Sequence alignment for CL0525

PF14360

SLS2_TRYB2/201-275--------------------------------------------------------------------------------
Q4YWD7_PLABA/163-234--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
A9RPY7_PHYPA/269-340--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
Q4YWD8_PLABA/201-272--------------------------------------------------------------------------------
B3L7G0_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
A9SUW6_PHYPA/174-246--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
Q17C33_AEDAE/230-303--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
C5KN45_PERM5/142-213--------------------------------------------------------------------------------
C5L5L1_PERM5/146-217--------------------------------------------------------------------------------
SMSR2_CAEEL/246-319--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
C5KL60_PERM5/83-154--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
C5LU78_PERM5/899-971--------------------------------------------------------------------------------
C5KY50_PERM5/57-128--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
A8PJJ0_BRUMA/218-291--------------------------------------------------------------------------------
F1QGE8_DANRE/232-307--------------------------------------------------------------------------------
F6UTK5_XENTR/280-353--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
J9FFV7_WUCBA/189-261--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------
Q6ESY2_ORYSJ/203-270--------------------------------------------------------------------------------

PF14378

B6U8K8_MAIZE/86-250MVKPDAPPLDLGFLATAGMHAA.IAAR-------------PWLNS--L--LAAL..NTVFVAMQAAYILWAILAE.QRPR
A9NYG8_PICSI/110-274MVPAGSQPYDVGFVWTQSLHDL.LLER-------------PALNT--V--LAAM..NTVFVGMQTFYILWTCVVE.GRGR
A2QMR5_ASPNC/116-299ALSILSFEHFLHLDVELSVQRYVLEQK-------------PWLMG--F--LARVYYSHIVLGVIFIVYCYTFLQR.DKYQ
D8JQM0_HYPDA/118-305DSALAEIDRRMGVDW.VAIAFW.FRDH-------------PLLSR--V--LCDV.YASNLWQPVVLIVALT.ATDPQRLR
A9W8V8_METEP/106-294DDWFIGIDRAFGFDW.LTFQTS.MVER-------------RGLME--I--LSRA.YETFFLQLGLTPVLLAALGEVRRSD
E8W7Z8_STRFA/49-239GLAILRLEKALHLNAEHPLNRL.LTAN-------------PAL.G--I--PADFAYASLHYLVTPAVLVWIFRRRSAAYR
A0LS47_ACIC1/68-252GTGILDLEHRWGLDVERSLNTF.LARH-------------PAL.G--V--AASWEYATTYVLVTFGVLLWVWRRRPDVYP
Q23DZ1_TETTS/93-261SIEVPKLSDPIH.DATSYLNNL.VNKH-------------KEIAM--F--FQIS..ASIIMDFSFFALCFYWVIKINSVR
C0CX33_9CLOT/34-204GAQLLALDLP.RHDIASPLDNR.LPFI-------------PQFLV--V--YLGC........YLFWIVNYILIARQDKTR
Q220L9_ALBFT/108-292DAPLAAWDRALGFDW.LALHGW.LQSH-------------PPAQT--T--LHIA.YQSGLIQLAFVILFLGFSARPAQLD
PDCT1_ARATH/110-274MIPARSEPFDLGFVVTRSLNRV.LASS-------------PDLNT--V--LAAL..NTVFVGMQTTYIVWTWLVE.GRAR
B5HNK4_9ACTO/51-241GLAILKVEKVLHLNAEHPLNRL.FTSQ-------------TWI.G--V--PADFWYASLHYLVTPAVLIWLFRSHAVHYR

PF01569

A4I568_LEIIN/102-249PAMNLILYLIL....SVCL.....NVV........L....KATVR..S..PRPAHPAAGMSYTTV.Y.............
DOPP1_DICDI/54-178RTISIFLGLLF....SECT.....NYV........L....KKSIK..E..HRPTMWKELRKQSY................
Q17D95_AEDAE/56-197LYSRLLLSVLL....TEYA.....NTL........I....KWILA..E..DRPFWWVRETKEFTT.LNRPKLYQNEL...
G6PC3_MOUSE/53-195LGISVLWITFI....AEWL.....NLV........F....KWFLF..G..DRPFWWVHESGYSTQTPIQIHQFPS.....
A0BM37_PARTE/91-226GALLYGGMILF....SVAS.....NSL........L....KNFYH..Q..PRPFFIVQEIEPYECNK.............
Q23FV4_TETTS/102-237..LYLLSITVL....SLFQ.....MTF........L....KSLYQ..D..PRPYFVNLDIKTDECGPE............
A0EE96_PARTE/81-240QIFKLITMNAI....AAAF.....GNL........I....KMIMT..Q..PRPFYLDPEIKLDFC.YT............
A8FE89_BACP2/71-198YKRYYSIMMLF....LLYL....TEKT........INHELKGLFA..R..ERPAFDHLVNETYY................
A0LYQ4_GRAFK/59-183TMVVVTLLITT....TDQL.....ANL........F....KHGFE..R..PRPCRQEGVMEYARYVAERCG.........
Q7MUE1_PORGI/58-185ALFIVGAVLLS....VLICDQ.LSSSF........F....KPFFA..R..FRPSHHPDFIDYVKTVYGYRGG........
A0K0K5_ARTS2/118-241RPMLLAGAMLT....GVAL.....AQI........I....GRSVG..R..QRPPLDLMLFGPDVTF..............
A4XP73_PSEMY/98-234ALFAFLTALLA....LLLLRV.GFAEL.............VKVMG..W..QRPSASLVVEGSARLTELFPDWEERWD...
A4X1H8_SALTO/101-242PLLPPVAGVAL....IYLI.....VGA........L....KVSTA..R..PAPSASVREPFLAPE.QTLPLFQHEL....
Q9EWX3_STRCO/115-237PLLALGVSLLL....LNVT.....VGA........A....KYGMG..R..LGPHYATTIGANEMWLGGD...........
F2G969_ALTMD/101-223KSLTFILAVAA....GIAM.....TFL........L....KAGID..R..PRPSLTMQHVDVYTQ...............
A1BJZ6_CHLPD/56-185GALIILFSLCA....LGIADY.TASGI........L....KPLFQ..R..IRPCFVLEGCRLLVDQSHSF..........
A4FQA0_SACEN/76-196AALLAPVATAV....AYLG.....SEL........L....KTWWQ..Q..ERPCRAVRDIAATLAECPEPG.........
B0U8C7_METS4/61-186FAIGAVISVFT....AILT.....SRL.............TQNLLPMR..LRPLHSGDSNFIAPIGTKIEIFE.......
A1S1V4_SHEAM/77-196IFWKSLTAIAV....AALL.....INA........L....KQGFD..V..MRPAAVLEHIRIVGAMRLNH..........
A1W5E3_ACISJ/72-191QLLQFVIGFGI....AIAI.....ASI........L....KFWLD..F..PRPAAVFGHLNHVLGTVEEH..........
A5CF96_ORITB/78-203YLLYVGTAYTI....FLLV.....YSK........L....KRLFS..F..TRPCCSLSSSEIQTVIDFNTEYV.......
B4U5Z7_HYDS0/54-171KLKVYLVTLII....ETIL.....VTA........L....KNIFD..Q..PRPASVLKHVHLLYKLYWG...........
A5DBA1_PICGU/102-232LSRDLIYVLGL....GIYI.....SGN........L....KDYMC..L..PRPRSPPLHRITMSSYTAQE..........
Q4D544_TRYCC/102-225EVLDMCVLMCL....SQYI.....TGT........L....KDAAG..C..PRPPCPPVELRGRASASREY..........
SSPA_DICDI/88-218LGVELCVVLAL....TIGG.....GNI........L....KNTFTLPR..PPPNIVWTNTAHQKDH..............
Q32GQ5_SHIDS/77-232....VLFAILA....AAILVGQGVKSW........I....KDKVQ..E..PRPFVIWLEKTHHIPVDEFYTLKRAERGNL
Q9CMX4_PASMU/75-237GVLVMAFAVIL....TQGI.....KSG........L....KTLFS..E..PRPYIVYVAEASGISVEQFYAQERKQRSHF
Q21JU9_SACD2/110-231AHWGIFLAAII....GGIV.....SNV........S....KDYFD..A..LRPPAVFTTDLFNLVGKGYTN.........
C1DG09_AZOVD/106-238TARLFARLGNS....EAAV.................VEAAQNVFD..R..KRPFAADGRVQVLPQASMMSVEMAKSQ...
Q0K1U6_CUPNH/103-229KETPYLNILLR....RSLV........DA....GLSTYKAKDHYK..R..TRPFVANKTQMCTPAETAKLEK........
Q65GX3_BACLD/179-304NVVSLVNTLRG....NYSS.....SNP........A....KSYFN..Y..PRPFRWKDNSIIVPTLIPVINPDP......
Q2IJN8_ANADE/141-265DLMILTETLAL...NSAAV.....MTV.............KFAVQ..R..PLPVTYAGRDGLVKQAQGYR..........
Q29NI1_DROPS/67-184MQVNMLVGLIL....DIVV.....VAV........L....KSFVR..R..RRPVAIKDTLVIGPDKF.............
Q6FEM9_ACIAD/65-182QILYLVVGGSV....GTGI.....YKF........L....KNKTT..R..PRPYQVHQVIVLGERPLDHF..........
A1K7H5_AZOSB/105-237QVGYLLVAMAL....GPGLF..VDVGL.............KDYWG..R..ARPAKVEAFGGASTFSPALVPSNQ......
Q3SNT4_NITWN/91-218.AFLLITMLLS....AGIL.....TNL.......TF....KSYWA..R..PRPVMVTEFSGPWKFMPWWDPRGE......
Q6MBQ7_PARUW/87-223LYLILVLAIGS....GIFV.....HAI........F....KDHWG..R..PRPKQIIEFGGAQPF.LPYYKPRFNH....
A8EX54_ARCB4/94-229GLVILLLSMIL....VPAL.....TVS........I....KGVTN..M..PCPNNLAEYGGRYPDVRIFDSYPKD.....
Q87X15_PSESM/102-231...CLVLSMAL....STAF.....VTP........V....KVVTS..V..QCPWSLTEFGGQETYSELLSPRPAT.....
Q03CR8_LACC3/177-306AVVATLICLLS....DQIV.....NAM.............KTFWG..R..FRPYELNGNPTHFTSWFQPNGAN.......
R5ZI70_9ACTN/141-283.LMVLAVWAAQ....AIIL.....NVI........V....KPLWS..R..PRMRVIEVTQGLDFQPWWVIGNPDKWAFI.
A8BDI5_GIAIC/110-282VLVAAIVYIGM....ANLT.....TLV........L....KIALN..R..PRPRQIAEFTTVSGPTVTFMPVFSRYT...
A8BQZ4_GIAIC/121-285FPLSFCFYVIT....VQTV.....VIA........L....KVLLR..R..PRPRNTHEFGILLETCKYEFKAIFTPY...
Q6MTZ1_MYCMS/144-270KAVIVLITIIS....LLIV.....INI........L....KLTFN..R..PRPTNLELYRNWWNIKWTSWK.........
R5TP42_9FIRM/95-216......IGMTI....FLLI.....STV........F....PNGLT.....LRPVVFPRDNIFTDM.VRMLYLAD......
A3LWS4_PICST/248-396ALKLYALSIGA....QNILVV.LTHFVIPTAPPLFI....KLYGEHKV....PSFEMTYTDGITRQDMKFGSSMYRY...
Q127S7_POLSJ/95-224ELCRYGAAMAL.....MCL.....AGL.............AIFYFWPTAAPQPNIDWSQYPDVGLLKSLD..........
A4CJ32_ROBBH/299-448DKTVFAYTKTSIALFDGFI................SCWDEKYRSN..L..IRPETLINQHIDDSWKPVLQT.........
Q2HER5_CHAGB/260-418FYAQLNYALAN....AGIA.................SWDAKYTYL..G..WRPVTAIHHPTPWVHSGADISSPSWT....
A8L0R7_FRASN/276-428LQTARMFAMVDLTEADATT................ACFNEKAAWT..S..WRPVTAIQLADTDGNPATTADPTWAPL...
Q4YWD7_PLABA/107-241MFIRIAIILGS....IYSI.....................RSIFIYVTTIPCPVPTCQPLVNNGFLQNIYSIYLIV....
Q6NJR5_CORDI/194-319RKAWLGVCYAL....TVALTW.APVVV........M....KVVFQ..R..PRPDHALLRFPPEVTPADW...........
A1SKJ7_NOCSJ/98-218PVVFIALVLAG....VGGC.....YGI........A....TALIS..R..DRPPVRILDPGLVPDD..............
Q82Z33_ENTFA/85-204LAFWAVSNLLA....VGFL.....GSV........F....KHVVG..R..ARPNLGALADRSSA................
A2DYB5_TRIVA/98-241FLWAFVAAEGI....SGFT.....VSI........F....KNYVG..R..TRPDLYSICGSQEINPSDPSTCPGLS....
A2EZZ9_TRIVA/91-236IICAHLSSIMF....AGDI.....CHV........L....KTYVG..R..ARPDYYTFTTEILEA.SVDEEKKLSDKRK.
A4H9E7_LEIBR/233-378WVLLQAFSVAL....SVMI.....VDA........L....KVYAG..R..LRPDFLSRLRNEGFNASSVGVDWCTV....
Q6BYN9_DEBHA/112-272GLMALSGSMAT....QLMI.....TCI........L....KNICG..L..PRPDLISRCQPTQTEMLIYGQLATVEICET
A7EIU4_SCLS1/134-294AVIGLLYSLIT....AAVF.....QVF........L....KWLIG..G..LRPHFLTVCKPNIPVTTQQETGNGLNYIMY
A7TF94_VANPO/122-266SLVCLGLILTI....NGVI.....TNS........L....KLFIG..N..LRPDFLERCQPMIPK.GQEKEYYNLDVCK.
Q2TYI3_ASPOR/35-224GWLGLCLSLAG....AFFV.....VLG........L....KDIVG..K..PRPDFLARCDPDLSNISAHLAGGLGLRREG
A2EQG2_TRIVA/90-230ATASYIFSIAS....AMLV.....CAA........I....GKIVG..R..PRPDTIAICGGDGSY.LTCTGFLDQK....
LPPR5_MOUSE/122-275FLGIYAFGLFA....TDIFVN.AGQVV........TGNLAPHFLA..L..CKPNYTALGCQQYTQ.FISGEEACTGNP..
Q9VNU2_DROME/65-225AEATFSFGFIA....TYLT.....TEL........A....KHAVG..R..LRPHFFHGCQPRLDDGSSCSDLQNAELYVE
A8WXP5_CAEBR/128-286TYLKYLLMYAA....CTFA.....MEF........L....KCYVG..R..LRPHFVSVCKPDWSKVDCSDKESFIDPSDL
A6X217_OCHA4/121-242WATLVLTSIVV....GSIP.....TEI........G....KLAIG..R..ARPFLLDDVGAAYFSPFKGQFL........
Q5NGF4_FRATT/116-236YAGFILATVAI....SGIL.....GQI........L....KMIIG..R..ARPKFFLEYGSHYFQHFHAPG.........
Q5ZX13_LEGPH/91-208..WYLLGCVLL....PNLL.....TFV........L....KISFS..R..ARPDLLFDNNLYGFYWFQLNDN........
Q6MH55_BDEBA/105-226WALNFFVALLV....AGVI.....THI........I....KFTVG..R..QRPHKTPDFDPYVFDHFTTHWH........
B4S7E2_PROA2/140-261TGRAVIEAHTF....SLLI.....TGV........M....KAVAG..R..SRPYTGDGNNRFNWVETSNRY.........
Q7NZZ5_CHRVO/815-932TGLIALESAGV....AVAG.....SEM........L....KFTSN..R..ARPGDDNAPWRSQPAGTSRWQ.........
Q0SBZ7_RHOSR/226-347PALILIGTVGA....AALA.....STV........T....KSVVG..R..ARPPIVSQVLLETDH...............
Q89JR9_BRADU/79-199AGNHALLVTVA....ASLL.....PHG........L....KLLFD..Q..TRPDRRTVIGHLHGVPFSGKS.........
B7VND8_VIBSL/235-351.ALKFGFTLIS....VTLL.....TLI........A....HQGFG..F..PRPHAYLPTLKLVMS.SG............
Q5E4L0_VIBF1/241-366SALTLLFGIIL....SIVL.....TGL........A....KQGLG..L..PRPFVYIPQLQLTEA.VGF...........
Q9RVR6_DEIRA/14-135GGRDLGVAFAL....SYLV.....NSA........L....KYGLN..L..PRPFTDDPALASAAARATAGG.........

PF14360

SLS2_TRYB2/201-275---------------------HCGD------------------------------------------------LM---YS
Q4YWD7_PLABA/163-234---------------------ECTD------------------------------------------------LI---IS
B8C480_THAPS/431-503---------------------GCGD------------------------------------------------LM---FS
IPCS3_ARATH/172-244---------------------GCGD------------------------------------------------LI---FS
SAMD8_HUMAN/292-365---------------------TCGD------------------------------------------------YM---FS
A2DHW8_TRIVA/46-124---------------------QCGD------------------------------------------------LI---VS
A9RPY7_PHYPA/269-340---------------------GCND------------------------------------------------LM---FS
SLS_LEIMA/211-286---------------------HCGD------------------------------------------------LM---FS
A5K283_PLAVS/202-273---------------------VCSD------------------------------------------------LI---IS
Q4YWD8_PLABA/201-272---------------------VCSD------------------------------------------------LI---VS
B3L7G0_PLAKH/276-347---------------------ECTD------------------------------------------------LI---IS
Q28DN3_XENTR/220-293---------------------LCGD------------------------------------------------FL---YS
Q4N3L0_THEPA/182-253---------------------PCTG------------------------------------------------VL---FS
A8XDY1_CAEBR/127-200---------------------LCGD------------------------------------------------LL---FS
IPCS_ORYSJ/172-244---------------------GCGD------------------------------------------------LI---FS
A9SUW6_PHYPA/174-246---------------------GCGD------------------------------------------------LI---FS
SMSR1_CAEEL/321-394---------------------SCGD------------------------------------------------YM---FS
Q17C33_AEDAE/230-303---------------------YCGD------------------------------------------------YI---YS
SMS2_CAEEL/201-274---------------------LCGD------------------------------------------------LM---FS
A8X0T5_CAEBR/264-337---------------------LCGD------------------------------------------------YI---YS
A9S9I4_PHYPA/275-346---------------------GCND------------------------------------------------LV---FS
B3SD02_TRIAD/279-352---------------------TCGD------------------------------------------------YL---FS
A2DN61_TRIVA/170-240---------------------TCGD------------------------------------------------MI---YS
C5KN45_PERM5/142-213---------------------GCSD------------------------------------------------LI---YS
C5L5L1_PERM5/146-217---------------------GCSD------------------------------------------------LI---FS
SMSR2_CAEEL/246-319---------------------LCGD------------------------------------------------LI---VS
B5YLZ6_THAPS/422-494---------------------GCND------------------------------------------------LI---LS
C6KT87_PLAF7/201-272---------------------VCAD------------------------------------------------LI---VS
D0MWV3_PHYIT/192-264---------------------GCGD------------------------------------------------LM---FS
B7FUU7_PHATC/326-397---------------------GCND------------------------------------------------LI---IS
SLS11_TRYCC/193-267---------------------HCGD------------------------------------------------LM---FS
D2VDJ4_NAEGR/246-319---------------------TCGD------------------------------------------------YM---FS
C5KL60_PERM5/83-154---------------------TCAD------------------------------------------------VF---YS
D2VXN5_NAEGR/191-270---------------------TCGD------------------------------------------------YV---FS
D2VKR1_NAEGR/196-272---------------------TCGD------------------------------------------------YV---FS
B9HC73_POPTR/172-244---------------------GCGD------------------------------------------------LI---FS
C6KT86_PLAF7/265-336---------------------ECTD------------------------------------------------LV---IS
C4LV27_ENTHI/184-261---------------------TCAD------------------------------------------------LL---FS
A2FIE9_TRIVA/168-238---------------------TCGD------------------------------------------------MI---FS
B7QHG5_IXOSC/233-306---------------------FCGD------------------------------------------------YI---YS
C5LU78_PERM5/899-971---------------------GCGD------------------------------------------------LV---FS
C5KY50_PERM5/57-128---------------------TCAD------------------------------------------------VF---YS
D0NII4_PHYIT/164-244---------------------SCGD------------------------------------------------HI---FL
A7ANZ4_BABBO/239-311---------------------TCTD------------------------------------------------MI---IS
A0JMN0_DANRE/269-342---------------------MCGD------------------------------------------------YL---YS
C3XQA8_BRAFL/273-346---------------------LCGD------------------------------------------------YL---FS
A8PJJ0_BRUMA/218-291---------------------LCGD------------------------------------------------YI---YS
F1QGE8_DANRE/232-307---------------------MCGD------------------------------------------------FL---YS
F6UTK5_XENTR/280-353---------------------LCGD------------------------------------------------YL---YS
H3CAZ2_TETNG/175-248---------------------MCGD------------------------------------------------FL---YS
J9FFV7_WUCBA/189-261---------------------LCGD------------------------------------------------LL---FS
Q4U956_THEAN/200-270---------------------NCTD------------------------------------------------LI---VS
Q6ESY2_ORYSJ/203-270---------------------GCSD------------------------------------------------LM---YS

PF14378

B6U8K8_MAIZE/86-250AAVAALMMFTCRGVLGCATQLPLPE....EFLGSGMDF.....PVGNVSFF......................LF---FS
A9NYG8_PICSI/110-274PTIAALFMFTCRGILGYTTQLPLPE....EFLGSGVDF.....PVGNVSFF......................LF---FS
A2QMR5_ASPNC/116-299AIRRTLAFENVIAFTILTLWRCMPP....RLLPEEYGFIDVLHSNTGGSAWTQNKFQLT............IAAM---PS
D8JQM0_HYPDA/118-305VMITASAITLAITMFGFFLFPAMGPYWHFNFTPADFPDAVNVMPWEQPKFI..EGLRNGWREMV....FSGIVEF---PS
A9W8V8_METEP/106-294RFVASFILCVTMTTIISAVLPAEGA...AGLLGPD...EAHLLFQGATPLVDLHALRDGTMRALPLNEVGPLISF---PS
E8W7Z8_STRFA/49-239AARTWLMTSTLLGLVGFTLMPTCPP....RLLDAHHGFVDTMAQYSSYGWWGAGASAPRGLSGM....TNQYAAM---PS
A0LS47_ACIC1/68-252WARNTLAGLTLGAITCFALWPTTPP....RLLPGS.DFADIVAANHPPGTWGTAAVSAG.........ADELAAM---PS
Q23DZ1_TETTS/93-261AIFAMACFYIFRGLNQALIIFPFPE....GYYWEYPNFPSYVTPYGKTSDF.......................F---YS
C0CX33_9CLOT/34-204CY.QFFTADFLSRIVCLIFFLAFPT..............TNIRPDVSGPGFWNHAMRILYALDLPLN......LF---PS
Q220L9_ALBFT/108-292EFMRLFIVATVLTILMSGPFPAAGAWKHHALAG..........PFDLSSLSHFELLRDGRMRDIPLRDMQGLISI---PS
PDCT1_ARATH/110-274ATIAALFMFTCRGILGYSTQLPLPQ....DFLGSGVDF.....PVGNVSFF......................LF---FS
B5HNK4_9ACTO/51-241AARTWLMTSTFMGLIGFTLLPTCPP....RLLSASHGFVDTMAQYSSYGWWGGEASAPRGMGGM....TNQYAAM---PS

PF01569

A4I568_LEIIN/102-249.........................------------------------------------------------GM...PS
DOPP1_DICDI/54-178.........................------------------------------------------------GM...PS
Q17D95_AEDAE/56-197.................TCEPSPGN------------------------------------------------.....PS
G6PC3_MOUSE/53-195...................SCETGP------------------------------------------------GS...PS
A0BM37_PARTE/91-226.........................------------------------------------------------EFG.KPS
Q23FV4_TETTS/102-237.........................------------------------------------------------.FG.NPS
A0EE96_PARTE/81-240.........................------------------------------------------------GFG.DPS
A8FE89_BACP2/71-198.........................------------------------------------------------SF...PS
A0LYQ4_GRAFK/59-183.......................RF------------------------------------------------GY...FS
Q7MUE1_PORGI/58-185.......................KY------------------------------------------------GF...IS
A0K0K5_ARTS2/118-241.........................------------------------------------------------SF...PS
A4XP73_PSEMY/98-234..................MKDSASR------------------------------------------------SF...PG
A4X1H8_SALTO/101-242...................PLEFTR------------------------------------------------SY...PS
Q9EWX3_STRCO/115-237.........................------------------------------------------------IF...PS
F2G969_ALTMD/101-223.........................------------------------------------------------SF...PS
A1BJZ6_CHLPD/56-185.........................------------------------------------------------SF...AS
A4FQA0_SACEN/76-196.......................DW------------------------------------------------SL...PS
B0U8C7_METS4/61-186......................HWS------------------------------------------------SF...PS
A1S1V4_SHEAM/77-196.........................------------------------------------------------SF...PS
A1W5E3_ACISJ/72-191........................Y------------------------------------------------SL...PS
A5CF96_ORITB/78-203.....................NCFT------------------------------------------------SF...PS
B4U5Z7_HYDS0/54-171.........................------------------------------------------------SF...PS
A5DBA1_PICGU/102-232........................Y------------------------------------------------GF...PS
Q4D544_TRYCC/102-225.........................------------------------------------------------GY...PS
SSPA_DICDI/88-218.........................------------------------------------------------GL...PS
Q32GQ5_SHIDS/77-232VKEQLAEEKNIPQYLRSHWQKETGF------------------------------------------------AF...PS
Q9CMX4_PASMU/75-237IDQFYQTKSDTPNWLKNHYEKEVGY------------------------------------------------AF...PS
Q21JU9_SACD2/110-231........................H------------------------------------------------SF...PS
C1DG09_AZOVD/106-238.................GENLPTKG------------------------------------------------SW...PS
Q0K1U6_CUPNH/103-229.......................DG------------------------------------------------SY...PS
Q65GX3_BACLD/179-304.....................NKDG------------------------------------------------GF...PS
Q2IJN8_ANADE/141-265.........................------------------------------------------------SF...YS
Q29NI1_DROPS/67-184.........................------------------------------------------------SF...PS
Q6FEM9_ACIAD/65-182.........................------------------------------------------------SF...PS
A1K7H5_AZOSB/105-237....................CDGNC------------------------------------------------SF...VS
Q3SNT4_NITWN/91-218....................CGRNC------------------------------------------------SF...FS
Q6MBQ7_PARUW/87-223...................SFEPSK------------------------------------------------SF...PC
A8EX54_ARCB4/94-229....................FIQKS------------------------------------------------KIKCWPA
Q87X15_PSESM/102-231....................DKPGR------------------------------------------------CW...PG
Q03CR8_LACC3/177-306......................GHM------------------------------------------------SF...PS
R5ZI70_9ACTN/141-283...............AAGVIKDGFK------------------------------------------------SF...AS
A8BDI5_GIAIC/110-282..................GPNPANL------------------------------------------------KLYSTPS
A8BQZ4_GIAIC/121-285.................LGRSQCSH------------------------------------------------SLSSTPS
Q6MTZ1_MYCMS/144-270.......................HN------------------------------------------------SF...PS
R5TP42_9FIRM/95-216.....................TPTN------------------------------------------------VF...PS
A3LWS4_PICST/248-396..................VYYAIPN------------------------------------------------KFASCPS
Q127S7_POLSJ/95-224........................A------------------------------------------------SGNACPS
A4CJ32_ROBBH/299-448........................P------------------------------------------------PFPEYTS
Q2HER5_CHAGB/260-418..................PLLRPTP------------------------------------------------SHPDYVS
A8L0R7_FRASN/276-428..................LVTPPHP------------------------------------------------DF...TS
Q4YWD7_PLABA/107-241...................FAKVYE------------------------------------------------CTDLIIS
Q6NJR5_CORDI/194-319.........................------------------------------------------------SY...PS
A1SKJ7_NOCSJ/98-218.........................------------------------------------------------SF...PS
Q82Z33_ENTFA/85-204.........................------------------------------------------------SF...PS
A2DYB5_TRIVA/98-241...................ASEFKD------------------------------------------------QFRSWPS
A2EZZ9_TRIVA/91-236................DELKKEAFK------------------------------------------------SF...PS
A4H9E7_LEIBR/233-378...................ANEGRL------------------------------------------------SF...PS
Q6BYN9_DEBHA/112-272FSRD.......SVGPSLHILQEGFR------------------------------------------------SF...PS
A7EIU4_SCLS1/134-294DRT........ICTGDEDEIDDSLE------------------------------------------------SF...PS
A7TF94_VANPO/122-266................QANKGILHE------------------------------------------------GLKSTPS
Q2TYI3_ASPOR/35-224AAVLV.....RASICQNTDAAVIKD------------------------------------------------GFAAFPS
A2EQG2_TRIVA/90-230..................QLASQFS------------------------------------------------SF...PA
LPPR5_MOUSE/122-275.................DLIMRARK------------------------------------------------TF...PS
Q9VNU2_DROME/65-225QFHC......TNNNLSTRQIRELHV------------------------------------------------SF...PS
A8WXP5_CAEBR/128-286VC..........TNPNPRKIRTART------------------------------------------------SF...PS
A6X217_OCHA4/121-242.......................YE------------------------------------------------SF...PS
Q5NGF4_FRATT/116-236........................Y------------------------------------------------DFASMPS
Q5ZX13_LEGPH/91-208.......................YW------------------------------------------------SF...PS
Q6MH55_BDEBA/105-226.......................WH------------------------------------------------SF...SS
B4S7E2_PROA2/140-261........................W------------------------------------------------SL...PS
Q7NZZ5_CHRVO/815-932........................S------------------------------------------------SF...TS
Q0SBZ7_RHOSR/226-347.........................------------------------------------------------SF...PS
Q89JR9_BRADU/79-199.......................ED------------------------------------------------AF...PS
B7VND8_VIBSL/235-351........................Y------------------------------------------------SF...PS
Q5E4L0_VIBF1/241-366.........................------------------------------------------------GM...PS
Q9RVR6_DEIRA/14-135........................P------------------------------------------------GL...PS

PF14360

SLS2_TRYB2/201-275GHT---VILTLHLMFHWI-YGAMVHWS---------------------------------......FRPVVTVVAIFGYY
Q4YWD7_PLABA/163-234GHT---CFTTLFVFTWLY-YEKNLF..---------------------------------......IKLIILLYSIYLYL
B8C480_THAPS/431-503SHT---IYTMSFVCVVFK-YFNFKS..---------------------------------......LKVIMALLQISIVP
IPCS3_ARATH/172-244SHT---IFTLVFVRTYQR-YGTRRW..---------------------------------......IKHLAWLMAVIQSI
SAMD8_HUMAN/292-365GHT---VVLTMLNFFVTE-YTPRSWNF---------------------------------......LHTLSWVLNLFGIF
A2DHW8_TRIVA/46-124GHT---MFMWQSSRWIME-TTSRMLPT---------------------------------LG.STFVKLGSLYTFLIGIC
A9RPY7_PHYPA/269-340GHV---FVAVLTAMAWQE-AYPGW...---------------------------------......TSTLIWLLVVHTAQ
SLS_LEIMA/211-286GHT---MILSLAFILAWD-YSPFLHPW---------------------------------.....AVRVWVSVLLPISYY
A5K283_PLAVS/202-273GHS---FSTTIFLLFALF-YVNSVV..---------------------------------......LKTLITFLCFVIYA
Q4YWD8_PLABA/201-272GHS---FTSTIFLLFIFC-YMDNVV..---------------------------------......IKVITALLSCFVYS
B3L7G0_PLAKH/276-347GHT---AFTTVLKFFWMF-YEKKIY..---------------------------------......IKAVLFLYCLFIYG
Q28DN3_XENTR/220-293GHT---VILTLTYLFIKE-YSPRHFWW---------------------------------......YHLICWLLSAAGVI
Q4N3L0_THEPA/182-253GHV---YFVILAFIILSQ-NSGFL...---------------------------------......FNMTMFVYAALISV
A8XDY1_CAEBR/127-200GHT---LVMVTCSLAVAY-YLPKSIKP---------------------------------......LQWIAHVSCFVGMI
IPCS_ORYSJ/172-244SHM---IFTLVFVRTYHK-YGSKRL..---------------------------------......IKILAWLMAIIQSL
A9SUW6_PHYPA/174-246SHM---TFALTFFHSYVK-YGTRQW..---------------------------------......MKFVAFLTMVALSL
SMSR1_CAEEL/321-394GHT---TVITMISHFITE-YTPADWTG---------------------------------......LHTFTWVLNCFAIF
Q17C33_AEDAE/230-303GHT---VTLVMGYLIIAE-YSPKKFWI---------------------------------......IHWLAWCASLTGVS
SMS2_CAEEL/201-274GHT---VVLTIMYFVQLQ-YTPRGLVI---------------------------------......LRYIAAPITFLGIA
A8X0T5_CAEBR/264-337GHT---LVLVVSALFIGE-YSPRRFYI---------------------------------......LHWLSWLVCAVGVV
A9S9I4_PHYPA/275-346GHM---YVAVLTAMAWQE-AYPGW...---------------------------------......GSVFIWFLVAHTGQ
B3SD02_TRIAD/279-352GHT---VAVTLSNFFITE-YTPDSWHL---------------------------------......LHFLTWTLNLSGIF
A2DN61_TRIVA/170-240GHT---MGFMFPGLIHHR-FFNKK...---------------------------------......LGVLYLVLGFIGSF
C5KN45_PERM5/142-213GHM---MYAILATCAIFR-YAQNWY..---------------------------------......IKATCLALNILQGF
C5L5L1_PERM5/146-217GHM---LYVISITCALFR-YAEHWS..---------------------------------......IKYFALVLNILQGF
SMSR2_CAEEL/246-319GHT---LTIFTAFLVFKT-YAPQRLQP---------------------------------......LSHIYHVLAFTALF
B5YLZ6_THAPS/422-494GHA---TVTSTLGCASTS-VASNTR..---------------------------------......FSMALWTLMALDYS
C6KT87_PLAF7/201-272GHS---FSTTIFLMFSFY-YINNVI..---------------------------------......IKFIIFTFSCFIYA
D0MWV3_PHYIT/192-264SHT---IYTVSFILTVWK-YWPNKY..---------------------------------......GISIMVLVQITIAF
B7FUU7_PHATC/326-397GHA---TVTSTLACVAVS-AHPSKV..---------------------------------......FGGCLVCLLLLDYS
SLS11_TRYCC/193-267GHT---VSITLSLLVQWI-YGSMLHWV---------------------------------......FRPASVLLVLLSFY
D2VDJ4_NAEGR/246-319GHM---SMITILNYTINE-YTPKHWKG---------------------------------......LHIITWVLNCFGAF
C5KL60_PERM5/83-154GHS---IPITLSMMFWMD-YTASVQ..---------------------------------......ERVFGSLLSVMALL
D2VXN5_NAEGR/191-270GHA---TALILVFWFVWY-YSHSDRWS---------------------------------KAVRMIFNTILFTVTFVGCF
D2VKR1_NAEGR/196-272GHA---TSLSVVCWFVWY-YSNKEWVG---------------------------------R...IWTNLLLIILHIVGCL
B9HC73_POPTR/172-244SHM---IFTLVFVLTYQK-CGTKRC..---------------------------------......IKQLGWLIAVVLSF
C6KT86_PLAF7/265-336GHT---AFTTLLTFFWFF-YERNIY..---------------------------------......VKTTIFLYSIYIYI
C4LV27_ENTHI/184-261GHT---ANLTLCAFIWEY-YSEKVPFF---------------------------------NP..LIERICAWIIAFIGYF
A2FIE9_TRIVA/168-238GHT---MGFIFPGLIHHH-FIGKI...---------------------------------......IGWIYLFVGVIGAF
B7QHG5_IXOSC/233-306GHT---VILTLAYLVVRE-YSPQRCKV---------------------------------......VHITYLTLSCVGIL
C5LU78_PERM5/899-971SHM---MYCLLATLVVTH-YSRSLV..---------------------------------......LMVIEWLLCCALVC
C5KY50_PERM5/57-128GHS---ISVTLATMVWWD-YTSSIA..---------------------------------......SRLFGLFWGLFTLL
D0NII4_PHYIT/164-244GHI---ANTNSAVLLYLR-TLARNFAG---------------------------------RTASKIRRVCRMTCLMSFGA
A7ANZ4_BABBO/239-311GHT---AGSISIMLMFVL-HNRQWY..---------------------------------......LNTIIMIVAGIICF
A0JMN0_DANRE/269-342GHT---VMLTLTYLFIKE-YSPRRFWW---------------------------------......FHWGCWSLCAVGVF
C3XQA8_BRAFL/273-346GHT---VILTITYLFIKE-YSPRGWFI---------------------------------......LHWCTWLVSCIGIF
A8PJJ0_BRUMA/218-291GHT---VVLVTSCLFITE-YSPQRWKP---------------------------------......LHFFSIMVSAAGVI
F1QGE8_DANRE/232-307GHT---VMLTLTFLFIYE-YSPRSRLW---------------------------------T....VYHVICGLLSAMGMI
F6UTK5_XENTR/280-353GHT---VMLTLTYMFIKE-YSSPRLWL---------------------------------......YHWICWFLSCVGIF
H3CAZ2_TETNG/175-248GHT---VMLTLSYLFIKE-YSPPWMWW---------------------------------......YHWSCWLLSASGVV
J9FFV7_WUCBA/189-261GHT---LAMVVSSLTVAY-YLPDSFRP---------------------------------......LRYIPCMLSWVGMI
Q4U956_THEAN/200-270GHT---MFTVITCILFVE-NAKYLI..---------------------------------......TKVILVLYTGFVLF
Q6ESY2_ORYSJ/203-270GHM---LVAVLTAMAWTE-AYGGW...---------------------------------......ISVVIWFLVLHSAQ

PF14378

B6U8K8_MAIZE/86-250GHV---AGAVIAAADMRR.EGRLAL-----------------------------------------AR.LFDSLNVLQVV
A9NYG8_PICSI/110-274GHV---AGAVIASLDMRR.VKRNQL-----------------------------------------AF.TFDTLNALQSV
A2QMR5_ASPNC/116-299LHF---GNSMFIALCLLK.FSPHWY-----------------------------------------LRAVAPIWPMLMAL
D8JQM0_HYPDA/118-305YHA---ASAILFAVAWRG.VPIIGV-----------------------------------------...LGILLNVVMFV
A9W8V8_METEP/106-294LHC---AVAYLVTAAIWP.LQRLRW-----------------------------------------...VVLLLNAVMTV
E8W7Z8_STRFA/49-239LHV---GWAVWCGVLLWR.HGRHPL-----------------------------------------VRAAGVAYPLLTVL
A0LS47_ACIC1/68-252VHV---AWAAWVLAVLAR.LHMSRW-----------------------------------------ALALGSAHLAVTTV
Q23DZ1_TETTS/93-261GHV---GFLNIVALEWYK..QKNYF-----------------------------------------MFYLTCAFNVYVAF
C0CX33_9CLOT/34-204VHC---LVSWFCYIGIRRNTAIPLW-----------------------------------------YRRCSCVMAILVFI
Q220L9_ALBFT/108-292LHT---VMAVLLVYAMRG....TGI-----------------------------------------LLSVFIVVNVAMLV
PDCT1_ARATH/110-274GHV---AGSMIASLDMRR.MQRLRL-----------------------------------------AM.VFDILNVLQSI
B5HNK4_9ACTO/51-241LHV---GWALWCGVMLWR.YGRTRT-----------------------------------------TKAAAVAYPLITTI

PF01569

A4I568_LEIIN/102-249DHA...QFMAGFSVYLLR-RWTRARRNRTERRKYSHLQQRKAA......SASAALARTSSPYALVALLLFATL...FIGV
DOPP1_DICDI/54-178SHS...QFMFFFAVLMTL-FYLKKRIRFGSK..............................ILPIISVTFLFFLAAGVAY
Q17D95_AEDAE/56-197GHL...MTSTTYLYVIFS-VLEEAGMQYGK...............................MVVVALRACYYLSLLLIAV
G6PC3_MOUSE/53-195GHC...MITGAALWPVMT-AISSQVASRSRS.............................PWVRVIPGLAYCTFLLAVGL
A0BM37_PARTE/91-226GHA...MSSQAMCFLLPS-ILFPAIWKDQPNCK.........................YPLYLRVLFIFIITFWTFMTGF
Q23FV4_TETTS/102-237GHG...VNNLVMVYVSHY-IADNDCFKMLIKGENG.....................KYKLHQRRFWVNLIGLVLCILIGW
A0EE96_PARTE/81-240GHS...LRSFVFYTILIE-TIVLKKYNIQENCSLIQSDKQALDEKEISNSELYKQIYSNQYISYSKYKFFIAIFAFLIGI
A8FE89_BACP2/71-198GHS...MNAATIYPFIAY-LLVEMIPWLKE................................RQKIVYLITGICVLMIGV
A0LYQ4_GRAFK/59-183AHA...ANSTGVAVFLSL-LFKKHYPK.......................................LFVFLLIWAVVVSY
Q7MUE1_PORGI/58-185GHT...TNYISLALFTSR-IFRNKFYT.........................................WTIWSVVALVIY
A0K0K5_ARTS2/118-241GHV...LGACDFLLVTTF-LIFSRRQSTW.................................PAVAAFALAVFGIFLASI
A4XP73_PSEMY/98-234DHA...SVLLIWALFMSF-FARNWRLL..........................................LVWAIAVIGML
A4X1H8_SALTO/101-242GHV...VNTIVWYGVIVL-LLARLLETYGRT..............................LPPRMATAVRVVPPLVVLT
Q9EWX3_STRCO/115-237GHT...ANAVVTWGILAY-LASTHRTR.....................................RWLSAISAVTSLGVGM
F2G969_ALTMD/101-223AHA...TLSTLVYFYIAH-LLTYFTQNTS.................................VRTWIYFTAAFLVFCIGL
A1BJZ6_CHLPD/56-185SHA...ANAAAVAATIWI-YFYRNGSIV...................................DKLFSLLIALYAFFVAY
A4FQA0_SACEN/76-196NHS...AIAAASAVALAF-AWRRLAVA...........................................AVLLALLEGF
B0U8C7_METS4/61-186DSS...AYAFALSTAIWY-ASRSLGSF..........................................FYAWSIFVMCL
A1S1V4_SHEAM/77-196AHT...GTVFVIAGMAWT-LCRRTDIK.........................................TLILLLALMVGL
A1W5E3_ACISJ/72-191GHS...TYAALVAGALWP-LTGVRHRL..........................................ALVAYVVLVGW
A5CF96_ORITB/78-203AHT...GITFFIVACLWH-KLNRIGKF..........................................AGVVLVIMVGI
B4U5Z7_HYDS0/54-171GDT...AMAFVIAMVGSY-NEKPLVKA..........................................FFFSYAFLIMY
A5DBA1_PICGU/102-232SHS...ANATAVSLVLFS-RLYDSRDQFTP...............................IKFVVLASILFIYYFSLIF
Q4D544_TRYCC/102-225THA...SHSVLFSYCAYN-LLVFLFPTY...................................TVACTMACIFFTLNVSL
SSPA_DICDI/88-218THT...ASAFGLTFYFLI-YTYFLFPTIGESF............................NISLLSMFFIVLFWSTSVMF
Q32GQ5_SHIDS/77-232GHT...MFAASWALLAVG-LLWPRRRT......................................LTIAILLVWATGVMG
Q9CMX4_PASMU/75-237GHT...IFAATWLMLVVG-FVHLLSVRSL.................................TAKVLVSFTSLWAVFMLI
Q21JU9_SACD2/110-231GHS...LTAFLAATLFFH-YLNSVKMR.........................................WLFFVAAACAAL
C1DG09_AZOVD/106-238SRA...ARVTASAIVMSE-IVPERKSE...........................................LWSRAREYAE
Q0K1U6_CUPNH/103-229GHS...AIGWAWALILAE-VEPERAND...........................................ILARGRAFGQ
Q65GX3_BACLD/179-304GHT...NAAYLSAFAMAY-AIPERYQE...........................................LLTRASELGH
Q2IJN8_ANADE/141-265GHT...STAVAALTAASW-TYTLRRGPA....................................AWPWLVTAAVGASVGA
Q29NI1_DROPS/67-184GHA...SRAFYVLIFFTK-LYSLNFVF........................................LMPLTAWAVSVAL
Q6FEM9_ACIAD/65-182GHT...LHAVMATITLGY-VQPILVVL...........................................MLPFTLLVAL
A1K7H5_AZOSB/105-237GHA...SAGFYLVSLGFL-GGAAARRR.......................................WVLVGLAAGAVFGL
Q3SNT4_NITWN/91-218GEG...ATAFWTLAPAAL-TPPAWRPL.......................................AYAGALAFGAVTSV
Q6MBQ7_PARUW/87-223GHC...SVGFYFFSFLWL-GKHYRSYFL...................................YILGLFLTISLGGALSY
A8EX54_ARCB4/94-229GHA...SMGFSLMALFFL-FKKPRNQK......................................IALGIALVLAWMTGG
Q87X15_PSESM/102-231GHA...ATGFTLFALFFM-LRDRRPRLA....................................KLGLALALGLGSIFSA
Q03CR8_LACC3/177-306GHT...QTAATLLTLTWF-VDRDKPKRQ....................................RLVFWLTFAYGAVMAY
R5ZI70_9ACTN/141-283GHTAHAAIGLMLAGLPAA-AFKEKPSRR....................................RVVFWTAAMVAALVAF
A8BDI5_GIAIC/110-282GHTMFMASALFPLPILTY-LLAQMYIKVVDSERTPSTSGQGR........LKYMLWLVFFYLGVAITAVFAILMPPTMAY
A8BQZ4_GIAIC/121-285GHT...AAAAYCILPSVA-YIIQLFELIRAYWAPRLLGL..............TILSIVMGLLLTVVAVWGISGIILMII
Q6MTZ1_MYCMS/144-270GHT...YSATTLLFVLLL-FNKINKKA.....................................YLWISFTWILIIIIAM
R5TP42_9FIRM/95-216LHV...FNSLAACIAIAQ-SEQLKKHP......................................VISNGAYILAGLIIL
A3LWS4_PICST/248-396IHA...CTSSLVFFFVCY-YSRTSIFK.........................................LMAMVYLFGQWW
Q127S7_POLSJ/95-224LHV...ATAFFSGFWLHH-LMRQFRAP.....................................LWIHLVNWTWCVGIIY
A4CJ32_ROBBH/299-448GHS...VVSGAAATALTS-IFGDNFAFDDDTEL..........................PYGLPVRSFNSFNEASAEAAI
Q2HER5_CHAGB/260-418THS...TFGGAAAAVLRA-WNGGKDKIAGTGVTVSSN..................VTLDARGVITRTYTDLKGAAEENSA
A8L0R7_FRASN/276-428GHT...CFTTASMSTLAF-FFGRDDIPFSAYS...........................ADSGTTRYFRGFSHAIAEVIE
Q4YWD7_PLABA/107-241GHT...CFTTLFVFTWLY-YEKNLFIK.........................................LIILLYSIYLYL
Q6NJR5_CORDI/194-319GHT...AFVTASVITLYL-IAKTAQHQLW..................................RSVAAAGVVLGIVAVAA
A1SKJ7_NOCSJ/98-218GHL...GTAVAVYCGIAL-LLAWVAPRT....................................RPWPWLLLVVPVVVAL
Q82Z33_ENTFA/85-204GHS...LLAMALVCTILI-ILTYLHVEK...................................TKGIKIFLLTYLVLIVL
A2DYB5_TRIVA/98-241GHS...QTAMSGFVIIAF-FVQRIIKSKNL................................VGTFCGSLFIILAIWCGA
A2EZZ9_TRIVA/91-236GHS...CTAASGALFFSL-SLISIIDHNRV................................WSILLKLLPLCYAFYIGS
A4H9E7_LEIBR/233-378GHS...SAGFSAFVPLCF-YVLHSLHAFRRSG...........................VSLWRILIGLTPLILPITVAV
Q6BYN9_DEBHA/112-272GHS...STVFCGMVITSL-NFAGKLQIFDKRG............................ISFKVLLAICPIMVACFVSC
A7EIU4_SCLS1/134-294GHS...TAAFAGFVFLSL-YLNAKLKVWSNYH...........................PAMWKLIVTYAPILGATLIAG
A7TF94_VANPO/122-266GHS...SFISSGMGFIFL-WQCYFVNGN....................................KVRHLWCVVLAVVVMI
Q2TYI3_ASPOR/35-224GHS...SFAWAGLLYLSL-WLCAKFAIIPPSHRTGHSALTRNGP....PAYPLTSRPAAPPLYLLLIATIPVGLALCICA
A2EQG2_TRIVA/90-230TEA...AEAMAAAIFLCL-YIGELIPYYNN................................VTSLLMASPIFFAIFVVA
LPPR5_MOUSE/122-275KEA...ALSVYAATYLTM-YITSTIKAKGTR..............................LAKPVLCLGLMCLAFLTGL
Q9VNU2_DROME/65-225AHS...SLSFYSMVLLAL-YVHGVWRGRGGV.............................RVLRHVLQFLLLMAALCVSL
A8WXP5_CAEBR/128-286GHT...AAAFHVFLFVYI-YLRRMATNTGIKE...........................IITVRNILVPFYTIWTVVCAV
A6X217_OCHA4/121-242GHS...MMAGIMMVSLWI-FLPRWRVL...........................................TAPACFLFGI
Q5NGF4_FRATT/116-236GHS...ITVGAMFIAFFY-IFPKLRYF...........................................WYLLIVVFAG
Q5ZX13_LEGPH/91-208GHS...ITITALAAGLGF-LFPRYFFL...........................................FIGAALLVAA
Q6MH55_BDEBA/105-226GHS...QVIFTVATMLSV-AFPRFKWF...........................................WIPFAMLICL
B4S7E2_PROA2/140-261GHA...TSAFAVSSALSQ-RIDRPLAS.........................................VGLYALSCVTVL
Q7NZZ5_CHRVO/815-932NHT...AILFATVTPFAK-EYDQPWLY.............................................GIAALGAA
Q0SBZ7_RHOSR/226-347GHA...TGAMALFTMAAV-MFGYALSPTR..................................RALLLSLAAAVTVVVSV
Q89JR9_BRADU/79-199GHA...LHMGALASAAGA-MPAGPRRA...........................................IRAIAVGISL
B7VND8_VIBSL/235-351LLA...GLWVSLTLLVFW-KLKRLLEQ......................................KAILIVLAGLLWIML
Q5E4L0_VIBF1/241-366MHS...MLSVVIYGTFYL-ILKRLSLPEK.................................ILKRYACIFIILIIGQSI
Q9RVR6_DEIRA/14-135GHA...QMSATLWLGIAA-QVRRPAFT.........................................LFAAVLVALIIA

PF14360

SLS2_TRYB2/201-275CIVASRFHYTDDVLVA-IYLTIATFI-----AVGHN------
Q4YWD7_PLABA/163-234LIIISRFHYTVDVLLG-IFFGSTIF.-----IFYHW------
B8C480_THAPS/431-503FILAARKHYSVDVFTA-LYVTPLVFE-----LLWTR------
IPCS3_ARATH/172-244LIIASRKHYTVDIVVA-WYTVNLVMF-----YVDSK------
SAMD8_HUMAN/292-365FILAAHEHYSIDVFIA-FYITTRLF.-----LYYHT------
A2DHW8_TRIVA/46-124YITLSRNHYTIDIWFG-FLLSEGCY.-----YLYGL------
A9RPY7_PHYPA/269-340REIRERHHYSVDVVTG-VYFGIFLWN-----TTGWI------
SLS_LEIMA/211-286CILASRSHYTDDILVA-MYVMIATYK-----VIDHA------
A5K283_PLAVS/202-273FIIVGFIHYTSDVLLG-FIFGIFIF.-----TFYHL------
Q4YWD8_PLABA/201-272VLIVGFIHYTSDVLLG-ILFGFFIF.-----GLYHI------
B3L7G0_PLAKH/276-347MIVISRFHYTVDVLMG-YVFGSTVF.-----LFYHC------
Q28DN3_XENTR/220-293CILVAHEHYTVDVIVA-YYVTTRLF.-----WWYHT------
Q4N3L0_THEPA/182-253SIVASKYHYSIDAMFS-ILFAPFIYN-----VYFSS------
A8XDY1_CAEBR/127-200CMIISRTHYTIDVIIA-YWLSNMVF.-----RIYHA------
IPCS_ORYSJ/172-244LIIASRKHYSVDVVVA-WYTVNLVVF-----FIDNK------
A9SUW6_PHYPA/174-246LIIASHKHYSVDIVVA-WFTVYFVFF-----YVDRR------
SMSR1_CAEEL/321-394LILAAHEHYSIDVFIA-FYISSRMF.-----LYYHA------
Q17C33_AEDAE/230-303MVLLAHGHYTVDVLIA-YYVTTRLF.-----WTYHT------
SMS2_CAEEL/201-274ALVVSGGHYTMDVLIA-YWLTSHVF.-----WSYHQ------
A8X0T5_CAEBR/264-337FLVLSHGHYTIDVILS-YFACTRVF.-----WAYHT------
A9S9I4_PHYPA/275-346REIRERHHYSVDVVSG-IYVGILMWR-----TTRWI------
B3SD02_TRIAD/279-352FILAAHEHYSIDVLIG-YYITTRLF.-----IYYHA------
A2DN61_TRIVA/170-240SLILTRFHYTVDVLLS-IILTTTMW.-----FTYNL------
C5KN45_PERM5/142-213VIVASRAHYSVDVIVA-AYTIPAFW.-----CTFAY------
C5L5L1_PERM5/146-217LIIASRRHNTVDVVVA-AYAVPCIW.-----CTFAY------
SMSR2_CAEEL/246-319SILLARKHYMIDIVLG-YTVSTRIF.-----MEYHA------
B5YLZ6_THAPS/422-494IEAYQGLHYSVDMWLG-CIVTCLLWQ-----LTKPL------
C6KT87_PLAF7/201-272IIIIGFIHYTSDVLLG-IIFGVFMF.-----SFYHI------
D0MWV3_PHYIT/192-264LIVASRKHYTLDVFSA-LYIVPLFWL-----ALEAY------
B7FUU7_PHATC/326-397VEIYEGFHYSVDMWLG-LVIVSLFW.-----KVFSF------
SLS11_TRYCC/193-267SIIASRSHYTDDILVS-FYITVTTFL-----VLRHS------
D2VDJ4_NAEGR/246-319FVLAAHEHYSIDVFIG-FFISSRLF.-----VYYHD------
C5KL60_PERM5/83-154IIVCTHFHYTLDVFYG-AGLTVIIW.-----RLYHF------
D2VXN5_NAEGR/191-270LIIVAKEHYTVDVILG-VVISVMFC.-----ALYHM------
D2VKR1_NAEGR/196-272GILLAKEHYTVDVLLA-CTISLLVC.-----QLYHS------
B9HC73_POPTR/172-244LIIASRKHYTVDVVVA-WYTVNLVVF-----FLDKK------
C6KT86_PLAF7/265-336IIIISRFHYTVDVLMG-YVFGGSVF.-----LFYHY------
C4LV27_ENTHI/184-261IFLSNHFHYSCDVFIG-FIVASLLF.-----NLYHT------
A2FIE9_TRIVA/168-238GLIVSRFHYTVDVLLS-LVLSPLLY.-----FAYNL------
B7QHG5_IXOSC/233-306MVLLSRGHYTVDVVIG-YYVTTRLF.-----WVYHT------
C5LU78_PERM5/899-971LILAQRSHYTLDVWVS-WYTVPMVWI-----CFYHF------
C5KY50_PERM5/57-128VIMSTHFHYTLDVVYG-VAVTFIAW.-----RLYHY------
D0NII4_PHYIT/164-244LCIAGHKRHTVDVVLG-LIISTLVFF-----HFEHS------
A7ANZ4_BABBO/239-311LLILTRAHYTIDIMFG-MLFALQIYS-----QHLRM------
A0JMN0_DANRE/269-342CILLAHDHYTIDVVVA-YFITTRLF.-----WWYHT------
C3XQA8_BRAFL/273-346CILLAHDHYTIDVVVA-YFITTRLF.-----WIYHT------
A8PJJ0_BRUMA/218-291LLLISRAHYTIDVIIS-YWISTRVF.-----WTYHT------
F1QGE8_DANRE/232-307CILMGHEHYSLDVVVA-YYITSRLF.-----YWYHT------
F6UTK5_XENTR/280-353CILLAHDHYTVDVVVA-YYITSRSF.-----WWYHT------
H3CAZ2_TETNG/175-248CILVAHDHYSIDVLVG-YVATTRLF.-----WWYHT------
J9FFV7_WUCBA/189-261CMVISRTHYTIDVLFA-YWLSTAVF.-----SIYH.------
Q4U956_THEAN/200-270LIVACKYHYTVDVLLG-LSIAILLH.-----FYYY.------
Q6ESY2_ORYSJ/203-270REIRERHHYSVDCIVA-IYVGILLWR-----M....------

PF14378

B6U8K8_MAIZE/86-250RLLACRGHYTIDLAVG-VGAGILFDT-----L----------
A9NYG8_PICSI/110-274RLLGTRGHYTIDLVAG-VGAGWLFDS-----L----------
A2QMR5_ASPNC/116-299TIVATANHFILDAVVG-ACVTLTAFR-----Y----------
D8JQM0_HYPDA/118-305STVPVGGHYLIDLYVG-AAIALVSLA-----L----------
A9W8V8_METEP/106-294SAVTHGAHYACDCVAG-LLVAAISFH-----L----------
E8W7Z8_STRFA/49-239VVMGTANHYFLDAVAG-AAVMTVGAL-----L----------
A0LS47_ACIC1/68-252DVLATGTHYTLDAAAG-AALVLLAVA-----G----------
Q23DZ1_TETTS/93-261VMVVFRIHYVVDITTG-LVVSHYIFM-----L----------
C0CX33_9CLOT/34-204STLAVKQHVVIDIVGA-VVLAEACLR-----L----------
Q220L9_ALBFT/108-292SIPVDGGHYLVDVIAG-AAMAFGLIA-----L----------
PDCT1_ARATH/110-274RLLGTRGHYTIDLAVG-VGAGILFDS-----L----------
B5HNK4_9ACTO/51-241VVMGTANHYFLDAAAG-AVVMGLGFL-----L----------

PF01569

A4I568_LEIIN/102-249GRVYNGYHTVGQALVG.WMVGIALAF.....ACTTAHVQRGF
DOPP1_DICDI/54-178SRVHLYYHTAKQVFCG.SFIGICLGF.....IWYGVIEYIFR
Q17D95_AEDAE/56-197SRMYFGCHFLHQCIIG.ILLGVAMTK.....LTMSLSFEKYL
G6PC3_MOUSE/53-195SRVFLLAHFPHQVLGG.LIVGAALGW.....LMSPRVPMERE
A0BM37_PARTE/91-226SRVFMGVHSFGQILLGWVYQGYISII.....YMNYFHDRITE
Q23FV4_TETTS/102-237ARVCLGMHSLNQVLLG.WVLGILWIL.....AYICVFYKRF.
A0EE96_PARTE/81-240GRLYFGVHFLNQIIIG.WVIGGYIIY.....VYYYCGLEKMI
A8FE89_BACP2/71-198SRMYIGVHFLTDVAGG.FAIGLALFL.....ICKKIDEKLSV
A0LYQ4_GRAFK/59-183SRIYLGVHYPGDVITG.MLIGAIFGV.....LFHFLRKFLTE
Q7MUE1_PORGI/58-185SRIYIGVHFITDIIPG.IAVGLIVGH.....FVYKVYLYARS
A0K0K5_ARTS2/118-241SRLYLGYHWVSDALAS.LFISFVVLG.....AVIALDTWRTA
A4XP73_PSEMY/98-234PRLVAGAHWGSDAFVGGVFLSLLALA.....WSCYTPLGYRA
A4X1H8_SALTO/101-242TTTYLGWHWLTDSIAG.LLLGLLLDR.....VLHRVPWDDVP
Q9EWX3_STRCO/115-237STVYLGTHWLSDVLLG.WVAGLLILL.....ALPWFEPLITR
F2G969_ALTMD/101-223SRVLLGVHWPSDIIAG.WFAGGSMAS.....FCFYVIKWKRK
A1BJZ6_CHLPD/56-185SRVYVGVHYPSDVFAG.SFIGICSAL.....LTYIIWSWLYK
A4FQA0_SACEN/76-196SRVYVGAHYPHDVIAG.FLLGALVAT.....AVMPLTGPLTP
B0U8C7_METS4/61-186PRIYAGYHYATDIIAG.AIIGISTAM.....FVRFLLPINTI
A1S1V4_SHEAM/77-196SRITNGAHWPLDVVMG.AWLGWGSAR.....LAAHWVPECQL
A1W5E3_ACISJ/72-191SRIAAGMHFPADVLAG.WGIASGSLA.....LAGSLLTMLAS
A5CF96_ORITB/78-203SRLSLAMHYPSDIIYS.CIITAMILY.....TTKAILEIQII
B4U5Z7_HYDS0/54-171ERSYVGVHFPLDTITG.ALIGVFSFY.....VAKALVDSSFK
A5DBA1_PICGU/102-232GRLYCGMHGFLDLLVG.SIIGTGLFI.....FRYVWGNAWDM
Q4D544_TRYCC/102-225SRLFLGMHWPADVVAG...IGVAFLI.....VLSHMAFLRVW
SSPA_DICDI/88-218SRLYNGHHTPMDVIAG.LIVAITSIL.....ATTYQLRYFIE
Q32GQ5_SHIDS/77-232SRLLLGMHWPRDLVVA.TLISWALVA.....VATWLAQR...
Q9CMX4_PASMU/75-237SRLRFGMHYPIDLFIS.TLIAFFVHW.....GIFTFLQKKSI
Q21JU9_SACD2/110-231SRVLVGVHWPVDTLVG.SGLGILCAL.....AGIYIANKTPR
C1DG09_AZOVD/106-238SRVIAGMHYPQDLEMG.YRAGTALAA.....LLQADAEFKAE
Q0K1U6_CUPNH/103-229SRVVCNVHWQSDVNEG.RMMAAATVA.....RLHADPTFRAD
Q65GX3_BACLD/179-304NRIVAGMHSPLDVMGG.RVMATALSA.....AILSDPANERL
Q2IJN8_ANADE/141-265ERVLAGRHFPTDVLVG.AAAGFGFGT.....LVPLLHARGGR
Q29NI1_DROPS/67-184SRLILQRHYMLDIFAG.AIIGVLEAR.....LLEFIWISETF
Q6FEM9_ACIAD/65-182SRMILGLHYPSDVLVG.AFIGAIVAC.....GIVFCAPLAGI
A1K7H5_AZOSB/105-237GRISQGGHFLTDIVFS.FYATWLGAW.....IAWLLFVRLGW
Q3SNT4_NITWN/91-218LRMAFGGHFFTDVATA.GLVAFLVIW.....LVHGYIYR...
Q6MBQ7_PARUW/87-223ARLVQGGHFFSDVVFS.ALIMWLTSI.....GCYQIIFKSGY
A8EX54_ARCB4/94-229YKMSIGDHFLSHTLIS.MILGWLIIL.....LIVKSISFLEK
Q87X15_PSESM/102-231GRMLQGAHFFSHNIWT.AVFCWLICL.....GVYYFVLYR..
Q03CR8_LACC3/177-306TRVRILAHFTGDVTMS.LILTWSLIL.....ILAAVVQQPLV
R5ZI70_9ACTN/141-283GRIVIGAHFLSDVSCG.FALVLALEC.....LAARIAYP...
A8BDI5_GIAIC/110-282ARYAASAHFFTDTVVS.IVLAFLHLV.....LIFLSLPDLRC
A8BQZ4_GIAIC/121-285ARMSAGAHFLSDTLTA.VLIAVAFLS.....IVVVTRPDVHA
Q6MTZ1_MYCMS/144-270SRIVLNKHFLTDVVFS.VLLSFTIST.....IILIINHKKGK
R5TP42_9FIRM/95-216ATIFLKQHSVIDVMGA.VLMAYTLYQ.....FVYATEKKKV.
A3LWS4_PICST/248-396AALYLDHHWRFDIFAG.LIYSIFVWT.....VIKTWKNGLNR
Q127S7_POLSJ/95-224STLAVRQHVVVDVAGG.LVLGGLAAW.....LSLRGRGAAKR
A4CJ32_ROBBH/299-448SRMYGGIHYRMAIEVG.LDQGRSLGGYVVDQLEMNQRQTAMA
Q2HER5_CHAGB/260-418SRVFGGIHFTFAGVEG.VALGERVAK.....ETLKKFDANWD
A8L0R7_FRASN/276-428ARVWGGIHTRSADTEG.AKIGAKVTA.....YATRNYFRPRR
Q4YWD7_PLABA/107-241LIIISRFHYTVDVLLG.IFFGSTIFI.....FYHWLVDIAAK
Q6NJR5_CORDI/194-319VVMTQGVHYPTDVLGS.VVWAGCVAP.........AISLFLL
A1SKJ7_NOCSJ/98-218ARLYQGAHHPTDELAS.VCYAGAWLA.....VVRSQVLTRRP
Q82Z33_ENTFA/85-204GRLILRVHYPSDVIAG.MLLSYSWIN.....FSFQIVQRYLP
A2DYB5_TRIVA/98-241TRIRDYKHRPDDVLAG.FFVGYIFAQ.....LVWLQMIGNVF
A2EZZ9_TRIVA/91-236MRIVEYRHHIDDVISG.FLIGFLISI.....VFYLASYNAVY
A4H9E7_LEIBR/233-378SRTRDNRHNFDDILAG.SLIGIFTAL.....VAVRATMVVNY
Q6BYN9_DEBHA/112-272TRISDNRHFLRDVIGG.SVIGTHVAI.....WFYLQYFPSIF
A7EIU4_SCLS1/134-294ALTIDEYHNWYDCLAG.AIIGTVMAF.....SAYRMVYASIW
A7TF94_VANPO/122-266SRLTDHRHHWYDVLFG.SSIGLATVF.....LCWRWVFVNKQ
Q2TYI3_ASPOR/35-224TRYSDYMHAGWDIMSA.TIIGIFFAC.....LSFRWYHTFPS
A2EQG2_TRIVA/90-230ACIWDRRNHIDDAVCA.MIIGAVMGL.....ISFHTFKKVIK
LPPR5_MOUSE/122-275NRVAEYRNHWSDVIAG.FLVGISIAV.....FLVVCVVNNFK
Q9VNU2_DROME/65-225SRVADYWHHWSDVLAG.ALLGVTYAA.....ITAAYVGNLLR
A8WXP5_CAEBR/128-286TRVTDNWHFPTDVLGG.VILAIVFIV.....PAFRNSWTSTE
A6X217_OCHA4/121-242SRLAAGAHYPTDIVAG.LTIGFVATW.....WVARYMATRNI
Q5NGF4_FRATT/116-236SRIMVSSHYPSDVIFG.VAFGCYCTA.......YIYYWMRNR
Q5ZX13_LEGPH/91-208TRVILYHHYLSDVMTG.FYISMLLVG.....LFTQYLQRN..
Q6MH55_BDEBA/105-226TRVVVHDHFVSDIIFG.ACVGYVGTL.....LALQLMRKKTS
B4S7E2_PROA2/140-261NRIYDDKHWLSDTLLG.AAIGTAVGV.....AVGNMINKEED
Q7NZZ5_CHRVO/815-932GRLASQDHWLSDITAG.GILGYVAGN.....WLWQSQRDNSR
Q0SBZ7_RHOSR/226-347TRLYLGEHWLSDVVGG.VLLGGLAAV.....IGGALYTTWMD
Q89JR9_BRADU/79-199TRLVVLAHWASDVVAG.FALGAALER.....FLRLCTGYPLD
B7VND8_VIBSL/235-351FKSYSGSAFFSDVLMG.GVLGALTTW.....HIVRLDAK...
Q5E4L0_VIBF1/241-366ARVWLGVHFVSDAIVG.VCLGGMVFY.....HFSNMQKKHGD
Q9RVR6_DEIRA/14-135SRLVLHVHFPSDVVVG.LLLGLAFAY.....LGTHGQFNQQG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window