Sequence alignment for CL0525

PF01569

Q29NI1_DROPS/70-187-----------------------------MQVNMLVG-----LIL....D------------------------------
A4I568_LEIIN/102-249-----------------------------PAMNLILY-----LIL....S------------------------------
DOPP1_DICDI/54-178-----------------------------RTISIFLG-----LLF....S------------------------------
Q17D95_AEDAE/56-197-----------------------------LYSRLLLS-----VLL....T------------------------------
G6PC3_MOUSE/53-195-----------------------------LGISVLWI-----TFI....A------------------------------
A0BM37_PARTE/91-226-----------------------------GALLYGGM-----ILF....S------------------------------
Q23FV4_TETTS/102-237-----------------------------..LYLLSI-----TVL....S------------------------------
A0EE96_PARTE/81-240-----------------------------QIFKLITM-----NAI....A------------------------------
A8FE89_BACP2/71-198-----------------------------YKRYYSIM-----MLF....L------------------------------
A0LYQ4_GRAFK/59-183-----------------------------TMVVVTLL-----ITT....T------------------------------
Q7MUE1_PORGI/58-185-----------------------------ALFIVGAV-----LLS....V------------------------------
A0K0K5_ARTS2/118-241-----------------------------RPMLLAGA-----MLT....G------------------------------
A4XP73_PSEMY/98-234-----------------------------ALFAFLTA-----LLA....L------------------------------
A4X1H8_SALTO/101-242-----------------------------PLLPPVAG-----VAL....I------------------------------
Q9EWX3_STRCO/115-237-----------------------------PLLALGVS-----LLL....L------------------------------
A1BJZ6_CHLPD/56-185-----------------------------GALIILFS-----LCA....L------------------------------
A4FQA0_SACEN/76-196-----------------------------AALLAPVA-----TAV....A------------------------------
B0U8C7_METS4/61-186-----------------------------FAIGAVIS-----VFT....A------------------------------
A1S1V4_SHEAM/77-196-----------------------------IFWKSLTA-----IAV....A------------------------------
A1W5E3_ACISJ/72-191-----------------------------QLLQFVIG-----FGI....A------------------------------
A5CF96_ORITB/78-203-----------------------------YLLYVGTA-----YTI....F------------------------------
B4U5Z7_HYDS0/54-171-----------------------------KLKVYLVT-----LII....E------------------------------
A5DBA1_PICGU/102-232-----------------------------LSRDLIYV-----LGL....G------------------------------
Q4D544_TRYCC/102-225-----------------------------EVLDMCVL-----MCL....S------------------------------
SSPA_DICDI/88-218-----------------------------LGVELCVV-----LAL....T------------------------------
Q32GQ5_SHIDS/77-232-----------------------------....VLFA-----ILA....A------------------------------
Q9CMX4_PASMU/75-237-----------------------------GVLVMAFA-----VIL....T------------------------------
Q21JU9_SACD2/110-231-----------------------------AHWGIFLA-----AII....G------------------------------
C1DG09_AZOVD/106-238-----------------------------TARLFARL-----GNS....E------------------------------
Q0K1U6_CUPNH/103-229-----------------------------KETPYLNI-----LLR....R------------------------------
Q65GX3_BACLD/179-304-----------------------------NVVSLVNT-----LRG....N------------------------------
Q2IJN8_ANADE/141-265-----------------------------DLMILTET-----LAL...NS------------------------------
Q6FEM9_ACIAD/65-182-----------------------------QILYLVVG-----GSV....G------------------------------
A1K7H5_AZOSB/105-237-----------------------------QVGYLLVA-----MAL....G------------------------------
Q3SNT4_NITWN/91-218-----------------------------.AFLLITM-----LLS....A------------------------------
Q6MBQ7_PARUW/87-223-----------------------------LYLILVLA-----IGS....G------------------------------
A8EX54_ARCB4/94-229-----------------------------GLVILLLS-----MIL....V------------------------------
Q87X15_PSESM/102-231-----------------------------...CLVLS-----MAL....S------------------------------
Q03CR8_LACC3/177-306-----------------------------AVVATLIC-----LLS....D------------------------------
R5ZI70_9ACTN/141-283-----------------------------.LMVLAVW-----AAQ....A------------------------------
A8BDI5_GIAIC/110-282-----------------------------VLVAAIVY-----IGM....A------------------------------
A8BQZ4_GIAIC/121-285-----------------------------FPLSFCFY-----VIT....V------------------------------
Q6MTZ1_MYCMS/144-270-----------------------------KAVIVLIT-----IIS....L------------------------------
R5TP42_9FIRM/95-216-----------------------------......IG-----MTI....F------------------------------
A3LWS4_PICST/248-396-----------------------------ALKLYALS-----IGA....Q------------------------------
Q127S7_POLSJ/95-224-----------------------------ELCRYGAA-----MAL.....------------------------------
A4CJ32_ROBBH/299-448-----------------------------DKTVFAYT-----KTSIALFD------------------------------
Q2HER5_CHAGB/260-418-----------------------------FYAQLNYA-----LAN....A------------------------------
A8L0R7_FRASN/276-428-----------------------------LQTARMFA-----MVDLTEAD------------------------------
Q4YWD7_PLABA/107-241-----------------------------MFIRIAII-----LGS....I------------------------------
Q6NJR5_CORDI/194-319-----------------------------RKAWLGVC-----YAL....T------------------------------
A1SKJ7_NOCSJ/98-218-----------------------------PVVFIALV-----LAG....V------------------------------
Q82Z33_ENTFA/85-204-----------------------------LAFWAVSN-----LLA....V------------------------------
A2DYB5_TRIVA/98-241-----------------------------FLWAFVAA-----EGI....S------------------------------
A2EZZ9_TRIVA/91-236-----------------------------IICAHLSS-----IMF....A------------------------------
A4H9E7_LEIBR/233-378-----------------------------WVLLQAFS-----VAL....S------------------------------
Q6BYN9_DEBHA/112-272-----------------------------GLMALSGS-----MAT....Q------------------------------
A7EIU4_SCLS1/134-294-----------------------------AVIGLLYS-----LIT....A------------------------------
A7TF94_VANPO/122-266-----------------------------SLVCLGLI-----LTI....N------------------------------
Q2TYI3_ASPOR/35-224-----------------------------GWLGLCLS-----LAG....A------------------------------
A2EQG2_TRIVA/90-230-----------------------------ATASYIFS-----IAS....A------------------------------
PLPR5_MOUSE/122-275-----------------------------FLGIYAFG-----LFA....T------------------------------
Q9VNU2_DROME/65-225-----------------------------AEATFSFG-----FIA....T------------------------------
A8WXP5_CAEBR/128-286-----------------------------TYLKYLLM-----YAA....C------------------------------
A6X217_OCHA4/121-242-----------------------------WATLVLTS-----IVV....G------------------------------
Q5NGF4_FRATT/116-236-----------------------------YAGFILAT-----VAI....S------------------------------
Q5ZX13_LEGPH/91-208-----------------------------..WYLLGC-----VLL....P------------------------------
Q6MH55_BDEBA/105-226-----------------------------WALNFFVA-----LLV....A------------------------------
B4S7E2_PROA2/140-261-----------------------------TGRAVIEA-----HTF....S------------------------------
Q7NZZ5_CHRVO/815-932-----------------------------TGLIALES-----AGV....A------------------------------
Q0SBZ7_RHOJR/226-347-----------------------------PALILIGT-----VGA....A------------------------------
Q89JR9_BRADU/79-199-----------------------------AGNHALLV-----TVA....A------------------------------
B7VND8_VIBTL/235-351-----------------------------.ALKFGFT-----LIS....V------------------------------
Q5E4L0_VIBF1/241-366-----------------------------SALTLLFG-----IIL....S------------------------------
Q9RVR6_DEIRA/14-135-----------------------------GGRDLGVA-----FAL....S------------------------------

PF14378

Q5K8D7_CRYNJ/128-311REIIAIERWLHIDCELSLQK.FVMKTNW.LLMFFNKT.....YAM----V------------------------------
B0UG28_METS4/124-315PVLMRAEAALGFDWRAHVA..LVERHPA.VARALALA.....YHS----S------------------------------
A1SJR6_NOCSJ/50-230RDIVRVEERLGIDVEGAIQA.PVTLSPV.LETAANWV.....YIW----G------------------------------
C5APU7_METEA/131-322PALARVETAMGFDWRGWVG..SLAAHPD.LSWWLALA.....YHS----S------------------------------
E4NIW3_KITSK/45-228LSLRSAERALHLAVEPAANG.WLAGHPL.LCHLAVYV.....YR.----G------------------------------
Q989C0_RHILO/119-308WLLVAGDKTLGFDWPSALG..YANSHPK.IAAVLVFC.....YEA----L------------------------------
G8WRV6_STREN/158-347EAIVRLEHTLRISPEHALNQ.LFTHQAW.LGVPACFA.....YAT----L------------------------------
C7QD07_CATAD/71-251TWIWDTERDVFLPSEHWIQHLFFPAHPT.VVKFFNLY.....YAS----M------------------------------
Q1D5Z1_MYXXD/96-274AQLVAADQRL.FGMQAAVV..LSRVVPAWLNDILLVC.....YYG----.------------------------------
Q2G5H1_NOVAD/115-305PWLHAADRSIGFDFRWLSQ..VYADNPA.IMSISRFA.....YSS----L------------------------------
U4LB32_PYROM/137-324LSLIAWEEALGIFVELDIQH.WFLERPI.LLKIINCI.....YSF----I------------------------------
Q1IHV8_KORVE/153-330LFLYSFDASLGGQWTFRLAQ.FTAHHPG.AHFVSAMV.....YNV----V------------------------------
F2R3P1_STRVP/39-228LAVLRLERLLGVDVERPLNR.LFTDVPA.LGVPADFA.....YAS----L------------------------------
A9HHP2_GLUDA/131-314ADLARFDRNLGFDWPEWIQ..GLKAHPF.VQVVMAAT.....YGS----L------------------------------
Q13PQ7_BURXL/110-293HAFIAADAALGFHWPDTYR..WVLAHPW.LHRALGWA.....YAS----G------------------------------
R6XNQ9_9FIRM/3-178NFIIATQLSLDHDIASFMNK.LLNNFGSFLTPILKFITILGNFGT----I------------------------------
Q63V72_BURPS/125-308GALIRLDARLGFDWPAVYE..RIRAHPA.LRRALAFA.....YDS----A------------------------------
Q01VD1_SOLUE/159-330YYLYAFDGSLGLQPSFILGS.IVAPVPV.LVWLTAMV.....YNS----L------------------------------
D1CA82_SPHTD/53-235REVMHLERKLGLFREIGVQA.WLLAQPW.IVHFLNWV.....YTY----T------------------------------
K0K1I4_SACES/40-223LQVQRLEQMLHIAIEQPLNQ.AILAHPA.AIHLTGYF.....YR.----L------------------------------
D1C524_SPHTD/53-234ELVIAVERSVGLFWEAHVQA.WVLEHPR.LVDIFNWI.....YIY----V------------------------------
W5TLL4_9NOCA/53-242HGLMRVEGWLGLHPELWLNG.VFVDHAW.IAIPADFA.....YAT----L------------------------------
D3HTE9_LEGLN/101-283PSIVNFENYIHFPMESVVA..WTNNHPK.FKYLLGVT.....YDS----L------------------------------
Q2JBQ4_FRASC/47-236HDLLRLETFLHLDPELGLNR.WLQSVPV.LAVVCCYY.....YAT----L------------------------------
W0BEC4_9GAMM/94-276KYILKFESSLYINMEGIVR..WTREHPN.INTLLMYS.....YRT----L------------------------------
Q220L9_RHOFT/109-292APLAAWDRALGFDWLALHG..WLQSHPP.AQTTLHIA.....YQS----G------------------------------
G2P916_STRVO/51-241LAILHFEQRLNIDFESPLND.LFTAHAV.IGIPADFA.....YAS----L------------------------------
Q87M50_VIBPA/146-355QSLIELDRWLHFGNDPWVITHAILSSPW.ASLAINTA.....YNA----W------------------------------
B1LSY3_METRJ/129-320PALARIETALGFDWTGHVA..FLARHPT.LSWWLALA.....YHS----S------------------------------
A2BL06_HYPBU/51-224VALFGVPLAVYFQFHRLLV..........LDIYTGIV.....YA.----L------------------------------
L0PFU2_PNEJ8/5-201IWVSVLPTLENIVYGASLSN.LLSKHTYFFLDILAWI....PYGI----I------------------------------
C9Z2S2_STRSW/63-253LAILRFEKALWLNAEHPLNR.LFTREPW.IGIPADFW.....YAS----L------------------------------
B9L518_THERP/33-215FLVMRLESALGLAIEQQLQR.IVLATPV.LVTLLNGI.....YAF----T------------------------------
E3JAH2_FRASU/94-282RRLLHLEQVTHLNPEHPLNN.FLVHATV.LAVPACYF.....YAT----L------------------------------
F8AWV4_FRADG/47-236WDIMRIQADLHLDIELGLNH.WLQGVPA.LAVACCYY.....YAT----L------------------------------
R7Y200_9ACTN/124-318RELHLMDRALFLGHEPATVLHTIFGTGP.SAHVLSSV.....YLW----F------------------------------
A0LS47_ACIC1/69-252TGILDLEHRWGLDVERSLNT.FLARHPA.LGVAASWE.....YAT----T------------------------------
E2Q4K3_STRC2/45-234LAILRAERALYLDFETPLND.LFTSTPA.IGIPADFF.....YAS----L------------------------------
F8J559_HYPSM/123-309KILVAADAGLGIDWVALAF..WFRDHPE.LTRILSHA.....YAS----I------------------------------
L0ET54_LIBCB/102-293NTLSLVDERLGFHWISFIR..FVDARPW.LSFWLKES.....YSS----F------------------------------
Q89QL0_BRADU/109-300SEFAVLDQRLGFDWMAWLA..AMNAAPL.LHRILAGA.....YAS----F------------------------------
B1VW42_STRGG/49-238LAILRLEQALHLNAEHPLNR.LFTSTPS.LGIPADFA.....YAS----L------------------------------
C5AQ48_METEA/107-294DWFIGIDRAFGFDWLTFQT..SMVERRA.LMEILSRA.....YET----F------------------------------
H0PVV4_9RHOO/74-256TQFSELDRAIGFSWLAWFE..LTRANIV.LDTLLRLA.....YHS----L------------------------------
E3EJC2_PAEPS/1-162M.LINVDFALFH.........WINELADHLAFLNGTMRFLAQYAP----Y------------------------------
G0HGL8_CORVD/79-265QWILDAEDRFGLAWERGLNT.FLDTTPS.VAAVCAVV.....YAS----L------------------------------
A1SDU3_NOCSJ/130-324RELHYLDRALLFGHDPAHVLHGLLGEGF.MAWPLSYI.....YLW----F------------------------------
C7QBQ6_CATAD/84-272HDILRVEHFLGLNFERSFNH.WVYSVRW.LAFSMNVY.....YAT----L------------------------------
A1SHK3_NOCSJ/128-322QELLAIERWFLLGHSPAVLLHGLLGEGQ.AAVVLAVV.....YRS----F------------------------------
E3J0M0_FRASU/110-299ETLLRWQSAMHLDIELSLNH.WLDTVPV.LAVICCYY.....YAT----L------------------------------
C8XDB0_NAKMY/22-205QALQSIERSLHLDIELAANQ.WLAERPA.LIQAAALY.....YR.----L------------------------------
G7XGU5_ASPKW/117-299LSILSFEHFLHLDVELSVQRYVLEQKPW.LMGFLARV.....YYS----.------------------------------
N0BE90_9RHIZ/119-305AALAEIDRRMGIDWVAIAF..WFRAHPE.LSRVLCAV.....YGS----N------------------------------
B1LVV6_METRJ/99-290STFHAWDRRLGLDWRAYLA..FVDGHPR.LGLALSLA.....YRS----L------------------------------
Q5ZV46_LEGPH/101-283KQIIKLEAQLGINMISILE..WTNKYQH.FKYLLAII.....YDT----L------------------------------

PF14360

SLS2_TRYB2/201-275------------------------------------------HCG----D------------------------------
B8C480_THAPS/431-503------------------------------------------GCG----D------------------------------
IPCS3_ARATH/172-244------------------------------------------GCG----D------------------------------
SAMD8_HUMAN/292-365------------------------------------------TCG----D------------------------------
A2DHW8_TRIVA/46-124------------------------------------------QCG----D------------------------------
A9RPY7_PHYPA/269-340------------------------------------------GCN----D------------------------------
SLS_LEIMA/211-286------------------------------------------HCG----D------------------------------
A5K283_PLAVS/202-273------------------------------------------VCS----D------------------------------
Q4YWD8_PLABA/201-272------------------------------------------VCS----D------------------------------
B3L7G0_PLAKH/276-347------------------------------------------ECT----D------------------------------
Q28DN3_XENTR/220-293------------------------------------------LCG----D------------------------------
Q4N3L0_THEPA/182-253------------------------------------------PCT----G------------------------------
A8XDY1_CAEBR/127-200------------------------------------------LCG----D------------------------------
IPCS_ORYSJ/172-244------------------------------------------GCG----D------------------------------
A9SUW6_PHYPA/174-246------------------------------------------GCG----D------------------------------
SMSR1_CAEEL/321-394------------------------------------------SCG----D------------------------------
Q17C33_AEDAE/230-303------------------------------------------YCG----D------------------------------
SMS2_CAEEL/201-274------------------------------------------LCG----D------------------------------
A8X0T5_CAEBR/264-337------------------------------------------LCG----D------------------------------
A9S9I4_PHYPA/275-346------------------------------------------GCN----D------------------------------
B3SD02_TRIAD/279-352------------------------------------------TCG----D------------------------------
A2DN61_TRIVA/170-240------------------------------------------TCG----D------------------------------
C5KN45_PERM5/142-213------------------------------------------GCS----D------------------------------
C5L5L1_PERM5/146-217------------------------------------------GCS----D------------------------------
SMSR2_CAEEL/246-319------------------------------------------LCG----D------------------------------
B5YLZ6_THAPS/422-494------------------------------------------GCN----D------------------------------
C6KT87_PLAF7/201-272------------------------------------------VCA----D------------------------------
D0MWV3_PHYIT/192-264------------------------------------------GCG----D------------------------------
B7FUU7_PHATC/326-397------------------------------------------GCN----D------------------------------
SLS11_TRYCC/193-267------------------------------------------HCG----D------------------------------
D2VDJ4_NAEGR/246-319------------------------------------------TCG----D------------------------------
C5KL60_PERM5/83-154------------------------------------------TCA----D------------------------------
D2VXN5_NAEGR/191-270------------------------------------------TCG----D------------------------------
D2VKR1_NAEGR/196-272------------------------------------------TCG----D------------------------------
B9HC73_POPTR/172-244------------------------------------------GCG----D------------------------------
C6KT86_PLAF7/265-336------------------------------------------ECT----D------------------------------
C4LV27_ENTHI/184-261------------------------------------------TCA----D------------------------------
A2FIE9_TRIVA/168-238------------------------------------------TCG----D------------------------------
B7QHG5_IXOSC/233-306------------------------------------------FCG----D------------------------------
C5LU78_PERM5/899-971------------------------------------------GCG----D------------------------------
C5KY50_PERM5/57-128------------------------------------------TCA----D------------------------------
D0NII4_PHYIT/164-244------------------------------------------SCG----D------------------------------
A7ANZ4_BABBO/239-311------------------------------------------TCT----D------------------------------
A0JMN0_DANRE/269-342------------------------------------------MCG----D------------------------------
C3XQA8_BRAFL/273-346------------------------------------------LCG----D------------------------------
A0A0H5S654_BRUMA/218-291------------------------------------------LCG----D------------------------------
F8W5G6_DANRE/232-307------------------------------------------MCG----D------------------------------
F6UTK5_XENTR/280-353------------------------------------------LCG----D------------------------------
H3CAZ2_TETNG/175-248------------------------------------------MCG----D------------------------------
J9FFV7_WUCBA/189-261------------------------------------------LCG----D------------------------------
Q4U956_THEAN/200-270------------------------------------------NCT----D------------------------------

PF02681

F2NNY3_MARHT/5-141-----------------------------LGNQILWT-----ALA----A------------------------------
K9T6M6_9CYAN/8-143-----------------------------LSNRVLIV-----SLL----A------------------------------
D4ZTL8_ARTPN/8-143-----------------------------LDNRVLLV-----ALF----A------------------------------
K9WGM7_9CYAN/8-143-----------------------------LNNQVLLV-----AII----A------------------------------
B7GI74_ANOFW/24-164-----------------------------..NRAIQT-----ALC----T------------------------------
B1WS33_CYAA5/8-143-----------------------------FHNKILLV-----SLI----A------------------------------
R5AEV3_9CLOT/9-146-----------------------------FSNRILIA-----AIV----A------------------------------
Q31Q62_SYNE7/9-145-----------------------------LANDVLVA-----ALL----A------------------------------
R5XG63_9CLOT/5-137-----------------------------FQNRILLI-----SIF----S------------------------------
D4JCM8_9FIRM/8-144-----------------------------....PLVS-----ALL----A------------------------------
W0E929_9FIRM/8-143-----------------------------FQNEVLVS-----AIT----A------------------------------
D3FYY4_BACPE/4-149-----------------------------FHNFPLWA-----ALF----A------------------------------
F0RVM2_SPHGB/6-143-----------------------------FGNAPFLS-----AAL----S------------------------------
H6NB79_9BACL/2-142-----------------------------..NRALWT-----SIA----G------------------------------
Q7V6P1_PROMM/15-147-----------------------------LDNAVLAW-----GLA----A------------------------------
Q18B69_PEPD6/8-140-----------------------------FNNGALGI-----SLI----A------------------------------
G0GF41_SPITZ/9-149-----------------------------LSHPVFLS-----GFL----S------------------------------
Q65FE5_BACLD/4-149-----------------------------LTNFPLLA-----SFA----A------------------------------
U5LF62_9BACI/2-142-----------------------------..NKGVIV-----ALL----S------------------------------
R7L0C2_9FIRM/5-149-----------------------------..NYILVT-----SIV----G------------------------------
Q5WDV5_BACSK/4-146-----------------------------LDNFPLWA-----AFM----A------------------------------
D6GSF2_FILAD/8-144-----------------------------LQNKVLGV-----AIL----C------------------------------
E6U5K5_ETHHY/8-143-----------------------------FHNYILMA-----AVL----S------------------------------
Q5SJ95_THET8/4-140-----------------------------LANAVFWT-----AVL----A------------------------------
R5GK39_9FIRM/5-157-----------------------------MANPTITV-----GLI----S------------------------------
Q9RSQ8_DEIRA/8-143-----------------------------LSNRWLWA-----AVF----A------------------------------
P73185_SYNY3/8-143-----------------------------FHNQVLLI-----SLA----A------------------------------
D1AKQ0_SEBTE/7-143-----------------------------FGNRILDV-----AVI----A------------------------------
E0RXA3_BUTPB/8-144-----------------------------LNNRLLLA-----AFF----G------------------------------
F5YE41_TREAZ/16-155-----------------------------IENPIVLS-----SLT----S------------------------------
V5WEJ9_9SPIO/6-144-----------------------------..NPVFTS-----ALL----S------------------------------
U5LHE7_9BACI/5-149-----------------------------L.NFPLWS-----ALA----A------------------------------
K9XWG4_STAC7/8-143-----------------------------FHNQILLV-----AIL----A------------------------------
E6U2C7_BACCJ/4-149-----------------------------LTNFPLWV-----ALF----T------------------------------
R7M7X6_9CLOT/12-143-----------------------------...KYIIV-----PFM----V------------------------------
K9V3M2_9CYAN/8-143-----------------------------FNNRVLLV-----ALV----A------------------------------
B9IAH9_POPTR/38-171-----------------------------..NLPLLS-----ALL----A------------------------------
M0RZC5_MUSAM/20-155-----------------------------.VNRPLFS-----AVL----A------------------------------
R5ZD30_9FIRM/8-146-----------------------------....PLVT-----AII----S------------------------------
R6Q3Q8_9FIRM/8-138-----------------------------L.NKPFWA-----AIL----S------------------------------
F4GLJ1_SPHCD/5-141-----------------------------LTNSPLIA-----SFL----A------------------------------
C0ZKP9_BREBN/5-150-----------------------------FENFPLWA-----ALL----A------------------------------
D8TLE7_VOLCA/33-168-----------------------------FVNGALVS-----AIV----A------------------------------
D4JU78_9FIRM/7-157-----------------------------..NVILLI-----ALI----S------------------------------
K9YEC7_HALP7/8-143-----------------------------VENHLLWV-----SLI----A------------------------------
K3XML5_SETIT/24-159-----------------------------FHNYPLVA-----AML----G------------------------------
K9RII7_9CYAN/8-143-----------------------------FDNHVLIV-----ALI----A------------------------------
K4LIZ6_THEPS/40-169-----------------------------FQERYILS-----GLL----S------------------------------
E6TWS5_BACCJ/5-142-----------------------------.....IFT-----ALL----A------------------------------
R6V5P2_9CLOT/18-171-----------------------------.......S-----IAL----A------------------------------
Q73MW8_TREDE/10-150-----------------------------FSNPIFLS-----AIT----S------------------------------
Q8Y4P9_LISMO/4-149-----------------------------FTNTPLIA-----SII----A------------------------------
M0SK26_MUSAM/139-272-----------------------------.GNPTFVS-----GLV----A------------------------------
I0GIV6_CALEA/8-146-----------------------------LSNNILIT-----SII----S------------------------------
A9TH33_PHYPA/30-165-----------------------------FTNFPIVA-----AFL----S------------------------------
G4KW10_OSCVS/4-137-----------------------------WNNHLLVN-----SMI----A------------------------------
R5CL70_9FIRM/8-147-----------------------------FHNPLFVA-----SAC----S------------------------------
I0I5M8_CALAS/5-139-----------------------------LSNTALWL-----PLS----I------------------------------
D7CKU8_SYNLT/12-144-----------------------------.NHKLIVA-----PLT----A------------------------------
R7IRJ9_9CLOT/8-142-----------------------------ITNRYLYI-----PLI----L------------------------------
B8HXR8_CYAP4/8-143-----------------------------ITNRVLLV-----SLS----A------------------------------
B0C3J0_ACAM1/8-143-----------------------------LNNQVLLV-----SLA----A------------------------------
I4DAH9_DESAJ/3-144-----------------------------HSNVLLFS-----ALF----S------------------------------
Q46K07_PROMT/15-148-----------------------------LDNAVLAW-----GLA----A------------------------------
R7A3G1_9CLOT/8-142-----------------------------ITNKYLYL-----PFL----V------------------------------
Q24V03_DESHY/8-143-----------------------------LDNHILIS-----AMI----A------------------------------
K9VPU0_9CYAN/9-144-----------------------------LNNHVLVV-----ALL----A------------------------------
D1BMJ6_VEIPT/9-146-----------------------------AHNYIAQA-----AFW----G------------------------------
Q10X44_TRIEI/8-143-----------------------------MDNYVLWV-----ALV----A------------------------------
A4RZ57_OSTLU/3-142-----------------------------LDNCGLIA-----AFV----A------------------------------
D8QR56_SELML/24-159-----------------------------FSNLPLVA-----AFV----S------------------------------
K4AZY7_SOLLC/140-274-----------------------------AANPTFVS-----GFI----A------------------------------
Q8ENX8_OCEIH/4-149-----------------------------FSNFPLWA-----ALC----A------------------------------
K7V114_MAIZE/48-182-----------------------------..NFPLAV-----ALL----A------------------------------
D4IXN8_BUTFI/8-143-----------------------------ITNKIFVA-----PTV----A------------------------------
Q01ES7_OSTTA/128-261-----------------------------.GNHVFLC-----AFL----S------------------------------
E3HA83_ILYPC/7-143-----------------------------FGNRIIDV-----VFI----A------------------------------
V5RVF1_9BACT/5-132-----------------------------....YLVA-----IVI----G------------------------------
A6TR41_ALKMQ/8-144-----------------------------GNNKILGT-----ALL----A------------------------------
I1KRZ5_SOYBN/9-144-----------------------------TSNYPLIS-----AIV----A------------------------------
R5KDM7_9CLOT/8-150-----------------------------LHNPILVA-----PIL----G------------------------------
R7I9S8_9FIRM/10-145-----------------------------FSNQVLLC-----CIT----A------------------------------
R6BY11_9CLOT/8-144-----------------------------VQNKVLLS-----AVS----G------------------------------
R5ITD2_9FIRM/8-144-----------------------------FSNRVLLS-----GLI----G------------------------------
K9RQD3_SYNP3/8-143-----------------------------LHNDLLWL-----ALA----A------------------------------
K9SVF9_9SYNE/8-143-----------------------------LDNRVLLI-----AIA----A------------------------------
Q7VBG6_PROMA/16-148-----------------------------LDNAVLAW-----ALI----A------------------------------
O83188_TREPA/14-153-----------------------------FSGEVFLS-----ATC----S------------------------------
G8QY16_SPHPG/6-143-----------------------------LHNIPFIA-----AAL----A------------------------------
D3EMZ3_ATETH/8-144-----------------------------IHNKILLV-----SLL----A------------------------------
R5TH29_9CLOT/11-163-----------------------------........-----LGA----A------------------------------
A9TSJ4_PHYPA/1-141-----------------------------....VLIS-----AAT----A------------------------------
R5YWD2_9CLOT/9-140-----------------------------...RFLVV-----PIL----V------------------------------
M0SG02_MUSAM/22-157-----------------------------LHNYPLIS-----AIL----A------------------------------
F5YMS6_TREPZ/16-155-----------------------------VESPIFLS-----AVT----S------------------------------
R7J8Q8_9FUSO/12-143-----------------------------....ALSA-----GIL----A------------------------------
R7R6N9_9FIRM/8-144-----------------------------FHNQLLIA-----AVL----G------------------------------
C7NE60_LEPBD/7-143-----------------------------FGNRLLDV-----AAI----S------------------------------
R5IDQ6_9CLOT/2-138-----------------------------LGNQVLVS-----AVV----G------------------------------
D9R8M4_CLOSW/8-144-----------------------------LGNQVLIT-----AVA----G------------------------------
D7BAF5_MEISD/5-141-----------------------------LSNQVLWT-----AVL----A------------------------------
F8F1T7_TRECH/16-155-----------------------------FENPVFLS-----AIT----S------------------------------
Q93ZZ7_ARATH/51-205-----------------------------IHNKVLIA-----AGT----S------------------------------
D8U4F3_VOLCA/38-173-----------------------------LTNRVFLV-----GFW----S------------------------------
J7IS94_DESMD/8-142-----------------------------FHNTILIS-----AIT----A------------------------------
A4XKK1_CALS8/9-143-----------------------------VTNKALQV-----GFV----S------------------------------
F9VBI0_LACGL/8-142-----------------------------ISNQILIT-----AIV----G------------------------------
K9W0K1_9CYAN/16-151-----------------------------LDNQVLLV-----ALL----A------------------------------
A9NHX4_ACHLI/6-144-----------------------------..EAVLII-----SIS----A------------------------------
D1AXZ8_STRM9/7-141-----------------------------FGNKILDV-----VFI----S------------------------------
K9UG93_9CYAN/16-151-----------------------------LDNRILLV-----AVA----A------------------------------
F4LN44_TREBD/13-152-----------------------------FKNSVFLA-----CIF----S------------------------------
R6NRL3_9CLOT/2-140-----------------------------...KIFIV-----CFM----S------------------------------
K0IWZ6_AMPXN/4-149-----------------------------LKNFPLII-----SLF----A------------------------------
W8TJV6_EUBAC/8-150-----------------------------ANNQVFII-----SVT----A------------------------------
R5BKA4_9FIRM/8-146-----------------------------FDNYIALS-----AFL----G------------------------------
A8MFI8_ALKOO/8-144-----------------------------GKNEIFIV-----AVF----S------------------------------
H9UHZ5_SPIAZ/13-152-----------------------------VRNPVFLS-----TFT----S------------------------------
B8CY18_HALOH/3-134-----------------------------....LLEI-----SLL----S------------------------------
B2A528_NATTJ/7-141-----------------------------LSNIYLIS-----ALI----G------------------------------
R6ME09_9FIRM/8-142-----------------------------ISNSVLIT-----ALI----G------------------------------
F2NS18_TRES6/11-151-----------------------------FSQPAFLA-----CLF----S------------------------------
R5PNP2_9CLOT/8-138-----------------------------...RYLIV-----PFV----T------------------------------
Q1J0I2_DEIGD/9-145-----------------------------LGNRWLWT-----AVL----A------------------------------
D6DFV4_CLOSC/8-144-----------------------------TGNQVLMS-----GVI----G------------------------------
I4D8V5_DESAJ/8-142-----------------------------FYNTILIS-----AVT----A------------------------------
R7A673_9FIRM/8-144-----------------------------LHNRIFVS-----AAL----G------------------------------
R7FJ12_9CLOT/8-142-----------------------------IQNKYIYI-----PFL----L------------------------------
O51097_BORBU/6-146-----------------------------LTNDLFLS-----CLV----S------------------------------
K8GFC4_9CYAN/8-143-----------------------------LNNQVLLV-----AIA----A------------------------------
R6QDM5_9CLOT/9-141-----------------------------...EVLGN-----ACI----A------------------------------
M4CGY8_BRARP/134-268-----------------------------SANPTFVS-----AVF----A------------------------------
K9Q226_9CYAN/8-142-----------------------------FHNQILIV-----ALA----A------------------------------
R6N1H2_9CLOT/6-146-----------------------------RDNSVVFL-----GLL----S------------------------------
D3FSU1_BACPE/2-142-----------------------------..NRPMLT-----ALL----T------------------------------
B9DG97_ARATH/20-155-----------------------------FTNYPLIS-----AVT----S------------------------------
Q9CGU3_LACLA/8-142-----------------------------FHNQILMT-----AIV----S------------------------------
F2I5F0_AERUA/1-152-----------------------------MKNFPLTA-----TIV----A------------------------------
R7N6H8_9FIRM/8-144-----------------------------THNSIFMS-----AIT----G------------------------------
C1FDH6_MICCC/170-303-----------------------------.GNLVFMC-----AFW----S------------------------------
R6SUP5_9CLOT/9-142-----------------------------FTNYVMMS-----AVF----S------------------------------
Q7U880_SYNPX/15-147-----------------------------LDNSSLAW-----GLV----A------------------------------
A5GM29_SYNPW/13-145-----------------------------LDNASLAW-----GLA----A------------------------------
Q2JKH6_SYNJB/6-142-----------------------------MANHVLWV-----ALL----A------------------------------
F2JMF4_CELLD/8-142-----------------------------LQNKILWV-----AIV----S------------------------------
E6SHJ0_THEM7/12-146-----------------------------..NQPLVS-----AVA----A------------------------------
K9S6R1_9CYAN/8-143-----------------------------LSNRTLLV-----ALL----A------------------------------
E3PRG0_CLOSD/8-144-----------------------------IHNQVFIA-----CFL----A------------------------------
R5N6N4_9CLOT/8-137-----------------------------..YKYIIV-----PFV----T------------------------------
B1YKA4_EXIS2/4-132-----------------------------..NHPLFA-----AIT----A------------------------------
R5GZB8_9FIRM/8-144-----------------------------IHNTVFMS-----AVT----G------------------------------
D5WTV2_KYRT2/8-146-----------------------------..NLPLLS-----ALA----S------------------------------
R6PRB8_9FIRM/8-139-----------------------------FQNKIIGI-----SIL----S------------------------------
E6UEQ9_RUMA7/8-144-----------------------------LSNVFVIT-----AIA----S------------------------------
C1N1Q0_MICPC/8-144-----------------------------FDNVGLVA-----AII----A------------------------------
L0A6P8_DEIPD/5-141-----------------------------IHNKWLWT-----AVF----A------------------------------
M1E7F3_9FIRM/5-139-----------------------------LANKLIWI-----PFT----A------------------------------
R6USA8_9FIRM/5-142-----------------------------...YPLVA-----ALL----A------------------------------
A9SA98_PHYPA/3-154-----------------------------..EQVLVS-----AVT----A------------------------------
E3DMH7_HALPG/3-133-----------------------------....LLEV-----SMF----S------------------------------
E4U9L1_OCEP5/5-141-----------------------------LANEVLWA-----ALI----A------------------------------
E8N0A2_ANATU/6-140-----------------------------LSNHVLWI-----SLI----A------------------------------
K9SNJ2_9CYAN/8-142-----------------------------LDNQLLLI-----AVL----A------------------------------
F0T097_SYNGF/8-149-----------------------------LANKVMLI-----SLL----A------------------------------
A8FH06_BACP2/4-149-----------------------------LTNFPLLA-----SLA----A------------------------------
A9SE32_PHYPA/36-170-----------------------------RTNPTFMS-----GLV----A------------------------------
I0JQ19_HALH3/6-151-----------------------------LHNFPLWA-----SIA----S------------------------------
R5SAC8_9GAMM/12-144-----------------------------...EVIFV-----AFS----G------------------------------
M4FCC5_BRARP/76-227-----------------------------...KVLIA-----AGF----S------------------------------
G8LW53_CLOCD/8-141-----------------------------INNRTITV-----PMF----A------------------------------
C8WVG2_ALIAD/12-152-----------------------------WGNTALMA-----AIC----A------------------------------
R5ADD7_9CLOT/7-149-----------------------------FSNPLINA-----GVL----S------------------------------
D4K6A9_9FIRM/9-148-----------------------------SANQILTA-----SLL----S------------------------------
K3YAI4_SETIT/11-145-----------------------------.VNYPLVA-----ALL----A------------------------------
R7F8Q2_9CLOT/8-142-----------------------------ITNKFIYV-----PLL----T------------------------------
A3DDN6_CLOTH/8-143-----------------------------LSNKTVTV-----PMI----A------------------------------
K9Z2J9_CYAAP/8-142-----------------------------FSNKLLVI-----PLL----A------------------------------
K9P352_CYAGP/15-157-----------------------------LANGVLAW-----GLA----A------------------------------
K9XC51_9CHRO/8-143-----------------------------LDNSVLLV-----AVI----A------------------------------
R6Y7H0_9FIRM/7-149-----------------------------LSNSLINV-----GVV----S------------------------------
E1RAI3_SPISS/5-141-----------------------------LQNRILWL-----TLA----V------------------------------
X2GPK1_9BACI/6-151-----------------------------LQNTPLLV-----ALF----S------------------------------
R5R4Q1_9FIRM/8-145-----------------------------LHNTILIN-----AVT----G------------------------------
Q7V118_PROMP/8-139-----------------------------FDNSVLFW-----SLL----A------------------------------
B8E2Q0_DICTD/12-146-----------------------------LQNPVFII-----PMM----V------------------------------
K4KZ53_9FIRM/8-148-----------------------------LNNNIMWV-----SLF----A------------------------------
R6EV23_9FIRM/8-145-----------------------------FSNHIFLT-----AAC----G------------------------------
D6Y193_BACIE/4-149-----------------------------FTNFPLWA-----GLF----A------------------------------
F5WQX5_ERYRF/7-143-----------------------------....PIIS-----ALV----A------------------------------
C4L0Z0_EXISA/3-131-----------------------------..NEPLLA-----AIL----A------------------------------
D7GPW8_9FIRM/6-142-----------------------------LGNQILIS-----AVL----G------------------------------
D5E1E4_BACMQ/2-142-----------------------------..NKGIVI-----ALS----S------------------------------
A4J281_DESRM/9-144-----------------------------WLNKILFA-----PLS----A------------------------------
I0JIT0_HALH3/2-142-----------------------------..NRGILT-----ALT----A------------------------------
E1Z6N1_CHLVA/1-136-----------------------------.HNGAFVA-----AFL----G------------------------------
D3PLN0_MEIRD/5-141-----------------------------LSNQVLWT-----AVL----A------------------------------
Q8DMU2_THEEB/9-144-----------------------------LANHVLWV-----AFA----A------------------------------
A4RUH5_OSTLU/12-147-----------------------------VSSPALIA-----ALL----S------------------------------
Q5L0A2_GEOKA/2-142-----------------------------..NKGLKT-----ALA----T------------------------------
W1NTD9_AMBTC/34-169-----------------------------LSNLPLLS-----SFL----A------------------------------
K8EPQ0_CARML/4-150-----------------------------LTNYPLIA-----ALS----A------------------------------
C6CSF5_PAESJ/6-132-----------------------------....YFLA-----PLI----G------------------------------
G2TKM5_BACCO/4-146-----------------------------..SYPILS-----ALL----G------------------------------
K9TPQ7_9CYAN/8-143-----------------------------IDNRVLLV-----ATL----A------------------------------
N0B1X3_9BACI/2-142-----------------------------..NKGVSI-----ALI----S------------------------------
V5WJH0_9SPIO/5-132-----------------------------.....FFT-----AVS----V------------------------------
C9RC18_AMMDK/8-140-----------------------------.AHKLILA-----PLA----A------------------------------
L7VUG0_CLOSH/9-141-----------------------------LSNRAITT-----PVL----T------------------------------
R5J5K1_9FIRM/8-139-----------------------------FSNKMLWT-----SIF----A------------------------------
C1E358_MICCC/7-142-----------------------------ISSPALVS-----ALL----A------------------------------
R7MBM3_9CLOT/16-148-----------------------------...EVITC-----GVA----S------------------------------
R6B6R3_9CLOT/12-145-----------------------------...RYLVV-----PFF----T------------------------------
A5GRZ6_SYNR3/9-137-----------------------------LDNGPLAW-----GLA----A------------------------------
R7B1C9_9CLOT/8-144-----------------------------TSNQTLMT-----GVT----G------------------------------

PF10261

Q5KDG2_CRYNJ/99-376-------RVAYFARKSNILNVIFVKRAWAWTSAIYLL-----HLV----T.......SPRNRSRMFSFST..........
G2QCT9_MYCTT/113-344-------.PSYFARKDNLLNVLFVKRGWAWISVAFWA-----FLL----T.......HP........AAG..........
E3RV27_PYRTT/85-309-------APSYFAQKKNVFNVYFVKVGWFWTTLAFAF-----FVT----L.......HP....GFGRGA...........
R7YND5_CONA1/92-324-------.PSYFAQKRNVFNLFFVKQGWAWTTAALVL-----FLL----T.......HP....SLGPPMRP.........
G2XHJ1_VERDV/98-323-------APGYFARKNNVFNVVYVKRGWFWTTVVFGL-----FVA----T.......HP....ALQNT............
C4Y4H3_CLAL4/57-287-------VYNYYNDKGNIFNQWFVKKGWAWTTGAIAL-----FYT----..................IEVSK........
C5DQ74_ZYGRC/35-359-------....SVDKDGWINTVFVKKGWFWTSLVMWM-----CVY----..........RYG..................
G8BYR0_TETPH/33-386-------.KTWDINRDSIINSVFVKRGWFWNSLVLWY-----VIL----FTNITIVDEPKRNNSIEGRKTK.........
E3KJ35_PUCGT/96-348-------.LPYFANKSNFLNQKFVKLGWAWTTFVVWF-----HAI----AIATCYFGPPHPNQQQQQTQNS.........
N1RPR7_FUSC4/66-290-------.PSYFARKSNIFNVLFVKRGWAWITVAFFV-----FIF----S.......HP....STTDT............
F9WXZ1_ZYMTI/84-317-------APSYFAKKSNIFNVYFVKVGWLWTTLAFFL-----LIL----S.......HS....SLGPPLRL.........
G3BAX8_CANTC/92-323-------VYNYYNDKNNVFNQLFVKRGWFWTTVVMAA-----FYG----SVFYGKHPQLGTNRF................
G8BIE7_CANPC/69-321-------VYNYYNNKHNFFNTVFVKRGWGWTTLIIIV-----FYA----VIVMPKLYS.........NKNDTTS......
C5FE12_ARTOC/64-296-------PVNYFARKGNVFNVYFVKIGWLWMSLAFLS-----LLL----T.......QQ....AFISKRIS.........
G8ZXV3_TORDC/32-356-------DLQYRINKDGLLNSFFVKRGWFWTSAIGWW-----CMI----..........RYRSFN...............
A5DKF9_PICGU/56-288-------VYNYYNNKNNVFNQIFVKRGWFWTTVVLVA-----FYG----VI....FT..........STTHSYIK.....
E3QPL9_COLGM/87-312-------APSYFARKSNLFNIIFVKRGWFWITAAFFA-----FLL----T.......HP....GTKNA............
S3CVS7_OPHP1/100-357-------APSYFARKSNVLNVLFVKRGWFWITVTFFA-----FVA----T.......HPYFTAVQKAPSK..........
A3LYM5_PICST/59-299-------VYNYYTNKKNVLNQVFVKNGWFWTTANIVL-----FYG----IV....LY..........KEKS.........
G0WG33_NAUDC/40-380-------....TVDKDGLINTLFVKKGWFWTTLVGWF-----CIY----..........RYNNRRPDF............
M3IZX9_CANMX/56-283-------VYNYYNNKGNIFNQYFVKKGWGWTTLVILL-----FYS----NL....LY..........KTPA.........
G3JBH7_CORMM/90-318-------APNYFARKSNLFNVYFVKRGWGWTSAALLA-----FVL----L.......HP....AVASP............
R9AQ78_WALI9/64-296-------.GAYFAARKNVFNKLFVKKAWGWTSVSILS-----LVL----T.......APNDDRSTSQ.............
C5E2P1_LACTC/32-359-------.....VDKDGWLNTYFVKQGWFWTSLVGWW-----CMI----..........RYGGFGPR.............
T0K1V0_COLGC/87-312-------APSYFARKSNLFNVLFVKRGWFWITAAFFA-----FIF----T.......HP....ATVHS............
G8Y1H9_PICSO/62-313-------VYNYYNDKRNILNQFFVKKGWAWTTVVIVV-----FYI----LILRSKHP..........KVQS.........
C5G9K2_AJEDR/75-292-------PVNYFARKGNIFNVYFVKVGWLWTTLAFIS-----LLL----T.......QP....AFNNRLLS.........
C5MI48_CANTT/55-284-------IYNYYSNKKNIFNKLFVKQGWGWTTLVILI-----FYS----NL....IY..........KTSN.........
N1Q4W5_DOTSN/87-323-------APSYFAKKSNVFNVYFVKIGWIWITAAFLL-----FIL----S.......HS....SLGPILRP.........
S3DE95_GLAL2/81-314-------APSYFAKKSNIFNKLFVKQGWAWITFSYLF-----FLF----T.......HP....SIGPPLSV.........
R9P3R6_PSEHS/103-383-------ALNYWANRKNIVNQIFVKKAWLWTTIAWLL-----QLF----LLRLAPASGSATPTSTVGAAPSRASARVGAR
N1Q6I4_PSEFD/84-317-------APSYFAKKSNVFNVWFVKIGWFWITLAFTL-----LIF----S.......HS....SLGPPLRP.........
K2R4W1_MACPH/94-328-------APSYFAQKKNIFNVYFVKKGWAWTTGALLL-----FVL----T.......HP....SLGPPMRP.........
N1QNJ0_SPHMS/101-335-------APSYFAKKSNVFNVYFVKIGWFWTTLAFFT-----LIF----T.......HS....SHGPPFRL.........
F7WC52_SORMK/81-344-------.PSYFARKDNLFNVLFVKRAWFWITVSFFA-----FVF----T.......HP....SYRST............
M2N8T6_BAUCO/89-327-------APSYFAKKGNFFNVYFVKIGWFWTTLAFVA-----LIL----T.......HP....SLGPPLKP.........
K9G927_PEND2/67-311-------PVNYFARKNNIFNLYFVKIGWLWTTAAFVS-----LLI----F.......QPLYSSSRRESSSQ.........
C4R337_KOMPG/57-293-------VNNYFTDKRNLVNMVFVKNGWGWNLIIFTI-----FCV----AKLR.KGV.......................
A1CR84_ASPCL/74-313-------PVNYFARKDNIFNLYFVKVGWLWTTIAFAS-----LLV----S.......QP....AYTSPST..........
A5E4A1_LODEL/62-350-------VYNYYNDKRNVLNQWFVKRGWGWTTLVVVL-----FYS----LFAVPQILNSTLTTATAARTTTTARRVDENE
U1G5N5_ENDPU/81-322-------TLNYFAGKGNFLNLYFVKIGWFWTTLAFGL-----LQL----TTTNDPKQQPPSSRTGSK.............
E5R3U3_ARTGP/64-297-------PVNYFARKGNVFNVYFVKIGWLWTSLAFLS-----LLL----T.......QD....AFTSKRVS.........
K1WMV9_MARBU/113-341-------APSYFAKKSNIFNVFFVKQGWAWVTVSYLF-----FLF----T.......HP....STGPASL..........
G0VEA6_NAUCC/39-386-------...HWANKDGLINSIFVKKGWFWTTLLTWF-----CIF----..........KYSSTATASSA..........
Q6FR77_CANGA/32-368-------.GPIAVNKDGFVNRILVKRGWFWTTVIGWL-----CIL----..........RYDAK................
E9EF85_METAQ/84-313-------APSYFARKSNIFNVVFVKRGWGWTTFAFYF-----FLL----T.......HP....SGGAGGL..........
R8BRZ8_TOGMI/87-311-------.PSYFARKNNLFNTLFVKRGWAWITVAFAA-----FAL----T.......HP....AL..AA...........
M9LJJ3_PSEA3/95-341-------ALNYWANRKNIVNRIFVKKAWLWTTAAWLA-----QLF----FLRLAAAT..........PRLKKEDA.....
M1VZ69_CLAP2/82-312-------APSYFARKSNIFNVLFVKRGWGWTTFAFYF-----FLL----T.......HP....SGGSGGL..........
V5GE99_BYSSN/78-302-------SVNYFARKNNIFNLYFVKIGWLWTTLAFVA-----LLL----T.......QP....AYTNSR...........
I2FTC6_USTH4/101-374-------ALNYWANRKNIVNQIFVKNAWLWTTLAWAL-----QLF----FLRLAPAS..TTPTSTSARPRTSAAVASQNT
G8JR11_ERECY/38-363-------..FWVANKDGILNVWFVKRGWFWTSVIAWW-----CQI----..........RYGDLSH..............
Q6BUP0_DEBHA/108-353-------VYNYYNNKRNVFNQVFVKRGWGWTTLIIVV-----FYS----FL....MY..........GNSHARI......
Q4WJI3_ASPFU/73-304-------PVNYFARKDNIFNLYFVKVGWIWTTLAFLS-----LLV----S.......QP....AYTAPSA..........
G2R9R1_THITE/97-341-------.PSYFARKDNLLNTLFVKRGWAWITLAFAS-----FVV----T.......HP....AL..AGR..........
I4YGQ8_WALMC/41-264-------.ATYFATKKNIFNKLFVKKAWGWTTASVLA-----LLV----S.......APHDERTTNK.............
G2XPX9_BOTF4/55-288-------APSYFAKKSNVFNQYFVKQGWAWISASYFF-----FLL----T.......HP....STGPPGVF.........
G3AEN0_SPAPN/55-285-------VYNYYTDKRNILNQLFVKNGWAWTTIVIVV-----FYV----SILTQSRPRKS....................
C7Z7P3_NECH7/60-283-------APSYFALKSNIFNVVFVKRGWAWITVAFAL-----FIF----T.......HP....STADA............
E7KCE6_YEASA/33-370-------.LQATLNKDGLVNAMLVKKGWFWTSLVGWW-----CII----..........RYRAVPGATG...........
G3YDY9_ASPNA/76-295-------PVNYFARKDNIFNLYFVKVGWLWTTAALAF-----ILL----S.......QP....AYTLAAS..........
L8FY78_PSED2/112-347-------APSYFAKKSNLVNILFVKRGWFWVTMSFFL-----FLF----T.......NA....AIGARGSD.........
A7TR39_VANPO/62-394-------ASNLNIDRDNFLNVIFVKKGWFWTTIVVWY-----SLF----MTNVNLIN.......................
N1JKB0_BLUG1/90-317-------APSYFAKKDNIFNVFFVKRGWAWVTFSYFL-----FLF----T.......HP....STRSSSSP.........
B6Q6E7_TALMQ/81-304-------PVNYFARKNNIFNLYFVKIGWVWITAAFLA-----LLL----T.......RP....YY..TRVP.........
B8M5R8_TALSN/84-316-------PVNYFARKNNIFNLYFVKIGWVWITFAFLS-----LLL----T.......RP....YY..TKAP.........
C8V5A4_EMENI/56-278-------.INYFARKNNIFNLFFVKLGWIWFTLAFVA-----LLL----T.......YP........PSP..........
G0T001_RHOT2/1044-1290-------..PFFADKRNPINQLFVKRAWAWITALFLA-----FLV----AVFLFPSPLPAQTASSSTRTTSQT.......
Q6CKM7_KLULA/25-334-------....TADKDGILNVYFVKFGWFWTSVISCL-----CVI----..........RYSN.................
Q75EB2_ASHGO/35-359-------PNSWNADKDSTVNIWFIKQGWAWTSAVCWW-----CVV----..........RYKGLGG..............
M7SYX4_EUTLA/110-375-------VPSYFARKDNLLNLLFVKRGWAWITVAFAA-----FVL----S.......HP....AFRSVPVGNS.......
E9CZW5_COCPS/67-291-------PVNYFARKGNIFNVYFVKIGWLWTTVAFLS-----ILS----T.......QP....AFVSRRID.........
F0XPI2_GROCL/81-317-------APSYFARKDNVLNVFFVKRGWFWISLAFAQ-----FVL----R.......HPSFTVSDSE.............
A7UX33_NEUCR/112-389-------.PSYFARKDNLFNVFFVKRAWFWITVSFFG-----FLF----S.......HP....GYNSNNNNNMTGT....
J3NLN2_GAGT3/91-336-------APSYFARKDNLVNVLFVKRGWAWVSAAFAA-----FVL----T.......HPHHTKNTTTGRGGGQ.......
A7EQ03_SCLS1/55-288-------APSYFAKKSNIFNQWFVKKGWAWITASYFF-----FLL----T.......HP....STGPPGVL.........
G9NCA4_HYPVG/72-300-------..GYFARKNNVFNVFFVKRGWGWITFAFVF-----SLL----M.......QP....TGKTPPA..........

PF01569

Q29NI1_DROPS/70-187--------------------------------IVV.....VAV........L....KSFVR..R..RR----P-VA----
A4I568_LEIIN/102-249--------------------------------VCL.....NVV........L....KATVR..S..PR----P-AH----
DOPP1_DICDI/54-178--------------------------------ECT.....NYV........L....KKSIK..E..HR----P-TM----
Q17D95_AEDAE/56-197--------------------------------EYA.....NTL........I....KWILA..E..DR----P-FW----
G6PC3_MOUSE/53-195--------------------------------EWL.....NLV........F....KWFLF..G..DR----P-FW----
A0BM37_PARTE/91-226--------------------------------VAS.....NSL........L....KNFYH..Q..PR----P-FF----
Q23FV4_TETTS/102-237--------------------------------LFQ.....MTF........L....KSLYQ..D..PR----P-YF----
A0EE96_PARTE/81-240--------------------------------AAF.....GNL........I....KMIMT..Q..PR----P-FY----
A8FE89_BACP2/71-198--------------------------------LYL....TEKT........INHELKGLFA..R..ER----P-AF----
A0LYQ4_GRAFK/59-183--------------------------------DQL.....ANL........F....KHGFE..R..PR----P-CR----
Q7MUE1_PORGI/58-185--------------------------------LICDQ.LSSSF........F....KPFFA..R..FR----P-SH----
A0K0K5_ARTS2/118-241--------------------------------VAL.....AQI........I....GRSVG..R..QR----P-PL----
A4XP73_PSEMY/98-234--------------------------------LLLRV.GFAEL.............VKVMG..W..QR----P-SA----
A4X1H8_SALTO/101-242--------------------------------YLI.....VGA........L....KVSTA..R..PA----P-SA----
Q9EWX3_STRCO/115-237--------------------------------NVT.....VGA........A....KYGMG..R..LG----P-HY----
A1BJZ6_CHLPD/56-185--------------------------------GIADY.TASGI........L....KPLFQ..R..IR----P-CF----
A4FQA0_SACEN/76-196--------------------------------YLG.....SEL........L....KTWWQ..Q..ER----P-CR----
B0U8C7_METS4/61-186--------------------------------ILT.....SRL.............TQNLLPMR..LR----P-LH----
A1S1V4_SHEAM/77-196--------------------------------ALL.....INA........L....KQGFD..V..MR----P-AA----
A1W5E3_ACISJ/72-191--------------------------------IAI.....ASI........L....KFWLD..F..PR----P-AA----
A5CF96_ORITB/78-203--------------------------------LLV.....YSK........L....KRLFS..F..TR----P-CC----
B4U5Z7_HYDS0/54-171--------------------------------TIL.....VTA........L....KNIFD..Q..PR----P-AS----
A5DBA1_PICGU/102-232--------------------------------IYI.....SGN........L....KDYMC..L..PR----P-RS----
Q4D544_TRYCC/102-225--------------------------------QYI.....TGT........L....KDAAG..C..PR----P-PC----
SSPA_DICDI/88-218--------------------------------IGG.....GNI........L....KNTFTLPR..PP----P-NI----
Q32GQ5_SHIDS/77-232--------------------------------AILVGQGVKSW........I....KDKVQ..E..PR----P-FV----
Q9CMX4_PASMU/75-237--------------------------------QGI.....KSG........L....KTLFS..E..PR----P-YI----
Q21JU9_SACD2/110-231--------------------------------GIV.....SNV........S....KDYFD..A..LR----P-PA----
C1DG09_AZOVD/106-238--------------------------------AAV.................VEAAQNVFD..R..KR----P-FA----
Q0K1U6_CUPNH/103-229--------------------------------SLV........DA....GLSTYKAKDHYK..R..TR----P-FV----
Q65GX3_BACLD/179-304--------------------------------YSS.....SNP........A....KSYFN..Y..PR----P-FR----
Q2IJN8_ANADE/141-265--------------------------------AAV.....MTV.............KFAVQ..R..PL----P-VT----
Q6FEM9_ACIAD/65-182--------------------------------TGI.....YKF........L....KNKTT..R..PR----P-YQ----
A1K7H5_AZOSB/105-237--------------------------------PGLF..VDVGL.............KDYWG..R..AR----P-AK----
Q3SNT4_NITWN/91-218--------------------------------GIL.....TNL.......TF....KSYWA..R..PR----P-VM----
Q6MBQ7_PARUW/87-223--------------------------------IFV.....HAI........F....KDHWG..R..PR----P-KQ----
A8EX54_ARCB4/94-229--------------------------------PAL.....TVS........I....KGVTN..M..PC----P-NN----
Q87X15_PSESM/102-231--------------------------------TAF.....VTP........V....KVVTS..V..QC----P-WS----
Q03CR8_LACC3/177-306--------------------------------QIV.....NAM.............KTFWG..R..FR----P-YE----
R5ZI70_9ACTN/141-283--------------------------------IIL.....NVI........V....KPLWS..R..PR----M-RV----
A8BDI5_GIAIC/110-282--------------------------------NLT.....TLV........L....KIALN..R..PR----P-RQ----
A8BQZ4_GIAIC/121-285--------------------------------QTV.....VIA........L....KVLLR..R..PR----P-RN----
Q6MTZ1_MYCMS/144-270--------------------------------LIV.....INI........L....KLTFN..R..PR----P-TN----
R5TP42_9FIRM/95-216--------------------------------LLI.....STV........F....PNGLT.....LR----P-VV----
A3LWS4_PICST/248-396--------------------------------NILVV.LTHFVIPTAPPLFI....KLYGEHKV....----P-SF----
Q127S7_POLSJ/95-224--------------------------------MCL.....AGL.............AIFYFWPTAAPQ----P-NI----
A4CJ32_ROBBH/299-448--------------------------------GFI................SCWDEKYRSN..L..IR----P-ET----
Q2HER5_CHAGB/260-418--------------------------------GIA.................SWDAKYTYL..G..WR----P-VT----
A8L0R7_FRASN/276-428--------------------------------ATT................ACFNEKAAWT..S..WR----P-VT----
Q4YWD7_PLABA/107-241--------------------------------YSI.....................RSIFIYVTTIPC----P-VP----
Q6NJR5_CORDI/194-319--------------------------------VALTW.APVVV........M....KVVFQ..R..PR----P-DH----
A1SKJ7_NOCSJ/98-218--------------------------------GGC.....YGI........A....TALIS..R..DR----P-PV----
Q82Z33_ENTFA/85-204--------------------------------GFL.....GSV........F....KHVVG..R..AR----P-NL----
A2DYB5_TRIVA/98-241--------------------------------GFT.....VSI........F....KNYVG..R..TR----P-DL----
A2EZZ9_TRIVA/91-236--------------------------------GDI.....CHV........L....KTYVG..R..AR----P-DY----
A4H9E7_LEIBR/233-378--------------------------------VMI.....VDA........L....KVYAG..R..LR----P-DF----
Q6BYN9_DEBHA/112-272--------------------------------LMI.....TCI........L....KNICG..L..PR----P-DL----
A7EIU4_SCLS1/134-294--------------------------------AVF.....QVF........L....KWLIG..G..LR----P-HF----
A7TF94_VANPO/122-266--------------------------------GVI.....TNS........L....KLFIG..N..LR----P-DF----
Q2TYI3_ASPOR/35-224--------------------------------FFV.....VLG........L....KDIVG..K..PR----P-DF----
A2EQG2_TRIVA/90-230--------------------------------MLV.....CAA........I....GKIVG..R..PR----P-DT----
PLPR5_MOUSE/122-275--------------------------------DIFVN.AGQVV........TGNLAPHFLA..L..CK----P-NY----
Q9VNU2_DROME/65-225--------------------------------YLT.....TEL........A....KHAVG..R..LR----P-HF----
A8WXP5_CAEBR/128-286--------------------------------TFA.....MEF........L....KCYVG..R..LR----P-HF----
A6X217_OCHA4/121-242--------------------------------SIP.....TEI........G....KLAIG..R..AR----P-FL----
Q5NGF4_FRATT/116-236--------------------------------GIL.....GQI........L....KMIIG..R..AR----P-KF----
Q5ZX13_LEGPH/91-208--------------------------------NLL.....TFV........L....KISFS..R..AR----P-DL----
Q6MH55_BDEBA/105-226--------------------------------GVI.....THI........I....KFTVG..R..QR----P-HK----
B4S7E2_PROA2/140-261--------------------------------LLI.....TGV........M....KAVAG..R..SR----P-YT----
Q7NZZ5_CHRVO/815-932--------------------------------VAG.....SEM........L....KFTSN..R..AR----P-GD----
Q0SBZ7_RHOJR/226-347--------------------------------ALA.....STV........T....KSVVG..R..AR----P-PI----
Q89JR9_BRADU/79-199--------------------------------SLL.....PHG........L....KLLFD..Q..TR----P-DR----
B7VND8_VIBTL/235-351--------------------------------TLL.....TLI........A....HQGFG..F..PR----P-HA----
Q5E4L0_VIBF1/241-366--------------------------------IVL.....TGL........A....KQGLG..L..PR----P-FV----
Q9RVR6_DEIRA/14-135--------------------------------YLV.....NSA........L....KYGLN..L..PR----P-FT----

PF14378

Q5K8D7_CRYNJ/128-311--------------------------------HIP-----ATI--------A----FMAYSYRY--FK----P-YI----
B0UG28_METS4/124-315--------------------------------GPQ-----IAL--------V----VIVLAA.T--RR----M-GR----
A1SJR6_NOCSJ/50-230--------------------------------HWP-----VIV--------L----TMAWLV.W--HH----R-PA----
C5APU7_METEA/131-322--------------------------------GPQ-----VGL--------V----VIALSA.V--SR----V-SR----
E4NIW3_KITSK/45-228--------------------------------YYL-----VVL--------G----VLVWLF.V--RD----G-AA----
Q989C0_RHILO/119-308--------------------------------TYQ-----LPV--------V----VLWHAV.T--NQ----R-LR----
G8WRV6_STREN/158-347--------------------------------HYV-----ITP--------A----VLVWLW.R--RH----S-GS----
C7QD07_CATAD/71-251--------------------------------HFT-----CMI--------I----FLIWLF.I--RH----R-EH----
Q1D5Z1_MYXXD/96-274--------------------------------HFI-----WAL--------V----MGLVLYRR--PG----G-AE----
Q2G5H1_NOVAD/115-305--------------------------------AIQ-----TIV--------I----PVVMAV.T--LP----P-KR----
U4LB32_PYROM/137-324--------------------------------HIP-----GTI--------L----FLAWLYYY--AP----R-RL----
Q1IHV8_KORVE/153-330--------------------------------LVP-----PAL--------V----YAAL...L--ND----E-RR----
F2R3P1_STRVP/39-228--------------------------------HYL-----VTP--------A----ILVWLF.R--RR----P-AH----
A9HHP2_GLUDA/131-314--------------------------------IFQ-----IIG--------S----LLVLAL.A--RK----R-GR----
Q13PQ7_BURXL/110-293--------------------------------ACQ-----LFV--------V----PVILAI.T--RN----T-RD----
R6XNQ9_9FIRM/3-178--------------------------------FII-----LSL--------L----FLLF...T--KT----R-KA----
Q63V72_BURPS/125-308--------------------------------QWQ-----LIG--------I----PVWLGL.T--RR----D-DD----
Q01VD1_SOLUE/159-330--------------------------------GFW-----FCV--------M----YAAHS..R--VH----G-QF----
D1CA82_SPHTD/53-235--------------------------------HMA-----GLV--------L----FGIWLF.W--RH----T-ER----
K0K1I4_SACES/40-223--------------------------------SIL-----AVP--------A----VLIWLY.I--AR----R-AR----
D1C524_SPHTD/53-234--------------------------------HLP-----ATL--------L----FGLGVL.C--LR----P-HR----
W5TLL4_9NOCA/53-242--------------------------------HYV-----VTP--------A----ILIWVW.W--SH----R-EH----
D3HTE9_LEGLN/101-283--------------------------------TYQ-----MSI--------L----PLFVIF.T--CH----F-HL----
Q2JBQ4_FRASC/47-236--------------------------------HFV-----VTP--------A----LLVWMH.R--RH----P-PR----
W0BEC4_9GAMM/94-276--------------------------------DYQ-----LNF--------I----PILVIA.A--KR----F-QL----
Q220L9_RHOFT/109-292--------------------------------LIQ-----LAF--------V----ILFLGF.S--AR----P-AQ----
G2P916_STRVO/51-241--------------------------------HYV-----LTP--------T----ILMWMWKR--RK----A-SD----
Q87M50_VIBPA/146-355--------------------------------FFF-----MWM--------T----LFFFVLYK--KA----R-ML----
B1LSY3_METRJ/129-320--------------------------------GPQ-----VGL--------V----VIALSA.T--RR----L-GR----
A2BL06_HYPBU/51-224--------------------------------HPV-----YFF--------A----FAVLLA.F--RE----P-KL----
L0PFU2_PNEJ8/5-201--------------------------------HFG-----APF--------V----TSIIVYLF--SP----P-GT----
C9Z2S2_STRSW/63-253--------------------------------HYL-----VTP--------A----ILVWLF.R--SR----A-VR----
B9L518_THERP/33-215--------------------------------HLW-----TVL--------L----FGTWAF.F--RV----P-DR----
E3JAH2_FRASU/94-282--------------------------------HYI-----LTP--------V----VLAWMY.R--RN----P-AH----
F8AWV4_FRADG/47-236--------------------------------HFI-----VTP--------A----VLVWLY.R--KR----A-RS----
R7Y200_9ACTN/124-318--------------------------------LPL-----VPL--------A----LAAWLVWS--RN----I-TF----
A0LS47_ACIC1/69-252--------------------------------YVL-----VTF--------G----VLLWVW.R--RR----P-DV----
E2Q4K3_STRC2/45-234--------------------------------HYA-----VTP--------V----VLIWLF.R--SH----A-VR----
F8J559_HYPSM/123-309--------------------------------EWQ-----PII--------L----VLTLAW..--AD----P-ER----
L0ET54_LIBCB/102-293--------------------------------AFQ-----LLI--------W----PIILIF.L--KI----P-ER----
Q89QL0_BRADU/109-300--------------------------------AVQ-----TTA--------V----VLVLAA.A--GH----A-LR----
B1VW42_STRGG/49-238--------------------------------HYL-----VTP--------A----VLIWMF.R--RR----S-AA----
C5AQ48_METEA/107-294--------------------------------FLQ-----LGL--------T----PVLLAA.L--GE----V-RR----
H0PVV4_9RHOO/74-256--------------------------------IVQ-----ILV--------S----IILFAH.A--ER----T-SR----
E3EJC2_PAEPS/1-162--------------------------------LFG-----VAL--------L----MYWFTFKM--PH----R-MM----
G0HGL8_CORVD/79-265--------------------------------HFI-----VTP--------G----TLVWLY.V--KH----H-RH----
A1SDU3_NOCSJ/130-324--------------------------------LPL-----VPL--------A----VTAWLVWS--RN----L-SY----
C7QBQ6_CATAD/84-272--------------------------------HFI-----VPI--------A----VLVWVY.F--KF----P-DR----
A1SHK3_NOCSJ/128-322--------------------------------TYL-----VPL--------S----VVGTLALL--PR----V-RE----
E3J0M0_FRASU/110-299--------------------------------HFI-----VTP--------T----VILWMH.R--RH----G-AS----
C8XDB0_NAKMY/22-205--------------------------------YYL-----PLI--------G----VLLWVL.F--AR----A-DV----
G7XGU5_ASPKW/117-299--------------------------------HIV-----LGV--------I----FIVYCYTC--IQ----R-DK----
N0BE90_9RHIZ/119-305--------------------------------IWQ-----PAL--------L----LLALTF..--AD----P-ER----
B1LVV6_METRJ/99-290--------------------------------ILQ-----TML--------A----VILLGF.S--GR----L-RA----
Q5ZV46_LEGPH/101-283--------------------------------PYQ-----MSI--------L----PLYVIV.S--GR----F-YI----

PF14360

SLS2_TRYB2/201-275--------------------------------LMY---------------------------------------------
B8C480_THAPS/431-503--------------------------------LMF---------------------------------------------
IPCS3_ARATH/172-244--------------------------------LIF---------------------------------------------
SAMD8_HUMAN/292-365--------------------------------YMF---------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------LIV---------------------------------------------
A9RPY7_PHYPA/269-340--------------------------------LMF---------------------------------------------
SLS_LEIMA/211-286--------------------------------LMF---------------------------------------------
A5K283_PLAVS/202-273--------------------------------LII---------------------------------------------
Q4YWD8_PLABA/201-272--------------------------------LIV---------------------------------------------
B3L7G0_PLAKH/276-347--------------------------------LII---------------------------------------------
Q28DN3_XENTR/220-293--------------------------------FLY---------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------VLF---------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------LLF---------------------------------------------
IPCS_ORYSJ/172-244--------------------------------LIF---------------------------------------------
A9SUW6_PHYPA/174-246--------------------------------LIF---------------------------------------------
SMSR1_CAEEL/321-394--------------------------------YMF---------------------------------------------
Q17C33_AEDAE/230-303--------------------------------YIY---------------------------------------------
SMS2_CAEEL/201-274--------------------------------LMF---------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------YIY---------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------LVF---------------------------------------------
B3SD02_TRIAD/279-352--------------------------------YLF---------------------------------------------
A2DN61_TRIVA/170-240--------------------------------MIY---------------------------------------------
C5KN45_PERM5/142-213--------------------------------LIY---------------------------------------------
C5L5L1_PERM5/146-217--------------------------------LIF---------------------------------------------
SMSR2_CAEEL/246-319--------------------------------LIV---------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------LIL---------------------------------------------
C6KT87_PLAF7/201-272--------------------------------LIV---------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------LMF---------------------------------------------
B7FUU7_PHATC/326-397--------------------------------LII---------------------------------------------
SLS11_TRYCC/193-267--------------------------------LMF---------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------YMF---------------------------------------------
C5KL60_PERM5/83-154--------------------------------VFY---------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------YVF---------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------YVF---------------------------------------------
B9HC73_POPTR/172-244--------------------------------LIF---------------------------------------------
C6KT86_PLAF7/265-336--------------------------------LVI---------------------------------------------
C4LV27_ENTHI/184-261--------------------------------LLF---------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------MIF---------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------YIY---------------------------------------------
C5LU78_PERM5/899-971--------------------------------LVF---------------------------------------------
C5KY50_PERM5/57-128--------------------------------VFY---------------------------------------------
D0NII4_PHYIT/164-244--------------------------------HIF---------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------MII---------------------------------------------
A0JMN0_DANRE/269-342--------------------------------YLY---------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------YLF---------------------------------------------
A0A0H5S654_BRUMA/218-291--------------------------------YIY---------------------------------------------
F8W5G6_DANRE/232-307--------------------------------FLY---------------------------------------------
F6UTK5_XENTR/280-353--------------------------------YLY---------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------FLY---------------------------------------------
J9FFV7_WUCBA/189-261--------------------------------LLF---------------------------------------------
Q4U956_THEAN/200-270--------------------------------LIV---------------------------------------------

PF02681

F2NNY3_MARHT/5-141--------------------------------NVI-----AQS--------L----KLVIY..YLING....R-WE....
K9T6M6_9CYAN/8-143--------------------------------CFI-----AQG--------L----KFFIE..LIRNG....K-VN....
D4ZTL8_ARTPN/8-143--------------------------------CLF-----AQA--------S----KLAIE..LIQHG....K-IN....
K9WGM7_9CYAN/8-143--------------------------------CLV-----AQL--------C----KLLVE..LTKNR....K-LN....
B7GI74_ANOFW/24-164--------------------------------IAL-----AQF--------L----KIPLT..KRKTK....K-WD....
B1WS33_CYAA5/8-143--------------------------------CFS-----AQG--------L----KLIIE..LIRHR....K-IN....
R5AEV3_9CLOT/9-146--------------------------------WAA-----AQL--------I----KTIIY..LILYH....E-WR....
Q31Q62_SYNE7/9-145--------------------------------CGL-----AQF--------S----KLIVE..GVRDR....R-LN....
R5XG63_9CLOT/5-137--------------------------------CFL-----AQF--------L----KIFTG....KEK....K-FD....
D4JCM8_9FIRM/8-144--------------------------------NVV-----AQV--------G----KTIVY..YFKSG....K-WD....
W0E929_9FIRM/8-143--------------------------------WLV-----AQV--------I----KVLIN..FKIHH....T-FD....
D3FYY4_BACPE/4-149--------------------------------IFF-----AQF--------I----KIPLA..FLPTR....K-LD....
F0RVM2_SPHGB/6-143--------------------------------FFL-----AQL--------L----KPFVN..ALFER....R-FD....
H6NB79_9BACL/2-142--------------------------------IGA-----AQA--------L----KVPMK..LRQTG....R-IE....
Q7V6P1_PROMM/15-147--------------------------------CGL-----AQL--------S----KLIVE..LIFYR....R-WR....
Q18B69_PEPD6/8-140--------------------------------CFL-----AQF--------I----KIFTG....KEK....R-IE....
G0GF41_SPITZ/9-149--------------------------------WFC-----AQV--------I----KLLVE...ALKR....R-RRFASP
Q65FE5_BACLD/4-149--------------------------------IFF-----AQF--------I----KVPIY..FVVSK....K-WD....
U5LF62_9BACI/2-142--------------------------------III-----AQG--------M----KIPLH..FLKKR....E-WK....
R7L0C2_9FIRM/5-149--------------------------------WCI-----AQL--------L----KTIIN..LIKYK....K-FS....
Q5WDV5_BACSK/4-146--------------------------------III-----AQA--------I----KIPLA..FFATK....K-LD....
D6GSF2_FILAD/8-144--------------------------------WFV-----AQT--------L----KVIFT..IIIDR....R-FD....
E6U5K5_ETHHY/8-143--------------------------------WIF-----AQI--------I----KTVIT..LIITK....R-FD....
Q5SJ95_THET8/4-140--------------------------------NLT-----AQT--------L----KLLLY..YFLEG....R-FQ....
R5GK39_9FIRM/5-157--------------------------------FVS-----AQI--------I----KTALY..AIKQK....T-FN....
Q9RSQ8_DEIRA/8-143--------------------------------SLG-----AQV--------L----KVLLI..LLLER....R-WH....
P73185_SYNY3/8-143--------------------------------CFL-----AQG--------I----KAIVE..IFRNG....K-IN....
D1AKQ0_SEBTE/7-143--------------------------------CFA-----AQF--------Y----KVFSP..LFKGR....G-AS....
E0RXA3_BUTPB/8-144--------------------------------WLS-----AQI--------L----KTIIY..VLVNK....E-FN....
F5YE41_TREAZ/16-155--------------------------------WVM-----AQI--------V----KALVV...LLGS....R-KKSPRE
V5WEJ9_9SPIO/6-144--------------------------------WFA-----AQF--------I----KTILN..AIYKR....R-LHNAAD
U5LHE7_9BACI/5-149--------------------------------IFF-----AQF--------V----KVPIQ..YIATR....R-LD....
K9XWG4_STAC7/8-143--------------------------------CFT-----AQG--------F----KLIIE..LIRNR....K-VN....
E6U2C7_BACCJ/4-149--------------------------------IGF-----AQF--------I----KVPLQ..YLATK....R-FD....
R7M7X6_9CLOT/12-143--------------------------------WFG-----IQL--------F----KFIYD..LIKTK....K-FN....
K9V3M2_9CYAN/8-143--------------------------------CLL-----AQA--------I----KLVVE..LVKNR....K-LN....
B9IAH9_POPTR/38-171--------------------------------CAL-----AQF--------L----KLFTT..WYKEK....R-WD....
M0RZC5_MUSAM/20-155--------------------------------FAV-----AQF--------L----KLFTT..WYKEK....R-WD....
R5ZD30_9FIRM/8-146--------------------------------NII-----AQI--------A----KTIVY..FYKSG....E-WD....
R6Q3Q8_9FIRM/8-138--------------------------------WAL-----AQG--------F----KTIRP..IVTER....K-FD....
F4GLJ1_SPHCD/5-141--------------------------------LFT-----AQM--------L----KPIIV..AILER....R-FE....
C0ZKP9_BREBN/5-150--------------------------------IGI-----AQF--------I----KIPLH..FFATK....T-WQ....
D8TLE7_VOLCA/33-168--------------------------------FFI-----AQL--------S----KVFTH..YYREQ....V-WD....
D4JU78_9FIRM/7-157--------------------------------WGT-----AQI--------L----KTLIH..FIKTK....N-FK....
K9YEC7_HALP7/8-143--------------------------------CLV-----AQG--------L----KLVIE..FLREG....K-FD....
K3XML5_SETIT/24-159--------------------------------FAI-----AQS--------I----KFFVT..WYKEN....R-WD....
K9RII7_9CYAN/8-143--------------------------------CLT-----AQA--------L----KLLIE..FIKNR....K-VS....
K4LIZ6_THEPS/40-169--------------------------------VFC-----TQG--------M----KPFTY...........R-SD..GG
E6TWS5_BACCJ/5-142--------------------------------IGL-----AQF--------L----KIPIK..QLKTK....K-WN....
R6V5P2_9CLOT/18-171--------------------------------WVT-----SQA--------F----KTLLK..IAITKNKNPR-NI....
Q73MW8_TREDE/10-150--------------------------------WMM-----SQI--------I----KTIFA...LFNA....S-IKTPID
Q8Y4P9_LISMO/4-149--------------------------------IVF-----AQV--------V----KVPIH..ILVYR....K-FN....
M0SK26_MUSAM/139-272--------------------------------WSL-----AQT--------I----KMFLN..FFVER....R-WD....
I0GIV6_CALEA/8-146--------------------------------NFV-----AQA--------L----KVLFT..FLVEK....K-WD....
A9TH33_PHYPA/30-165--------------------------------FFV-----AQS--------L----KVLTT..WYKEN....R-WD....
G4KW10_OSCVS/4-137--------------------------------WII-----AQI--------L----KVIIY..ALMNQ....K-LD....
R5CL70_9FIRM/8-147--------------------------------WLV-----AQL--------S----KTILY..MIINH....K-FC....
I0I5M8_CALAS/5-139--------------------------------ALI-----VQF--------Y----KVVAY..WVQTG....R-FD....
D7CKU8_SYNLT/12-144--------------------------------CGV-----TQL--------I----KGVYM..YLKER....C-WR....
R7IRJ9_9CLOT/8-142--------------------------------WFC-----IQT--------F----KVIYE..LIKTK....K-FN....
B8HXR8_CYAP4/8-143--------------------------------SLI-----AQI--------L----KLVIE..YIKNR....K-LN....
B0C3J0_ACAM1/8-143--------------------------------SLI-----AQG--------L----KIIID..LIQNG....K-IN....
I4DAH9_DESAJ/3-144--------------------------------AIF-----AQI--------I----KVPIN..YWRNR....I-WD....
Q46K07_PROMT/15-148--------------------------------CGL-----AQF--------S----KLLFE..LIFKQ....R-WR....
R7A3G1_9CLOT/8-142--------------------------------WFC-----IQT--------F----KVIYD..LVTTK....K-FN....
Q24V03_DESHY/8-143--------------------------------WFI-----AQT--------L----KLIIN..FSIHR....T-FD....
K9VPU0_9CYAN/9-144--------------------------------CLA-----AQI--------M----KLPIE..LVKNR....K-FN....
D1BMJ6_VEIPT/9-146--------------------------------WFT-----AQA--------I----KFVWQ..LLRHG....K-FR....
Q10X44_TRIEI/8-143--------------------------------CLM-----AQF--------L----KIVVE..LVQHR....Q-IN....
A4RZ57_OSTLU/3-142--------------------------------VVA-----AQA--------L----KPLTA..RVAGG....A-WR....
D8QR56_SELML/24-159--------------------------------FVA-----AQS--------L----KIVTT..WYKEK....R-WD....
K4AZY7_SOLLC/140-274--------------------------------WFM-----AQS--------M----KVFLN..FCVER....K-WD....
Q8ENX8_OCEIH/4-149--------------------------------IVF-----AQV--------I----KIPIK..LIFTK....E-FQ....
K7V114_MAIZE/48-182--------------------------------FAF-----ANF--------V----NLVSI..WLKEK....R-WD....
D4IXN8_BUTFI/8-143--------------------------------WIV-----AQL--------I----KMLVD...VCKY....G-FN....
Q01ES7_OSTTA/128-261--------------------------------WLV-----AQV--------A----KIFTA..YYREG....R-WD....
E3HA83_ILYPC/7-143--------------------------------WFI-----AQF--------Y----KVISA..IIFDK....T-LD....
V5RVF1_9BACT/5-132--------------------------------WLV-----AQG--------L----KYVFD..AIRSR....T-WS....
A6TR41_ALKMQ/8-144--------------------------------WFI-----AQT--------I----KVIHT..FIVDK....R-FN....
I1KRZ5_SOYBN/9-144--------------------------------FAL-----AQS--------I----KFFTT..WFKDR....R-WD....
R5KDM7_9CLOT/8-150--------------------------------WLT-----AQI--------L----KVIIH..LCMTK....K-WN....
R7I9S8_9FIRM/10-145--------------------------------WFV-----AQA--------L----KIPTY..YLVEK....K-WD....
R6BY11_9CLOT/8-144--------------------------------WLI-----AQI--------L----KTLIH..LFFTK....K-FV....
R5ITD2_9FIRM/8-144--------------------------------WGA-----AQV--------L----KTIIY..ALMHH....T-LD....
K9RQD3_SYNP3/8-143--------------------------------SAI-----AQI--------L----KLLID..VIRHQ....K-LN....
K9SVF9_9SYNE/8-143--------------------------------SFG-----AQC--------L----KLLLL..YIQSG....Q-IK....
Q7VBG6_PROMA/16-148--------------------------------CGL-----AQF--------S----KLFVE..LIFYQ....K-WR....
O83188_TREPA/14-153--------------------------------WLA-----SQV--------I----KVAIA...CRRS....A-IRSVHG
G8QY16_SPHPG/6-143--------------------------------VII-----AQA--------S----KPFIN..AIVDH....R-FD....
D3EMZ3_ATETH/8-144--------------------------------CFS-----AQS--------L----KFLIE..LIHHR....K-MN....
R5TH29_9CLOT/11-163--------------------------------WIF-----SQT--------F----KTLLN..FCTTR....R-FK....
A9TSJ4_PHYPA/1-141--------------------------------STL-----GQL--------A----KPFAA..ALAGK....G-FN....
R5YWD2_9CLOT/9-140--------------------------------WIA-----IQS--------F----KVMYD..LAVTK....K-FN....
M0SG02_MUSAM/22-157--------------------------------FAI-----AQS--------I----KVFTT..WYKER....R-WD....
F5YMS6_TREPZ/16-155--------------------------------WFL-----AQM--------V----KAVVL...LLKT....K-KRNGRE
R7J8Q8_9FUSO/12-143--------------------------------AFS-----AQV--------I----KFFIF..TIKTR....K-IN....
R7R6N9_9FIRM/8-144--------------------------------WLV-----AQL--------L----KTGIH..MYFNK....S-FV....
C7NE60_LEPBD/7-143--------------------------------CFS-----AQF--------Y----KVFFP..VFKGQ....K-PQ....
R5IDQ6_9CLOT/2-138--------------------------------WTV-----AQV--------L----KTLID..FALNK....S-FN....
D9R8M4_CLOSW/8-144--------------------------------WLV-----AQV--------L----KTIID..LALNK....N-FN....
D7BAF5_MEISD/5-141--------------------------------SFI-----AQV--------L----KLLIY..YAVER....E-WQ....
F8F1T7_TRECH/16-155--------------------------------LIF-----AQL--------L----KAIIV...LLKN....T-KKSAKE
Q93ZZ7_ARATH/51-205--------------------------------AVI-----GQL--------S----KPFTS.VVLYGK....N-LD....
D8U4F3_VOLCA/38-173--------------------------------WFT-----AQF--------L----KIFTK..RFKKG....I-WD....
J7IS94_DESMD/8-142--------------------------------WFS-----AQF--------L----KVIVN..LIVIR....K-LN....
A4XKK1_CALS8/9-143--------------------------------WFV-----AQC--------L----KIIIT..FFMTH....Q-ID....
F9VBI0_LACGL/8-142--------------------------------WFA-----AQI--------I----KIIVD..IFRYR....R-LD....
K9W0K1_9CYAN/16-151--------------------------------CLI-----AQL--------L----KLLFE..LVIHR....K-VN....
A9NHX4_ACHLI/6-144--------------------------------MLI-----AQV--------S----KFFID..GLINR....K-LN....
D1AXZ8_STRM9/7-141--------------------------------AFT-----AQI--------Y----KCFSP..VIFKR....K-ID....
K9UG93_9CYAN/16-151--------------------------------CLI-----AQV--------L----KLIID..TIQNG....K-FS....
F4LN44_TREBD/13-152--------------------------------WFS-----AQF--------I----KTVIK...LFTG....K-ISSLRE
R6NRL3_9CLOT/2-140--------------------------------WFI-----AQV--------L----KVIIN..YVKYLVGKRK-GINRSK
K0IWZ6_AMPXN/4-149--------------------------------ILF-----AQG--------I----KVPIH..YIATK....E-FK....
W8TJV6_EUBAC/8-150--------------------------------WFV-----AQV--------I----KVLLT..LLLEN....K-LD....
R5BKA4_9FIRM/8-146--------------------------------WFS-----AQA--------L----KFVIV..LLQYR....R-FQ....
A8MFI8_ALKOO/8-144--------------------------------WFI-----AQV--------I----KVVNT..FIAEG....R-ID....
H9UHZ5_SPIAZ/13-152--------------------------------WLT-----AQV--------I----KAFID...VLRR....R-TDTTRD
B8CY18_HALOH/3-134--------------------------------LFI-----AQV--------L----KIFTT......L....P-PD....
B2A528_NATTJ/7-141--------------------------------WFV-----AQL--------I----KFTIY..LIKHR....S-LD....
R6ME09_9FIRM/8-142--------------------------------WFA-----AQV--------L----KMIL...VWDKK....K-FD....
F2NS18_TRES6/11-151--------------------------------WLS-----AQL--------V----KTLIK...LFSG....K-VHSLKE
R5PNP2_9CLOT/8-138--------------------------------WFC-----VQT--------F----KVLWE..LATTK....K-FN....
Q1J0I2_DEIGD/9-145--------------------------------SIS-----AQL--------L----KVLLI..LLIEG....R-WR....
D6DFV4_CLOSC/8-144--------------------------------WIV-----AQV--------L----KTIID..IALNR....S-FN....
I4D8V5_DESAJ/8-142--------------------------------WLA-----AQL--------L----KVVIS..LIAAG....K-LD....
R7A673_9FIRM/8-144--------------------------------WMV-----AQV--------L----KTIIH..MILTK....Q-FV....
R7FJ12_9CLOT/8-142--------------------------------WFF-----IQL--------Y----KVLYD..LITTK....K-FN....
O51097_BORBU/6-146--------------------------------GIS-----AQV--------I----KYGIQ..TVKTR....K-LKLTPV
K8GFC4_9CYAN/8-143--------------------------------CLI-----AQL--------L----KVFVE..LAKNG....K-VN....
R6QDM5_9CLOT/9-141--------------------------------AII-----AQV--------I----KFVYF..YIAHK....K-IN....
M4CGY8_BRARP/134-268--------------------------------WFF-----AQT--------S----KMVIN..FFIER....K-WD....
K9Q226_9CYAN/8-142--------------------------------CIS-----AQM--------L----KIPID..LIRYK....K-AD....
R6N1H2_9CLOT/6-146--------------------------------WFI-----AQL--------I----KFIIE..VSTHR....R-IN....
D3FSU1_BACPE/2-142--------------------------------IGL-----AQS--------L----KVPIK..KMQTD....Q-WE....
B9DG97_ARATH/20-155--------------------------------FTI-----AQF--------I----KLFTS..WYRER....R-WD....
Q9CGU3_LACLA/8-142--------------------------------WAL-----AQL--------I----KIIIE..LIRTH....R-IN....
F2I5F0_AERUA/1-152--------------------------------IIF-----TQI--------I----KYPIAYLFMGKK....E-TK....
R7N6H8_9FIRM/8-144--------------------------------WFV-----AQV--------L----KTIIH..IIVNK....Q-FV....
C1FDH6_MICCC/170-303--------------------------------WLT-----AQT--------M----KYFTA..FYREG....K-WD....
R6SUP5_9CLOT/9-142--------------------------------WLL-----AQL--------L----KVVTG..AFKVQ....K-FT....
Q7U880_SYNPX/15-147--------------------------------CGT-----AQL--------S----KLVIE..LVVHR....R-WR....
A5GM29_SYNPW/13-145--------------------------------CGI-----AQL--------S----KLFIE..LVTQR....R-WR....
Q2JKH6_SYNJB/6-142--------------------------------SVL-----AQA--------I----KLILS..YVRSG....K-VN....
F2JMF4_CELLD/8-142--------------------------------WFI-----AQL--------F----KVIIT..LLQEH....R-LD....
E6SHJ0_THEM7/12-146--------------------------------AGL-----GQA--------T----KAVLA..AV.TG....K-DD....
K9S6R1_9CYAN/8-143--------------------------------CLI-----AQV--------L----KVIVE..FARHG....K-VN....
E3PRG0_CLOSD/8-144--------------------------------WFI-----AQL--------I----KVVLT..YFFEN....R-FD....
R5N6N4_9CLOT/8-137--------------------------------WFG-----IQL--------F----KVLYK..RVHEG....V-WD....
B1YKA4_EXIS2/4-132--------------------------------WFI-----AQA--------A----KLVTG..LIKTK....K-FD....
R5GZB8_9FIRM/8-144--------------------------------WFA-----AQV--------I----KTVIY..TCITK....S-FD....
D5WTV2_KYRT2/8-146--------------------------------MLV-----AQG--------I----KIPFQ..RWREK....A-WN....
R6PRB8_9FIRM/8-139--------------------------------WAV-----AQL--------I----KIIID..VYTTK....K-ID....
E6UEQ9_RUMA7/8-144--------------------------------WAE-----AQV--------L----KTMIH..AIVNK....K-FD....
C1N1Q0_MICPC/8-144--------------------------------VFV-----AQF--------L----KPFAE..WARTR....R-AR....
L0A6P8_DEIPD/5-141--------------------------------STG-----AQV--------I----KVLLI..LLFER....R-WR....
M1E7F3_9FIRM/5-139--------------------------------SII-----AQI--------L----KMFYY..WRKNH....K-IN....
R6USA8_9FIRM/5-142--------------------------------NVI-----AQV--------L----KPIVL..YFRTK....E-LD....
A9SA98_PHYPA/3-154--------------------------------STL-----AQL--------V----KPFAA..GLIGK....G-FN....
E3DMH7_HALPG/3-133--------------------------------LFT-----AQF--------L----KIFFI......R....P-MN....
E4U9L1_OCEP5/5-141--------------------------------NLV-----AQG--------L----KLVIH..YLFER....R-WS....
E8N0A2_ANATU/6-140--------------------------------WGL-----AQF--------L----KPFLE..YLETR....R-WV....
K9SNJ2_9CYAN/8-142--------------------------------SFL-----AQF--------L----KLIIV..FIRVR....K-IE....
F0T097_SYNGF/8-149--------------------------------WFI-----AQL--------A----KVMMN..FLIER....K-ID....
A8FH06_BACP2/4-149--------------------------------IFF-----AQF--------V----KVPIQ..FIISR....R-LD....
A9SE32_PHYPA/36-170--------------------------------WAI-----AQV--------L----KVFTK..YFVER....R-WD....
I0JQ19_HALH3/6-151--------------------------------IFF-----AQI--------V----KIPIQ..FIASR....N-FN....
R5SAC8_9GAMM/12-144--------------------------------IVL-----AQI--------V----KCFLH..LIVKR....N-LD....
M4FCC5_BRARP/76-227--------------------------------GAI-----GQL--------L----KPFTS.VVFYKK....K-LD....
G8LW53_CLOCD/8-141--------------------------------WFL-----AQL--------L----KVINV..LVSSK....K-ID....
C8WVG2_ALIAD/12-152--------------------------------IVV-----TQI--------L----KVPIH..FVTTR....A-WD....
R5ADD7_9CLOT/7-149--------------------------------WLC-----AQL--------I----KTVID..AIKHR....S-FN....
D4K6A9_9FIRM/9-148--------------------------------WFI-----AQV--------L----KTIIN..FILLG....K-FQ....
K3YAI4_SETIT/11-145--------------------------------FAI-----AQS--------S----KVFTT..WYKDN....R-WD....
R7F8Q2_9CLOT/8-142--------------------------------WFG-----IQL--------F----KVIWD..LVTTK....K-FN....
A3DDN6_CLOTH/8-143--------------------------------WFV-----AQF--------L----KVVNV..IVVER....K-LD....
K9Z2J9_CYAAP/8-142--------------------------------CFL-----AQI--------I----KVSVD..TIANQ....K-FS....
K9P352_CYAGP/15-157--------------------------------CGV-----AQL--------S----KLLIE..LVVHR....R-WR....
K9XC51_9CHRO/8-143--------------------------------CLI-----AQA--------S----KLVVE..LIKNR....K-LD....
R6Y7H0_9FIRM/7-149--------------------------------WLV-----AQL--------I----KTALD..AVKHR....S-FN....
E1RAI3_SPISS/5-141--------------------------------TMT-----AQA--------L----KVLIE..LLIEK....K-LD....
X2GPK1_9BACI/6-151--------------------------------VLF-----AQF--------V----KIPIH..FLMTK....Q-LK....
R5R4Q1_9FIRM/8-145--------------------------------WLC-----AQI--------L----KTITH..LIINK....K-FV....
Q7V118_PROMP/8-139--------------------------------CLI-----AQF--------L----KIIFN..FFATG....K-VR....
B8E2Q0_DICTD/12-146--------------------------------AMI-----TQG--------I----KGLIR..SIQER....K-FL....
K4KZ53_9FIRM/8-148--------------------------------WIL-----AQF--------L----KILIN..FVIEK....E-WD....
R6EV23_9FIRM/8-145--------------------------------WFV-----AQI--------L----KTLIH..LIISK....K-FV....
D6Y193_BACIE/4-149--------------------------------IGF-----AQF--------V----KVPLE..FIATR....K-FN....
F5WQX5_ERYRF/7-143--------------------------------NIL-----AQV--------L----KPFFH..YLKTG....E-KN....
C4L0Z0_EXISA/3-131--------------------------------WFI-----AQA--------A----KLVTE..LIKTR....D-FE....
D7GPW8_9FIRM/6-142--------------------------------WTV-----AQF--------L----KTVID..MVINK....S-FN....
D5E1E4_BACMQ/2-142--------------------------------IGL-----AQA--------L----KIPIK..KYQTG....K-WD....
A4J281_DESRM/9-144--------------------------------FLI-----AQI--------M----KGILA..SIKSK....K-WH....
I0JIT0_HALH3/2-142--------------------------------IGV-----AQA--------L----KIVTY..KRLTG....K-WD....
E1Z6N1_CHLVA/1-136--------------------------------FFF-----AQS--------A----KVFTH..YYTEQ....K-WD....
D3PLN0_MEIRD/5-141--------------------------------SVV-----AQL--------L----KLFIY..YWVER....R-WE....
Q8DMU2_THEEB/9-144--------------------------------SAI-----AQM--------L----KLLID..IAKHR....K-LN....
A4RUH5_OSTLU/12-147--------------------------------FSI-----AQI--------A----KVFTH..YHATG....K-VD....
Q5L0A2_GEOKA/2-142--------------------------------IAL-----AQF--------L----KIPIK..QLETG....R-WD....
W1NTD9_AMBTC/34-169--------------------------------FAI-----AQF--------L----KLFTT..RYKEK....R-WD....
K8EPQ0_CARML/4-150--------------------------------ICF-----SQF--------I----KVPIA..FLLKK....N-TT....
C6CSF5_PAESJ/6-132--------------------------------WFV-----SGI--------L----KFMIN..YIRFG....K-EA....
G2TKM5_BACCO/4-146--------------------------------MLV-----AQI--------I----KVPIH..FITSG....K-FD....
K9TPQ7_9CYAN/8-143--------------------------------CLI-----AQS--------A----KLAIE..LARNR....K-FN....
N0B1X3_9BACI/2-142--------------------------------IGL-----AQA--------V----KIPLH..FMKSG....E-WK....
V5WJH0_9SPIO/5-132--------------------------------QLV-----CQL--------T----KFIAY..SIRDK....K-FT....
C9RC18_AMMDK/8-140--------------------------------CWV-----TQG--------I----KSFLA..WRRER....R-WS....
L7VUG0_CLOSH/9-141--------------------------------WFL-----AQS--------I----KFFHN..YVKTR....K-LD....
R5J5K1_9FIRM/8-139--------------------------------CFM-----AQF--------L----KVFSG.....EK....K-FD....
C1E358_MICCC/7-142--------------------------------FTV-----AQV--------A----KVFTH..WHTTG....K-LD....
R7MBM3_9CLOT/16-148--------------------------------AFF-----AQV--------I----KFILF..TVKSR....R-VN....
R6B6R3_9CLOT/12-145--------------------------------WIG-----IQL--------F----KIIWE..YAETK....R-LN....
A5GRZ6_SYNR3/9-137--------------------------------CGL-----AQL--------S----KLLIE..LVVHR....R-WR....
R7B1C9_9CLOT/8-144--------------------------------WVV-----AQV--------L----KTILD..IGLNH....S-FN....

PF10261

Q5KDG2_CRYNJ/99-376....................PPNDGRIRRLLVWIA-----ATA-------------CWAVFTRW..FFG...A.GL----
G2QCT9_MYCTT/113-344...................PGAKTRARAAV.RWAA-----VTA-------------WWVFVTQW..FFG...P.AL----
E3RV27_PYRTT/85-309.....................SARRVRAVL.RYGV-----VTT-------------WWCFLTQW..FFG...P.PL----
R7YND5_CONA1/92-324...................VLTPRRVRAVL.RYLL-----VTL-------------WWAGVTQW..FFG...A.PL----
G2XHJ1_VERDV/98-323......................KRRMQAGV.RWAV-----ATA-------------LWFLVTQW..CFG...P.AI----
C4Y4H3_CLAL4/57-287..................SGFRLKVLRGAVLRWLV-----ATC-------------WWYLFTQW..CFG...L.PI----
C5DQ74_ZYGRC/35-359.......................KFNRQSFTRYLI-----LTA-------------WWYVFTQA.LWFH..TA.PI----
G8BYR0_TETPH/33-386..................TRIHTLNIKKFIKRYVI-----VTM-------------WWILFTQGIPFFK..IP.PI----
E3KJ35_PUCGT/96-348..................RSHPSSHVPRILSLHLL-----ATL-------------LWIFLTQW..CFG...S.SL----
N1RPR7_FUSC4/66-290......................GRRVRASL.RWVA-----VTT-------------MWFLVTQW..CFG...P.AL----
F9WXZ1_ZYMTI/84-317...................QLTRRRWQATL.RYTC-----ATL-------------IWIFVTQW..FFG...P.AI----
G3BAX8_CANTC/92-323.......................PVAKNAIISYTI-----ATA-------------WWILFTQW..CFG...V.PI----
G8BIE7_CANPC/69-321................IQQQQKIEFLIKAVVRYAI-----ATF-------------WWILFTQW..CFG...L.PI----
C5FE12_ARTOC/64-296..................ADCRLRRVGQALFRYSI-----VTF-------------SWILTTQW..CFG...P.PI----
G8ZXV3_TORDC/32-356.......................RQNHHSLVRYAI-----LTI-------------WWYMFTQS.LWFG..SA.PI----
A5DKF9_PICGU/56-288...............DTPYSQRMHLLRRTLMRYLV-----MTV-------------WWVLFTQW..CFG...L.PL----
E3QPL9_COLGM/87-312......................TVRLQATL.RWVL-----VTT-------------WWFFVTQW..FFG...P.AI----
S3CVS7_OPHP1/100-357...................TLFGRRASAAI.RWSL-----VTG-------------WWILVTQW..FFG...P.AL----
A3LYM5_PICST/59-299..................SAIRINIAKGAVIRYVL-----ATV-------------WWIFFTQW..FFG...L.PI----
G0WG33_NAUDC/40-380......................QKILWKAFKHYCV-----LTC-------------WWYAFTQSIFIY....P.PL----
M3IZX9_CANMX/56-283...................ADRIRVLRRAVTNYII-----ATV-------------WWILFTQW..CFG...L.PI----
G3JBH7_CORMM/90-318......................GARARAAA.RWAA-----VTT-------------WWVLVVQW..CFG...A.PM----
R9AQ78_WALI9/64-296.......................RWRVVSGLRWVA-----ATS-------------SWFLFTTW..FFG...D.GL----
C5E2P1_LACTC/32-359.......................GTWKRTLLRYAI-----LTV-------------WWFVFTQS.LWSE..AA.PL----
T0K1V0_COLGC/87-312......................TRRIQATL.RWVL-----VTT-------------WWFFVTQW..FFG...P.AI----
G8Y1H9_PICSO/62-313..................QQEKIRLLRNGLIKYSI-----MTF-------------WWVLFTQW..CFG...L.PI----
C5G9K2_AJEDR/75-292..................PGARLKRVGQATGRYIL-----VTI-------------AWWLTTQW..FFG...P.GI----
C5MI48_CANTT/55-284..................YSIRQKLIYKGILNYLL-----STL-------------WWILFTQW..CFG...L.PI----
N1Q4W5_DOTSN/87-323...................QLTRRRLQAGA.RYAC-----ITL-------------AWFFVTQW..FFG...P.GI----
S3DE95_GLAL2/81-314...................TLTPKRIRGLL.RYSI-----VTT-------------WWIFVTQW..FFG...P.AI----
R9P3R6_PSEHS/103-383VDHKKQDDASSATEAAAAQATITSPVSIPVLRYMI-----ATS-------------AWLLFANW..FFG...P.PL----
N1Q6I4_PSEFD/84-317...................QLTKRRIQAIL.RYIC-----VTV-------------IWIFVTQW..FFG...P.AI----
K2R4W1_MACPH/94-328...................VLTPRRVRSVL.RWAL-----VTL-------------AWVFVTQW..FFG...P.PL----
N1QNJ0_SPHMS/101-335...................QLTKRRVQAIF.RYMT-----ITA-------------VWVFVTQW..FFG...P.AI----
F7WC52_SORMK/81-344......................ERKLRATV.RWGL-----VTL-------------WWIFVTQW..FFG...P.AI----
M2N8T6_BAUCO/89-327...................ALTRRRLQAAV.RYVC-----ITA-------------VWVAVTQW..FFG...P.PI----
K9G927_PEND2/67-311..................QEARFRRTLQAILRYAL-----TTT-------------VWYLATQW..FFG...P.AI----
C4R337_KOMPG/57-293.......................KIKPVTIVRLAL-----ITG-------------WWWVFTQW..CFG...L.PI----
A1CR84_ASPCL/74-313....................HQPRRLAQALLRYAL-----ATA-------------AWYLTTQW..FFG...P.AI----
A5E4A1_LODEL/62-350DDSVLVSGKKEKKLYTTKSERLSKYFLGAIVRYLL-----LTI-------------WWVLFTQW..CFG...L.PI----
U1G5N5_ENDPU/81-322......................NNNFLQALLRYSL-----ITL-------------TWIFTTQW..FFG...P.AL----
E5R3U3_ARTGP/64-297..................ADYRMRRVGQALLRYSL-----VTF-------------SWILTTQW..CFG...A.PI----
K1WMV9_MARBU/113-341...................TLTPKRLRGIF.RYAI-----VTG-------------WWIFVTQW..FFG...P.AI----
G0VEA6_NAUCC/39-386....................RRHSRLTRSLIRYII-----LTL-------------WWFMFTQN.LIPGTQLP.PI----
Q6FR77_CANGA/32-368.......................RQWKSSLKRYLI-----LTL-------------WWYVFTQGILWFD..IP.PI----
E9EF85_METAQ/84-313...................DMTPRRLRAML.RWAA-----VTA-------------WWFLVTQW..CFG...P.PM----
R8BRZ8_TOGMI/87-311....................APQRRVKAGV.RWAL-----VTG-------------WWFFVTQW..FFG...P.AL----
M9LJJ3_PSEA3/95-341...............RSGQATITSPVSISVLRYMV-----ATG-------------AWLLFANW..FFG...P.PL----
M1VZ69_CLAP2/82-312...................DLTPRRLRAIL.RWAA-----VTG-------------WWFLVTQW..FFG...A.PL----
V5GE99_BYSSN/78-302....................ARGRKTVQALARYGI-----VTL-------------SWILTTQW..FFG...P.AI----
I2FTC6_USTH4/101-374INN...KKDEDAISQAAQQATITSPLSISVLRYAI-----ATG-------------IWLLFADW..FFG...P.PL----
G8JR11_ERECY/38-363.......................TNIKRTLIRYIL-----LTV-------------WWFTFTQS.VWVG..VA.PI----
Q6BUP0_DEBHA/108-353................RTKQQRISVLKKAIFNYVV-----ATL-------------WWVLFTQW..CFG...L.PL----
Q4WJI3_ASPFU/73-304....................HQPRRLVQAALRYSV-----ATL-------------VWYLMTQW..FFG...P.PI----
G2R9R1_THITE/97-341...................RRRLRLLRAAVLRWAL-----VTV-------------WWVFVTQW..FFG...P.AL----
I4YGQ8_WALMC/41-264.......................RWRIVTVSRWVA-----ATS-------------SWFLFTNW..FFG...D.SL----
G2XPX9_BOTF4/55-288...................ILTARRARGTL.RYLV-----VTI-------------WWIFVTQW..FFG...P.PL----
G3AEN0_SPAPN/55-285.......................KVIREAVIRYAV-----ITM-------------WWILFTQW..CFG...L.PI----
C7Z7P3_NECH7/60-283......................GRRLRAVY.RWAA-----VTT-------------VWILVTQW..CFG...P.AL----
E7KCE6_YEASA/33-370....................RDRRHIVQSFKRYAI-----LTV-------------WWYVFTQG.IWFG..VG.PI----
G3YDY9_ASPNA/76-295....................HRARRTGQAVLRYVL-----ATT-------------VWYLTTQW..FFG...P.PI----
L8FY78_PSED2/112-347...................ALLRKRIQGAL.RWGL-----VTL-------------WWVFVTQW..FFG...P.AI----
A7TR39_VANPO/62-394..........................KKFIKRYFA-----LTF-------------WWYVFTQGISFLN..IP.PV----
N1JKB0_BLUG1/90-317...................VFVTKRVHGFM.RYCV-----VTL-------------WWIFVTQW..FFG...P.AI----
B6Q6E7_TALMQ/81-304..................GNLRGKRSVRAFLRYTI-----VTS-------------AWFLTTQW..FFG...P.AI----
B8M5R8_TALSN/84-316..................GNLRGKRSVQALLRYAI-----VTC-------------AWFLTTQW..FFG...P.AI----
C8V5A4_EMENI/56-278....................HRGRRQFQAFVRYAL-----ATT-------------AWYFVTQW..FFG...P.AI----
G0T001_RHOT2/1044-1290................RTQAVSTAHVAASVRRYLL-----ASL-------------YWFYLTQA.TWFGRSLGPSI----
Q6CKM7_KLULA/25-334.........................IVNHWKRYLL-----LTL-------------WWMIFTQE..VFG..LT.PL----
Q75EB2_ASHGO/35-359.......................RSLRQTALRYVA-----LTA-------------WWYAFTQA.IWFG..IA.PI----
M7SYX4_EUTLA/110-375.................SGGSGGKTFRAAA.RWAL-----VTT-------------WWILVTQW..CFG...P.PI----
E9CZW5_COCPS/67-291..................PNKRLRRIYQALFRYAV-----VTL-------------AWVLTTQW..CFG...P.AI----
F0XPI2_GROCL/81-317.......................RSVSGTSSSHTI-----...-------------...........FGSGAPQPS----
A7UX33_NEUCR/112-389.............RGGDNGSGTGRKIKAVV.RWGL-----VTL-------------WWVFVTQW..FFG...P.AI----
J3NLN2_GAGT3/91-336.................QGGSSSRRLRAVL.RWAL-----VTG-------------WWVLVTQW..CFG...P.PL----
A7EQ03_SCLS1/55-288...................TVTPRRLRGFL.RYAV-----VTT-------------WWIFVTQW..FFG...P.AI----
G9NCA4_HYPVG/72-300...................VVLMRRIRAGL.RWVA-----VTG-------------WWFFVTQW..FFG...P.PI----

PF01569

Q29NI1_DROPS/70-187--I-KDTLVIGPDKF................-------------------------------------------------
A4I568_LEIIN/102-249--P-AAGMSYTTV.Y................-------------------------------------------------
DOPP1_DICDI/54-178--W-KELRKQSY...................-------------------------------------------------
Q17D95_AEDAE/56-197--W-VRETKEFTT.LNRPKLYQNEL......-------------------------------------------------
G6PC3_MOUSE/53-195--W-VHESGYSTQTPIQIHQFPS........-------------------------------------------------
A0BM37_PARTE/91-226--I-VQEIEPYECNK................-------------------------------------------------
Q23FV4_TETTS/102-237--V-NLDIKTDECGPE...............-------------------------------------------------
A0EE96_PARTE/81-240--L-DPEIKLDFC.YT...............-------------------------------------------------
A8FE89_BACP2/71-198--D-HLVNETYY...................-------------------------------------------------
A0LYQ4_GRAFK/59-183--Q-EGVMEYARYVAERCG............-------------------------------------------------
Q7MUE1_PORGI/58-185--H-PDFIDYVKTVYGYRGG...........-------------------------------------------------
A0K0K5_ARTS2/118-241--D-LMLFGPDVTF.................-------------------------------------------------
A4XP73_PSEMY/98-234--S-LVVEGSARLTELFPDWEERWD......-------------------------------------------------
A4X1H8_SALTO/101-242--S-VREPFLAPE.QTLPLFQHEL.......-------------------------------------------------
Q9EWX3_STRCO/115-237--A-TTIGANEMWLGGD..............-------------------------------------------------
A1BJZ6_CHLPD/56-185--V-LEGCRLLVDQSHSF.............-------------------------------------------------
A4FQA0_SACEN/76-196--A-VRDIAATLAECPEPG............-------------------------------------------------
B0U8C7_METS4/61-186--S-GDSNFIAPIGTKIEIFE..........-------------------------------------------------
A1S1V4_SHEAM/77-196--V-LEHIRIVGAMRLNH.............-------------------------------------------------
A1W5E3_ACISJ/72-191--V-FGHLNHVLGTVEEH.............-------------------------------------------------
A5CF96_ORITB/78-203--S-LSSSEIQTVIDFNTEYV..........-------------------------------------------------
B4U5Z7_HYDS0/54-171--V-LKHVHLLYKLYWG..............-------------------------------------------------
A5DBA1_PICGU/102-232--P-PLHRITMSSYTAQE.............-------------------------------------------------
Q4D544_TRYCC/102-225--P-PVELRGRASASREY.............-------------------------------------------------
SSPA_DICDI/88-218--V-WTNTAHQKDH.................-------------------------------------------------
Q32GQ5_SHIDS/77-232--I-WLEKTHHIPVDEFYTLKRAERGNLVKE-------------------------------------------------
Q9CMX4_PASMU/75-237--V-YVAEASGISVEQFYAQERKQRSHFIDQ-------------------------------------------------
Q21JU9_SACD2/110-231--V-FTTDLFNLVGKGYTN............-------------------------------------------------
C1DG09_AZOVD/106-238--A-DGRVQVLPQASMMSVEMAKSQ......-------------------------------------------------
Q0K1U6_CUPNH/103-229--A-NKTQMCTPAETAKLEK...........-------------------------------------------------
Q65GX3_BACLD/179-304--W-KDNSIIVPTLIPVINPDP.........-------------------------------------------------
Q2IJN8_ANADE/141-265--Y-AGRDGLVKQAQGYR.............-------------------------------------------------
Q6FEM9_ACIAD/65-182--V-HQVIVLGERPLDHF.............-------------------------------------------------
A1K7H5_AZOSB/105-237--V-EAFGGASTFSPALVPSNQ.........-------------------------------------------------
Q3SNT4_NITWN/91-218--V-TEFSGPWKFMPWWDPRGE.........-------------------------------------------------
Q6MBQ7_PARUW/87-223--I-IEFGGAQPF.LPYYKPRFNH.......-------------------------------------------------
A8EX54_ARCB4/94-229--L-AEYGGRYPDVRIFDSYPKD........-------------------------------------------------
Q87X15_PSESM/102-231--L-TEFGGQETYSELLSPRPAT........-------------------------------------------------
Q03CR8_LACC3/177-306--L-NGNPTHFTSWFQPNGAN..........-------------------------------------------------
R5ZI70_9ACTN/141-283--I-EVTQGLDFQPWWVIGNPDKWAFI....-------------------------------------------------
A8BDI5_GIAIC/110-282--I-AEFTTVSGPTVTFMPVFSRYT......-------------------------------------------------
A8BQZ4_GIAIC/121-285--T-HEFGILLETCKYEFKAIFTPY......-------------------------------------------------
Q6MTZ1_MYCMS/144-270--L-ELYRNWWNIKWTSWK............-------------------------------------------------
R5TP42_9FIRM/95-216--F-PRDNIFTDM.VRMLYLAD.........-------------------------------------------------
A3LWS4_PICST/248-396--E-MTYTDGITRQDMKFGSSMYRY......-------------------------------------------------
Q127S7_POLSJ/95-224--D-WSQYPDVGLLKSLD.............-------------------------------------------------
A4CJ32_ROBBH/299-448--L-INQHIDDSWKPVLQT............-------------------------------------------------
Q2HER5_CHAGB/260-418--A-IHHPTPWVHSGADISSPSWT.......-------------------------------------------------
A8L0R7_FRASN/276-428--A-IQLADTDGNPATTADPTWAPL......-------------------------------------------------
Q4YWD7_PLABA/107-241--T-CQPLVNNGFLQNIYSIYLIV.......-------------------------------------------------
Q6NJR5_CORDI/194-319--A-LLRFPPEVTPADW..............-------------------------------------------------
A1SKJ7_NOCSJ/98-218--R-ILDPGLVPDD.................-------------------------------------------------
Q82Z33_ENTFA/85-204--G-ALADRSSA...................-------------------------------------------------
A2DYB5_TRIVA/98-241--Y-SICGSQEINPSDPSTCPGLS.......-------------------------------------------------
A2EZZ9_TRIVA/91-236--Y-TFTTEILEA.SVDEEKKLSDKRK....-------------------------------------------------
A4H9E7_LEIBR/233-378--L-SRLRNEGFNASSVGVDWCTV.......-------------------------------------------------
Q6BYN9_DEBHA/112-272--I-SRCQPTQTEMLIYGQLATVEICETFSR-------------------------------------------------
A7EIU4_SCLS1/134-294--L-TVCKPNIPVTTQQETGNGLNYIMYDRT-------------------------------------------------
A7TF94_VANPO/122-266--L-ERCQPMIPK.GQEKEYYNLDVCK....-------------------------------------------------
Q2TYI3_ASPOR/35-224--L-ARCDPDLSNISAHLAGGLGLRREGAAV-------------------------------------------------
A2EQG2_TRIVA/90-230--I-AICGGDGSY.LTCTGFLDQK.......-------------------------------------------------
PLPR5_MOUSE/122-275--T-ALGCQQYTQ.FISGEEACTGNP.....-------------------------------------------------
Q9VNU2_DROME/65-225--F-HGCQPRLDDGSSCSDLQNAELYVEQFH-------------------------------------------------
A8WXP5_CAEBR/128-286--V-SVCKPDWSKVDCSDKESFIDPSDLVC.-------------------------------------------------
A6X217_OCHA4/121-242--L-DDVGAAYFSPFKGQFL...........-------------------------------------------------
Q5NGF4_FRATT/116-236--F-LEYGSHYFQHFHAPG............-------------------------------------------------
Q5ZX13_LEGPH/91-208--L-FDNNLYGFYWFQLNDN...........-------------------------------------------------
Q6MH55_BDEBA/105-226--T-PDFDPYVFDHFTTHWH...........-------------------------------------------------
B4S7E2_PROA2/140-261--G-DGNNRFNWVETSNRY............-------------------------------------------------
Q7NZZ5_CHRVO/815-932--D-NAPWRSQPAGTSRWQ............-------------------------------------------------
Q0SBZ7_RHOJR/226-347--V-SQVLLETDH..................-------------------------------------------------
Q89JR9_BRADU/79-199--R-TVIGHLHGVPFSGKS............-------------------------------------------------
B7VND8_VIBTL/235-351--Y-LPTLKLVMS.SG...............-------------------------------------------------
Q5E4L0_VIBF1/241-366--Y-IPQLQLTEA.VGF..............-------------------------------------------------
Q9RVR6_DEIRA/14-135--D-DPALASAAARATAGG............-------------------------------------------------

PF14378

Q5K8D7_CRYNJ/128-311--F-QSTRRTLVLCNCL.AFIVFSSWPCMPP.................RLMP..--------------------------
B0UG28_METS4/124-315--L-WAFVRLFCAALAC.AVAVSALLPAVGP.................YAAY..--------------------------
A1SJR6_NOCSJ/50-230--F-LRLRDGMLVSGGL.GLIVYVTYPVAPP.................RLV...--------------------------
C5APU7_METEA/131-322--L-WAYARLFSLALLA.SIAVSALFPAIGP.................YAYY..--------------------------
E4NIW3_KITSK/45-228--Y-RRARRALLAMTAL.ILPVYWAVPMSPP.................RFA...--------------------------
Q989C0_RHILO/119-308--L-LEFVAILFASSVL.TAIIMAAVPVDGP.................YLYF..--------------------------
G8WRV6_STREN/158-347--Y-LYMRTWLMISTLL.GLIGFSLLPTAPP.................RLL...--------------------------
C7QD07_CATAD/71-251--Y-ASARTTMALATAF.ALAI.QLIPVAPP.................RMI...--------------------------
Q1D5Z1_MYXXD/96-274--Y-DEYLTALGLLFFL.NYAAYALVPAVGP.................RYF...--------------------------
Q2G5H1_NOVAD/115-305--L-LHFIAAYSLTLTI.TVAVFPLFPAEGP.................YVYY..--------------------------
U4LB32_PYROM/137-324--F-EARRRTLALCNLL.AFVVFTSWPCMPP.................RLLP..--------------------------
Q1IHV8_KORVE/153-330--A-RTALWAFLIVGPL.ACVCFLLFPATGP.................VYAF..--------------------------
F2R3P1_STRVP/39-228--Y-RAARTWLMASTLL.GLVGFTLLPTCPP.................RLL...--------------------------
A9HHP2_GLUDA/131-314--N-RELLVNMQVALCL.TSVLVALMPAAGP.................WTYF..--------------------------
Q13PQ7_BURXL/110-293--Y-AEFVVQFMVSATL.VILISVPFPAESA.................FVHF..--------------------------
R6XNQ9_9FIRM/3-178--G-IIALIALLIGVIT.VSITKIAVSRDRP.......................--------------------------
Q63V72_BURPS/125-308--L-SEFIALFMLTSVM.VLLISTPFPAASA.................FLHF..--------------------------
Q01VD1_SOLUE/159-330--R-FSIVRLFVVSNCI.GCALYFLFPAAGP.................MYAY..--------------------------
D1CA82_SPHTD/53-235--Y-REFRNVFLGILGI.GLLIYALYPLAPP.................RFF...--------------------------
K0K1I4_SACES/40-223--Y-SHLRTVLVVMMLL.DLLLVWLFPEAPP.................RFA...--------------------------
D1C524_SPHTD/53-234--F-VETRNIYLTLLVV.AIPVYRLFPLAPP.................RYF...--------------------------
W5TLL4_9NOCA/53-242--Y-RAARTQLGIATAA.GLIGFVLMPTAPP.................RLL...--------------------------
D3HTE9_LEGLN/101-283--V-REYYFYLLCTTLI.GFSFYYFFPTTAP.......................--------------------------
Q2JBQ4_FRASC/47-236--Y-AQARWTLVITTLI.CLVGFFLFPTAPP.................RLL...--------------------------
W0BEC4_9GAMM/94-276--M-REYYFLLFSSALI.GYTFYYFFPTTAP.......................--------------------------
Q220L9_RHOFT/109-292--L-DEFMRLFIVATVL.TILMSGPFPAAGA.................WKHHAL--------------------------
G2P916_STRVO/51-241--Y-RFLRTWLLVSTII.GLIGFTLLPTCPP.................RLL...--------------------------
Q87M50_VIBPA/146-355--R-LQFLLTFLLTWMINGSLFATAFSSVGPCYLELLNGDDLFAPLMQRLN...--------------------------
B1LSY3_METRJ/129-320--L-WTYIRLFSATLLC.VIGLAALLPALGP.................YAHY..--------------------------
A2BL06_HYPBU/51-224--F-RRLLAAFLVASAV.AITVYVLSPTAPP.................WIALPC--------------------------
L0PFU2_PNEJ8/5-201--L-PVFAKSFGYLNLI.GVIIQLAFPCSPP....................WYQ--------------------------
C9Z2S2_STRSW/63-253--Y-RAARTWLLTSTFI.GLIGFTLLPTCPP.................RLL...--------------------------
B9L518_THERP/33-215--Y-REVRATFLAILGA.GLLSYTLFPLAPP.................RFF...--------------------------
E3JAH2_FRASU/94-282--Y-RRARSTILLTTIL.GLVGFWLLPTTPP.................RLL...--------------------------
F8AWV4_FRADG/47-236--Y-LAARWTIVCTTVI.SLTGFFLVPTAPP.................RLL...--------------------------
R7Y200_9ACTN/124-318--G-YWFATSQCLAWSL.GTASYYALPTLGPGFQYSWLYRDLPDTGSGALM...--------------------------
A0LS47_ACIC1/69-252--Y-PWARNTLAGLTLG.AITCFALWPTTPP.................RLL...--------------------------
E2Q4K3_STRC2/45-234--Y-RAARTWLMVSTLL.GLVGFTLMPTCPP.................RLL...--------------------------
F8J559_HYPSM/123-309--L-RSVMTTSTVVLAA.TIAIFLVAPAIGP.................YAHF..--------------------------
L0ET54_LIBCB/102-293--A-YIMVTSYGVLCFV.SSIVATWFPALGT.................YVYY..--------------------------
Q89QL0_BRADU/109-300--L-RIFMLSFVLTTLL.TIGVSAFMPAQGV.................WGHL..--------------------------
B1VW42_STRGG/49-238--Y-RAARVWLMNSTLL.GLVGFTLMPTCPP.................RLL...--------------------------
C5AQ48_METEA/107-294--S-DRFVSSFILCVTM.TTIISAVLPAEGA.................AGLL..--------------------------
H0PVV4_9RHOO/74-256--N-RELFWTAVIALVI.TSALSDVFPAAGT.................FYHF..--------------------------
E3EJC2_PAEPS/1-162--V-LEAVITVCIGFII.SWGLGHLFYRDRP.......................--------------------------
G0HGL8_CORVD/79-265--Y-RFTSTVLILTTCL.ALVGFYTLPTAPP.................RMF...--------------------------
A1SDU3_NOCSJ/130-324--G-YWFVTSQCIAWSL.GTASYYALPTLGPGLEYTWLYDSLPTTPTSRLM...--------------------------
C7QBQ6_CATAD/84-272--Y-RAIRTVMISMTLI.ALFGFYFYSLAPP.................RLL...--------------------------
A1SHK3_NOCSJ/128-322--A-YVMLCSALWVWIL.GVGSYYLVPSLGP.......................--------------------------
E3J0M0_FRASU/110-299--Y-SRARWTLVFTTLL.CLLGFFLFPTAPP.................RLL...--------------------------
C8XDB0_NAKMY/22-205--Y-PKVRRTFVVMAPL.ALLIFWLLPMSPP.................RFA...--------------------------
G7XGU5_ASPKW/117-299--Y-QAIRRTLAFENVI.AFTILTLWRCMPP.................RLL...--------------------------
N0BE90_9RHIZ/119-305--L-RLMITASAITLAI.TMFGFFLIPAMGP.................YWYF..--------------------------
B1LVV6_METRJ/99-290--L-QDFVLAFALAGTV.TVLVSALTPALAN.................FVFL..--------------------------
Q5ZV46_LEGPH/101-283--L-KDYYFLLLCTTLM.GFSYYYFFPTTAP.......................--------------------------

PF14360

SLS2_TRYB2/201-275--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
A9RPY7_PHYPA/269-340--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
Q4YWD8_PLABA/201-272--------------------------------------------------------------------------------
B3L7G0_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
A9SUW6_PHYPA/174-246--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
Q17C33_AEDAE/230-303--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
C5KN45_PERM5/142-213--------------------------------------------------------------------------------
C5L5L1_PERM5/146-217--------------------------------------------------------------------------------
SMSR2_CAEEL/246-319--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
C5KL60_PERM5/83-154--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
C5LU78_PERM5/899-971--------------------------------------------------------------------------------
C5KY50_PERM5/57-128--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
A0A0H5S654_BRUMA/218-291--------------------------------------------------------------------------------
F8W5G6_DANRE/232-307--------------------------------------------------------------------------------
F6UTK5_XENTR/280-353--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
J9FFV7_WUCBA/189-261--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------

PF02681

F2NNY3_MARHT/5-141..W.ERFLETGGM-------------------------------------------------------------------
K9T6M6_9CYAN/8-143..L.RYLVTTGGM-------------------------------------------------------------------
D4ZTL8_ARTPN/8-143..L.RVLVTTGGM-------------------------------------------------------------------
K9WGM7_9CYAN/8-143..L.RDLVTTGGM-------------------------------------------------------------------
B7GI74_ANOFW/24-164..W.SLFFETGGM-------------------------------------------------------------------
B1WS33_CYAA5/8-143..F.RYLVTTGGM-------------------------------------------------------------------
R5AEV3_9CLOT/9-146..F.ERLVGSGGM-------------------------------------------------------------------
Q31Q62_SYNE7/9-145..W.HVLIETGGM-------------------------------------------------------------------
R5XG63_9CLOT/5-137..F.KRIIISGGM-------------------------------------------------------------------
D4JCM8_9FIRM/8-144..L.HWVIASGGF-------------------------------------------------------------------
W0E929_9FIRM/8-143..L.YFLISSGGF-------------------------------------------------------------------
D3FYY4_BACPE/4-149..W.TLFTSTGGM-------------------------------------------------------------------
F0RVM2_SPHGB/6-143..W.HLLISTGGM-------------------------------------------------------------------
H6NB79_9BACL/2-142..W.KDLFGTGGM-------------------------------------------------------------------
Q7V6P1_PROMM/15-147..P.AVLLETGGM-------------------------------------------------------------------
Q18B69_PEPD6/8-140..L.SRILISGGM-------------------------------------------------------------------
G0GF41_SPITZ/9-149LLP.VVLWKTGGM-------------------------------------------------------------------
Q65FE5_BACLD/4-149..W.RLVTSTGGM-------------------------------------------------------------------
U5LF62_9BACI/2-142..P.GLFFQTGGM-------------------------------------------------------------------
R7L0C2_9FIRM/5-149..F.ERLFGAGGW-------------------------------------------------------------------
Q5WDV5_BACSK/4-146..F.SLFTSTGGM-------------------------------------------------------------------
D6GSF2_FILAD/8-144..F.TRFVGSGGM-------------------------------------------------------------------
E6U5K5_ETHHY/8-143..P.ERILGAGGM-------------------------------------------------------------------
Q5SJ95_THET8/4-140..W.HRFLDTGGM-------------------------------------------------------------------
R5GK39_9FIRM/5-157..P.ERITGAGGM-------------------------------------------------------------------
Q9RSQ8_DEIRA/8-143..P.GAFMETGGM-------------------------------------------------------------------
P73185_SYNY3/8-143..L.RSLVSTGGM-------------------------------------------------------------------
D1AKQ0_SEBTE/7-143..W.VRLFQTGGM-------------------------------------------------------------------
E0RXA3_BUTPB/8-144..A.ERLTGDGGM-------------------------------------------------------------------
F5YE41_TREAZ/16-155LVE.TIIWRTGGM-------------------------------------------------------------------
V5WEJ9_9SPIO/6-144IIA.SLMWRTGGM-------------------------------------------------------------------
U5LHE7_9BACI/5-149..W.SLLTSTGGM-------------------------------------------------------------------
K9XWG4_STAC7/8-143..F.RYLVTTGGM-------------------------------------------------------------------
E6U2C7_BACCJ/4-149..W.SLLTSTGGM-------------------------------------------------------------------
R7M7X6_9CLOT/12-143..F.KKLMQAGGM-------------------------------------------------------------------
K9V3M2_9CYAN/8-143..I.SVLFTTGGM-------------------------------------------------------------------
B9IAH9_POPTR/38-171..S.KRMLDSGGM-------------------------------------------------------------------
M0RZC5_MUSAM/20-155..S.RRLLGSGGM-------------------------------------------------------------------
R5ZD30_9FIRM/8-146..L.HWVIASGGF-------------------------------------------------------------------
R6Q3Q8_9FIRM/8-138..A.SRLTGTGGM-------------------------------------------------------------------
F4GLJ1_SPHCD/5-141..P.SMLVSTGGM-------------------------------------------------------------------
C0ZKP9_BREBN/5-150..W.SLLMSTGGM-------------------------------------------------------------------
D8TLE7_VOLCA/33-168..W.TRLVSSGGM-------------------------------------------------------------------
D4JU78_9FIRM/7-157..A.ERLTGAGGM-------------------------------------------------------------------
K9YEC7_HALP7/8-143..A.RSLFTTGGM-------------------------------------------------------------------
K3XML5_SETIT/24-159..P.KQLIGSGGM-------------------------------------------------------------------
K9RII7_9CYAN/8-143..A.SVLVTTGGM-------------------------------------------------------------------
K4LIZ6_THEPS/40-169IAW.RQLFRCGGM-------------------------------------------------------------------
E6TWS5_BACCJ/5-142..W.KTFFESGGM-------------------------------------------------------------------
R6V5P2_9CLOT/18-171..I.KQFFSDGDF-------------------------------------------------------------------
Q73MW8_TREDE/10-150FFE.LVFWRTGGM-------------------------------------------------------------------
Q8Y4P9_LISMO/4-149..L.GLMFSTGGM-------------------------------------------------------------------
M0SK26_MUSAM/139-272..L.GMLFSCGGM-------------------------------------------------------------------
I0GIV6_CALEA/8-146..L.QMFISTGGN-------------------------------------------------------------------
A9TH33_PHYPA/30-165..V.KRLYGSGGM-------------------------------------------------------------------
G4KW10_OSCVS/4-137..I.RRLFGDGGM-------------------------------------------------------------------
R5CL70_9FIRM/8-147..F.ERIFGAGGM-------------------------------------------------------------------
I0I5M8_CALAS/5-139..V.RVMAQAGGM-------------------------------------------------------------------
D7CKU8_SYNLT/12-144..W.YWLFSDGGM-------------------------------------------------------------------
R7IRJ9_9CLOT/8-142..F.KRIVGAGGM-------------------------------------------------------------------
B8HXR8_CYAP4/8-143..F.RVLVETGGM-------------------------------------------------------------------
B0C3J0_ACAM1/8-143..F.RVLVETGGM-------------------------------------------------------------------
I4DAH9_DESAJ/3-144..W.KAVFQPRGM-------------------------------------------------------------------
Q46K07_PROMT/15-148..P.SVLIETGGM-------------------------------------------------------------------
R7A3G1_9CLOT/8-142..F.KRIIGAGGM-------------------------------------------------------------------
Q24V03_DESHY/8-143..V.AFLFSSGGF-------------------------------------------------------------------
K9VPU0_9CYAN/9-144..L.QYLVTTGGM-------------------------------------------------------------------
D1BMJ6_VEIPT/9-146..P.ERLVGSGGF-------------------------------------------------------------------
Q10X44_TRIEI/8-143..L.RVLFTSGGM-------------------------------------------------------------------
A4RZ57_OSTLU/3-142..P.ALALASGGF-------------------------------------------------------------------
D8QR56_SELML/24-159..L.KRMAGSGGM-------------------------------------------------------------------
K4AZY7_SOLLC/140-274..F.RIMFASGGM-------------------------------------------------------------------
Q8ENX8_OCEIH/4-149..P.GLAFSTGGM-------------------------------------------------------------------
K7V114_MAIZE/48-182..A.RKFLTSAGV-------------------------------------------------------------------
D4IXN8_BUTFI/8-143..K.ENIYAKTGM-------------------------------------------------------------------
Q01ES7_OSTTA/128-261..Y.RVMFDSGGM-------------------------------------------------------------------
E3HA83_ILYPC/7-143..F.KRFWGTGGM-------------------------------------------------------------------
V5RVF1_9BACT/5-132..HLRQLYLSGSM-------------------------------------------------------------------
A6TR41_ALKMQ/8-144..L.SRFVGSGGM-------------------------------------------------------------------
I1KRZ5_SOYBN/9-144..L.KQLVGSGGM-------------------------------------------------------------------
R5KDM7_9CLOT/8-150..W.ERVVGGGGM-------------------------------------------------------------------
R7I9S8_9FIRM/10-145..W.HRFFGSGGM-------------------------------------------------------------------
R6BY11_9CLOT/8-144..A.ERLVGSGGM-------------------------------------------------------------------
R5ITD2_9FIRM/8-144..L.TRIFGDGGM-------------------------------------------------------------------
K9RQD3_SYNP3/8-143..F.RVLVETGGM-------------------------------------------------------------------
K9SVF9_9SYNE/8-143..L.HVLFETGGM-------------------------------------------------------------------
Q7VBG6_PROMA/16-148..P.SVLLETGGM-------------------------------------------------------------------
O83188_TREPA/14-153FFD.FAVWRTGGM-------------------------------------------------------------------
G8QY16_SPHPG/6-143..W.SLLHSTGSM-------------------------------------------------------------------
D3EMZ3_ATETH/8-144..F.NSLVSTGGM-------------------------------------------------------------------
R5TH29_9CLOT/11-163..F.KMLFSDGDF-------------------------------------------------------------------
A9TSJ4_PHYPA/1-141..W.KLVIKSGGM-------------------------------------------------------------------
R5YWD2_9CLOT/9-140..F.KRIMGAGGM-------------------------------------------------------------------
M0SG02_MUSAM/22-157..A.KQLIGSGGM-------------------------------------------------------------------
F5YMS6_TREPZ/16-155LLE.TIIWRTGGM-------------------------------------------------------------------
R7J8Q8_9FUSO/12-143..F.KIFTTTGGM-------------------------------------------------------------------
R7R6N9_9FIRM/8-144..P.ERLVGSGGM-------------------------------------------------------------------
C7NE60_LEPBD/7-143..W.ARLVQTGGM-------------------------------------------------------------------
R5IDQ6_9CLOT/2-138..A.ERLVGSGGM-------------------------------------------------------------------
D9R8M4_CLOSW/8-144..P.ERLVGSGGM-------------------------------------------------------------------
D7BAF5_MEISD/5-141..W.ERFVETGGM-------------------------------------------------------------------
F8F1T7_TRECH/16-155IVA.TLLWKTGGM-------------------------------------------------------------------
Q93ZZ7_ARATH/51-205..F.RSVFQAGGF-------------------------------------------------------------------
D8U4F3_VOLCA/38-173..A.GAMLESGGM-------------------------------------------------------------------
J7IS94_DESMD/8-142..F.SLFFSSGGF-------------------------------------------------------------------
A4XKK1_CALS8/9-143..F.KKFISSGGM-------------------------------------------------------------------
F9VBI0_LACGL/8-142..W.RLLFATGGM-------------------------------------------------------------------
K9W0K1_9CYAN/16-151..I.RVLVTTGGM-------------------------------------------------------------------
A9NHX4_ACHLI/6-144..E.SILISTGGM-------------------------------------------------------------------
D1AXZ8_STRM9/7-141..F.TRLFSTGGM-------------------------------------------------------------------
K9UG93_9CYAN/16-151..V.KVLTTTGGM-------------------------------------------------------------------
F4LN44_TREBD/13-152LFE.LLLWRTGGM-------------------------------------------------------------------
R6NRL3_9CLOT/2-140VTL.ETLFKLGGM-------------------------------------------------------------------
K0IWZ6_AMPXN/4-149..P.GLAFSTGGM-------------------------------------------------------------------
W8TJV6_EUBAC/8-150..A.SRFVGSGGM-------------------------------------------------------------------
R5BKA4_9FIRM/8-146..W.ERLIGSGGF-------------------------------------------------------------------
A8MFI8_ALKOO/8-144..F.TRFVGSGGM-------------------------------------------------------------------
H9UHZ5_SPIAZ/13-152LMV.TVFWKTGGM-------------------------------------------------------------------
B8CY18_HALOH/3-134..F.SRIIGSGGM-------------------------------------------------------------------
B2A528_NATTJ/7-141..L.KLFVASGGM-------------------------------------------------------------------
R6ME09_9FIRM/8-142..F.KRIIGSGGM-------------------------------------------------------------------
F2NS18_TRES6/11-151LFE.LLLWRTGSM-------------------------------------------------------------------
R5PNP2_9CLOT/8-138..F.KRIIGAGGM-------------------------------------------------------------------
Q1J0I2_DEIGD/9-145..P.AAFFETGGM-------------------------------------------------------------------
D6DFV4_CLOSC/8-144..P.ERLTGSGGM-------------------------------------------------------------------
I4D8V5_DESAJ/8-142..F.QLIWSSGGF-------------------------------------------------------------------
R7A673_9FIRM/8-144..A.ERMVGSGGM-------------------------------------------------------------------
R7FJ12_9CLOT/8-142..F.KRIIGAGGM-------------------------------------------------------------------
O51097_BORBU/6-146HLLKKIFLETGGM-------------------------------------------------------------------
K8GFC4_9CYAN/8-143..I.RSLVETGGM-------------------------------------------------------------------
R6QDM5_9CLOT/9-141..F.KIFTTTGGM-------------------------------------------------------------------
M4CGY8_BRARP/134-268..L.SLLFASGGM-------------------------------------------------------------------
K9Q226_9CYAN/8-142..L.RSLFSAGGM-------------------------------------------------------------------
R6N1H2_9CLOT/6-146..W.RRFFESGGM-------------------------------------------------------------------
D3FSU1_BACPE/2-142..W.DTLLETGGM-------------------------------------------------------------------
B9DG97_ARATH/20-155..L.KQLIGSGGM-------------------------------------------------------------------
Q9CGU3_LACLA/8-142..W.QLIFATGGM-------------------------------------------------------------------
F2I5F0_AERUA/1-152..L.SIIHTTGGM-------------------------------------------------------------------
R7N6H8_9FIRM/8-144..A.ERLVGGGGM-------------------------------------------------------------------
C1FDH6_MICCC/170-303..W.RVMFDSGGM-------------------------------------------------------------------
R6SUP5_9CLOT/9-142..LNSLLFGSGGM-------------------------------------------------------------------
Q7U880_SYNPX/15-147..P.AVLIETGGM-------------------------------------------------------------------
A5GM29_SYNPW/13-145..P.QVLIETGGM-------------------------------------------------------------------
Q2JKH6_SYNJB/6-142..L.RVLVETGGM-------------------------------------------------------------------
F2JMF4_CELLD/8-142..W.SKLWASGGM-------------------------------------------------------------------
E6SHJ0_THEM7/12-146..PKAALVKAGGM-------------------------------------------------------------------
K9S6R1_9CYAN/8-143..L.RALVETGGM-------------------------------------------------------------------
E3PRG0_CLOSD/8-144..A.SRFVGSGGM-------------------------------------------------------------------
R5N6N4_9CLOT/8-137..I.ERILGAGGM-------------------------------------------------------------------
B1YKA4_EXIS2/4-132..L.EIMFASGGM-------------------------------------------------------------------
R5GZB8_9FIRM/8-144..P.ERLVGSGGM-------------------------------------------------------------------
D5WTV2_KYRT2/8-146..W.RLAFCSGGM-------------------------------------------------------------------
R6PRB8_9FIRM/8-139..L.NLIMSSGGM-------------------------------------------------------------------
E6UEQ9_RUMA7/8-144..I.TRLFGDGGM-------------------------------------------------------------------
C1N1Q0_MICPC/8-144..P.SLALASGGF-------------------------------------------------------------------
L0A6P8_DEIPD/5-141..P.DKFMETGGM-------------------------------------------------------------------
M1E7F3_9FIRM/5-139..L.RHLTEAGGM-------------------------------------------------------------------
R6USA8_9FIRM/5-142..V.HQCIACGGF-------------------------------------------------------------------
A9SA98_PHYPA/3-154..W.KLIYKSGGM-------------------------------------------------------------------
E3DMH7_HALPG/3-133..F.YTFFTSGGM-------------------------------------------------------------------
E4U9L1_OCEP5/5-141..W.ERLLESGGM-------------------------------------------------------------------
E8N0A2_ANATU/6-140..W.GLWFSSGGM-------------------------------------------------------------------
K9SNJ2_9CYAN/8-142..L.RVLFETGGM-------------------------------------------------------------------
F0T097_SYNGF/8-149..F.RLIFSSGGF-------------------------------------------------------------------
A8FH06_BACP2/4-149..W.SLITSTGGM-------------------------------------------------------------------
A9SE32_PHYPA/36-170..W.KMLVGSGGM-------------------------------------------------------------------
I0JQ19_HALH3/6-151..P.SLAFSTGGM-------------------------------------------------------------------
R5SAC8_9GAMM/12-144..L.RLFTTTGGM-------------------------------------------------------------------
M4FCC5_BRARP/76-227..F.RTALQAGGF-------------------------------------------------------------------
G8LW53_CLOCD/8-141..F.TRFIGSGGM-------------------------------------------------------------------
C8WVG2_ALIAD/12-152..W.SRVFGAGGM-------------------------------------------------------------------
R5ADD7_9CLOT/7-149..R.QRLAGAGGM-------------------------------------------------------------------
D4K6A9_9FIRM/9-148..L.ERMWGDGGM-------------------------------------------------------------------
K3YAI4_SETIT/11-145..A.RQFIASGGM-------------------------------------------------------------------
R7F8Q2_9CLOT/8-142..F.KRILGAGGM-------------------------------------------------------------------
A3DDN6_CLOTH/8-143..F.TRFIGSGGM-------------------------------------------------------------------
K9Z2J9_CYAAP/8-142..F.RYIVSTGGM-------------------------------------------------------------------
K9P352_CYAGP/15-157..P.AVLVETGGM-------------------------------------------------------------------
K9XC51_9CHRO/8-143..M.RVLVTTGGM-------------------------------------------------------------------
R6Y7H0_9FIRM/7-149..R.QRLAGAGGM-------------------------------------------------------------------
E1RAI3_SPISS/5-141..L.RRMGETGGM-------------------------------------------------------------------
X2GPK1_9BACI/6-151..W.GLFTSTGGM-------------------------------------------------------------------
R5R4Q1_9FIRM/8-145..W.ERLVGDGGM-------------------------------------------------------------------
Q7V118_PROMP/8-139..F.EIMFETGGM-------------------------------------------------------------------
B8E2Q0_DICTD/12-146..W.RAFFEWGGM-------------------------------------------------------------------
K4KZ53_9FIRM/8-148..F.DLLTSSGGF-------------------------------------------------------------------
R6EV23_9FIRM/8-145..A.ERLVGSGGM-------------------------------------------------------------------
D6Y193_BACIE/4-149..W.GLLTSTGGM-------------------------------------------------------------------
F5WQX5_ERYRF/7-143..L.SMIFESGGF-------------------------------------------------------------------
C4L0Z0_EXISA/3-131..I.EIMFASGGM-------------------------------------------------------------------
D7GPW8_9FIRM/6-142..P.ERVFGSGGM-------------------------------------------------------------------
D5E1E4_BACMQ/2-142..M.RMIAASGGM-------------------------------------------------------------------
A4J281_DESRM/9-144..W.DRFIEAGGM-------------------------------------------------------------------
I0JIT0_HALH3/2-142..V.KQVATTGGM-------------------------------------------------------------------
E1Z6N1_CHLVA/1-136..F.TRLVSSGGM-------------------------------------------------------------------
D3PLN0_MEIRD/5-141..W.ERLAETGGM-------------------------------------------------------------------
Q8DMU2_THEEB/9-144..F.RVLVETGGM-------------------------------------------------------------------
A4RUH5_OSTLU/12-147..Y.SRIVGSGGM-------------------------------------------------------------------
Q5L0A2_GEOKA/2-142..W.RLFFETGGM-------------------------------------------------------------------
W1NTD9_AMBTC/34-169..A.KRLLGSGGM-------------------------------------------------------------------
K8EPQ0_CARML/4-150..W.ALAVSTGGM-------------------------------------------------------------------
C6CSF5_PAESJ/6-132....KQRVGNGGF-------------------------------------------------------------------
G2TKM5_BACCO/4-146..W.RMAFSTGGM-------------------------------------------------------------------
K9TPQ7_9CYAN/8-143..F.RVLVETGGM-------------------------------------------------------------------
N0B1X3_9BACI/2-142..P.EMFFSTGGM-------------------------------------------------------------------
V5WJH0_9SPIO/5-132..P.SYLATAGGM-------------------------------------------------------------------
C9RC18_AMMDK/8-140..W.EWLYADGGM-------------------------------------------------------------------
L7VUG0_CLOSH/9-141..F.RKLIGSGGM-------------------------------------------------------------------
R5J5K1_9FIRM/8-139..L.TRIITSGGM-------------------------------------------------------------------
C1E358_MICCC/7-142..Y.GRLVGSGGM-------------------------------------------------------------------
R7MBM3_9CLOT/16-148..F.KIFSTTGGM-------------------------------------------------------------------
R6B6R3_9CLOT/12-145..I.RRLWGAGGM-------------------------------------------------------------------
A5GRZ6_SYNR3/9-137..P.AVLIETGGM-------------------------------------------------------------------
R7B1C9_9CLOT/8-144..P.ERLVGSGGM-------------------------------------------------------------------

PF10261

Q5KDG2_CRYNJ/99-376--GDRIIALTGGNCALPLPPSISP.ILARHTFGKLFTAGPQGSSGQEKIYIALP..........................
G2QCT9_MYCTT/113-344--IDRGFRWSGGKCEVAEE...........VVRQGEAG..........TKEVVT..........................
E3RV27_PYRTT/85-309--IDRGFRFTGGQCEL..................L..RKPDAREDMSNTREYIT..........................
R7YND5_CONA1/92-324--IDRGFLLTGGQCEL..................I..KDPGAREEMSNTREYVT..........................
G2XHJ1_VERDV/98-323--IDRSFRWTGGRCEVVVD...........KVQDGDAD..........VGEFVS..........................
C4Y4H3_CLAL4/57-287--MDKVFVLTGGKCASVSAE.........KLARLTESLHLFTLVDGVYESSAIS..........................
C5DQ74_ZYGRC/35-359--MDLIFLATGGLCR....................FDVLDADGN....LNSSFQDSDSRKSRSLSKIYSFLVRFQLTTQD
G8BYR0_TETPH/33-386--MDLCFVFTGGSCN....................FEIFDESNA....INIKFQDSEYRKLKSLKRIYKILKDYKESYIE
E3KJ35_PUCGT/96-348--IERVLILSGAKCIPSL..............KPF.....HSSETTPTTPTTLE..........................
N1RPR7_FUSC4/66-290--IDRGFRWTGGRCELARR...........EVEFGSDT..........VGDKVT..........................
F9WXZ1_ZYMTI/84-317--IDRSFRWTGGQCQVI...............YGNSLADQKEREEMNDVREVFT..........................
G3BAX8_CANTC/92-323--MDKIFLWTGGRCVSVAED..........RLAHHSEFFNKVED..LYESTVVG..........................
G8BIE7_CANPC/69-321--MDKIFVLTGGVCVLEPHPTTQTTPPSTIANHALGQSFLQDLETLVWKSKDVS..........................
C5FE12_ARTOC/64-296--IDRGFLATGGRCELI................QQKGLLEDPSRPGLNPALVLS..........................
G8ZXV3_TORDC/32-356--MDLIFTLTGGSCK....................FDVFDERGR....LSSLFHDTFPRRIRSLERIYHLLKKKPAHDEL
A5DKF9_PICGU/56-288--MDKVFVYTGGKCANVSSA..........AVAGMEAFFTATSSPAVYESNKIT..........................
E3QPL9_COLGM/87-312--IDRSFRWTGGKCELVED...........KIKMGEGD..........AKEFFT..........................
S3CVS7_OPHP1/100-357--IDRSFRLTGGGCEALQALA.......DEIEAEAVQQGRAGSTSAQFLNAASS..........................
A3LYM5_PICST/59-299--MDKVFVYTGGSCVIEKETHPGQSRFLHLFEAAGEEVGNKLS......STSIT..........................
G0WG33_NAUDC/40-380--MDLIFLMTGGLCN....................FDVFNIASDGKIELNLEFQDNSTRRMKSLNKIYKILKRTQRDATG
M3IZX9_CANMX/56-283--MDKIFVWTGGKCKIDITNH........DVNHVHSSFIHSLEN..IWESTGIT..........................
G3JBH7_CORMM/90-318--IDRGFRWTGGQCQLAEL...........DVAAGTAD..........AGAVLT..........................
R9AQ78_WALI9/64-296--LHRLWLMTGAQCVI.................EDINAGIEGGTPATPLLVPVN..........................
C5E2P1_LACTC/32-359--MDLVFTATGGRCS....................FEVFDLSDSPTWGINEKFHDTFSRRQSSLQKLYNALKKGAQNPPS
T0K1V0_COLGC/87-312--IDRGFRWTGGKCEIIEE...........KVELGEGD..........AKEVFT..........................
G8Y1H9_PICSO/62-313--MDKVFVWTGGKCQKVAEKELL....RHFPGALKDKFFSPSSDGESFEASSIT..........................
C5G9K2_AJEDR/75-292--IDRSFIATGGRCE....................KSIAPGSTDSISELAVVLT..........................
C5MI48_CANTT/55-284--MDKIFIWTGGKCKIEGIEI.......KNINHLHNSFIQTLEN..IWESTGIT..........................
N1Q4W5_DOTSN/87-323--VDRSFRWTGGKCEQV...............AYDDADDLARKVEAGDLKEIIT..........................
S3DE95_GLAL2/81-314--IDRSFRLTGGQCEL..................V.EQADKGHIEMDDTRQFVT..........................
R9P3R6_PSEHS/103-383--SERILTATGAVCV............................PSSNPGQSPVE..........................
N1Q6I4_PSEFD/84-317--IDRSFRWTGGKCNQ..................VLSDTLDEKMERGDVKEVFS..........................
K2R4W1_MACPH/94-328--IDTLFRFTGGQCEL..................V..RDPAARESMSDAREYIT..........................
N1QNJ0_SPHMS/101-335--VDRSFRWTGGRCSQ..................VLATGLTEKMEQGDAKDVFT..........................
F7WC52_SORMK/81-344--VDRGFRVTGGKCAVAQAKVN......EQVKADSIPGPVGADVDVAGFKEFVT..........................
M2N8T6_BAUCO/89-327--VDRSFRWTGGKCETI...............LSDSAASQAEKADMGEVERAFT..........................
K9G927_PEND2/67-311--VDRGFVATGGKCEQA...............LEEVGKMAAGQSSPTGLETLFT..........................
C4R337_KOMPG/57-293--MDRLFVFTGGKCSNIPTIQAE...RYIQRFPAFREFFSKKDSEPLVQEAIIS..........................
A1CR84_ASPCL/74-313--IDRGFVVTGGKCEEIL.............RETPVEVVEREGSVSRGLERLFT..........................
A5E4A1_LODEL/62-350--MDKIFVVSGGACVIEPPQFAASQQKISNSQHLFGK.FIQDLETLVWRSSSVS..........................
U1G5N5_ENDPU/81-322--IDRSFTSTGGRCVP..................RHHGKVDSLAEGIELSSVAT..........................
E5R3U3_ARTGP/64-297--IDRGFLATGGKCEI..................TQQVFDDRSQAELPPTVVLT..........................
K1WMV9_MARBU/113-341--IDRGFMLTGGQCEL..................V.AQADVGDIEMDNTRQLVT..........................
G0VEA6_NAUCC/39-386--MDIIFLLSGGKCQ....................FDVFDLEHDGS..LNESFQNVLGDQWRRRHKAWSRIYQFLSKFDS
Q6FR77_CANGA/32-368--MDLIFKYSGGSCN....................FDIYDSDGN....VNLKFQDSWRRRIKSWRMIYDKVKDYQKNGKN
E9EF85_METAQ/84-313--IDRGFRWTGGKCDVAER...........DVLQGSSD..........MGEAFT..........................
R8BRZ8_TOGMI/87-311--IDRSFRFTGGKCEVARV...........EVEEGDPS..........KADFVT..........................
M9LJJ3_PSEA3/95-341--AERILTATGAVCV............................PSSNAGLGKVE..........................
M1VZ69_CLAP2/82-312--IDRGFRWTGGRCDLVQQ...........EIRMGDAG..........VGDILT..........................
V5GE99_BYSSN/78-302--VDRSFVLTGGRCE....................DVRPRTPGSTASELNAVFT..........................
I2FTC6_USTH4/101-374--SERILTATGAVCV............................PSGDPQSSPVE..........................
G8JR11_ERECY/38-363--MDLVFKLTGGHCS....................FDVFDQAMV....VSEKFQDSEPRRLGSLKKLVKWFSERRDGNAG
Q6BUP0_DEBHA/108-353--MDKVFVWTGGKCTGIAQEKLA....LHIPSYGTSSIFTEIESDLSYESKAIT..........................
Q4WJI3_ASPFU/73-304--IDRSFVITGGKCERVVAE..........TSGNPAVAVAQAGSVSAGLEKLFT..........................
G2R9R1_THITE/97-341--IDRGFRWTGGKCEAVAT...........VVGEGREGPSPA....GVVKEVLT..........................
I4YGQ8_WALMC/41-264--LHRIWLITGAQCV....................REEDNLEGTPATPLLVPVN..........................
G2XPX9_BOTF4/55-288--IDRGFVITGGQCEL..................V.DAAEKGKIDMDNTRQFLT..........................
G3AEN0_SPAPN/55-285--MDRIFVLTGGKCVVEDPGR........HVKLFA......NLGNGKSVSSTIS..........................
C7Z7P3_NECH7/60-283--IDRGFRWTGGRCELARR...........EIEMGDSG..........LGEMVT..........................
E7KCE6_YEASA/33-370--MDLVFVYTGGHCH....................YDVFDDAGH....VNEDFQGSVTRTNRALALIHNVLTLHGHHQEH
G3YDY9_ASPNA/76-295--IDRSFVLTGGKCE...................QAVPLAENEPAAADVKTLLT..........................
L8FY78_PSED2/112-347--IDRGFLLTGGMCEL..................K.DMIDRVETEVNIVERFVT..........................
A7TR39_VANPO/62-394--MDIWFVYTGGVCS....................FDVFDDLGG....ANITFQDTSSRRVKAIKKLYSILLKNTDGVAT
N1JKB0_BLUG1/90-317--IDRGFKYTGGHCEL..................V.AMNGSDSIHIGEKVIFLT..........................
B6Q6E7_TALMQ/81-304--IDRMFVITGGKCERLP..............AVI......PDDTWEGVKVILT..........................
B8M5R8_TALSN/84-316--IDRTFVITGGKCERL................PAAMANADDNTAWEDLKVVFT..........................
C8V5A4_EMENI/56-278--IDRSFVITGGKCEDALS...........ELNNVRNEKGVIGAGVEDFGIYLT..........................
G0T001_RHOT2/1044-1290--TFRILRSSGAVCVPSAL...........SSEAIAQAGQGGLHADGPHDAAAP..........................
Q6CKM7_KLULA/25-334--MDLVFLNSGGICS....................FDIFSTDGN.EQTLNLQFHDNEFRRLRGIRRMLNWLGNVHGSETL
Q75EB2_ASHGO/35-359--MDQVFTSTGGHCS....................FDVFDTGMG....LNSGFHDSEGRRTRSLQKLLQWFTAHGAQGDE
M7SYX4_EUTLA/110-375--IDRGFRFTGGRCEVALA...........AVSSSSSSSSDSVSAGADTKDVFT..........................
E9CZW5_COCPS/67-291--IDRSFTATGGRCE......................RIHASGMKEAISDSIMT..........................
F0XPI2_GROCL/81-317--SDRSFRLTGGSCQADG.............GLGVAEATSAAATAAASLAAVAV..........................
A7UX33_NEUCR/112-389--VDRGFRVTGGKCQEAQGRVN......AQVKADAMPGPVGSNVEVAGLKEFVT..........................
J3NLN2_GAGT3/91-336--IDRGFRYTGGKCEEAEQ...........KVRGADNYAAS.......PVDIFS..........................
A7EQ03_SCLS1/55-288--IDRGFIITGGQCDM..................V.DAAEKGHVDMDDTRQFLT..........................
G9NCA4_HYPVG/72-300--IDRSFRWTGGKCELAQR...........EVAMGDGS..........VKEMLT..........................

PF01569

Q29NI1_DROPS/70-187---------------------------------------------------------------.................
A4I568_LEIIN/102-249---------------------------------------------------------------.................
DOPP1_DICDI/54-178---------------------------------------------------------------.................
Q17D95_AEDAE/56-197---------------------------------------------------------------..............TCE
G6PC3_MOUSE/53-195---------------------------------------------------------------................S
A0BM37_PARTE/91-226---------------------------------------------------------------.................
Q23FV4_TETTS/102-237---------------------------------------------------------------.................
A0EE96_PARTE/81-240---------------------------------------------------------------.................
A8FE89_BACP2/71-198---------------------------------------------------------------.................
A0LYQ4_GRAFK/59-183---------------------------------------------------------------.................
Q7MUE1_PORGI/58-185---------------------------------------------------------------.................
A0K0K5_ARTS2/118-241---------------------------------------------------------------.................
A4XP73_PSEMY/98-234---------------------------------------------------------------...............MK
A4X1H8_SALTO/101-242---------------------------------------------------------------................P
Q9EWX3_STRCO/115-237---------------------------------------------------------------.................
A1BJZ6_CHLPD/56-185---------------------------------------------------------------.................
A4FQA0_SACEN/76-196---------------------------------------------------------------.................
B0U8C7_METS4/61-186---------------------------------------------------------------.................
A1S1V4_SHEAM/77-196---------------------------------------------------------------.................
A1W5E3_ACISJ/72-191---------------------------------------------------------------.................
A5CF96_ORITB/78-203---------------------------------------------------------------.................
B4U5Z7_HYDS0/54-171---------------------------------------------------------------.................
A5DBA1_PICGU/102-232---------------------------------------------------------------.................
Q4D544_TRYCC/102-225---------------------------------------------------------------.................
SSPA_DICDI/88-218---------------------------------------------------------------.................
Q32GQ5_SHIDS/77-232---------------------------------------------------------------QLAEEKNIPQYLRSHWQ
Q9CMX4_PASMU/75-237---------------------------------------------------------------FYQTKSDTPNWLKNHYE
Q21JU9_SACD2/110-231---------------------------------------------------------------.................
C1DG09_AZOVD/106-238---------------------------------------------------------------..............GEN
Q0K1U6_CUPNH/103-229---------------------------------------------------------------.................
Q65GX3_BACLD/179-304---------------------------------------------------------------.................
Q2IJN8_ANADE/141-265---------------------------------------------------------------.................
Q6FEM9_ACIAD/65-182---------------------------------------------------------------.................
A1K7H5_AZOSB/105-237---------------------------------------------------------------.................
Q3SNT4_NITWN/91-218---------------------------------------------------------------.................
Q6MBQ7_PARUW/87-223---------------------------------------------------------------................S
A8EX54_ARCB4/94-229---------------------------------------------------------------.................
Q87X15_PSESM/102-231---------------------------------------------------------------.................
Q03CR8_LACC3/177-306---------------------------------------------------------------.................
R5ZI70_9ACTN/141-283---------------------------------------------------------------............AAGVI
A8BDI5_GIAIC/110-282---------------------------------------------------------------...............GP
A8BQZ4_GIAIC/121-285---------------------------------------------------------------..............LGR
Q6MTZ1_MYCMS/144-270---------------------------------------------------------------.................
R5TP42_9FIRM/95-216---------------------------------------------------------------.................
A3LWS4_PICST/248-396---------------------------------------------------------------...............VY
Q127S7_POLSJ/95-224---------------------------------------------------------------.................
A4CJ32_ROBBH/299-448---------------------------------------------------------------.................
Q2HER5_CHAGB/260-418---------------------------------------------------------------...............PL
A8L0R7_FRASN/276-428---------------------------------------------------------------...............LV
Q4YWD7_PLABA/107-241---------------------------------------------------------------................F
Q6NJR5_CORDI/194-319---------------------------------------------------------------.................
A1SKJ7_NOCSJ/98-218---------------------------------------------------------------.................
Q82Z33_ENTFA/85-204---------------------------------------------------------------.................
A2DYB5_TRIVA/98-241---------------------------------------------------------------................A
A2EZZ9_TRIVA/91-236---------------------------------------------------------------.............DELK
A4H9E7_LEIBR/233-378---------------------------------------------------------------................A
Q6BYN9_DEBHA/112-272---------------------------------------------------------------D.......SVGPSLHIL
A7EIU4_SCLS1/134-294---------------------------------------------------------------........ICTGDEDEI
A7TF94_VANPO/122-266---------------------------------------------------------------.............QANK
Q2TYI3_ASPOR/35-224---------------------------------------------------------------LV.....RASICQNTDA
A2EQG2_TRIVA/90-230---------------------------------------------------------------...............QL
PLPR5_MOUSE/122-275---------------------------------------------------------------..............DLI
Q9VNU2_DROME/65-225---------------------------------------------------------------C......TNNNLSTRQI
A8WXP5_CAEBR/128-286---------------------------------------------------------------.........TNPNPRKI
A6X217_OCHA4/121-242---------------------------------------------------------------.................
Q5NGF4_FRATT/116-236---------------------------------------------------------------.................
Q5ZX13_LEGPH/91-208---------------------------------------------------------------.................
Q6MH55_BDEBA/105-226---------------------------------------------------------------.................
B4S7E2_PROA2/140-261---------------------------------------------------------------.................
Q7NZZ5_CHRVO/815-932---------------------------------------------------------------.................
Q0SBZ7_RHOJR/226-347---------------------------------------------------------------.................
Q89JR9_BRADU/79-199---------------------------------------------------------------.................
B7VND8_VIBTL/235-351---------------------------------------------------------------.................
Q5E4L0_VIBF1/241-366---------------------------------------------------------------.................
Q9RVR6_DEIRA/14-135---------------------------------------------------------------.................

PF14378

Q5K8D7_CRYNJ/128-311-----------------------------------.....YEEFGYIDTLHTGKAAS...................IWTT
B0UG28_METS4/124-315-----------------------------------....GLAPPDPDSVETVGALWHLH.....PLAQLRAGSLRVIALQ
A1SJR6_NOCSJ/50-230-----------------------------------.......DPDLVDTVTESSHAY..................RVLQP
C5APU7_METEA/131-322-----------------------------------....EPQAYPQGHLETVGALWHLD.....ALQALRDGTLSTIALS
E4NIW3_KITSK/45-228-----------------------------------.......LPGAVDVVARYDVLS................GADGGAG
Q989C0_RHILO/119-308-----------------------------------....RPAPSLFDHFTNAG.LSHAA.....TVDALRSGAPFDFLIS
G8WRV6_STREN/158-347-----------------------------------.....PAAAGFQDTMAHFSHLG..........WWGADAS.APQGL
C7QD07_CATAD/71-251-----------------------------------......VKAHLVDTALYFHQSV..................YGPMN
Q1D5Z1_MYXXD/96-274-----------------------------------......................LV.....DAFDGPLQGTLAPLLD
Q2G5H1_NOVAD/115-305-----------------------------------....NIPLERAPYLDRLFPWETGI.....KIEKLRLGYLRDVTSE
U4LB32_PYROM/137-324-----------------------------------....EEDGYGFVDTVHVGKVSS...................VWTS
Q1IHV8_KORVE/153-330-----------------------------------....KTFPMLAVPAGEIARLVP.....................GP
F2R3P1_STRVP/39-228-----------------------------------.....DPAYGFTDTMAHFSAYG..........WWGGEAS.APRGL
A9HHP2_GLUDA/131-314-----------------------------------.....S............SAGHVKYSYIDSFMALRNGHNPPFILN
Q13PQ7_BURXL/110-293-----------------------------------.....G.......IHDPGTASTVS.....DFGLFRTGQARELNLS
R6XNQ9_9FIRM/3-178-----------------------------------......................F........FDTNSDFYSWWLQA
Q63V72_BURPS/125-308-----------------------------------.....R.......VADPIALAGVS.....DFVRLRDGTLRVIDPA
Q01VD1_SOLUE/159-330-----------------------------------....PTYPIPPAVVQAGAVLLA.......................
D1CA82_SPHTD/53-235-----------------------------------......PYNGFVDTLALYGKVN.................YDQPSV
K0K1I4_SACES/40-223-----------------------------------.......QPGIVDYLATHDILF................SAESRVP
D1C524_SPHTD/53-234-----------------------------------......PELGFVDTVKLFTSTN.................YDAHAD
W5TLL4_9NOCA/53-242-----------------------------------.....ESASGFVDVMALHSSVG..........WWEGDAS.APRGL
D3HTE9_LEGLN/101-283-----------------------------------................ASVLNSDLFSISQIATGLKFQQIHHYINP
Q2JBQ4_FRASC/47-236-----------------------------------......TGTSYVDTMSHFEGWG..........WWSGSASAAPDGL
W0BEC4_9GAMM/94-276-----------------------------------................ASVIDSPLFFEAQRATGLKFQQIHSYIQP
Q220L9_RHOFT/109-292-----------------------------------AGPFDLSS..............LS.....HFELLRDGRMRDIPLR
G2P916_STRVO/51-241-----------------------------------.....EGGHGFVDTMAQYRSYG..........WWGADAS.APRGL
Q87M50_VIBPA/146-355-----------------------------------..............EQSTFLENVGAFPLWALQTQDYLWQGYVTQV
B1LSY3_METRJ/129-320-----------------------------------....APRVVPSEPLETVGALWHLE.....PVARLRAGTLHTLALG
A2BL06_HYPBU/51-224-----------------------------------IERPPNLVLKLVELVMGARIDP.......................
L0PFU2_PNEJ8/5-201-----------------------------------N.VYGNQPANYTMEGSAGGLAR............IDGFFGTKLYT
C9Z2S2_STRSW/63-253-----------------------------------.....DPSHGFVDTMAQYSSWG..........WWGGEAS.APRGL
B9L518_THERP/33-215-----------------------------------......PWRGFVDTLALMRGVN.................YDHPGI
E3JAH2_FRASU/94-282-----------------------------------......HGAGFHDTMAQVSDWG..........WWDDDAS.APRGL
F8AWV4_FRADG/47-236-----------------------------------......PSAGFIDTMASFHNWG..........WWAGDSSAAPKGL
R7Y200_9ACTN/124-318-----------------------------------.................................DSLFYARKGVVR
A0LS47_ACIC1/69-252-----------------------------------......PGSDFADIVAANHPPG................TWGTAAV
E2Q4K3_STRC2/45-234-----------------------------------.....DAKHGFVDTMAQYSSYG..........WWGAEAS.APRGM
F8J559_HYPSM/123-309-----------------------------------....NFKSSDFPSVIVPAAWVAPG.....ITDGLRNGD......H
L0ET54_LIBCB/102-293-----------------------------------....HIDPDTLKNIDSFYVYHFLQ.....QFDAVRDQSPFHLLFR
Q89QL0_BRADU/109-300-----------------------------------....HLSAVDSPAIVPMTRDLPLP.....VFFGLRDGTFRHLVAE
B1VW42_STRGG/49-238-----------------------------------.....DASHGFVDTMAQYSAYG..........WWGEGAS.APRGL
C5AQ48_METEA/107-294-----------------------------------.....G........PDEAHLLFQGATPLVDLHALRDGTMRALPLN
H0PVV4_9RHOO/74-256-----------------------------------....NIELARAVH.........LP.....HLLNLLAGTQAGFSFD
E3EJC2_PAEPS/1-162-----------------------------------.....................................FVGHSVIQ
G0HGL8_CORVD/79-265-----------------------------------......DGEGFVDIMAKTGTWG..........WWPESGTPAS...
A1SDU3_NOCSJ/130-324-----------------------------------.................................ESLAYGRNNVYW
C7QBQ6_CATAD/84-272-----------------------------------......ENGNFVDTFKLLNPWG...........QTSATSDGVAGL
A1SHK3_NOCSJ/128-322-----------------------------------............FASAPEEFAGLRPTAISATQVKYLAERAHFLAD
E3J0M0_FRASU/110-299-----------------------------------......PNAGFIDTMSRFSNYG..........WWSASASAAPHGL
C8XDB0_NAKMY/22-205-----------------------------------.......LPGIVDIVAQHDLFG................NDTSRDL
G7XGU5_ASPKW/117-299-----------------------------------.....PEEYGFIDVLHSNAGGS...................AWTQ
N0BE90_9RHIZ/119-305-----------------------------------....HFTPADFPDAINVMPWEQPK.....FIEGLRAGS......R
B1LVV6_METRJ/99-290-----------------------------------....GLSPADFPNLHPAASYVHVA.....DLTGLRDGTLRTINLD
Q5ZV46_LEGPH/101-283-----------------------------------................ASELQSSLFAPEQIATGLKFHQIHNYIHP

PF14360

SLS2_TRYB2/201-275--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
A9RPY7_PHYPA/269-340--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
Q4YWD8_PLABA/201-272--------------------------------------------------------------------------------
B3L7G0_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
A9SUW6_PHYPA/174-246--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
Q17C33_AEDAE/230-303--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
C5KN45_PERM5/142-213--------------------------------------------------------------------------------
C5L5L1_PERM5/146-217--------------------------------------------------------------------------------
SMSR2_CAEEL/246-319--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
C5KL60_PERM5/83-154--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
C5LU78_PERM5/899-971--------------------------------------------------------------------------------
C5KY50_PERM5/57-128--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
A0A0H5S654_BRUMA/218-291--------------------------------------------------------------------------------
F8W5G6_DANRE/232-307--------------------------------------------------------------------------------
F6UTK5_XENTR/280-353--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
J9FFV7_WUCBA/189-261--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------

PF02681

F2NNY3_MARHT/5-141--------------------------------------------------------------------------------
K9T6M6_9CYAN/8-143--------------------------------------------------------------------------------
D4ZTL8_ARTPN/8-143--------------------------------------------------------------------------------
K9WGM7_9CYAN/8-143--------------------------------------------------------------------------------
B7GI74_ANOFW/24-164--------------------------------------------------------------------------------
B1WS33_CYAA5/8-143--------------------------------------------------------------------------------
R5AEV3_9CLOT/9-146--------------------------------------------------------------------------------
Q31Q62_SYNE7/9-145--------------------------------------------------------------------------------
R5XG63_9CLOT/5-137--------------------------------------------------------------------------------
D4JCM8_9FIRM/8-144--------------------------------------------------------------------------------
W0E929_9FIRM/8-143--------------------------------------------------------------------------------
D3FYY4_BACPE/4-149--------------------------------------------------------------------------------
F0RVM2_SPHGB/6-143--------------------------------------------------------------------------------
H6NB79_9BACL/2-142--------------------------------------------------------------------------------
Q7V6P1_PROMM/15-147--------------------------------------------------------------------------------
Q18B69_PEPD6/8-140--------------------------------------------------------------------------------
G0GF41_SPITZ/9-149--------------------------------------------------------------------------------
Q65FE5_BACLD/4-149--------------------------------------------------------------------------------
U5LF62_9BACI/2-142--------------------------------------------------------------------------------
R7L0C2_9FIRM/5-149--------------------------------------------------------------------------------
Q5WDV5_BACSK/4-146--------------------------------------------------------------------------------
D6GSF2_FILAD/8-144--------------------------------------------------------------------------------
E6U5K5_ETHHY/8-143--------------------------------------------------------------------------------
Q5SJ95_THET8/4-140--------------------------------------------------------------------------------
R5GK39_9FIRM/5-157--------------------------------------------------------------------------------
Q9RSQ8_DEIRA/8-143--------------------------------------------------------------------------------
P73185_SYNY3/8-143--------------------------------------------------------------------------------
D1AKQ0_SEBTE/7-143--------------------------------------------------------------------------------
E0RXA3_BUTPB/8-144--------------------------------------------------------------------------------
F5YE41_TREAZ/16-155--------------------------------------------------------------------------------
V5WEJ9_9SPIO/6-144--------------------------------------------------------------------------------
U5LHE7_9BACI/5-149--------------------------------------------------------------------------------
K9XWG4_STAC7/8-143--------------------------------------------------------------------------------
E6U2C7_BACCJ/4-149--------------------------------------------------------------------------------
R7M7X6_9CLOT/12-143--------------------------------------------------------------------------------
K9V3M2_9CYAN/8-143--------------------------------------------------------------------------------
B9IAH9_POPTR/38-171--------------------------------------------------------------------------------
M0RZC5_MUSAM/20-155--------------------------------------------------------------------------------
R5ZD30_9FIRM/8-146--------------------------------------------------------------------------------
R6Q3Q8_9FIRM/8-138--------------------------------------------------------------------------------
F4GLJ1_SPHCD/5-141--------------------------------------------------------------------------------
C0ZKP9_BREBN/5-150--------------------------------------------------------------------------------
D8TLE7_VOLCA/33-168--------------------------------------------------------------------------------
D4JU78_9FIRM/7-157--------------------------------------------------------------------------------
K9YEC7_HALP7/8-143--------------------------------------------------------------------------------
K3XML5_SETIT/24-159--------------------------------------------------------------------------------
K9RII7_9CYAN/8-143--------------------------------------------------------------------------------
K4LIZ6_THEPS/40-169--------------------------------------------------------------------------------
E6TWS5_BACCJ/5-142--------------------------------------------------------------------------------
R6V5P2_9CLOT/18-171--------------------------------------------------------------------------------
Q73MW8_TREDE/10-150--------------------------------------------------------------------------------
Q8Y4P9_LISMO/4-149--------------------------------------------------------------------------------
M0SK26_MUSAM/139-272--------------------------------------------------------------------------------
I0GIV6_CALEA/8-146--------------------------------------------------------------------------------
A9TH33_PHYPA/30-165--------------------------------------------------------------------------------
G4KW10_OSCVS/4-137--------------------------------------------------------------------------------
R5CL70_9FIRM/8-147--------------------------------------------------------------------------------
I0I5M8_CALAS/5-139--------------------------------------------------------------------------------
D7CKU8_SYNLT/12-144--------------------------------------------------------------------------------
R7IRJ9_9CLOT/8-142--------------------------------------------------------------------------------
B8HXR8_CYAP4/8-143--------------------------------------------------------------------------------
B0C3J0_ACAM1/8-143--------------------------------------------------------------------------------
I4DAH9_DESAJ/3-144--------------------------------------------------------------------------------
Q46K07_PROMT/15-148--------------------------------------------------------------------------------
R7A3G1_9CLOT/8-142--------------------------------------------------------------------------------
Q24V03_DESHY/8-143--------------------------------------------------------------------------------
K9VPU0_9CYAN/9-144--------------------------------------------------------------------------------
D1BMJ6_VEIPT/9-146--------------------------------------------------------------------------------
Q10X44_TRIEI/8-143--------------------------------------------------------------------------------
A4RZ57_OSTLU/3-142--------------------------------------------------------------------------------
D8QR56_SELML/24-159--------------------------------------------------------------------------------
K4AZY7_SOLLC/140-274--------------------------------------------------------------------------------
Q8ENX8_OCEIH/4-149--------------------------------------------------------------------------------
K7V114_MAIZE/48-182--------------------------------------------------------------------------------
D4IXN8_BUTFI/8-143--------------------------------------------------------------------------------
Q01ES7_OSTTA/128-261--------------------------------------------------------------------------------
E3HA83_ILYPC/7-143--------------------------------------------------------------------------------
V5RVF1_9BACT/5-132--------------------------------------------------------------------------------
A6TR41_ALKMQ/8-144--------------------------------------------------------------------------------
I1KRZ5_SOYBN/9-144--------------------------------------------------------------------------------
R5KDM7_9CLOT/8-150--------------------------------------------------------------------------------
R7I9S8_9FIRM/10-145--------------------------------------------------------------------------------
R6BY11_9CLOT/8-144--------------------------------------------------------------------------------
R5ITD2_9FIRM/8-144--------------------------------------------------------------------------------
K9RQD3_SYNP3/8-143--------------------------------------------------------------------------------
K9SVF9_9SYNE/8-143--------------------------------------------------------------------------------
Q7VBG6_PROMA/16-148--------------------------------------------------------------------------------
O83188_TREPA/14-153--------------------------------------------------------------------------------
G8QY16_SPHPG/6-143--------------------------------------------------------------------------------
D3EMZ3_ATETH/8-144--------------------------------------------------------------------------------
R5TH29_9CLOT/11-163--------------------------------------------------------------------------------
A9TSJ4_PHYPA/1-141--------------------------------------------------------------------------------
R5YWD2_9CLOT/9-140--------------------------------------------------------------------------------
M0SG02_MUSAM/22-157--------------------------------------------------------------------------------
F5YMS6_TREPZ/16-155--------------------------------------------------------------------------------
R7J8Q8_9FUSO/12-143--------------------------------------------------------------------------------
R7R6N9_9FIRM/8-144--------------------------------------------------------------------------------
C7NE60_LEPBD/7-143--------------------------------------------------------------------------------
R5IDQ6_9CLOT/2-138--------------------------------------------------------------------------------
D9R8M4_CLOSW/8-144--------------------------------------------------------------------------------
D7BAF5_MEISD/5-141--------------------------------------------------------------------------------
F8F1T7_TRECH/16-155--------------------------------------------------------------------------------
Q93ZZ7_ARATH/51-205--------------------------------------------------------------------------------
D8U4F3_VOLCA/38-173--------------------------------------------------------------------------------
J7IS94_DESMD/8-142--------------------------------------------------------------------------------
A4XKK1_CALS8/9-143--------------------------------------------------------------------------------
F9VBI0_LACGL/8-142--------------------------------------------------------------------------------
K9W0K1_9CYAN/16-151--------------------------------------------------------------------------------
A9NHX4_ACHLI/6-144--------------------------------------------------------------------------------
D1AXZ8_STRM9/7-141--------------------------------------------------------------------------------
K9UG93_9CYAN/16-151--------------------------------------------------------------------------------
F4LN44_TREBD/13-152--------------------------------------------------------------------------------
R6NRL3_9CLOT/2-140--------------------------------------------------------------------------------
K0IWZ6_AMPXN/4-149--------------------------------------------------------------------------------
W8TJV6_EUBAC/8-150--------------------------------------------------------------------------------
R5BKA4_9FIRM/8-146--------------------------------------------------------------------------------
A8MFI8_ALKOO/8-144--------------------------------------------------------------------------------
H9UHZ5_SPIAZ/13-152--------------------------------------------------------------------------------
B8CY18_HALOH/3-134--------------------------------------------------------------------------------
B2A528_NATTJ/7-141--------------------------------------------------------------------------------
R6ME09_9FIRM/8-142--------------------------------------------------------------------------------
F2NS18_TRES6/11-151--------------------------------------------------------------------------------
R5PNP2_9CLOT/8-138--------------------------------------------------------------------------------
Q1J0I2_DEIGD/9-145--------------------------------------------------------------------------------
D6DFV4_CLOSC/8-144--------------------------------------------------------------------------------
I4D8V5_DESAJ/8-142--------------------------------------------------------------------------------
R7A673_9FIRM/8-144--------------------------------------------------------------------------------
R7FJ12_9CLOT/8-142--------------------------------------------------------------------------------
O51097_BORBU/6-146--------------------------------------------------------------------------------
K8GFC4_9CYAN/8-143--------------------------------------------------------------------------------
R6QDM5_9CLOT/9-141--------------------------------------------------------------------------------
M4CGY8_BRARP/134-268--------------------------------------------------------------------------------
K9Q226_9CYAN/8-142--------------------------------------------------------------------------------
R6N1H2_9CLOT/6-146--------------------------------------------------------------------------------
D3FSU1_BACPE/2-142--------------------------------------------------------------------------------
B9DG97_ARATH/20-155--------------------------------------------------------------------------------
Q9CGU3_LACLA/8-142--------------------------------------------------------------------------------
F2I5F0_AERUA/1-152--------------------------------------------------------------------------------
R7N6H8_9FIRM/8-144--------------------------------------------------------------------------------
C1FDH6_MICCC/170-303--------------------------------------------------------------------------------
R6SUP5_9CLOT/9-142--------------------------------------------------------------------------------
Q7U880_SYNPX/15-147--------------------------------------------------------------------------------
A5GM29_SYNPW/13-145--------------------------------------------------------------------------------
Q2JKH6_SYNJB/6-142--------------------------------------------------------------------------------
F2JMF4_CELLD/8-142--------------------------------------------------------------------------------
E6SHJ0_THEM7/12-146--------------------------------------------------------------------------------
K9S6R1_9CYAN/8-143--------------------------------------------------------------------------------
E3PRG0_CLOSD/8-144--------------------------------------------------------------------------------
R5N6N4_9CLOT/8-137--------------------------------------------------------------------------------
B1YKA4_EXIS2/4-132--------------------------------------------------------------------------------
R5GZB8_9FIRM/8-144--------------------------------------------------------------------------------
D5WTV2_KYRT2/8-146--------------------------------------------------------------------------------
R6PRB8_9FIRM/8-139--------------------------------------------------------------------------------
E6UEQ9_RUMA7/8-144--------------------------------------------------------------------------------
C1N1Q0_MICPC/8-144--------------------------------------------------------------------------------
L0A6P8_DEIPD/5-141--------------------------------------------------------------------------------
M1E7F3_9FIRM/5-139--------------------------------------------------------------------------------
R6USA8_9FIRM/5-142--------------------------------------------------------------------------------
A9SA98_PHYPA/3-154--------------------------------------------------------------------------------
E3DMH7_HALPG/3-133--------------------------------------------------------------------------------
E4U9L1_OCEP5/5-141--------------------------------------------------------------------------------
E8N0A2_ANATU/6-140--------------------------------------------------------------------------------
K9SNJ2_9CYAN/8-142--------------------------------------------------------------------------------
F0T097_SYNGF/8-149--------------------------------------------------------------------------------
A8FH06_BACP2/4-149--------------------------------------------------------------------------------
A9SE32_PHYPA/36-170--------------------------------------------------------------------------------
I0JQ19_HALH3/6-151--------------------------------------------------------------------------------
R5SAC8_9GAMM/12-144--------------------------------------------------------------------------------
M4FCC5_BRARP/76-227--------------------------------------------------------------------------------
G8LW53_CLOCD/8-141--------------------------------------------------------------------------------
C8WVG2_ALIAD/12-152--------------------------------------------------------------------------------
R5ADD7_9CLOT/7-149--------------------------------------------------------------------------------
D4K6A9_9FIRM/9-148--------------------------------------------------------------------------------
K3YAI4_SETIT/11-145--------------------------------------------------------------------------------
R7F8Q2_9CLOT/8-142--------------------------------------------------------------------------------
A3DDN6_CLOTH/8-143--------------------------------------------------------------------------------
K9Z2J9_CYAAP/8-142--------------------------------------------------------------------------------
K9P352_CYAGP/15-157--------------------------------------------------------------------------------
K9XC51_9CHRO/8-143--------------------------------------------------------------------------------
R6Y7H0_9FIRM/7-149--------------------------------------------------------------------------------
E1RAI3_SPISS/5-141--------------------------------------------------------------------------------
X2GPK1_9BACI/6-151--------------------------------------------------------------------------------
R5R4Q1_9FIRM/8-145--------------------------------------------------------------------------------
Q7V118_PROMP/8-139--------------------------------------------------------------------------------
B8E2Q0_DICTD/12-146--------------------------------------------------------------------------------
K4KZ53_9FIRM/8-148--------------------------------------------------------------------------------
R6EV23_9FIRM/8-145--------------------------------------------------------------------------------
D6Y193_BACIE/4-149--------------------------------------------------------------------------------
F5WQX5_ERYRF/7-143--------------------------------------------------------------------------------
C4L0Z0_EXISA/3-131--------------------------------------------------------------------------------
D7GPW8_9FIRM/6-142--------------------------------------------------------------------------------
D5E1E4_BACMQ/2-142--------------------------------------------------------------------------------
A4J281_DESRM/9-144--------------------------------------------------------------------------------
I0JIT0_HALH3/2-142--------------------------------------------------------------------------------
E1Z6N1_CHLVA/1-136--------------------------------------------------------------------------------
D3PLN0_MEIRD/5-141--------------------------------------------------------------------------------
Q8DMU2_THEEB/9-144--------------------------------------------------------------------------------
A4RUH5_OSTLU/12-147--------------------------------------------------------------------------------
Q5L0A2_GEOKA/2-142--------------------------------------------------------------------------------
W1NTD9_AMBTC/34-169--------------------------------------------------------------------------------
K8EPQ0_CARML/4-150--------------------------------------------------------------------------------
C6CSF5_PAESJ/6-132--------------------------------------------------------------------------------
G2TKM5_BACCO/4-146--------------------------------------------------------------------------------
K9TPQ7_9CYAN/8-143--------------------------------------------------------------------------------
N0B1X3_9BACI/2-142--------------------------------------------------------------------------------
V5WJH0_9SPIO/5-132--------------------------------------------------------------------------------
C9RC18_AMMDK/8-140--------------------------------------------------------------------------------
L7VUG0_CLOSH/9-141--------------------------------------------------------------------------------
R5J5K1_9FIRM/8-139--------------------------------------------------------------------------------
C1E358_MICCC/7-142--------------------------------------------------------------------------------
R7MBM3_9CLOT/16-148--------------------------------------------------------------------------------
R6B6R3_9CLOT/12-145--------------------------------------------------------------------------------
A5GRZ6_SYNR3/9-137--------------------------------------------------------------------------------
R7B1C9_9CLOT/8-144--------------------------------------------------------------------------------

PF10261

Q5KDG2_CRYNJ/99-376.............................................................................YKF
G2QCT9_MYCTT/113-344.............................................................................AAA
E3RV27_PYRTT/85-309.............................................................................AAT
R7YND5_CONA1/92-324.............................................................................AAG
G2XHJ1_VERDV/98-323.............................................................................AVA
C4Y4H3_CLAL4/57-287.............................................................................SSQ
C5DQ74_ZYGRC/35-359ELKGNLASHTLAT........................LRRLMGISNEKSDSTEPLVSPSEINIFIHDSIKSVREISTSAA
G8BYR0_TETPH/33-386SSYLHHLRC.................................AIDENAEGCMDFVPSKDTNELIKKIQDLDPMVQFISSK
E3KJ35_PUCGT/96-348.............................................................................NLY
N1RPR7_FUSC4/66-290.............................................................................AVA
F9WXZ1_ZYMTI/84-317.............................................................................HAA
G3BAX8_CANTC/92-323.............................................................................SKV
G8BIE7_CANPC/69-321.............................................................................SYH
C5FE12_ARTOC/64-296.............................................................................SVS
G8ZXV3_TORDC/32-356LEQSLNSIRC...............................AMNGTECHRELAKSVVPTDLNHYIHDSLFSGVTRNSSAV
A5DKF9_PICGU/56-288.............................................................................SYM
E3QPL9_COLGM/87-312.............................................................................AVA
S3CVS7_OPHP1/100-357.............................................................................SSA
A3LYM5_PICST/59-299.............................................................................SYH
G0WG33_NAUDC/40-380DDEKELLLHSLNSI.......................GCALEKSCDKINSTISSISSNRKLNEFINTQMNSIRRINTSAQ
M3IZX9_CANMX/56-283.............................................................................SYY
G3JBH7_CORMM/90-318.............................................................................AVA
R9AQ78_WALI9/64-296.............................................................................HLE
C5E2P1_LACTC/32-359LLQNAVSEIE...............................YWISEGKGHLRGEDVTPSQLNSLIDSALHSWKKINSSNL
T0K1V0_COLGC/87-312.............................................................................AVA
G8Y1H9_PICSO/62-313.............................................................................SYT
C5G9K2_AJEDR/75-292.............................................................................STA
C5MI48_CANTT/55-284.............................................................................SYT
N1Q4W5_DOTSN/87-323.............................................................................HAA
S3DE95_GLAL2/81-314.............................................................................GFA
R9P3R6_PSEHS/103-383.............................................................................DLY
N1Q6I4_PSEFD/84-317.............................................................................HAA
K2R4W1_MACPH/94-328.............................................................................AAT
N1QNJ0_SPHMS/101-335.............................................................................HAA
F7WC52_SORMK/81-344.............................................................................AAA
M2N8T6_BAUCO/89-327.............................................................................HAA
K9G927_PEND2/67-311.............................................................................AAT
C4R337_KOMPG/57-293.............................................................................SST
A1CR84_ASPCL/74-313.............................................................................AAA
A5E4A1_LODEL/62-350.............................................................................SYH
U1G5N5_ENDPU/81-322.............................................................................HLS
E5R3U3_ARTGP/64-297.............................................................................SVL
K1WMV9_MARBU/113-341.............................................................................GVA
G0VEA6_NAUCC/39-386TGPSDSDSQLLDAS......................LKTIGCVLNLEKECDMDHDVTSADLNSFIKRKMNSMGRISTSAM
Q6FR77_CANGA/32-368PLAVDSKLMDFVTGSIEKAIEHYSYHIKSNIMIKEISRLLSDLNITYSTEQINDFIKNFISNTTVGNSSGANSTLDNSFA
E9EF85_METAQ/84-313.............................................................................AVA
R8BRZ8_TOGMI/87-311.............................................................................AVA
M9LJJ3_PSEA3/95-341.............................................................................EMY
M1VZ69_CLAP2/82-312.............................................................................AMA
V5GE99_BYSSN/78-302.............................................................................AAA
I2FTC6_USTH4/101-374.............................................................................ELY
G8JR11_ERECY/38-363MGEETVYWL.................................NCRLGEGPCENTSPSNSAMNSFISEALNNAYPIDNGQM
Q6BUP0_DEBHA/108-353.............................................................................SYM
Q4WJI3_ASPFU/73-304.............................................................................AAA
G2R9R1_THITE/97-341.............................................................................AAA
I4YGQ8_WALMC/41-264.............................................................................HLE
G2XPX9_BOTF4/55-288.............................................................................GVA
G3AEN0_SPAPN/55-285.............................................................................SYN
C7Z7P3_NECH7/60-283.............................................................................SVA
E7KCE6_YEASA/33-370RQQQLWDRSIGSI........................QGALQATQPKTPKNVTASAAAAINTFIHDQMHRWQGPLTTSAQ
G3YDY9_ASPNA/76-295.............................................................................AAA
L8FY78_PSED2/112-347.............................................................................PMA
A7TR39_VANPO/62-394QGHIQRLKC.................................ALDNKSNCNSVSSPPNINADIKNTVFKLDPLVDMVSSN
N1JKB0_BLUG1/90-317.............................................................................AAT
B6Q6E7_TALMQ/81-304.............................................................................AAA
B8M5R8_TALSN/84-316.............................................................................AAA
C8V5A4_EMENI/56-278.............................................................................ATA
G0T001_RHOT2/1044-1290.............................................................................PLV
Q6CKM7_KLULA/25-334LSA.............................................LNSIISEDSSEYTPELAAELSELSKLVKSSAG
Q75EB2_ASHGO/35-359LRERTMYW..................................IRCMLTGGQCENTGLDPTELNSYIQDSVTASAIRSSHA
M7SYX4_EUTLA/110-375.............................................................................AAA
E9CZW5_COCPS/67-291.............................................................................AMA
F0XPI2_GROCL/81-317.............................................................................ASM
A7UX33_NEUCR/112-389.............................................................................AAA
J3NLN2_GAGT3/91-336.............................................................................AAA
A7EQ03_SCLS1/55-288.............................................................................GVA
G9NCA4_HYPVG/72-300.............................................................................AVA

PF01569

Q29NI1_DROPS/70-187.----------------------------------------....S-F---------------..---.PSGHA...SR-
A4I568_LEIIN/102-249.----------------------------------------....G-M---------------..---.PSDHA...QF-
DOPP1_DICDI/54-178.----------------------------------------....G-M---------------..---.PSSHS...QF-
Q17D95_AEDAE/56-197P----------------------------------------SPGN.-.---------------..---.PSGHL...MT-
G6PC3_MOUSE/53-195C----------------------------------------ETGPG-S---------------..---.PSGHC...MI-
A0BM37_PARTE/91-226.----------------------------------------....E-F---------------G.---KPSGHA...MS-
Q23FV4_TETTS/102-237.----------------------------------------.....-F---------------G.---NPSGHG...VN-
A0EE96_PARTE/81-240.----------------------------------------....G-F---------------G.---DPSGHS...LR-
A8FE89_BACP2/71-198.----------------------------------------....S-F---------------..---.PSGHS...MN-
A0LYQ4_GRAFK/59-183.----------------------------------------..RFG-Y---------------..---.FSAHA...AN-
Q7MUE1_PORGI/58-185.----------------------------------------..KYG-F---------------..---.ISGHT...TN-
A0K0K5_ARTS2/118-241.----------------------------------------....S-F---------------..---.PSGHV...LG-
A4XP73_PSEMY/98-234D----------------------------------------SASRS-F---------------..---.PGDHA...SV-
A4X1H8_SALTO/101-242L----------------------------------------EFTRS-Y---------------..---.PSGHV...VN-
Q9EWX3_STRCO/115-237.----------------------------------------....I-F---------------..---.PSGHT...AN-
A1BJZ6_CHLPD/56-185.----------------------------------------....S-F---------------..---.ASSHA...AN-
A4FQA0_SACEN/76-196.----------------------------------------..DWS-L---------------..---.PSNHS...AI-
B0U8C7_METS4/61-186.----------------------------------------.HWSS-F---------------..---.PSDSS...AY-
A1S1V4_SHEAM/77-196.----------------------------------------....S-F---------------..---.PSAHT...GT-
A1W5E3_ACISJ/72-191.----------------------------------------...YS-L---------------..---.PSGHS...TY-
A5CF96_ORITB/78-203.----------------------------------------NCFTS-F---------------..---.PSAHT...GI-
B4U5Z7_HYDS0/54-171.----------------------------------------....S-F---------------..---.PSGDT...AM-
A5DBA1_PICGU/102-232.----------------------------------------...YG-F---------------..---.PSSHS...AN-
Q4D544_TRYCC/102-225.----------------------------------------....G-Y---------------..---.PSTHA...SH-
SSPA_DICDI/88-218.----------------------------------------....G-L---------------..---.PSTHT...AS-
Q32GQ5_SHIDS/77-232K----------------------------------------ETGFA-F---------------..---.PSGHT...MF-
Q9CMX4_PASMU/75-237K----------------------------------------EVGYA-F---------------..---.PSGHT...IF-
Q21JU9_SACD2/110-231.----------------------------------------...HS-F---------------..---.PSGHS...LT-
C1DG09_AZOVD/106-238L----------------------------------------PTKGS-W---------------..---.PSSRA...AR-
Q0K1U6_CUPNH/103-229.----------------------------------------..DGS-Y---------------..---.PSGHS...AI-
Q65GX3_BACLD/179-304.----------------------------------------NKDGG-F---------------..---.PSGHT...NA-
Q2IJN8_ANADE/141-265.----------------------------------------....S-F---------------..---.YSGHT...ST-
Q6FEM9_ACIAD/65-182.----------------------------------------....S-F---------------..---.PSGHT...LH-
A1K7H5_AZOSB/105-237C----------------------------------------DGNCS-F---------------..---.VSGHA...SA-
Q3SNT4_NITWN/91-218C----------------------------------------GRNCS-F---------------..---.FSGEG...AT-
Q6MBQ7_PARUW/87-223F----------------------------------------EPSKS-F---------------..---.PCGHC...SV-
A8EX54_ARCB4/94-229F----------------------------------------IQKSK-I---------------KC---WPAGHA...SM-
Q87X15_PSESM/102-231D----------------------------------------KPGRC-W---------------..---.PGGHA...AT-
Q03CR8_LACC3/177-306.----------------------------------------.GHMS-F---------------..---.PSGHT...QT-
R5ZI70_9ACTN/141-283K----------------------------------------DGFKS-F---------------..---.ASGHTAHAAI-
A8BDI5_GIAIC/110-282N----------------------------------------PANLK-L---------------YS---TPSGHTMFMAS-
A8BQZ4_GIAIC/121-285S----------------------------------------QCSHS-L---------------SS---TPSGHT...AA-
Q6MTZ1_MYCMS/144-270.----------------------------------------..HNS-F---------------..---.PSGHT...YS-
R5TP42_9FIRM/95-216.----------------------------------------TPTNV-F---------------..---.PSLHV...FN-
A3LWS4_PICST/248-396Y----------------------------------------AIPNK-F---------------AS---CPSIHA...CT-
Q127S7_POLSJ/95-224.----------------------------------------...AS-G---------------NA---CPSLHV...AT-
A4CJ32_ROBBH/299-448.----------------------------------------...PP-F---------------PE---YTSGHS...VV-
Q2HER5_CHAGB/260-418L----------------------------------------RPTPS-H---------------PD---YVSTHS...TF-
A8L0R7_FRASN/276-428T----------------------------------------PPHPD-F---------------..---.TSGHT...CF-
Q4YWD7_PLABA/107-241A----------------------------------------KVYEC-T---------------DL---IISGHT...CF-
Q6NJR5_CORDI/194-319.----------------------------------------....S-Y---------------..---.PSGHT...AF-
A1SKJ7_NOCSJ/98-218.----------------------------------------....S-F---------------..---.PSGHL...GT-
Q82Z33_ENTFA/85-204.----------------------------------------....S-F---------------..---.PSGHS...LL-
A2DYB5_TRIVA/98-241S----------------------------------------EFKDQ-F---------------RS---WPSGHS...QT-
A2EZZ9_TRIVA/91-236K----------------------------------------EAFKS-F---------------..---.PSGHS...CT-
A4H9E7_LEIBR/233-378N----------------------------------------EGRLS-F---------------..---.PSGHS...SA-
Q6BYN9_DEBHA/112-272Q----------------------------------------EGFRS-F---------------..---.PSGHS...ST-
A7EIU4_SCLS1/134-294D----------------------------------------DSLES-F---------------..---.PSGHS...TA-
A7TF94_VANPO/122-266G----------------------------------------ILHEG-L---------------KS---TPSGHS...SF-
Q2TYI3_ASPOR/35-224A----------------------------------------VIKDG-F---------------AA---FPSGHS...SF-
A2EQG2_TRIVA/90-230A----------------------------------------SQFSS-F---------------..---.PATEA...AE-
PLPR5_MOUSE/122-275M----------------------------------------RARKT-F---------------..---.PSKEA...AL-
Q9VNU2_DROME/65-225R----------------------------------------ELHVS-F---------------..---.PSAHS...SL-
A8WXP5_CAEBR/128-286R----------------------------------------TARTS-F---------------..---.PSGHT...AA-
A6X217_OCHA4/121-242.----------------------------------------..YES-F---------------..---.PSGHS...MM-
Q5NGF4_FRATT/116-236.----------------------------------------...YD-F---------------AS---MPSGHS...IT-
Q5ZX13_LEGPH/91-208.----------------------------------------..YWS-F---------------..---.PSGHS...IT-
Q6MH55_BDEBA/105-226.----------------------------------------..WHS-F---------------..---.SSGHS...QV-
B4S7E2_PROA2/140-261.----------------------------------------...WS-L---------------..---.PSGHA...TS-
Q7NZZ5_CHRVO/815-932.----------------------------------------...SS-F---------------..---.TSNHT...AI-
Q0SBZ7_RHOJR/226-347.----------------------------------------....S-F---------------..---.PSGHA...TG-
Q89JR9_BRADU/79-199.----------------------------------------..EDA-F---------------..---.PSGHA...LH-
B7VND8_VIBTL/235-351.----------------------------------------...YS-F---------------..---.PSLLA...GL-
Q5E4L0_VIBF1/241-366.----------------------------------------....G-M---------------..---.PSMHS...ML-
Q9RVR6_DEIRA/14-135.----------------------------------------...PG-L---------------..---.PSGHA...QM-

PF14378

Q5K8D7_CRYNJ/128-311N----------------------------------------KFQNQ-L---------------AA...FPSLHF---GY-
B0UG28_METS4/124-315D----------------------------------------M..RG-L---------------VT...FPSFHV---SL-
A1SJR6_NOCSJ/50-230P----------------------------------------NFVNQ-Y---------------AA...MPSLHA---GW-
C5APU7_METEA/131-322E----------------------------------------I..RG-L---------------VT...FPSFHA---CL-
E4NIW3_KITSK/45-228G----------------------------------------TGGNH-Y---------------SA...MPSLHV---GW-
Q989C0_RHILO/119-308K----------------------------------------T..VG-I---------------TC...FPSFHT---TL-
G8WRV6_STREN/158-347G----------------------------------------GMTNQ-Y---------------AA...MPSLHV---GW-
C7QD07_CATAD/71-251A----------------------------------------DSPDQ-L---------------SA...MPSVHV---IW-
Q1D5Z1_MYXXD/96-274S----------------------------------------LMRKP-L---------------FARDCFPSGHT---GA-
Q2G5H1_NOVAD/115-305A----------------------------------------...AG-L---------------VS...FPSFHA---AS-
U4LB32_PYROM/137-324N----------------------------------------RFCQQ-L---------------AA...MPSLHF---GY-
Q1IHV8_KORVE/153-330V----------------------------------------GISGP-R---------------NA...IPSLHF---AW-
F2R3P1_STRVP/39-228G----------------------------------------GMTNQ-Y---------------AA...MPSLHV---GW-
A9HHP2_GLUDA/131-314R----------------------------------------M..EG-V---------------YT...FPSFHA---VM-
Q13PQ7_BURXL/110-293F----------------------------------------V..QG-L---------------VS...FPSLHT---IL-
R6XNQ9_9FIRM/3-178G----------------------------------------AVKES-S---------------YS...FPSGHT---TA-
Q63V72_BURPS/125-308A----------------------------------------L..QG-M---------------VS...MPSFHT---VL-
Q01VD1_SOLUE/159-330.----------------------------------------...GR-P---------------NA...MPSLHF---GG-
D1CA82_SPHTD/53-235A----------------------------------------MLYNP-F---------------AA...MPSLHV---AF-
K0K1I4_SACES/40-223R----------------------------------------PGVNL-L---------------AA...MPSMHV---AW-
D1C524_SPHTD/53-234T----------------------------------------LLYNP-F---------------AA...MPSMHV---AF-
W5TLL4_9NOCA/53-242G----------------------------------------SLTND-F---------------AA...MPSLHV---GW-
D3HTE9_LEGLN/101-283T----------------------------------------TNDGG-L---------------IA...LPSFHA---IW-
Q2JBQ4_FRASC/47-236E----------------------------------------GLTNQ-Y---------------AA...LPSLHC---AW-
W0BEC4_9GAMM/94-276T----------------------------------------TLEGG-M---------------IA...TPSFHA---IW-
Q220L9_RHOFT/109-292D----------------------------------------M..QG-L---------------IS...IPSLHT---VM-
G2P916_STRVO/51-241G----------------------------------------GLTNQ-F---------------AA...MPSLHV---GW-
Q87M50_VIBPA/146-355N----------------------------------------GIGSG-I---------------SA...MPSMHV---SI-
B1LSY3_METRJ/129-320D----------------------------------------L..RG-L---------------AT...FPSFHV---CL-
A2BL06_HYPBU/51-224.----------------------------------------...NP-Y---------------AA...MPSMHV---GM-
L0PFU2_PNEJ8/5-201S----------------------------------------TFPAS-P---------------LVFGAFPSLHA---GH-
C9Z2S2_STRSW/63-253G----------------------------------------GMTNQ-Y---------------AA...MPSLHV---GW-
B9L518_THERP/33-215A----------------------------------------TLYNP-F---------------AA...MPSLHV---AF-
E3JAH2_FRASU/94-282G----------------------------------------GLTNQ-Y---------------AA...MPSLHC---AW-
F8AWV4_FRADG/47-236A----------------------------------------GITNQ-F---------------AA...MPSLHC---AW-
R7Y200_9ACTN/124-318D----------------------------------------GIEGA-V---------------QSVAGFASLHV---AI-
A0LS47_ACIC1/69-252S----------------------------------------AGADE-L---------------AA...MPSVHV---AW-
E2Q4K3_STRC2/45-234G----------------------------------------NLTNQ-Y---------------AA...MPSLHV---GW-
F8J559_HYPSM/123-309Q----------------------------------------LHFAG-L---------------VT...FPSYHA---VV-
L0ET54_LIBCB/102-293D----------------------------------------T..AG-I---------------IT...FPSVHA---AV-
Q89QL0_BRADU/109-300G----------------------------------------A..EG-I---------------IS...FPSLHA---AL-
B1VW42_STRGG/49-238S----------------------------------------GMTNQ-Y---------------AA...MPSLHV---GW-
C5AQ48_METEA/107-294E----------------------------------------V..GP-L---------------IS...FPSLHC---AV-
H0PVV4_9RHOO/74-256D----------------------------------------M..QG-I---------------VT...FPSYHA---AM-
E3EJC2_PAEPS/1-162L----------------------------------------IHHDP-N---------------AS...FPSNHA---LG-
G0HGL8_CORVD/79-265D----------------------------------------NISNQ-F---------------AA...MPSLHC---AW-
A1SDU3_NOCSJ/130-324G----------------------------------------VVQDA-V---------------QSVAGFASLHV---AI-
C7QBQ6_CATAD/84-272G----------------------------------------KSTNE-F---------------AA...MPSLHI---GW-
A1SHK3_NOCSJ/128-322P----------------------------------------HAGDA-F---------------VSISAFASLHV---GF-
E3J0M0_FRASU/110-299D----------------------------------------KVANL-Y---------------AA...MPSLHC---AW-
C8XDB0_NAKMY/22-205T----------------------------------------TGQNH-F---------------SA...MPSLHV---GW-
G7XGU5_ASPKW/117-299N----------------------------------------KFQLT-I---------------AA...MPSLHF---GN-
N0BE90_9RHIZ/119-305E----------------------------------------MVFSG-I---------------VE...FPSYHA---AS-
B1LVV6_METRJ/99-290H----------------------------------------V..EG-I---------------IT...FPSFHA---AL-
Q5ZV46_LEGPH/101-283T----------------------------------------TIEGG-L---------------IA...LPSFHT---IW-

PF14360

SLS2_TRYB2/201-275----------------------------------------------------------------------SGHT---VI-
B8C480_THAPS/431-503----------------------------------------------------------------------SSHT---IY-
IPCS3_ARATH/172-244----------------------------------------------------------------------SSHT---IF-
SAMD8_HUMAN/292-365----------------------------------------------------------------------SGHT---VV-
A2DHW8_TRIVA/46-124----------------------------------------------------------------------SGHT---MF-
A9RPY7_PHYPA/269-340----------------------------------------------------------------------SGHV---FV-
SLS_LEIMA/211-286----------------------------------------------------------------------SGHT---MI-
A5K283_PLAVS/202-273----------------------------------------------------------------------SGHS---FS-
Q4YWD8_PLABA/201-272----------------------------------------------------------------------SGHS---FT-
B3L7G0_PLAKH/276-347----------------------------------------------------------------------SGHT---AF-
Q28DN3_XENTR/220-293----------------------------------------------------------------------SGHT---VI-
Q4N3L0_THEPA/182-253----------------------------------------------------------------------SGHV---YF-
A8XDY1_CAEBR/127-200----------------------------------------------------------------------SGHT---LV-
IPCS_ORYSJ/172-244----------------------------------------------------------------------SSHM---IF-
A9SUW6_PHYPA/174-246----------------------------------------------------------------------SSHM---TF-
SMSR1_CAEEL/321-394----------------------------------------------------------------------SGHT---TV-
Q17C33_AEDAE/230-303----------------------------------------------------------------------SGHT---VT-
SMS2_CAEEL/201-274----------------------------------------------------------------------SGHT---VV-
A8X0T5_CAEBR/264-337----------------------------------------------------------------------SGHT---LV-
A9S9I4_PHYPA/275-346----------------------------------------------------------------------SGHM---YV-
B3SD02_TRIAD/279-352----------------------------------------------------------------------SGHT---VA-
A2DN61_TRIVA/170-240----------------------------------------------------------------------SGHT---MG-
C5KN45_PERM5/142-213----------------------------------------------------------------------SGHM---MY-
C5L5L1_PERM5/146-217----------------------------------------------------------------------SGHM---LY-
SMSR2_CAEEL/246-319----------------------------------------------------------------------SGHT---LT-
B5YLZ6_THAPS/422-494----------------------------------------------------------------------SGHA---TV-
C6KT87_PLAF7/201-272----------------------------------------------------------------------SGHS---FS-
D0MWV3_PHYIT/192-264----------------------------------------------------------------------SSHT---IY-
B7FUU7_PHATC/326-397----------------------------------------------------------------------SGHA---TV-
SLS11_TRYCC/193-267----------------------------------------------------------------------SGHT---VS-
D2VDJ4_NAEGR/246-319----------------------------------------------------------------------SGHM---SM-
C5KL60_PERM5/83-154----------------------------------------------------------------------SGHS---IP-
D2VXN5_NAEGR/191-270----------------------------------------------------------------------SGHA---TA-
D2VKR1_NAEGR/196-272----------------------------------------------------------------------SGHA---TS-
B9HC73_POPTR/172-244----------------------------------------------------------------------SSHM---IF-
C6KT86_PLAF7/265-336----------------------------------------------------------------------SGHT---AF-
C4LV27_ENTHI/184-261----------------------------------------------------------------------SGHT---AN-
A2FIE9_TRIVA/168-238----------------------------------------------------------------------SGHT---MG-
B7QHG5_IXOSC/233-306----------------------------------------------------------------------SGHT---VI-
C5LU78_PERM5/899-971----------------------------------------------------------------------SSHM---MY-
C5KY50_PERM5/57-128----------------------------------------------------------------------SGHS---IS-
D0NII4_PHYIT/164-244----------------------------------------------------------------------LGHI---AN-
A7ANZ4_BABBO/239-311----------------------------------------------------------------------SGHT---AG-
A0JMN0_DANRE/269-342----------------------------------------------------------------------SGHT---VM-
C3XQA8_BRAFL/273-346----------------------------------------------------------------------SGHT---VI-
A0A0H5S654_BRUMA/218-291----------------------------------------------------------------------SGHT---VV-
F8W5G6_DANRE/232-307----------------------------------------------------------------------SGHT---VM-
F6UTK5_XENTR/280-353----------------------------------------------------------------------SGHT---VM-
H3CAZ2_TETNG/175-248----------------------------------------------------------------------SGHT---VM-
J9FFV7_WUCBA/189-261----------------------------------------------------------------------SGHT---LA-
Q4U956_THEAN/200-270----------------------------------------------------------------------SGHT---MF-

PF02681

F2NNY3_MARHT/5-141---------------------------------------------------------------------PSSHS---AT.
K9T6M6_9CYAN/8-143---------------------------------------------------------------------PSAHS---AL.
D4ZTL8_ARTPN/8-143---------------------------------------------------------------------PSSHS---AF.
K9WGM7_9CYAN/8-143---------------------------------------------------------------------PSAHS---AF.
B7GI74_ANOFW/24-164---------------------------------------------------------------------PSSHS---AG.
B1WS33_CYAA5/8-143---------------------------------------------------------------------PSAHS---AL.
R5AEV3_9CLOT/9-146---------------------------------------------------------------------PSSHA---AT.
Q31Q62_SYNE7/9-145---------------------------------------------------------------------PSSHS---AL.
R5XG63_9CLOT/5-137---------------------------------------------------------------------PSSHS---SF.
D4JCM8_9FIRM/8-144---------------------------------------------------------------------PSSHS---ST.
W0E929_9FIRM/8-143---------------------------------------------------------------------PSSHA---AT.
D3FYY4_BACPE/4-149---------------------------------------------------------------------PSSHS---AA.
F0RVM2_SPHGB/6-143---------------------------------------------------------------------PSSHT---AG.
H6NB79_9BACL/2-142---------------------------------------------------------------------PSSHS---AA.
Q7V6P1_PROMM/15-147---------------------------------------------------------------------PSSHS---AL.
Q18B69_PEPD6/8-140---------------------------------------------------------------------PSSHS---SF.
G0GF41_SPITZ/9-149---------------------------------------------------------------------PSSHS---AL.
Q65FE5_BACLD/4-149---------------------------------------------------------------------PSSHS---AA.
U5LF62_9BACI/2-142---------------------------------------------------------------------PSSHS---AG.
R7L0C2_9FIRM/5-149---------------------------------------------------------------------PSAHS---AM.
Q5WDV5_BACSK/4-146---------------------------------------------------------------------PSSHS---AA.
D6GSF2_FILAD/8-144---------------------------------------------------------------------PSSHS---SF.
E6U5K5_ETHHY/8-143---------------------------------------------------------------------PSAHS---AM.
Q5SJ95_THET8/4-140---------------------------------------------------------------------PSTHS---AT.
R5GK39_9FIRM/5-157---------------------------------------------------------------------PSSHS---AL.
Q9RSQ8_DEIRA/8-143---------------------------------------------------------------------PSSHS---AM.
P73185_SYNY3/8-143---------------------------------------------------------------------PSAHS---AL.
D1AKQ0_SEBTE/7-143---------------------------------------------------------------------PSSHA---ST.
E0RXA3_BUTPB/8-144---------------------------------------------------------------------PSSHS---AT.
F5YE41_TREAZ/16-155---------------------------------------------------------------------PSSHA---AV.
V5WEJ9_9SPIO/6-144---------------------------------------------------------------------PSSHS---AL.
U5LHE7_9BACI/5-149---------------------------------------------------------------------PSSHS---AA.
K9XWG4_STAC7/8-143---------------------------------------------------------------------PSAHS---AL.
E6U2C7_BACCJ/4-149---------------------------------------------------------------------PSSHS---GA.
R7M7X6_9CLOT/12-143---------------------------------------------------------------------PSSHS---GV.
K9V3M2_9CYAN/8-143---------------------------------------------------------------------PSAHS---AL.
B9IAH9_POPTR/38-171---------------------------------------------------------------------PSSHS---AT.
M0RZC5_MUSAM/20-155---------------------------------------------------------------------PSSHS---AT.
R5ZD30_9FIRM/8-146---------------------------------------------------------------------PSSHS---ST.
R6Q3Q8_9FIRM/8-138---------------------------------------------------------------------PSSHS---SL.
F4GLJ1_SPHCD/5-141---------------------------------------------------------------------PSSHT---AA.
C0ZKP9_BREBN/5-150---------------------------------------------------------------------PSSHS---SA.
D8TLE7_VOLCA/33-168---------------------------------------------------------------------PSSHT---AL.
D4JU78_9FIRM/7-157---------------------------------------------------------------------PSAHS---AT.
K9YEC7_HALP7/8-143---------------------------------------------------------------------PSAHS---AL.
K3XML5_SETIT/24-159---------------------------------------------------------------------PSSHS---AT.
K9RII7_9CYAN/8-143---------------------------------------------------------------------PSAHS---AL.
K4LIZ6_THEPS/40-169---------------------------------------------------------------------PSSHA---AV.
E6TWS5_BACCJ/5-142---------------------------------------------------------------------PSSHS---AG.
R6V5P2_9CLOT/18-171---------------------------------------------------------------------PSSHT---AVS
Q73MW8_TREDE/10-150---------------------------------------------------------------------PSSHS---AL.
Q8Y4P9_LISMO/4-149---------------------------------------------------------------------PSSHS---AA.
M0SK26_MUSAM/139-272---------------------------------------------------------------------PSSHS---AL.
I0GIV6_CALEA/8-146---------------------------------------------------------------------PSSHT---AT.
A9TH33_PHYPA/30-165---------------------------------------------------------------------PSSHS---AT.
G4KW10_OSCVS/4-137---------------------------------------------------------------------PSGHS---AT.
R5CL70_9FIRM/8-147---------------------------------------------------------------------PSAHS---AT.
I0I5M8_CALAS/5-139---------------------------------------------------------------------PSSHS---AL.
D7CKU8_SYNLT/12-144---------------------------------------------------------------------PSAHS---AM.
R7IRJ9_9CLOT/8-142---------------------------------------------------------------------PSSHS---AI.
B8HXR8_CYAP4/8-143---------------------------------------------------------------------PSSHS---AL.
B0C3J0_ACAM1/8-143---------------------------------------------------------------------PSSHS---AS.
I4DAH9_DESAJ/3-144---------------------------------------------------------------------PSSHT---AL.
Q46K07_PROMT/15-148---------------------------------------------------------------------PSSHS---AL.
R7A3G1_9CLOT/8-142---------------------------------------------------------------------PSSHS---AV.
Q24V03_DESHY/8-143---------------------------------------------------------------------PSSHS---AT.
K9VPU0_9CYAN/9-144---------------------------------------------------------------------PSAHS---SF.
D1BMJ6_VEIPT/9-146---------------------------------------------------------------------PSSHT---SF.
Q10X44_TRIEI/8-143---------------------------------------------------------------------PSAHS---AF.
A4RZ57_OSTLU/3-142---------------------------------------------------------------------PSSHS---AF.
D8QR56_SELML/24-159---------------------------------------------------------------------PSSHS---AT.
K4AZY7_SOLLC/140-274---------------------------------------------------------------------PSSHS---AL.
Q8ENX8_OCEIH/4-149---------------------------------------------------------------------PSSHS---AA.
K7V114_MAIZE/48-182---------------------------------------------------------------------MSSLS---AT.
D4IXN8_BUTFI/8-143---------------------------------------------------------------------PSSLA---AL.
Q01ES7_OSTTA/128-261---------------------------------------------------------------------PSSHT---SL.
E3HA83_ILYPC/7-143---------------------------------------------------------------------PSSHS---ST.
V5RVF1_9BACT/5-132---------------------------------------------------------------------PSAHS---AT.
A6TR41_ALKMQ/8-144---------------------------------------------------------------------PSSHS---SF.
I1KRZ5_SOYBN/9-144---------------------------------------------------------------------PSSHS---AT.
R5KDM7_9CLOT/8-150---------------------------------------------------------------------PSSHS---AT.
R7I9S8_9FIRM/10-145---------------------------------------------------------------------PSSHT---AF.
R6BY11_9CLOT/8-144---------------------------------------------------------------------PSSHS---AT.
R5ITD2_9FIRM/8-144---------------------------------------------------------------------PSGHS---AT.
K9RQD3_SYNP3/8-143---------------------------------------------------------------------PSSHS---AL.
K9SVF9_9SYNE/8-143---------------------------------------------------------------------PSSHS---AV.
Q7VBG6_PROMA/16-148---------------------------------------------------------------------PSSHS---AL.
O83188_TREPA/14-153---------------------------------------------------------------------PSSHS---AL.
G8QY16_SPHPG/6-143---------------------------------------------------------------------PSSHT---AG.
D3EMZ3_ATETH/8-144---------------------------------------------------------------------PSAHS---AL.
R5TH29_9CLOT/11-163---------------------------------------------------------------------PSTHT---TTA
A9TSJ4_PHYPA/1-141---------------------------------------------------------------------PSSHA---AS.
R5YWD2_9CLOT/9-140---------------------------------------------------------------------PSSHS---AV.
M0SG02_MUSAM/22-157---------------------------------------------------------------------PSSHS---AT.
F5YMS6_TREPZ/16-155---------------------------------------------------------------------PSSHA---SM.
R7J8Q8_9FUSO/12-143---------------------------------------------------------------------PSSHS---AG.
R7R6N9_9FIRM/8-144---------------------------------------------------------------------PSSHS---AT.
C7NE60_LEPBD/7-143---------------------------------------------------------------------PSSHA---ST.
R5IDQ6_9CLOT/2-138---------------------------------------------------------------------PSSHS---AT.
D9R8M4_CLOSW/8-144---------------------------------------------------------------------PSSHS---ST.
D7BAF5_MEISD/5-141---------------------------------------------------------------------PSSHA---AT.
F8F1T7_TRECH/16-155---------------------------------------------------------------------PSSHS---SL.
Q93ZZ7_ARATH/51-205---------------------------------------------------------------------PSTHS---SS.
D8U4F3_VOLCA/38-173---------------------------------------------------------------------PSSHS---SL.
J7IS94_DESMD/8-142---------------------------------------------------------------------PSSHS---AM.
A4XKK1_CALS8/9-143---------------------------------------------------------------------PSSHS---AF.
F9VBI0_LACGL/8-142---------------------------------------------------------------------PSSHS---AL.
K9W0K1_9CYAN/16-151---------------------------------------------------------------------PSAHS---AL.
A9NHX4_ACHLI/6-144---------------------------------------------------------------------PSSHS---AL.
D1AXZ8_STRM9/7-141---------------------------------------------------------------------PSSHS---SS.
K9UG93_9CYAN/16-151---------------------------------------------------------------------PSAHS---AL.
F4LN44_TREBD/13-152---------------------------------------------------------------------PSSHS---AL.
R6NRL3_9CLOT/2-140---------------------------------------------------------------------PSSHT---AT.
K0IWZ6_AMPXN/4-149---------------------------------------------------------------------PSSHS---AA.
W8TJV6_EUBAC/8-150---------------------------------------------------------------------PSSHS---SF.
R5BKA4_9FIRM/8-146---------------------------------------------------------------------PSSHS---SL.
A8MFI8_ALKOO/8-144---------------------------------------------------------------------PSSHA---SF.
H9UHZ5_SPIAZ/13-152---------------------------------------------------------------------PSSHS---SM.
B8CY18_HALOH/3-134---------------------------------------------------------------------PSSHA---SF.
B2A528_NATTJ/7-141---------------------------------------------------------------------PSSHS---SF.
R6ME09_9FIRM/8-142---------------------------------------------------------------------PSSHS---SF.
F2NS18_TRES6/11-151---------------------------------------------------------------------PSSHS---AL.
R5PNP2_9CLOT/8-138---------------------------------------------------------------------PSSHT---AI.
Q1J0I2_DEIGD/9-145---------------------------------------------------------------------PSSHS---AM.
D6DFV4_CLOSC/8-144---------------------------------------------------------------------PSSHS---ST.
I4D8V5_DESAJ/8-142---------------------------------------------------------------------PSSHS---AT.
R7A673_9FIRM/8-144---------------------------------------------------------------------PSSHS---AT.
R7FJ12_9CLOT/8-142---------------------------------------------------------------------PSSHS---AI.
O51097_BORBU/6-146---------------------------------------------------------------------PSSHS---ST.
K8GFC4_9CYAN/8-143---------------------------------------------------------------------PSAHS---AF.
R6QDM5_9CLOT/9-141---------------------------------------------------------------------PSSHS---AG.
M4CGY8_BRARP/134-268---------------------------------------------------------------------PSSHS---AL.
K9Q226_9CYAN/8-142---------------------------------------------------------------------PSAHS---AL.
R6N1H2_9CLOT/6-146---------------------------------------------------------------------PSSHS---AF.
D3FSU1_BACPE/2-142---------------------------------------------------------------------PSSHS---AG.
B9DG97_ARATH/20-155---------------------------------------------------------------------PSSHS---AT.
Q9CGU3_LACLA/8-142---------------------------------------------------------------------PSSHS---SL.
F2I5F0_AERUA/1-152---------------------------------------------------------------------PSSHT---AA.
R7N6H8_9FIRM/8-144---------------------------------------------------------------------PSSHS---AT.
C1FDH6_MICCC/170-303---------------------------------------------------------------------PSSHT---SL.
R6SUP5_9CLOT/9-142---------------------------------------------------------------------PSSHT---AA.
Q7U880_SYNPX/15-147---------------------------------------------------------------------PSSHS---AL.
A5GM29_SYNPW/13-145---------------------------------------------------------------------PSSHS---AL.
Q2JKH6_SYNJB/6-142---------------------------------------------------------------------PSSHA---AL.
F2JMF4_CELLD/8-142---------------------------------------------------------------------PSSHS---AF.
E6SHJ0_THEM7/12-146---------------------------------------------------------------------PSAHA---AL.
K9S6R1_9CYAN/8-143---------------------------------------------------------------------PSAHS---AL.
E3PRG0_CLOSD/8-144---------------------------------------------------------------------PSSHT---SF.
R5N6N4_9CLOT/8-137---------------------------------------------------------------------PSSHS---AI.
B1YKA4_EXIS2/4-132---------------------------------------------------------------------PSSHS---ST.
R5GZB8_9FIRM/8-144---------------------------------------------------------------------PSSHS---AT.
D5WTV2_KYRT2/8-146---------------------------------------------------------------------PSSHA---AV.
R6PRB8_9FIRM/8-139---------------------------------------------------------------------PSSHS---SF.
E6UEQ9_RUMA7/8-144---------------------------------------------------------------------PSGHS---AT.
C1N1Q0_MICPC/8-144---------------------------------------------------------------------PSSHS---AL.
L0A6P8_DEIPD/5-141---------------------------------------------------------------------PSSHT---AM.
M1E7F3_9FIRM/5-139---------------------------------------------------------------------PSSHS---AL.
R6USA8_9FIRM/5-142---------------------------------------------------------------------PSSHS---ST.
A9SA98_PHYPA/3-154---------------------------------------------------------------------PSSHS---AA.
E3DMH7_HALPG/3-133---------------------------------------------------------------------PSSHS---SF.
E4U9L1_OCEP5/5-141---------------------------------------------------------------------PSSHS---AM.
E8N0A2_ANATU/6-140---------------------------------------------------------------------PSSHS---AL.
K9SNJ2_9CYAN/8-142---------------------------------------------------------------------PSSHS---AL.
F0T097_SYNGF/8-149---------------------------------------------------------------------PSSHT---AI.
A8FH06_BACP2/4-149---------------------------------------------------------------------PSSHS---AA.
A9SE32_PHYPA/36-170---------------------------------------------------------------------PSSHS---AL.
I0JQ19_HALH3/6-151---------------------------------------------------------------------PSSHS---AA.
R5SAC8_9GAMM/12-144---------------------------------------------------------------------PSSHS---AG.
M4FCC5_BRARP/76-227---------------------------------------------------------------------PSTHS---SS.
G8LW53_CLOCD/8-141---------------------------------------------------------------------PSSHS---AF.
C8WVG2_ALIAD/12-152---------------------------------------------------------------------PSSHS---AG.
R5ADD7_9CLOT/7-149---------------------------------------------------------------------PSSHS---AV.
D4K6A9_9FIRM/9-148---------------------------------------------------------------------PSAHS---AT.
K3YAI4_SETIT/11-145---------------------------------------------------------------------PSSHS---AT.
R7F8Q2_9CLOT/8-142---------------------------------------------------------------------PSSHS---AV.
A3DDN6_CLOTH/8-143---------------------------------------------------------------------PSSHS---SF.
K9Z2J9_CYAAP/8-142---------------------------------------------------------------------PSAHS---AL.
K9P352_CYAGP/15-157---------------------------------------------------------------------PSSHS---SL.
K9XC51_9CHRO/8-143---------------------------------------------------------------------PSAHS---AL.
R6Y7H0_9FIRM/7-149---------------------------------------------------------------------PSSHS---AV.
E1RAI3_SPISS/5-141---------------------------------------------------------------------PSSHS---AA.
X2GPK1_9BACI/6-151---------------------------------------------------------------------PSSHS---AS.
R5R4Q1_9FIRM/8-145---------------------------------------------------------------------PSAHS---AT.
Q7V118_PROMP/8-139---------------------------------------------------------------------PSSHS---AL.
B8E2Q0_DICTD/12-146---------------------------------------------------------------------PSSHS---AL.
K4KZ53_9FIRM/8-148---------------------------------------------------------------------PSSHT---AI.
R6EV23_9FIRM/8-145---------------------------------------------------------------------PSSHS---AT.
D6Y193_BACIE/4-149---------------------------------------------------------------------PSSHS---AA.
F5WQX5_ERYRF/7-143---------------------------------------------------------------------PSSHT---AL.
C4L0Z0_EXISA/3-131---------------------------------------------------------------------PSSHS---ST.
D7GPW8_9FIRM/6-142---------------------------------------------------------------------PSSHS---AT.
D5E1E4_BACMQ/2-142---------------------------------------------------------------------PSSHS---AG.
A4J281_DESRM/9-144---------------------------------------------------------------------PSSHS---AM.
I0JIT0_HALH3/2-142---------------------------------------------------------------------PSSHS---AG.
E1Z6N1_CHLVA/1-136---------------------------------------------------------------------PSSHT---GL.
D3PLN0_MEIRD/5-141---------------------------------------------------------------------PSSHS---AT.
Q8DMU2_THEEB/9-144---------------------------------------------------------------------PSSHS---AL.
A4RUH5_OSTLU/12-147---------------------------------------------------------------------PSSHT---AL.
Q5L0A2_GEOKA/2-142---------------------------------------------------------------------PSSHS---AG.
W1NTD9_AMBTC/34-169---------------------------------------------------------------------PSSHA---AT.
K8EPQ0_CARML/4-150---------------------------------------------------------------------PSSHS---AG.
C6CSF5_PAESJ/6-132---------------------------------------------------------------------PSTHT---TV.
G2TKM5_BACCO/4-146---------------------------------------------------------------------PSSHT---SM.
K9TPQ7_9CYAN/8-143---------------------------------------------------------------------PSAHS---AL.
N0B1X3_9BACI/2-142---------------------------------------------------------------------PSSHS---AG.
V5WJH0_9SPIO/5-132---------------------------------------------------------------------PSAHS---AF.
C9RC18_AMMDK/8-140---------------------------------------------------------------------PSAHS---AM.
L7VUG0_CLOSH/9-141---------------------------------------------------------------------PSSHT---AF.
R5J5K1_9FIRM/8-139---------------------------------------------------------------------PSSHS---SF.
C1E358_MICCC/7-142---------------------------------------------------------------------PSSHT---AL.
R7MBM3_9CLOT/16-148---------------------------------------------------------------------PSSHS---AG.
R6B6R3_9CLOT/12-145---------------------------------------------------------------------PSAHS---AV.
A5GRZ6_SYNR3/9-137---------------------------------------------------------------------PSSHS---AL.
R7B1C9_9CLOT/8-144---------------------------------------------------------------------PSSHS---ST.

PF10261

Q5KDG2_CRYNJ/99-376CTGVPLTPDALPELFALLPGGGKGTAIPPGGGPTASHESLAPLPRP.R...............WHKGFDISGHS---FLL
G2QCT9_MYCTT/113-344C........................................KASGG.S...............WRGGHDISGHV---FLL
E3RV27_PYRTT/85-309C........................................KAVGG.T...............WKGGHDISGHV---FLL
R7YND5_CONA1/92-324C........................................KLVGG.Q...............WKGGYDISGHV---FLL
G2XHJ1_VERDV/98-323C........................................KAAGG.A...............WKGGHDISGHV---FLL
C4Y4H3_CLAL4/57-287C........................................RRLKG.S...............WEGGHDPSGHV---FLL
C5DQ74_ZYGRC/35-359C........................................RATGG.H...............WKGGHDPSGHI---FLN
G8BYR0_TETPH/33-386C........................................KRNGG.H...............WVGGHDPSGHI---FLL
E3KJ35_PUCGT/96-348C........................................QHRWGRKLPGLDNFILSTYKPYWSEGIDVSGHV---FLL
N1RPR7_FUSC4/66-290C........................................KAAGG.K...............WKGGHDISGHV---FLL
F9WXZ1_ZYMTI/84-317C........................................KATGG.T...............WRGGHDISGHV---FLL
G3BAX8_CANTC/92-323C........................................RQLRG.N...............WEGGHDPSGHV---FLL
G8BIE7_CANPC/69-321C........................................RKFKG.S...............WLGGYDPSGHV---FLM
C5FE12_ARTOC/64-296C........................................KASGG.T...............WEGGHDVSGHA---FML
G8ZXV3_TORDC/32-356C........................................RTLGG.Y...............WVGGHDPSGHI---FLI
A5DKF9_PICGU/56-288C........................................RRLKG.T...............WQGGHDPSGHV---FLL
E3QPL9_COLGM/87-312C........................................KASGG.R...............WSGGHDISGHV---FLL
S3CVS7_OPHP1/100-357C........................................KNAGG.T...............WSGGHDISGHV---FLL
A3LYM5_PICST/59-299C........................................RRIKG.S...............WEGGHDPSGHV---FLL
G0WG33_NAUDC/40-380C........................................RMHGG.Y...............WTKGHDPSGHI---FLL
M3IZX9_CANMX/56-283C........................................RKMKG.N...............WIGGHDPSGHV---FLM
G3JBH7_CORMM/90-318C........................................KASGG.R...............WSGGHDISGHV---FLL
R9AQ78_WALI9/64-296CYPQLLP...........................ASASTTTTSPTSAK...............WVGGHDVSGHT---FLL
C5E2P1_LACTC/32-359C........................................RSMGG.Y...............WIGGHDPSGHI---FLI
T0K1V0_COLGC/87-312C........................................KAAGG.K...............WRGGHDISGHV---FLL
G8Y1H9_PICSO/62-313C........................................RKLKG.A...............WTGGHDPSGHV---FLL
C5G9K2_AJEDR/75-292C........................................KASGG.A...............WTGGHDVSGHV---FML
C5MI48_CANTT/55-284C........................................RKFKG.N...............WIGGHDPSGHV---FLM
N1Q4W5_DOTSN/87-323C........................................KAIGG.Q...............WRGGHDISGHV---FLL
S3DE95_GLAL2/81-314C........................................KAVGG.Q...............WLGGHDISGHV---FLL
R9P3R6_PSEHS/103-383CRTRTPLSSSSHPA..............LFSSNSAATLKTSKSIRA.M...............WKGGHDISGHT---FIM
N1Q6I4_PSEFD/84-317C........................................KAVGG.Q...............WAGGHDISGHV---FLL
K2R4W1_MACPH/94-328C........................................KVAGG.T...............WKGGHDISGHV---FLL
N1QNJ0_SPHMS/101-335C........................................KAIGG.Q...............WRGGHDISGHV---FLL
F7WC52_SORMK/81-344C........................................KAAGG.R...............WTGGHDISGHV---FLL
M2N8T6_BAUCO/89-327C........................................KAIGG.Q...............WRGGHDISGHV---FIL
K9G927_PEND2/67-311C........................................KNAGG.A...............WRGGHDISGHV---LML
C4R337_KOMPG/57-293C........................................RSIKG.E...............WTGGHDPSGHV---FLL
A1CR84_ASPCL/74-313C........................................KAAGG.V...............WAGGHDVSGHV---FML
A5E4A1_LODEL/62-350C........................................RKLRG.N...............WEGGHDPLGHV---FLM
U1G5N5_ENDPU/81-322C........................................KAFGG.K...............WLGGHDISGHF---FML
E5R3U3_ARTGP/64-297C........................................KASGG.T...............WKGGHDVSGHA---FML
K1WMV9_MARBU/113-341C........................................KAVGG.E...............WKGGHDISGHV---FLL
G0VEA6_NAUCC/39-386C........................................RSHGG.Y...............WTMGHDPSGHI---FLI
Q6FR77_CANGA/32-368C........................................RLNGG.Y...............WQGGHDPSGHI---FLL
E9EF85_METAQ/84-313C........................................KAAGG.K...............WNGGHDISGHV---FLL
R8BRZ8_TOGMI/87-311C........................................KAAGG.R...............WSGGHDISGHV---FLL
M9LJJ3_PSEA3/95-341CRTRTPLSSTS...................HPALFSGSGAAKSIRA.A...............WRGGHDISGHT---FIM
M1VZ69_CLAP2/82-312C........................................KTSGG.R...............WSGGHDISGHV---FLL
V5GE99_BYSSN/78-302C........................................KAAGG.S...............WRGGHDVSGHI---FML
I2FTC6_USTH4/101-374CRTRTPLSSSTH..................PALFSSSSLRSKSIQA.I...............WKGGHDISGHT---FIM
G8JR11_ERECY/38-363C........................................RKLGG.Y...............WTGGHDPSGHV---FLI
Q6BUP0_DEBHA/108-353C........................................RKLKG.S...............WEGGHDPSGHV---FLL
Q4WJI3_ASPFU/73-304C........................................KAAGG.S...............WTGGHDVSGHV---FML
G2R9R1_THITE/97-341C........................................KASGG.R...............WSGGHDISGHV---FLL
I4YGQ8_WALMC/41-264CYPQPL.............................NSADTSAPLKAAK...............WVGGHDVSGHT---FLL
G2XPX9_BOTF4/55-288C........................................KAVGG.K...............WKGGHDISGHV---FLL
G3AEN0_SPAPN/55-285C........................................KRIKGSS...............WEGGHDPSGHV---FLL
C7Z7P3_NECH7/60-283C........................................KAAGG.K...............WKGGHDISGHV---FLL
E7KCE6_YEASA/33-370C........................................RRFGG.H...............WAGGHDPSGHV---FLA
G3YDY9_ASPNA/76-295C........................................KHAGG.A...............WKGGHDVSGHV---FLL
L8FY78_PSED2/112-347C........................................KANGG.K...............WSGGHDISGHV---FLL
A7TR39_VANPO/62-394C........................................RAHGG.H...............WVGGHDPSGHM---FIL
N1JKB0_BLUG1/90-317C........................................KAAGG.K...............WKGGHDISGHV---FLL
B6Q6E7_TALMQ/81-304C........................................KASGG.L...............WRGGHDVSGHV---FML
B8M5R8_TALSN/84-316C........................................KASGG.L...............WKGGHDVSGHV---FML
C8V5A4_EMENI/56-278C........................................KAAGG.A...............WRGGHDVSGHV---FML
G0T001_RHOT2/1044-1290C........................................TGAKGEY...............WRGGHDVSGHA---FMM
Q6CKM7_KLULA/25-334C........................................SYAGG.H...............WVGGHDPSGHI---FLI
Q75EB2_ASHGO/35-359C........................................SRLGG.H...............WMGGHDPSGHV---FLI
M7SYX4_EUTLA/110-375C........................................RAAGG.R...............WSGGHDISGHV---FLL
E9CZW5_COCPS/67-291C........................................KMVNG.A...............WNGGHDVSGHA---FML
F0XPI2_GROCL/81-317C........................................KRAGG.R...............WSGGHDISGHV---FLL
A7UX33_NEUCR/112-389C........................................KAAGG.K...............WQGGHDISGHV---FLL
J3NLN2_GAGT3/91-336C........................................RTAGG.R...............WRGGHDISGHV---FLL
A7EQ03_SCLS1/55-288C........................................KAVGG.K...............WRGGHDISGHV---FLL
G9NCA4_HYPVG/72-300C........................................KAAGG.K...............WKGGHDISGHV---FLL

PF01569

Q29NI1_DROPS/70-187AFYVLIF----FTK----LYSLNFVF.....................................-----------------
A4I568_LEIIN/102-249MAGFSVY----LLR----RWTRARRNRTERRKYSH...LQQRKAA.SASAALA..RTSSPYAL-----------------
DOPP1_DICDI/54-178MFFFAVL----MTL----FYLKKRIRFGS...............K.I..............LP-----------------
Q17D95_AEDAE/56-197STTYLYV----IFS----VLEEAGMQYG................K.M..............VV-----------------
G6PC3_MOUSE/53-195TGAALWP----VMT----AISSQVASRSR...............S.P.............WVR-----------------
A0BM37_PARTE/91-226SQAMCFL----LPS----ILFPAIWKDQPN.............CK.YP...........LYLR-----------------
Q23FV4_TETTS/102-237NLVMVYV----SHY----IADNDCFKMLIKG...........ENG.KYK.........LHQRR-----------------
A0EE96_PARTE/81-240SFVFYTI----LIE----TIVLKKYNIQENCSLIQSDKQALDEKEISNSELYKQIYSNQYISY-----------------
A8FE89_BACP2/71-198AATIYPF----IAY----LLVEMIPWLK................E................RQ-----------------
A0LYQ4_GRAFK/59-183STGVAVF----LSL----LFKKHYPK.....................................-----------------
Q7MUE1_PORGI/58-185YISLALF----TSR----IFRNKFYT.....................................-----------------
A0K0K5_ARTS2/118-241ACDFLLV----TTF----LIFSRRQSTW.................................PA-----------------
A4XP73_PSEMY/98-234LLIWALF----MSF----FARNWRLL.....................................-----------------
A4X1H8_SALTO/101-242TIVWYGV----IVL----LLARLLETYGR...............T.L..............PP-----------------
Q9EWX3_STRCO/115-237AVVTWGI----LAY----LASTHRTR.....................................-----------------
A1BJZ6_CHLPD/56-185AAAVAAT----IWI----YFYRNGSIV...................................D-----------------
A4FQA0_SACEN/76-196AAASAVA----LAF----AWRRLAVA.....................................-----------------
B0U8C7_METS4/61-186AFALSTA----IWY----ASRSLGSF.....................................-----------------
A1S1V4_SHEAM/77-196VFVIAGM----AWT----LCRRTDIK.....................................-----------------
A1W5E3_ACISJ/72-191AALVAGA----LWP----LTGVRHRL.....................................-----------------
A5CF96_ORITB/78-203TFFIVAC----LWH----KLNRIGKF.....................................-----------------
B4U5Z7_HYDS0/54-171AFVIAMV----GSY----NEKPLVKA.....................................-----------------
A5DBA1_PICGU/102-232ATAVSLV----LFS----RLYDSRDQFT................P.I..............KF-----------------
Q4D544_TRYCC/102-225SVLFSYC----AYN----LLVFLFPTY...................................T-----------------
SSPA_DICDI/88-218AFGLTFY----FLI----YTYFLFPTIGE..............SF.N.............ISL-----------------
Q32GQ5_SHIDS/77-232AASWALL----AVG----LLWPRRRT.....................................-----------------
Q9CMX4_PASMU/75-237AATWLML----VVG----FVHLLSVRSL.................................TA-----------------
Q21JU9_SACD2/110-231AFLAATL----FFH----YLNSVKMR.....................................-----------------
C1DG09_AZOVD/106-238VTASAIV----MSE----IVPERKSE.....................................-----------------
Q0K1U6_CUPNH/103-229GWAWALI----LAE----VEPERAND.....................................-----------------
Q65GX3_BACLD/179-304AYLSAFA----MAY----AIPERYQE.....................................-----------------
Q2IJN8_ANADE/141-265AVAALTA----ASW----TYTLRRGPA....................................-----------------
Q6FEM9_ACIAD/65-182AVMATIT----LGY----VQPILVVL.....................................-----------------
A1K7H5_AZOSB/105-237GFYLVSL----GFL----GGAAARRR.....................................-----------------
Q3SNT4_NITWN/91-218AFWTLAP----AAL----TPPAWRPL.....................................-----------------
Q6MBQ7_PARUW/87-223GFYFFSF----LWL----GKHYRSYFL...................................Y-----------------
A8EX54_ARCB4/94-229GFSLMAL----FFL----FKKPRNQK.....................................-----------------
Q87X15_PSESM/102-231GFTLFAL----FFM----LRDRRPRLA....................................-----------------
Q03CR8_LACC3/177-306AATLLTL----TWF----VDRDKPKRQ....................................-----------------
R5ZI70_9ACTN/141-283GLMLAGL----PAA----AFKEKPSRR....................................-----------------
A8BDI5_GIAIC/110-282ALFPLPI----LTY----LLAQMYIKVVDSERTP....STSGQGR.LKYMLW...LVFFYLGV-----------------
A8BQZ4_GIAIC/121-285AAYCILP----SVA----YIIQLFELIRAYWAP.......RLLGL.TILSI......VMGLLL-----------------
Q6MTZ1_MYCMS/144-270ATTLLFV----LLL----FNKINKKA.....................................-----------------
R5TP42_9FIRM/95-216SLAACIA----IAQ----SEQLKKHP.....................................-----------------
A3LWS4_PICST/248-396SSLVFFF----VCY----YSRTSIFK.....................................-----------------
Q127S7_POLSJ/95-224AFFSGFW----LHH----LMRQFRAP.....................................-----------------
A4CJ32_ROBBH/299-448SGAAATA----LTS----IFGDNFAFDDDT.............EL.PY............GLP-----------------
Q2HER5_CHAGB/260-418GGAAAAV----LRA----WNGGKDKIAGTGVT.........VSSN.VTLD........ARGVI-----------------
A8L0R7_FRASN/276-428TTASMST----LAF----FFGRDDIPFSA..............YS.AD............SGT-----------------
Q4YWD7_PLABA/107-241TTLFVFT----WLY----YEKNLFIK.....................................-----------------
Q6NJR5_CORDI/194-319VTASVIT----LYL----IAKTAQHQLW..................................R-----------------
A1SKJ7_NOCSJ/98-218AVAVYCG----IAL----LLAWVAPRT....................................-----------------
Q82Z33_ENTFA/85-204AMALVCT----ILI----ILTYLHVEK...................................T-----------------
A2DYB5_TRIVA/98-241AMSGFVI----IAF----FVQRIIKSKN................L................VG-----------------
A2EZZ9_TRIVA/91-236AASGALF----FSL----SLISIIDHNR................V................WS-----------------
A4H9E7_LEIBR/233-378GFSAFVP----LCF----YVLHSLHAFRR..............SG.VS............LWR-----------------
Q6BYN9_DEBHA/112-272VFCGMVI----TSL----NFAGKLQIFDK..............RG.I.............SFK-----------------
A7EIU4_SCLS1/134-294AFAGFVF----LSL----YLNAKLKVWSN..............YH.PA............MWK-----------------
A7TF94_VANPO/122-266ISSGMGF----IFL----WQCYFVNGN....................................-----------------
Q2TYI3_ASPOR/35-224AWAGLLY----LSL----WLCAKFAIIPPSHRTGH..SALTRNGP.PAYPLTS.RPAAPPLYL-----------------
A2EQG2_TRIVA/90-230AMAAAIF----LCL----YIGELIPYYN................N................VT-----------------
PLPR5_MOUSE/122-275SVYAATY----LTM----YITSTIKAKGT...............R.L..............AK-----------------
Q9VNU2_DROME/65-225SFYSMVL----LAL----YVHGVWRGRGG...............V.R.............VLR-----------------
A8WXP5_CAEBR/128-286AFHVFLF----VYI----YLRRMATNTGI..............KE.II............TVR-----------------
A6X217_OCHA4/121-242AGIMMVS----LWI----FLPRWRVL.....................................-----------------
Q5NGF4_FRATT/116-236VGAMFIA----FFY----IFPKLRYF.....................................-----------------
Q5ZX13_LEGPH/91-208ITALAAG----LGF----LFPRYFFL.....................................-----------------
Q6MH55_BDEBA/105-226IFTVATM----LSV----AFPRFKWF.....................................-----------------
B4S7E2_PROA2/140-261AFAVSSA----LSQ----RIDRPLAS.....................................-----------------
Q7NZZ5_CHRVO/815-932LFATVTP----FAK----EYDQPWLY.....................................-----------------
Q0SBZ7_RHOJR/226-347AMALFTM----AAV----MFGYALSPTR..................................R-----------------
Q89JR9_BRADU/79-199MGALASA----AGA----MPAGPRRA.....................................-----------------
B7VND8_VIBTL/235-351WVSLTLL----VFW----KLKRLLEQ.....................................-----------------
Q5E4L0_VIBF1/241-366SVVIYGT----FYL----ILKRLSLPEK.................................IL-----------------
Q9RVR6_DEIRA/14-135SATLWLG----IAA----QVRRPAFT.....................................-----------------

PF14378

Q5K8D7_CRYNJ/128-311SFVIGLS----LFL----YSPHR...------------------------------------------------------
B0UG28_METS4/124-315ALITAWA----...----LAPVP...------------------------------------------------------
A1SJR6_NOCSJ/50-230DLLVGLA----IAT----AATTL...------------------------------------------------------
C5APU7_METEA/131-322AVLTAWA----...----LAPVP...------------------------------------------------------
E4NIW3_KITSK/45-228ALWCAYA----AWS----ALRPAR.P------------------------------------------------------
Q989C0_RHILO/119-308GIIITYA----...----MRRTP...------------------------------------------------------
G8WRV6_STREN/158-347ALWCGVM----LWR----YAENR...------------------------------------------------------
C7QD07_CATAD/71-251AVLVGWT----VWR----VSPSK...------------------------------------------------------
Q1D5Z1_MYXXD/96-274TMLVLYY----AWR----FSRRV...------------------------------------------------------
Q2G5H1_NOVAD/115-305AILLGWA----SLS----WLWVR...------------------------------------------------------
U4LB32_PYROM/137-324SFVIGLT----LAT----MPNTRHRW------------------------------------------------------
Q1IHV8_KORVE/153-330VLLAYWN----SRD----TKAAI...------------------------------------------------------
F2R3P1_STRVP/39-228ALWCGVM----LWR----YGRTP...------------------------------------------------------
A9HHP2_GLUDA/131-314AFLFTYS----...----QRGIR...------------------------------------------------------
Q13PQ7_BURXL/110-293ALCFAYA----...----LRHAG...------------------------------------------------------
R6XNQ9_9FIRM/3-178ATEFGVA----LFI----SKNKK...------------------------------------------------------
Q63V72_BURPS/125-308GVLFAYA----...----LRRGR...------------------------------------------------------
Q01VD1_SOLUE/159-330SLMLFWM----ARP----WRSLR...------------------------------------------------------
D1CA82_SPHTD/53-235ALFCGIG----VIR----VGRKL...------------------------------------------------------
K0K1I4_SACES/40-223TTWCAYA----LWT----TLRDHA.P------------------------------------------------------
D1C524_SPHTD/53-234ALFVALG----VIR----LSRSR...------------------------------------------------------
W5TLL4_9NOCA/53-242ALWCGLM----LYR----FGRTE...------------------------------------------------------
D3HTE9_LEGLN/101-283AVLCVNL----...----VRDWK...------------------------------------------------------
Q2JBQ4_FRASC/47-236SLWCGFL----LVR----FGRRP...------------------------------------------------------
W0BEC4_9GAMM/94-276AWFCLYL----...----LRPWP...------------------------------------------------------
Q220L9_RHOFT/109-292AVLLVYA----...----MRGTG...------------------------------------------------------
G2P916_STRVO/51-241ALWCGVA----LWR----HGRWT...------------------------------------------------------
Q87M50_VIBPA/146-355AVLMALC----TYR----LNKTL...------------------------------------------------------
B1LSY3_METRJ/129-320ALLTAWA----...----LAPVP...------------------------------------------------------
A2BL06_HYPBU/51-224AVIFGYY----YVK----LYGGS..R------------------------------------------------------
L0PFU2_PNEJ8/5-201AMLEALF----LSH----IFPKT...------------------------------------------------------
C9Z2S2_STRSW/63-253ALWCGVI----LWR----LGSGS..R------------------------------------------------------
B9L518_THERP/33-215AVFVCLG----LFR----LSGNR...------------------------------------------------------
E3JAH2_FRASU/94-282ALWCGFL----IAR----HARRP...------------------------------------------------------
F8AWV4_FRADG/47-236ALWCGWN----IAR----LARHR...------------------------------------------------------
R7Y200_9ACTN/124-318TLLVALM----VQY----TLRNR...------------------------------------------------------
A0LS47_ACIC1/69-252AAWVLAV----LAR----LHMSR...------------------------------------------------------
E2Q4K3_STRC2/45-234ALWCGVI----MWK----YGRGP...------------------------------------------------------
F8J559_HYPSM/123-309AVLLAYG----...----WMAVP...------------------------------------------------------
L0ET54_LIBCB/102-293ATLCIWA----...----AWPLK...------------------------------------------------------
Q89QL0_BRADU/109-300GLLFLLA----...----LWPVR...------------------------------------------------------
B1VW42_STRGG/49-238SIWCGIL----LWR----HGRHP...------------------------------------------------------
C5AQ48_METEA/107-294AYLVTAA----...----IWPLQ...------------------------------------------------------
H0PVV4_9RHOO/74-256AIIFMYV----...----HRGQR...------------------------------------------------------
E3EJC2_PAEPS/1-162AFALAAI----LWL----HHQKY...------------------------------------------------------
G0HGL8_CORVD/79-265ATFCGIV----IVM----YTKNH...------------------------------------------------------
A1SDU3_NOCSJ/130-324TLLVALM----IQY----TVRSR...------------------------------------------------------
C7QBQ6_CATAD/84-272STWCALV----IAH----LAQRR...------------------------------------------------------
A1SHK3_NOCSJ/128-322TCTVLLV----ARY----YRWRR...------------------------------------------------------
E3J0M0_FRASU/110-299ALWCGLL----IAR----HARWL...------------------------------------------------------
C8XDB0_NAKMY/22-205SALCAYT----AWL----ALRDKH.P------------------------------------------------------
G7XGU5_ASPKW/117-299SMFIALC----LLK----FSPHW...------------------------------------------------------
N0BE90_9RHIZ/119-305AILFAFA----...----WSSVP...------------------------------------------------------
B1LVV6_METRJ/99-290GGLYIWA----FWS----LRAAR...------------------------------------------------------
Q5ZV46_LEGPH/101-283AVLCVYL----...----IKDWF...------------------------------------------------------

PF14360

SLS2_TRYB2/201-275LTLHLMF----HWI----YGAMVHWS---------------------------------....-----------------
B8C480_THAPS/431-503TMSFVCV----VFK----YFNFKS..---------------------------------....-----------------
IPCS3_ARATH/172-244TLVFVRT----YQR----YGTRRW..---------------------------------....-----------------
SAMD8_HUMAN/292-365LTMLNFF----VTE----YTPRSWNF---------------------------------....-----------------
A2DHW8_TRIVA/46-124MWQSSRW----IME----TTSRMLPT---------------------------------LG.S-----------------
A9RPY7_PHYPA/269-340AVLTAMA----WQE----AYPGW...---------------------------------....-----------------
SLS_LEIMA/211-286LSLAFIL----AWD----YSPFLHPW---------------------------------....-----------------
A5K283_PLAVS/202-273TTIFLLF----ALF----YVNSVV..---------------------------------....-----------------
Q4YWD8_PLABA/201-272STIFLLF----IFC----YMDNVV..---------------------------------....-----------------
B3L7G0_PLAKH/276-347TTVLKFF----WMF----YEKKIY..---------------------------------....-----------------
Q28DN3_XENTR/220-293LTLTYLF----IKE----YSPRHFWW---------------------------------....-----------------
Q4N3L0_THEPA/182-253VILAFII----LSQ----NSGFL...---------------------------------....-----------------
A8XDY1_CAEBR/127-200MVTCSLA----VAY----YLPKSIKP---------------------------------....-----------------
IPCS_ORYSJ/172-244TLVFVRT----YHK----YGSKRL..---------------------------------....-----------------
A9SUW6_PHYPA/174-246ALTFFHS----YVK----YGTRQW..---------------------------------....-----------------
SMSR1_CAEEL/321-394ITMISHF----ITE----YTPADWTG---------------------------------....-----------------
Q17C33_AEDAE/230-303LVMGYLI----IAE----YSPKKFWI---------------------------------....-----------------
SMS2_CAEEL/201-274LTIMYFV----QLQ----YTPRGLVI---------------------------------....-----------------
A8X0T5_CAEBR/264-337LVVSALF----IGE----YSPRRFYI---------------------------------....-----------------
A9S9I4_PHYPA/275-346AVLTAMA----WQE----AYPGW...---------------------------------....-----------------
B3SD02_TRIAD/279-352VTLSNFF----ITE----YTPDSWHL---------------------------------....-----------------
A2DN61_TRIVA/170-240FMFPGLI----HHR----FFNKK...---------------------------------....-----------------
C5KN45_PERM5/142-213AILATCA----IFR----YAQNWY..---------------------------------....-----------------
C5L5L1_PERM5/146-217VISITCA----LFR----YAEHWS..---------------------------------....-----------------
SMSR2_CAEEL/246-319IFTAFLV----FKT----YAPQRLQP---------------------------------....-----------------
B5YLZ6_THAPS/422-494TSTLGCA----STS----VASNTR..---------------------------------....-----------------
C6KT87_PLAF7/201-272TTIFLMF----SFY----YINNVI..---------------------------------....-----------------
D0MWV3_PHYIT/192-264TVSFILT----VWK----YWPNKY..---------------------------------....-----------------
B7FUU7_PHATC/326-397TSTLACV----AVS----AHPSKV..---------------------------------....-----------------
SLS11_TRYCC/193-267ITLSLLV----QWI----YGSMLHWV---------------------------------....-----------------
D2VDJ4_NAEGR/246-319ITILNYT----INE----YTPKHWKG---------------------------------....-----------------
C5KL60_PERM5/83-154ITLSMMF----WMD----YTASVQ..---------------------------------....-----------------
D2VXN5_NAEGR/191-270LILVFWF----VWY----YSHSDRWS---------------------------------KAVR-----------------
D2VKR1_NAEGR/196-272LSVVCWF----VWY----YSNKEWVG---------------------------------R...-----------------
B9HC73_POPTR/172-244TLVFVLT----YQK----CGTKRC..---------------------------------....-----------------
C6KT86_PLAF7/265-336TTLLTFF----WFF----YERNIY..---------------------------------....-----------------
C4LV27_ENTHI/184-261LTLCAFI----WEY----YSEKVPFF---------------------------------NP..-----------------
A2FIE9_TRIVA/168-238FIFPGLI----HHH----FIGKI...---------------------------------....-----------------
B7QHG5_IXOSC/233-306LTLAYLV----VRE----YSPQRCKV---------------------------------....-----------------
C5LU78_PERM5/899-971CLLATLV----VTH----YSRSLV..---------------------------------....-----------------
C5KY50_PERM5/57-128VTLATMV----WWD----YTSSIA..---------------------------------....-----------------
D0NII4_PHYIT/164-244TNSAVLL----YLR----TLARNFAG---------------------------------RTAS-----------------
A7ANZ4_BABBO/239-311SISIMLM----FVL----HNRQWY..---------------------------------....-----------------
A0JMN0_DANRE/269-342LTLTYLF----IKE----YSPRRFWW---------------------------------....-----------------
C3XQA8_BRAFL/273-346LTITYLF----IKE----YSPRGWFI---------------------------------....-----------------
A0A0H5S654_BRUMA/218-291LVTSCLF----ITE----YSPQRWKP---------------------------------....-----------------
F8W5G6_DANRE/232-307LTLTFLF----IYE----YSPRSRLW---------------------------------T...-----------------
F6UTK5_XENTR/280-353LTLTYMF----IKE----YSSPRLWL---------------------------------....-----------------
H3CAZ2_TETNG/175-248LTLSYLF----IKE----YSPPWMWW---------------------------------....-----------------
J9FFV7_WUCBA/189-261MVVSSLT----VAY----YLPDSFRP---------------------------------....-----------------
Q4U956_THEAN/200-270TVITCIL----FVE----NAKYLI..---------------------------------....-----------------

PF02681

F2NNY3_MARHT/5-141VAAAVVG....VGL....TEGWGSPL------------------------------------------------------
K9T6M6_9CYAN/8-143VGSLATG....VGL....TAGWSSPE------------------------------------------------------
D4ZTL8_ARTPN/8-143VGALAAS....VGQ....VIGWGSPE------------------------------------------------------
K9WGM7_9CYAN/8-143VAALAAG....VGQ....TMGWDSPD------------------------------------------------------
B7GI74_ANOFW/24-164VASLATY....VAL....KRGVHSID------------------------------------------------------
B1WS33_CYAA5/8-143VGALATG....VGL....TRGWESPE------------------------------------------------------
R5AEV3_9CLOT/9-146VCALSVS....ALL....HYGVGSPV------------------------------------------------------
Q31Q62_SYNE7/9-145VAALATA....VGR....QQGWGSLE------------------------------------------------------
R5XG63_9CLOT/5-137VTCLSML....VGF....DRGFASTE------------------------------------------------------
D4JCM8_9FIRM/8-144VTALSMA....VGI....QEGFDSTL------------------------------------------------------
W0E929_9FIRM/8-143VCALSVG....IGK....YYGWDSPI------------------------------------------------------
D3FYY4_BACPE/4-149VTALSTA....VAI....EHGMDSTI------------------------------------------------------
F0RVM2_SPHGB/6-143VIALVTS....IAL....TQGIGTVY------------------------------------------------------
H6NB79_9BACL/2-142VVSLATY....VGL....KKGFASIP------------------------------------------------------
Q7V6P1_PROMM/15-147VTGTAAG....VGW....EMGFDHSG------------------------------------------------------
Q18B69_PEPD6/8-140VTSLATV....VGI....EKGFNSTD------------------------------------------------------
G0GF41_SPITZ/9-149VTALATS....IGF....HDGADSSL------------------------------------------------------
Q65FE5_BACLD/4-149VTALSTG....VAL....DHGMDSSL------------------------------------------------------
U5LF62_9BACI/2-142VSSLTTF....IAL....KRGLPTID------------------------------------------------------
R7L0C2_9FIRM/5-149VCSAAAG....VYR....VDGANSTQ------------------------------------------------------
Q5WDV5_BACSK/4-146VTALSTA....VAI....EHGLDSSL------------------------------------------------------
D6GSF2_FILAD/8-144VIGLANS....VGL....TEGYDSTI------------------------------------------------------
E6U5K5_ETHHY/8-143VCALFVG....VLR....RCGAASPE------------------------------------------------------
Q5SJ95_THET8/4-140VSALAVS....VGL....REGFDTSL------------------------------------------------------
R5GK39_9FIRM/5-157VVSVSLY....LLR....LEGFGSTT------------------------------------------------------
Q9RSQ8_DEIRA/8-143VSALSTG....IGL....TEGWDTPL------------------------------------------------------
P73185_SYNY3/8-143VGALATG....VGL....QKGWGSNE------------------------------------------------------
D1AKQ0_SEBTE/7-143VVALATS....LAL....LKGMRSVE------------------------------------------------------
E0RXA3_BUTPB/8-144VMALVTS....AFY....YFGAGSFE------------------------------------------------------
F5YE41_TREAZ/16-155VCSMATA....VGV....YDGIGSNL------------------------------------------------------
V5WEJ9_9SPIO/6-144VTALAVS....TGI....LEGINTTL------------------------------------------------------
U5LHE7_9BACI/5-149VTALSTG....VAL....ETGMDSAV------------------------------------------------------
K9XWG4_STAC7/8-143VGALATS....IGK....TMGWSSPE------------------------------------------------------
E6U2C7_BACCJ/4-149VTALSTA....IAL....EEGVGSPL------------------------------------------------------
R7M7X6_9CLOT/12-143VVSLTTM....IGK....NVGINSPL------------------------------------------------------
K9V3M2_9CYAN/8-143VTALAAG....VGQ....TIGWSSPD------------------------------------------------------
B9IAH9_POPTR/38-171VTALAVA....VGL....QEGTGSPA------------------------------------------------------
M0RZC5_MUSAM/20-155VAALAMA....IAL....EEGTGGSS------------------------------------------------------
R5ZD30_9FIRM/8-146VTGLAMA....IGM....QEGFNSAL------------------------------------------------------
R6Q3Q8_9FIRM/8-138VMALTTS....VGK....YNGFDSAL------------------------------------------------------
F4GLJ1_SPHCD/5-141VIALATA....TGI....IQGIGSNY------------------------------------------------------
C0ZKP9_BREBN/5-150VTALSTA....VGL....REGFGSNM------------------------------------------------------
D8TLE7_VOLCA/33-168IIALTTA....VAV....QDGTDSSL------------------------------------------------------
D4JU78_9FIRM/7-157VCATAIT....TCR....VCGICSPE------------------------------------------------------
K9YEC7_HALP7/8-143VASLATG....VGI....REGWESTD------------------------------------------------------
K3XML5_SETIT/24-159VTALAVA....IGF....QDGFNCSL------------------------------------------------------
K9RII7_9CYAN/8-143VTALAAG....VGQ....TIGWASPE------------------------------------------------------
K4LIZ6_THEPS/40-169SAALATS....LGL....DYGWTSPI------------------------------------------------------
E6TWS5_BACCJ/5-142VASLATY....IGL....RLGGRTLD------------------------------------------------------
R6V5P2_9CLOT/18-171VTGCIVI....TPIMYEAIYNATSQT------------------------------------------------------
Q73MW8_TREDE/10-150VASLTVS....IGI....RQGFDSDL------------------------------------------------------
Q8Y4P9_LISMO/4-149VTALMTT....LAI....EYGLDSPY------------------------------------------------------
M0SK26_MUSAM/139-272CTALTAS....VAL....CHGVSDSL------------------------------------------------------
I0GIV6_CALEA/8-146VTTLTIL....LGV....KYGFDSPY------------------------------------------------------
A9TH33_PHYPA/30-165VTGLACA....IGL....REGLGGPL------------------------------------------------------
G4KW10_OSCVS/4-137VTAMAVT....AGM....ECGLNSSV------------------------------------------------------
R5CL70_9FIRM/8-147VCALVVS....TAV....VYGPSGFE------------------------------------------------------
I0I5M8_CALAS/5-139VCSLVTA....IGY....QYGLDSGL------------------------------------------------------
D7CKU8_SYNLT/12-144VVALVAG....IGF....TLGYNSDE------------------------------------------------------
R7IRJ9_9CLOT/8-142AMCIATM....IGK....AEGFDSNI------------------------------------------------------
B8HXR8_CYAP4/8-143VAALATG....VGQ....TKGWGGTE------------------------------------------------------
B0C3J0_ACAM1/8-143VTTLATC....VGQ....VQGWDSTE------------------------------------------------------
I4DAH9_DESAJ/3-144MVGLTTG....CLF....EYGWGDPY------------------------------------------------------
Q46K07_PROMT/15-148VTGTAAG....IGL....QLGFNDPV------------------------------------------------------
R7A3G1_9CLOT/8-142VTCLATL....IGK....SEGVDSIM------------------------------------------------------
Q24V03_DESHY/8-143VSALAIG....VGK....YYGWSSPT------------------------------------------------------
K9VPU0_9CYAN/9-144VGALAAG....VGQ....TMGWDSPD------------------------------------------------------
D1BMJ6_VEIPT/9-146VIATTTA....IYL....KNGV.TDL------------------------------------------------------
Q10X44_TRIEI/8-143VAALAVG....VAQ....TKGWGSPE------------------------------------------------------
A4RZ57_OSTLU/3-142VTALAAG....VGA....QWGYDSGS------------------------------------------------------
D8QR56_SELML/24-159VIGLTVA....IGL....RDGTGGSL------------------------------------------------------
K4AZY7_SOLLC/140-274CTALTTS....VAI....CHGVADSL------------------------------------------------------
Q8ENX8_OCEIH/4-149VTALTTA....IGI....TEGVTSSV------------------------------------------------------
K7V114_MAIZE/48-182VGSLAVA....VGQ....QEGADSSA------------------------------------------------------
D4IXN8_BUTFI/8-143VSALIII....TGI....IYGGGSFE------------------------------------------------------
Q01ES7_OSTTA/128-261VVGLTTS....IVH....QHGLGSVY------------------------------------------------------
E3HA83_ILYPC/7-143ATSLATS....IAI....VEGMSSSY------------------------------------------------------
V5RVF1_9BACT/5-132VVSLATV....VGL....RDGLDSAI------------------------------------------------------
A6TR41_ALKMQ/8-144VMGLTTA....IGL....DKGFDSAI------------------------------------------------------
I1KRZ5_SOYBN/9-144VTALAAA....IGL....QEGFGGPL------------------------------------------------------
R5KDM7_9CLOT/8-150VGGLATV....AFL....QFGPDSFE------------------------------------------------------
R7I9S8_9FIRM/10-145VVSLTLM....IGA....TQGFDSAI------------------------------------------------------
R6BY11_9CLOT/8-144VCALATS....TCI....YYGAQSFE------------------------------------------------------
R5ITD2_9FIRM/8-144VCAVATS....AGI....IYGLDSFP------------------------------------------------------
K9RQD3_SYNP3/8-143VTALATG....VGL....EKGWESVE------------------------------------------------------
K9SVF9_9SYNE/8-143VTALATG....IGK....TQGWNSGL------------------------------------------------------
Q7VBG6_PROMA/16-148VMGTASG....IGL....EQGFDHPA------------------------------------------------------
O83188_TREPA/14-153VSALTLS....FAL....KCGLHSDL------------------------------------------------------
G8QY16_SPHPG/6-143VIALLTG....IGM....TEGIGTVD------------------------------------------------------
D3EMZ3_ATETH/8-144VGSLATS....IGL....TEGWESSE------------------------------------------------------
R5TH29_9CLOT/11-163ITGVIIACYELLPLVFDSTKPEDTKT------------------------------------------------------
A9TSJ4_PHYPA/1-141VTAAATA....LAF....ERGLSDGV------------------------------------------------------
R5YWD2_9CLOT/9-140VTSLATM....VGK....NYGTDSAI------------------------------------------------------
M0SG02_MUSAM/22-157VTALAVA....IGI....QDGLGSSA------------------------------------------------------
F5YMS6_TREPZ/16-155VSAMTTS....IAI....IEGVRSNL------------------------------------------------------
R7J8Q8_9FUSO/12-143VMGLSTA....VGI....IEGWDSIV------------------------------------------------------
R7R6N9_9FIRM/8-144VCALSTA....AGI....QYGLDSFQ------------------------------------------------------
C7NE60_LEPBD/7-143VVSLVTG....VFL....LKGLSSIE------------------------------------------------------
R5IDQ6_9CLOT/2-138VCGLTTA....AAL....KYGAGSFE------------------------------------------------------
D9R8M4_CLOSW/8-144VCALTTA....AIY....RYGVGSFE------------------------------------------------------
D7BAF5_MEISD/5-141VSALATG....VGI....TEGWGSAY------------------------------------------------------
F8F1T7_TRECH/16-155VTALATS....VAF....KEGIGSTL------------------------------------------------------
Q93ZZ7_ARATH/51-205VVAAATA....IAF....ERGFADSI------------------------------------------------------
D8U4F3_VOLCA/38-173CAGITT