVLMRARPNNLMQNKLKRMRMERRP.PSFVAML
F1S2C6_PIG/1-333QARARQVLMRARPNDTLQTKLRRLRLERRP.PGFVGLL
H2PX42_PONAB/1-327QTRLKRVLSGATLPDKLRDKLKLMKQRRKP.PGFLALV
G1LQR5_AILME/1-315QVRARQVLMRARPNEMLQNKLRRMRLERRP.PGFVGML
PNMA5_MOUSE/1-323SIRLKHVLSQVSMTTGLRGKLSLLDQQGCP.PTFLELM
PNML1_BOVIN/3-358GVASESDQDGGLEGPPKKKAMGWVSAKS...PAYMRKK
G3U141_LOXAF/1-317QVRARQVLMRAHPNPTLYNKLRRMRVEGRP.PGFVGLL
H0W6U3_CAVPO/1-332QMRARQVLMRARPNWTLQKRLRRMRLERRP.PGFQALL
H0VWL7_CAVPO/1-322MVRLKHVLAQASVTGALRGKLELLEQQGCP.PSFLELV
PNML1_PONAB/5-364GGASESDQDGGHESPPKKKAMAWVSAKN...PAPMRKK
H0VK73_CAVPO/6-363EGTSKSDQGGGQGRPLKKKATGWASGKS...LGPVRKK
G3U379_LOXAF/1-308HLRLRQVLTKATLVEPLDEALRKLRLVGRA.PSFLEML
M4AZA8_XIPMA/3-326KARIEQLLKGAVGSDLMLIQLRLRERKGNP.PTFLELL
D2GZV4_AILME/1-325QARLEQVIAGANHSGAIRRQLWLTGAAEGPAPNLFQLL
F6Z9T2_HORSE/5-364GVASESEQAGGREGPPKKKAVGWASAKR...PAPTKKN
PNML1_MOUSE/6-363GNLEDSDQDGGPENPAKKKAMTWASNKI...PVPTRKK
F1PIM5_CANFA/1-358GVALESDQDGGQEGPPKKKAMSWALAKS...SAPMRKK
F7H8Z7_CALJA/1-318HFRLRQVLSRARPSEALQDTLKQMQLDRRP.PGFLRLL
PNM6B_HUMAN/1-319RVRLRQMLTRAHLTEPLDEALRKLRMAGRS.PSFLEML
G3QYD8_GORGO/1-326QARLDQVIAGA.VHKTIRRELNL..PEDGPAPGFLQLL
F6WC96_CALJA/1-321CVSLRRMLTRANLTEPLDEALRKL.MGGRS.PSFLEML
Q5BJV6_RAT/1-328QARLDQVIAGA.IHKSVRRELGL..PEGSPAPGLLQLL

PF16297

H0W794_CAVPO/2-110--------------------------------------
D3ZTE6_RAT/24-138--------------------------------------
G1MLQ7_AILME/2-114--------------------------------------
F7ASC6_CALJA/2-113--------------------------------------
Q9D6I0_MOUSE/2-112--------------------------------------

PF14244

B9SYP2_RICCO/12-59--------------------------------------
U5FIT1_POPTR/2-49--------------------------------------
F6H7D5_VITVI/2-49--------------------------------------
M1B3X1_SOLTU/18-62--------------------------------------
K7L0W9_SOYBN/14-61--------------------------------------
B9S0Y3_RICCO/33-80--------------------------------------
B9S242_RICCO/33-80--------------------------------------
K7LQ32_SOYBN/26-73--------------------------------------
U7DX79_POPTR/501-548--------------------------------------
B9RHL9_RICCO/34-81--------------------------------------
Q84JT5_ARATH/26-70--------------------------------------
M1DJS2_SOLTU/28-75--------------------------------------
M1BMN2_SOLTU/26-72--------------------------------------
B9T813_RICCO/29-76--------------------------------------
B9SUJ8_RICCO/31-74--------------------------------------
B9T3E3_RICCO/35-82--------------------------------------
M4EME5_BRARP/24-71--------------------------------------
T1J2U7_STRMM/119-166--------------------------------------
K7JVV9_NASVI/23-68--------------------------------------

PF13961

Q5AT23_EMENI/319-345--------------------------------------
Q5AT23_EMENI/515-541--------------------------------------
A9RSN5_PHYPA/14-40--------------------------------------
B0D6P6_LACBS/11-37--------------------------------------
B0WQU4_CULQU/10-36--------------------------------------
B0WWB7_CULQU/11-37--------------------------------------
B4K1A4_DROGR/12-38--------------------------------------
B4LA17_DROMO/10-36--------------------------------------
B4LAF9_DROMO/10-36--------------------------------------
B4LE08_DROVI/13-41--------------------------------------
B4MX54_DROWI/10-37--------------------------------------
B4NQE5_DROWI/11-37--------------------------------------
B4NQR9_DROWI/10-36--------------------------------------
B6HA76_PENCW/19-46--------------------------------------
B6QCF0_PENMQ/36-62--------------------------------------
B9NDW0_POPTR/15-41--------------------------------------
B9RBX9_RICCO/17-43--------------------------------------
B9RC68_RICCO/10-37--------------------------------------
B9S5P6_RICCO/16-42--------------------------------------
C5GBD9_AJEDR/188-215--------------------------------------
C5WNA6_SORBI/166-192--------------------------------------
C5XQM0_SORBI/42-68--------------------------------------
C5XUK3_SORBI/137-163--------------------------------------
C5Z583_SORBI/42-68--------------------------------------
C6JSM1_SORBI/23-49--------------------------------------
C7J1L6_ORYSJ/181-207--------------------------------------
C7J1U3_ORYSJ/16-44--------------------------------------
C7J5A1_ORYSJ/49-75--------------------------------------
C7J6P4_ORYSJ/14-42--------------------------------------
C7J7K5_ORYSJ/83-109--------------------------------------
D0NBZ2_PHYIT/18-44--------------------------------------
D0P386_PHYIT/3-29--------------------------------------
D0P4P1_PHYIT/16-42--------------------------------------
D0RLQ9_PHYIT/21-47--------------------------------------
D2A4C7_TRICA/13-39--------------------------------------
D2A543_TRICA/14-40--------------------------------------
Q0DA14_ORYSJ/28-54--------------------------------------
Q0IZT5_ORYSJ/33-59--------------------------------------
Q0J5Y3_ORYSJ/54-80--------------------------------------
Q16S15_AEDAE/12-38--------------------------------------
Q6K285_ORYSJ/82-108--------------------------------------
Q75M81_ORYSJ/48-74--------------------------------------
Q7G5Z8_ORYSJ/52-78--------------------------------------
Q7G756_ORYSJ/12-40--------------------------------------
Q7XKY1_ORYSJ/53-79--------------------------------------
Q7XMT1_ORYSJ/56-82--------------------------------------
Q84Q85_ORYSJ/36-62--------------------------------------
Q850T3_ORYSJ/12-40--------------------------------------
B9GKP2_POPTR/14-39--------------------------------------
B9HL08_POPTR/16-42--------------------------------------
D7U4H2_VITVI/8-34--------------------------------------
F6HTJ6_VITVI/13-39--------------------------------------
F6HVN0_VITVI/97-122--------------------------------------
F6HVN2_VITVI/18-42--------------------------------------
I1Q6P1_ORYGL/57-85--------------------------------------
Q0IZC5_ORYSJ/9-35--------------------------------------
Q0J8A6_ORYSJ/26-52--------------------------------------
Q53L57_ORYSJ/161-185--------------------------------------
Q60EK9_ORYSJ/143-168--------------------------------------
Q682G3_ARATH/13-39--------------------------------------
Q7X7W1_ORYSJ/19-45--------------------------------------
Q852C7_ORYSJ/12-40--------------------------------------
Q8S5D4_ORYSJ/104-130--------------------------------------
Q8SAX3_ORYSJ/39-67--------------------------------------
Q94GR9_ORYSJ/14-42--------------------------------------
Q9AUM6_ORYSJ/511-536--------------------------------------
U5G3M5_POPTR/16-42--------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window