Sequence alignment for CL0526

PF02393

D2K3J3_HCMV/211-336-------------------WSLGLDTM----ARFI----------------IRH-------HGQFM-------PLTYPP.
B8YE72_HCMV/157-296-------------------YRGDVESL----SAEV----------------TKR-------GYASY-------TIDDPF.
A8T728_HCMV/200-332-------------------NDTTPEGS----YATA----------------ERI-------LGCDV-------KLHTPG.
D2K4S5_HCMV/202-333-------------------DPTDAAAV----AKTA----------------REM-------SGLNL-------VIRTPGR
D3YS52_HCMVO/180-322-------------------HGHDADAL----AACV----------------GEH-------HGRDV-------NFHTPGR
D2K3X0_HCMV/202-332-------------------HDNSISEL----QRVT----------------CRY-------RGECV-------PLRTPGE
D2K5D0_HCMV/151-256-------------------GCMHIHAF----AQWR----------------ATY-------RGRLM-------VMGDYSV
C8BKJ5_HCMV/34-153-------------------SALGKVAL----RYAV----------------RKL-------MKRGA-------RLRHDS.
D2K5D0_HCMV/11-135-------------------LLDRWRPP----KTSR----------------PWK-------PGQRV-------AL..VWP
B9VXJ9_HCMVT/546-653-------------------ILHDRTNL----LRVC----------------QLH-------AGSKI-------RL..GGS
B9VXD4_HCMVT/116-247-------------------ANSTGRAM----RKWS----------------QRD-------AGTLL-------PL..GRP
C3Y900_BRAFL/167-275-------------------AYKSPTKL----QAFF----------------QEN-------YSISV-------PLGSNGD
C3Z365_BRAFL/157-265-------------------AYKSPKKL----KAFF----------------QEY-------RKTTL-------AVGSNGE
B9VXL1_HCMVT/265-382-------------------LARDLLAL----WRLC----------------MKR-------EGSIF-------....SWR
D3YRX5_HCMVO/17-135-------------------RAGDFNGL----NDFL----------------EQE-------CGTRL-------HV..AWP
Q14VM9_RAHV1/5-123-------------------SAKWRAEG----DRFL----------------EKF-------RGCKL-------RI..KGL
D2K5D5_HCMV/214-331-------------------ACEDTAAR----CAYV----------------EAH-------REAQL-------TL..IWP
A8T728_HCMV/45-168-------------------FCLEPMEI----TRYV----------------HRN-------EGRCL-------SLGPPK.
D2K4G8_HCMV/126-245-------------------TADARKDL----QKLV----------------RRV-------SGTVL-------RL..SWP
D2K595_HCMV/6-123-------------------APDGGLNL----DDFM----------------RRQ-------RGRHL-------DLPYPR.
C3RWK6_FRG3V/35-153-------------------KPGDLAVV----SDFV----------------KSN-------TGKRL-------PIGKRS.
C3RWV3_FRG3V/65-186-------------------DPANLVLV----ADFV----------------KKN-------RDAKL-------HPPASEA
C1C3V1_LITCT/15-136-------------------ADSHDLLV----DNFV----------------ENF-------SDDLI-------RPPDNEV
D2E8A7_ANHV1/5-121-------------------VQATFEEL----PQLV----------------DDR-------RGDRI-------LLKR...
Q070N0_CPRVZ/47-172-------------------PLAGPDLI----ACYA----------------DRH-------RGRHL-------YFAKQQ.
B5XAY6_SALSA/21-139-------------------AVEFLGQI----KEIV----------------SKH-------RNNKI-------LLAKPK.
B4YEM5_9ALPH/49-167-------------------TIADLEGI----RELV----------------RKF-------RGRLL-------PFEKCP.
B1NFI8_ADEGX/15-131-------------------YWGTLEEI----DRYA----------------KAN-------RGTVA-------PIGSG..
F5HIG2_HCMV/399-518-------------------ERASGVHL----QRYV----------------RAT-------AGRWL-------PL..CWP
D3YRW4_HCMVO/69-190-------------------AEFGLGCL----EAYV----------------RIN-------AGQVL-------PV..VWP
B9VXJ9_HCMVT/55-169-------------------VRRDYEGL----RRYL----------------RRF-------EGSCV-------SLGWPS.
C8CFJ9_HCMV/42-158-------------------CQYSADVL----RDWV----------------RNH-------VDQVL-------SLGIPH.
B9VXG6_HCMVT/274-510-------------------AEEATALG----RELR----------------RRW-------AGTTV-------ALQTPGR
Q4KS78_ISKNV/1-104-------------------........----...M----------------EST-------HGTTI-------AL..PHP
C8CFJ8_HCMV/54-179-------------------RQYDPPAL----RTYV----------------QRH-------QGTTV-------ALRNPA.
A8T729_HCMV/26-179-------------------CQDSRQDI----RHLV----------------RSY-------ADMNI-------SLPVSAP

PF14433

C3WDW2_FUSMR/11-172--------------------KSLAHQV----LEYA----------------GWY.......EGRKV-------DVEKIIE
F0KCA1_CLOAE/2-150--------------------KEKTIEI----LKKS----------------GWH.......PNRKI-------DITDLVV
C3BLQ7_9BACI/6-145--------------------SNKTIEE----LKKA----------------GWY.......EDRKI-------DILENVK
F0KCA3_CLOAE/3-152--------------------EERVKKI----LKRS----------------GWI.......ENQKI-------DITNQVK
B1HSL5_LYSSC/5-144--------------------SIKTKKI----LKQS----------------GWT.......PERKK-------DISSQVK
C0Z7L3_BREBN/2-133--------------------SKETLKI----LRDS----------------GWY.......EGRSI-------DIKEIEE
B7N9G4_ECOLU/6-148--------------------NKQVMSV----LLQN----------------GWH.......YGRKE-------NIDKYIK
A8RVU3_CLOBW/13-150--------------------KSKVKQL----MEYA----------------GWY.......EGRSV-------DISIAEQ
A9B4M5_HERA2/3-169--------------------ESIIHSL----LMTA----------------GWQ.......PDTTI-------DPEPWLY
C2M481_CAPGI/2-151--------------------KKSLENL----LAQQ----------------GITLLNSLSKEERRA-------RTETIKA
A9B4M4_HERA2/9-180--------------------SQLAETV----YRQL----------------GWT.......PDRDI-------DPTPHLE
A9B983_HERA2/9-180--------------------TDQTIFL----LTAA----------------GWS.......PERTY-------DPTTTII
D1ALL2_SEBTE/5-152--------------------DKDILET----LKKS----------------GWQ.......ENREI-------PIHNILE
C2G2C6_9SPHI/5-144--------------------DKRIITR----LLES----------------GWF.......DGRNI-------LKNLEFP
A9DRL2_9FLAO/4-142--------------------KKEVQEQ----FRKA----------------GWY.......EGRNL-------KKKYDKI
D7VVD7_9FLAO/4-136--------------------KSNVQTQ----FEKA----------------GWF.......ENRNI-------ETALNQK
D6B4A2_9ACTO/10-151--------------------SEDLLGA----LVAS----------------GWS.......ADRKV-------DPGQWVL
C5UVJ4_CLOBO/2-147--------------------ENITLNR----LKKA----------------GWT.......NERNI-------NIDLIEK
A4A0B2_9PLAN/1-122--------------------.......----MLAA----------------GWR.......ADRNV-------LNQLDMP
A2W0F4_9BURK/45-178--------------------PLTVRPL----FVAA----------------GWC.......GPADG-------RLSARDG
B7WUX3_COMTE/6-150--------------------SPVVIEL----LQAR----------------GWT.......PQREV-------AIPVPVQ
C6DGM5_PECCP/1-142--------------------MNKLIEL----ASKY----------------GEI.......KRQEI-------KLSECLS
B7M4P5_ECO8A/11-152--------------------MCELINE----ASKY----------------GKV.......NERKM-------DIDLCCK
C4GHT1_9NEIS/5-139--------------------NAKTLQV----LRQA----------------GWH.......PNRRT-------DIAAIAA
D1A3E8_THECD/9-150--------------------PPEVTAH----MTAA----------------GWS.......PERRV-------DVSAWEE
D9X9L6_STRVR/182-321--------------------SEETDRV----LRAG----------------GWF.......PGRSV-------PTETWET
Q82G08_STRAW/7-151--------------------TQEVLGW----LTER----------------GWFPGR.DIGEQAEE-------LVRVRLQ
B1VX82_STRGG/7-150--------------------VEEVDAW----LTEA----------------GWYPGR.DAAQEAAE-------AVATVTD
D6K3Y2_9ACTO/7-151--------------------PEEVDAW----LANA----------------GWHP....GRRCDDL-------AATEIED
A4X261_SALTO/97-242--------------------PPDVREV----LDQA----------------GWFPG...RDMTAAV-------DLWLARF
D6K3Y4_9ACTO/15-161--------------------RVTQRHR----AERI----------------GWTAG..RNVEREGM-------QAALRIA
B1VX84_STRGG/1-149--------------------MTSNHDA----LTAA----------------GWHDG..RDVRDDAM-------SAVLKTI
D9UTG4_STRS3/29-176--------------------PDAADSA----LRTA----------------AGPPAAGTSLQAEIW-------ADTLRAH
C4RQ15_9ACTO/292-437--------------------PDEVAHA----LVAA----------------GWAP....HIGDEIM-------AAAAVRD
A4X254_SALTO/6-153--------------------PPLVTEA----LQAA----------------GWVPGRRDDDRAQQW-------ALRLAAD

PF09346

A0RE58_BACAH/19-133--------------------PTSKEAI....QKLQ----------------KFS-------...SI.......DVPLDYL
C2T3B2_BACCE/8-142--------------------KATEESI....EELE----------------EFL-------...GF.......LLPEDYK
A4YB72_SHEPC/14-135--------------------PASTEEI....QALE----------------KWL-------...GT.......DLPSEHK
A0A011W5W1_BACTI/32-156--------------------GINLEDI....TSLQ----------------NEL-------...NI.......QIPDIYK
B1YF81_EXIS2/16-130--------------------GVSAVDL....KKAE----------------HAL-------...GV.......LFPDEYK
A6FHD8_9GAMM/19-145--------------------PINGDDI....TELE----------------SKL-------...NC.......FLPESYK
A4EPD0_9RHOB/35-163--------------------RVDPGQL....DQAE----------------QLL-------...GI.......KLPMDYR
A0RAV0_BACAH/42-162--------------------PLSKEEI....QVFE----------------DEM-------...GT.......RFPEPYK
B8I5J3_CLOCE/15-125--------------------AVNSVEI....DRIE----------------SEM-------...GL.......KLPKVFK
C3G559_BACTU/15-125--------------------AASDIEI....QAVE----------------NRM-------...NV.......TLPNVYK
A8FII6_BACP2/13-123--------------------PASDKQI....KKAE----------------SQL-------...NM.......VLPHAHK
Q1DBU4_MYXXD/34-167--------------------PVTADEV....AQLE----------------KKF-------...KL.......KLPPSYV
A5UV09_ROSS1/24-144--------------------GCTRDQLDQLIQKVQ----------------NEL-------...GA.......KLPEGYI
Q6HMR4_BACHK/23-143--------------------PATDTEVQSLRERVK----------------EKF-------...NV.......DLPREYE
Q1CV91_HELPH/17-134--------------------PLNEKAL....NGLE----------------DQL-------...KT.......GLSDAFK
B1YEX8_EXIS2/15-147--------------------PLKKEEI....KHIE----------------KQL-------...GS.......RLPKSYL
A5TTY9_FUSNP/35-181--------------------PVKEEEI....LDVE----------------QKL-------...GY.......RIPEDFR
Q47P53_THEFY/18-133--------------------PAKEALF....WRIE----------------EAL-------...GM.......PVPWELV
A0JSM0_ARTS2/15-129--------------------PASADAI....QACE----------------AQL-------...GH.......RLPDYLR
Q82GY4_STRAW/63-178--------------------PVSDDAL....TWAA----------------GVL-------...GS.......PLPDELI
Q2BBP1_9BACI/47-165--------------------PATEAET....ALIK----------------KEL-------...KV.......ELPDKLA
Q65PK7_BACLD/18-132--------------------PIETGKL....QKAE----------------ELL-------...GV.......SFPDELV
C2T2Q4_BACCE/27-144--------------------PATKDEL....TDIQ----------------KCL-------...HV.......ELPNDLY
A5UTX3_ROSS1/55-202--------------------PALPEDI....RAIE----------------QSL-------...GF.......ALPESLH
A6C6S9_9PLAN/31-128--------------------PLSADEL....KSLI----------------DNI-------............PLPQELC
A5FCA9_FLAJ1/44-161--------------------PVSKEEI....LALE----------------TKL-------...GT.......ALPENLK
B7X333_COMTE/152-284--------------------PFSLAEL....RLCE----------------WRL-------...GC.......NLSQSLR
Q4K6P0_PSEF5/56-173--------------------PVSEDAL....QALE----------------QRL-------...GC.......PLPRSLR
J8EZ11_BACCE/25-143--------------------PLKSEEI....EEAE----------------ELL-------...KM.......KFPKELK
B8I223_CLOCE/15-131--------------------KLSEDDI....INAE----------------RKM-------...GL.......ELPRELK
Q81BA7_BACCR/48-167--------------------REDKGQV....NEVI----------------NRL-------...GV.......EVSNTFR
Q89MJ4_BRADU/28-170--------------------QPTLAAL....EAFE----------------KSI-------...GC.......RLPDEYR
A3ZX28_9PLAN/24-139--------------------VPTSDEV....DSAS----------------QQV-------...CI.......PFSEDYR
A0AMA9_LISW6/21-137--------------------PATSDQI....NEAQ----------------KLL-------...NV.......QFNEQYI
A5FMA4_FLAJ1/23-172--------------------LASDEEI....QELT----------------SYF-------...SL.......PLPQELI
D4Q174_LISMN/14-152--------------------NNWQVDL....SAVE----------------KNL-------...PEQILKRYGKLPDAYK
D6EFH2_STRLI/29-155--------------------PVDGEAP....ARAE----------------AAL-------...GF.......PLPALLT
Q3BQF4_XANC5/29-173--------------------PATEAAI....AAAQ----------------ARL-------...GV.......RLPAWLR
Q4UXL8_XANC8/219-365--------------------VADTEAL....AAAE----------------ARL-------...GV.......RLPALFK
A5FJY1_FLAJ1/42-170--------------------NISTEEL....QDIK----------------SLT-------...NN.......NLEDSYY
Q1ZQF0_PHOAS/14-166--------------------KGKIVNI....SEIQ----------------KER-------...GM.......DLPSDYL
Q5WBD2_BACSK/23-138--------------------IPSVRDW....EKIE----------------KKF-------...GC.......EFPEEFK
A5FGR4_FLAJ1/41-198--------------------TAAVDDI....FEFE----------------KKY-------...NV.......SLPDCYR
Q0RKI3_FRAAA/56-185--------------------PAAEQTV....VAAE----------------QRL-------...AV.......RLPPTFR
Q9F3Q3_STRCO/47-179--------------------PADEERV....AAAE----------------ARL-------...GR.......RLPPSYR
A6CDZ7_9PLAN/19-143--------------------PATDEMI....TEAE----------------EQL-------...SV.......RFPASYR
A6X425_OCHA4/20-140--------------------PVGDLAI....AQAE----------------ADL-------...GV.......QFPLEYR
B3ZML8_BACCE/18-127--------------------GVSSAEI....KQAE----------------EEL-------...QF.......NFPEQYK
A4VZJ4_STRS2/19-128--------------------PASEQEV....AVAE----------------SKL-------...QL.......IFPAEYK
A1RNF3_SHESW/21-128--------------------LPTFEQL....VEVE----------------EQI-------...LI.......SLPRELK
Q0VNR5_ALCBS/21-130--------------------LPDEDRL....VEIE----------------EQL-------...LI.......SLPADYK
Q7M7B0_PHOLL/25-133--------------------LPDDELI....SQYE----------------KEI-------...GF.......EFSNDYK
F3IRY6_PSESL/25-133--------------------LPDDALI....IAYE----------------REL-------...GI.......SFLDEYK
A4Y9N5_SHEPC/8-116--------------------PPTDKEI....EEAQ----------------LKL-------...GF.......KFSPEYI
A4SRI0_AERS4/8-116--------------------IPTDDEI....AIAE----------------RKL-------...GI.......TFHNDYR
A0A016B5A2_BACFG/47-168--------------------TLNEDDI....VELE----------------RDL-------...KR.......EIPSQFR
Q82RV7_STRAW/96-236--------------------PAPEADI....REVE----------------QEL-------...DL.......TVPPGLK
A4FNW2_SACEN/30-166--------------------PPDPAEL....VALE----------------AEF-------...HV.......QLPADLR
A5FAZ7_FLAJ1/185-329--------------------GISTEDI....QEHI----------------ELE-------..DDI.......KIPPALI
A3I618_9BACI/42-194--------------------GATDAQI....ESLL----------------EIF-------...PQ.......S.PQSFI
B4SN74_STRM5/28-184--------------------GASAEDL....QRLR----------------AQW-------...P........QVPDSLV
Q39NE9_BURS3/28-182--------------------GATPAQL....DALR----------------DAY-------..PQC.........PASLL
Q6HHY9_BACHK/33-185--------------------GATKEDI....DILR----------------LKY-------..PNC.........PESLI
A5TXY3_FUSNP/37-189--------------------GASEENI....KKLK----------------EEY-------...P........EVPDSLI
A1RPC3_SHESW/26-168--------------------GLSNSAL....DEAE----------------KQL-------...GF.......TLISPLR
M2C2K9_TREDN/40-189--------------------GASEEEI....SAFE----------------EKL-------...GI.......TLPEDFK
H2K898_STRHJ/18-144--------------------GASDDEI....AALE----------------EAL-------...GV.......GAPEELK
A6G0Q7_9DELT/31-170--------------------PATDDEL....AAIA----------------EAA-------...GA.......ELPGELK
Q9RYT7_DEIRA/27-166--------------------GATAEAL....AQAE----------------KDM-------...GL.......TFPPEMR
Q93JL3_STRCO/163-310--------------------GATEAEI....AEAQ----------------TRL-------...GV.......TLPDELK
A1ZXR5_9BACT/30-166--------------------GAAKEDI....AKLS----------------AKI-------...GY.......ELPEDFQ
SMI1_CANGA/103-288--------------------PCTANDI....KHAE----------------EDL-------...EV.......VLPKALK
Q59YV1_CANAL/104-343--------------------KCTDSDL....QDFQ----------------KDL-------...SI.......KLPNCVI
A5DZP7_LODEL/117-382--------------------KCTSDDL....RDFQ----------------KDL-------...NI.......TLPNCVV
SMI1_DEBHA/98-296--------------------PCTDADL....SDFQ----------------KDL-------...NI.......KLPNCLI
Q55KB3_CRYNB/120-282--------------------PVNPTLL....ATFE----------------AEI-------...GC.......PLPRSVR
Q4PAY0_USTMA/184-339--------------------PCSEDAL....DELE----------------MTI-------...GY.......ALPSCVR
SMI2_DEBHA/142-319--------------------GVTTADL....NEFE----------------NDL-------...GCG......SLPVEIR
A1C9R6_ASPCL/143-317--------------------GCTQNDI....NELE----------------HEL-------...DC.......SLPLEVR
SMI1_YARLI/171-356--------------------PATASDL....NELE----------------ADL-------...DC.......SLPLDVR
A6EFN0_9SPHI/29-161--------------------PATLQDI....EHTE----------------KSI-------...GV.......AFNNELK
O07689_LISSE/36-156--------------------GATDAQL....AEVE----------------KML-------...DI.......SLPDDLK
A3ZN04_9PLAN/36-149--------------------GATADEL....VALE----------------GEL-------...GI.......SLPTEYR
B1YF88_EXIS2/9-123--------------------GITEERL....QEVE----------------TEL-------...GF.......SLPSELR
A7VFJ3_9CLOT/24-132--------------------ETTEEKI....LEFE----------------KEK-------...EI.......TLPSKYK
A4X269_SALTO/103-245--------------------HLDEVQL....QAVE----------------AEL-------...GT.......RLPPSYR
A1RND9_SHESW/4-129--------------------DLSEEQL....KRTE----------------EEL-------...GA.......KLPHEYR
A0PQE6_MYCUA/4-131--------------------PVAEKYI....LDTE----------------EKL-------...GV.......TFPAAFR
I0LI94_CORGK/4-116--------------------PVTEDKI....LAAE----------------ETL-------...GR.......RLPETLR
Q0VKY9_ALCBS/4-130--------------------PVDEKYI....ENTK----------------NEL-------...GV.......KFPDSFR
Q9F2N4_STRCO/160-298--------------------AVTEQQV....QGVE----------------EDL-------...GY.......RLPGAYR
A3KB11_9RHOB/18-152--------------------AALADAV....AELE----------------TAL-------...GT.......ALPEPYR
Q1DEQ7_MYXXD/33-153--------------------PVTAARI....AAFE----------------AQM-------...GW.......RLDDDLR
Q1CY42_MYXXD/19-141--------------------PATPAQI....AAFE----------------QSV-------...GW.......RLDPDLR
Q09D40_STIAD/24-149--------------------PAHPDEL....ADFE----------------RRM-------...GW.......KLDPDLR
B1YEY9_EXIS2/39-159--------------------PVRSETL....DAFE----------------AEF-------...KQ.......PLPSEYQ
Q5WJU2_BACSK/38-153--------------------PVTENHL....SQFE----------------KDQ-------...GI.......NIPSDFK
A7Z7P3_BACA2/41-156--------------------GATDLEI....ESFE----------------KKI-------...KV.......SLPEDYK
J7JW73_BACIU/42-161--------------------KATLNDI....QSFE----------------AKH-------...QL.......TLPQDYQ
M1U9G8_BACIU/23-165--------------------INTNEQL....KELE----------------MNI-------...GN.......QLPSDYK
A7Z5R7_BACA2/23-158--------------------INSHQVL....KKFE----------------DEN-------...SF.......DISDDYK
A3ZX25_9PLAN/22-154--------------------PLSEDEL....ERLE----------------NSV-------...GV.......AFPDDYR
A7VE32_9CLOT/35-145--------------------PEPEDAV....KRFE----------------SRY-------....T.......PIPAEYR
A7MRN6_CROS8/1-150--------------------MITEADI....QRLE----------------KTY-------...CI.......SLPEDYK
B3Z4D7_BACCE/12-154--------------------LPSDSLI....LKKE----------------EFW-------...RV.......QLPVDYK
Q3IK24_PSEHT/8-124--------------------RVNIEDV....HGIE----------------KHF-------...NV.......ILPDDYK
A5Z4R3_9FIRM/12-152--------------------KLTVDEI....QSFE----------------KKI-------...GK.......IFPNDFK
A5Z4R9_9FIRM/9-151--------------------KITKEDI....LEFE----------------EKL-------...NT.......KFPEAYV
A1ZMA9_9BACT/9-138--------------------TITQQDI....DNWE----------------QKE-------...GI.......VLDKTFQ
A0A011UV81_BACTI/12-152--------------------PIGIEDI....EDFE----------------NKY-------...GI.......LLPDDYK
C2SX01_BACCE/13-142--------------------KVTDEQI....EQLE----------------EYF-------...GI.......KFPNDFI
A0A011VP76_BACTI/12-138--------------------AIDEQVI....IAVE----------------NSF-------...GV.......RFPDDYR
Q6HGG3_BACHK/12-159--------------------PLLRENV....KNVE----------------REL-------...GI.......HFPLDYI
Q6HGE4_BACHK/13-160--------------------EVSETKI....KEIG----------------LQL-------...GF.......QLPQDYI
A0RAF8_BACAH/19-149--------------------LGNEEAV....VRFE----------------NML-------...EI.......VLPNDYK
A7FEI4_YERP3/10-144--------------------PADELSI....VNIE----------------KKL-------...GI.......TFPNDYR
Q21ED8_SACD2/11-151--------------------AISESAI....RDFE----------------ENI-------...GM.......PFPPDYR
A6CCT7_9PLAN/22-151--------------------KPTVDAI....KQFE----------------VVI-------...GR.......ELPETLK
Q6CS49_KLULA/64-193--------------------PLNDEDV....KKFE----------------KFV-------...GT.......VLSSGVR
B1J8X4_PSEPW/139-260--------------------AISCADL....DFLE----------------EVL-------...GG.......RLPPEFR
A7ML24_CROS8/19-151--------------------KISNIEW....TEFA----------------KCF-------...PA.......RLPESFK
A5FLI6_FLAJ1/11-131--------------------KLTIKEI....IEFE----------------KLF-------...NC.......LLPDSFK
A0A014N9J6_YERPE/11-153--------------------NIDLSDI....KSVE----------------KTL-------...GY.......SFPEAFV
Q5LEK4_BACFN/167-306--------------------PLTKEDI....KDFE----------------MEL-------...NI.......KIPAAMK
Q65VI9_MANSM/10-134--------------------PITANEL....LAIE----------------KRL-------...NI.......VLPQEMK
B8I222_CLOCE/15-149--------------------KLSEWDL....QEIE----------------KKF-------...SF.......KIPSDIY
F6BM79_SINMB/32-167--------------------GADCGTI....QRVE----------------AKF-------...GR.......RLPPDIR
Q28UU7_JANSC/42-166--------------------GVDEAAL....DAFE----------------ARF-------...DI.......VLPEAFR
Q5LEK4_BACFN/11-139--------------------SLTLKDF....EEIE----------------SNL-------...GY.......VLPKRLK
Q5LEK9_BACFN/11-148--------------------SLTLKDF....EEIE----------------SKL-------...GY.......ALPERLK
A7RYE8_NEMVE/119-257--------------------GLTETEI....SRIE----------------ERH-------.LKGL.......SLPLDVK
G1S8C1_NOMLE/121-251--------------------GAREEDL....DAVE----------------AQI-------...GC.......KLPDDYR
Q52KV8_XENLA/36-166--------------------GVLERDL....NGVE----------------EKI-------...GC.......KLPDDYR
A0RFK3_BACAH/36-159--------------------GTSEEYV....HAFE----------------QEW-------...GY.......KLDLKYR
Q9CND2_PASMU/14-158--------------------MVSQEII....SDFE----------------GTF-------...GI.......KLLKLYI
A6DN67_9BACT/17-158--------------------IVTQKDI....SVFE----------------KKY-------...NI.......KLPKKYK
A9B016_HERA2/24-146--------------------GVDEAVI....AELE----------------QAR-------...GY.......RLPACYR
Q5WC01_BACSK/21-135--------------------GIPESEI....EAKE----------------REL-------...GF.......SLPLVLR
A1ZUI6_9BACT/29-147--------------------GCTEAEI....QELE----------------ALH-------.PSGL.......SIPQIFK
Q47R76_THEFY/31-145--------------------GCTPEEV....AEVL----------------AEK-------..KDV.......SVPQAYV
A8M704_SALAI/21-139--------------------GLEPSEV....QQVQ----------------AAW-------..DMI.......RLPSAYE
H2GD97_CORD2/14-156--------------------KCTALDT....ARIE----------------NEL-------...GK.......KLPQSYR
A1IPF3_NEIMA/1-117--------------------MIKQNSF....VPYP----------------EAM-------LPKGF.......KYPQSYL
A3I6Z7_9BACI/22-146--------------------NVKDSWI....TDAE----------------IEL-------...GF.......QLPPSYC
Q4KGS7_PSEF5/46-175--------------------GTTIEAI....RAAE----------------MAL-------...GR.......TLPCSFA
Q38V57_LACSS/13-131--------------------LIDPRFI....KP..----------------...-------...NA.......ALPADYL
A4BCB8_9GAMM/14-147--------------------ELTDEML....EVAE----------------KKL-------...GV.......KLPAEYV
A0R498_MYCS2/11-150--------------------PLTDELL....DATE----------------QRL-------...GV.......RLPESLV
A6VZI9_MARMS/37-168--------------------YSAEEAL....SCFE----------------EKY-------...GF.......LLPKEYV
Q2BBP3_9BACI/17-145--------------------ELHEETL....QKVQ----------------REL-------...QV.......DLPESYI
C2T7X0_BACCE/16-147--------------------PIKDELI....KKAE----------------EVL-------...NV.......KLPESYI
A5TTM3_FUSNP/176-315--------------------TATDEDF....KKVE----------------KEL-------...GY.......RLPEAYK
A4X5D2_SALTO/28-164--------------------PLTDEVL....QVVE----------------AQL-------...GH.......KLPTAYV
Q11VT9_CYTH3/29-168--------------------TPTDALI....DSIE----------------QEL-------...GY.......KLPASYI
A1INP6_NEIMA/28-167--------------------PFTPEIL....AAVE----------------SEL-------...GY.......KLPQSFI
H1GFW8_LISIO/124-264--------------------YPTPQRV....AAIE----------------AEL-------...GY.......KLPKSYI
A8FAT3_BACP2/17-145--------------------KINEKGI....AKAE----------------KKL-------...GV.......ILPDTYK
B1KH37_SHEWM/28-163--------------------CASDKQL....FDIE----------------AFL-------...GT.......SLPSDYK
B1KH38_SHEWM/29-165--------------------LSSNEEL....IAIE----------------RFL-------...QA.......KLPDDYL
Q8GDM6_PHOLU/25-137--------------------APSPEWI....NKTE----------------KAL-------...SL.......TLPDDYK
Q7N9I9_PHOLL/23-147--------------------GVDIDTI....REFE----------------SLL-------...GV.......TFPESYK
Q926X2_LISIN/25-149--------------------TGTPELI....KIYQ----------------DAL-------...GN.......EFPETYK
Q5DWB0_CLOPF/25-151--------------------GASIEAI....NLAE----------------EML-------...DL.......KFSKLYR
B1KPX6_SHEWM/17-136--------------------GASLGLV....SNLE----------------EAL-------...GV.......ILPETYK
A7Z5G8_BACA2/23-137--------------------GIGEDKI....LKIE----------------QDL-------...QV.......TLPDSYK
B1ESH1_BACAN/4-119--------------------AVDQAN.....KGIQ----------------QML-------...NI.......KFPNSYH
A7GQ33_BACCN/21-130--------------------EISDENI....VMIE----------------KKL-------...GC.......TFPPQYR
A4IKF8_GEOTN/21-132--------------------GASEQEI....RKAE----------------EIL-------...GL.......QFPESYR
A3ZX34_9PLAN/23-143--------------------KASQESI....EKLE----------------SLL-------...GS.......RLPVSFK
B7KWA7_METC4/14-155--------------------TSSEADL....ARAE----------------AEL-------...GF.......PLPQSYR
Q2SDZ5_HAHCH/28-140--------------------APDQDSL....ARAE----------------RLL-------...EV.......RLPQEYK
Q4K9A1_PSEF5/28-140--------------------LASQTQI....LEAQ----------------QAL-------...GL.......QLPADYT
Q633D5_BACCZ/17-131--------------------PTSLENI....TVIE----------------SQL-------...NI.......SFPTDYI
A5Z4Q5_9FIRM/17-131--------------------PATKIMI....EKVE----------------KEW-------...NI.......SLPCEYK
A1TSU7_ACIAC/17-133--------------------PADERAI....ARVE----------------SEL-------...DV.......VFPVDYR
G7QG99_LEPII/16-123--------------------GTNLNTI....QKIE----------------SIF-------...KV.......TFPEDYK
Q5LEL2_BACFN/13-124--------------------GASSASI....DDVE----------------KLL-------...NT.......TLPKQYK

PF14568

A0AMA9_LISW6/24-135-----------------------SDQI----NEAQ----------------KLL----------NV.....--QFNEQYI
A3I6Z7_9BACI/25-144-----------------------DSWI----TDAE----------------IEL----------GF.....--QLPPSYC
A3ZX34_9PLAN/26-141-----------------------QESI----EKLE----------------SLL----------GS.....--RLPVSFK
A4IKF8_GEOTN/24-130-----------------------EQEI----RKAE----------------EIL----------GL.....--QFPESYR
A4VZJ4_STRS2/22-126-----------------------EQEV----AVAE----------------SKL----------QL.....--IFPAEYK
A6CDZ7_9PLAN/22-141-----------------------DEMI----TEAE----------------EQL----------SV.....--RFPASYR
A6X425_OCHA4/23-138-----------------------DLAI----AQAE----------------ADL----------GV.....--QFPLEYR
A7FEI4_YERP3/13-142-----------------------ELSI----VNIE----------------KKL----------GI.....--TFPNDYR
A7GQ33_BACCN/24-128-----------------------DENI----VMIE----------------KKL----------GC.....--TFPPQYR
A7Z5G8_BACA2/26-135-----------------------EDKI----LKIE----------------QDL----------QV.....--TLPDSYK
A7ZAC8_BACA2/3-116-----------------------EEEF----RAAE----------------KSL----------RA.....--SFPKAYK
A8UFY5_9FLAO/12-126-----------------------EDDL----NELE----------------LVL----------EK.....--ELPEDYK
A9DRK0_9FLAO/13-128-----------------------EEDL----QEFE----------------NTL----------GK.....--RLPEDYR
A9INX3_BART1/38-152-----------------------DLQI----EKAE----------------KTL----------GL.....--QFTSSYK
A9INY0_BART1/31-145-----------------------DVLI----EKAE----------------KTL----------GL.....--QFTTSYK
A9INY3_BART1/35-149-----------------------DILI----EKAE----------------RTL----------GL.....--QFTSSYK
A9INY6_BART1/35-148-----------------------DLVI----EKAE----------------KAL----------GL.....--QFTSSYK
A9INZ4_BART1/35-149-----------------------DLRI----EKAE----------------KAL----------GL.....--QFTSSYK
A0A011PWV5_BACAN/9-120-----------------------DQAN----KGIQ----------------QML----------NI.....--KFPNSYH
B1BP25_CLOPF/31-145-----------------------LEEI----NKYE----------------EKL----------GV.....--EFPNIYK
B1KH37_SHEWM/31-161-----------------------DKQL----FDIE----------------AFL----------GT.....--SLPSDYK
B1KPX6_SHEWM/20-134-----------------------LGLV----SNLE----------------EAL----------GV.....--ILPETYK
B3ZML8_BACCE/21-125-----------------------SAEI----KQAE----------------EEL----------QF.....--NFPEQYK
B4AJF6_BACPU/18-123-----------------------DINI----KKAE----------------SQL----------NM.....--VLPDAYK
B5ULT3_BACCE/26-136-----------------------DNDW----RELE----------------KKF----------GC.....--QFPKEFK
B5UUA7_BACCE/17-130-----------------------ELQI----KETE----------------EKL----------GA.....--AFPNQYR
B7INQ5_BACC2/11-140-----------------------EESI----EELE----------------EFL----------GF.....--LLPEDYK
B7JLP8_BACC0/25-134-----------------------KKQV----DYVQ----------------DTL----------QL.....--KLPESYK
B8DA94_LISMH/28-135-----------------------TEWV----NNAE----------------KAL----------SI.....--KLPSDYK
B8DD33_LISMH/29-148-----------------------AEVI----TIYQ----------------NVL----------EN.....--VFPDSYK
B8DD37_LISMH/24-135-----------------------EEQI----HEAE----------------KIL----------DA.....--QFNKQYI
C2KY92_9FIRM/22-126-----------------------TAQI----REAQ----------------ESL----------DL.....--VFPDEYI
C2M8M5_CAPGI/23-138-----------------------ITWI----EQTE----------------KKL----------GF.....--SLPDSYK
C2PY06_BACCE/26-128-----------------------EEAI----QEVE----------------ERL----------NV.....--KLPDSYR
C2TZ07_BACCE/17-130-----------------------ELYI----KETE----------------EKL----------GV.....--VFPAQYR
C2ZR32_BACCE/17-130-----------------------EIDI----KETE----------------EKL----------GV.....--IFPEQYR
C3BVU2_9BACI/35-154-----------------------LEDI----TILQ----------------NEL----------NI.....--QIPDIYK
C3WVX7_FUSNU/23-127-----------------------EEQI----IRAE----------------KRL----------EL.....--KFPEEYK
C4L6I6_EXISA/20-124-----------------------EKEV----QQAE----------------EKL----------GM.....--MFPKTYR
C6ABU4_BARGA/31-145-----------------------DVLI----EKAE----------------KTL----------GL.....--QFTTSYK
C6ABU7_BARGA/31-144-----------------------DVRI----KTAE----------------NTL----------DL.....--QFTSSYK
C6AD58_BARGA/31-144-----------------------DIWV----KKAE----------------ETL----------GL.....--QFTSSYK
C6AD60_BARGA/31-146-----------------------DVWI----KRAE----------------ETL----------GL.....--QFTSSYK
C6AEU7_BARGA/31-145-----------------------NERI----EEAE----------------KIL----------GV.....--KFTTSYK
C6CF14_DICZE/28-135-----------------------SEWI----QKAE----------------QAL----------GV.....--TLPEDYK
C7GI90_9FIRM/31-150-----------------------EEEI----DMSE----------------KKL----------GI.....--SFSPQCK
C7N7K9_SLAHD/25-127-----------------------PEMV----KEAQ----------------EKL----------GV.....--EIPEQFL
C8K547_LISMN/28-148-----------------------DTII----EKAQ----------------VVL----------NV.....--NFPEDYK
D0KCB2_PECWW/28-147-----------------------EEDI----IKYE----------------SEL----------GV.....--LFPESYK
D0KCZ5_PECWW/26-145-----------------------EAEI----KEFE----------------ALL----------GV.....--FFPESYK
D1W447_9BACT/21-143-----------------------NEQI----LYIE----------------NEL----------NI.....--KLPKQYK
D3EC77_GEOS4/25-144-----------------------EEWI----AEAE----------------AEL----------GF.....--SLPPSYR
D3FRA3_BACPE/26-146-----------------------LELI----RAAE----------------DKI----------GL.....--KFTGAYL
D3FRA5_BACPE/24-128-----------------------DEAI----EKAE----------------EVL----------KV.....--KFPRDYR
D3I7I1_9BACT/41-148-----------------------DKDI----KQAE----------------VML----------NV.....--VFDSDYK
D3I8Y5_9BACT/21-120-----------------------EDKI----VSAE----------------NVL----------GL.....--HFAQEYR
D4FV91_BACNB/25-133-----------------------EDKI----KEIQ----------------NSL----------NV.....--KLPESYK
D4FXH9_BACNB/26-163-----------------------NEQL----KEIE----------------MNI----------GK.....--QLPSDYK
D4FXI0_BACNB/26-142-----------------------DQEI----RNFE----------------EAV----------LGKFPVN--EIPSGYK
D4FXI1_BACNB/25-133-----------------------HENI----GRIE----------------ENL----------QC.....--DLPNSYK
D5HHH7_9FIRM/25-128-----------------------DKDL----YDAE----------------KIL----------NL.....--KIPEQYV
D5SSH7_PLAL2/27-142-----------------------RGSI----ERLQ----------------ELL----------HT.....--RLPLSLQ
D6CWW7_9BACE/84-197-----------------------DEDI----SKLE----------------SKL----------NV.....--ILPLSYK
D7JDE8_9BACT/35-142-----------------------REEI----INAE----------------NEL----------GI.....--KFDKDYV
D7VC45_LACPN/26-146-----------------------SELI----AMGE----------------TKL----------GV.....--QFPSDYR
E1UUR3_BACAS/39-142-----------------------PQEI----SDIE----------------QKL----------GV.....--TFPNDYK
E1UUR6_BACAS/25-133-----------------------GDQI----REIE----------------EYL----------NV.....--TLPDSYK
E2MKG2_PSEUB/45-159-----------------------DEWI----IKAE----------------QRL----------GH.....--PLPDSYK
E3YTZ2_9LIST/29-148-----------------------PELI----EVYQ----------------DSL----------GN.....--EFPESYK
E3ZJV4_LISIV/35-139-----------------------MEQI----KLVE----------------NNL----------GI.....--SFSSDYV
E4LF31_9FIRM/27-134-----------------------DDEI----LNIE----------------KAL----------NI.....--KLDDDFK
E5W3S4_9BACI/29-137-----------------------EEKI----KKIE----------------NDL----------QT.....--TLPESYK
E5W3S5_9BACI/24-128-----------------------NEDI----TNAE----------------NQL----------RC.....--KFPQEYK
E6UJN0_RUMA7/22-127-----------------------MEKI----KNAE----------------DKL----------GL.....--QFADDYK
E8K361_9STRE/11-132-----------------------INII----ESVE----------------HRL----------QI.....--TLPEDYK
E9SF19_RUMAL/19-157-----------------------KDII----KRFE----------------NIL----------GL.....--SFPDDYK
F0RDN6_CELLC/80-198-----------------------ETEI----IEIE----------------KQI----------NL.....--TLPLSYK
Q0VKY9_ALCBS/7-128-----------------------EKYI----ENTK----------------NEL----------GV.....--KFPDSFR
Q2SDZ5_HAHCH/31-138-----------------------QDSL----ARAE----------------RLL----------EV.....--RLPQEYK
Q4K9A1_PSEF5/31-138-----------------------QTQI----LEAQ----------------QAL----------GL.....--QLPADYT
Q4KGS7_PSEF5/49-173-----------------------IEAI----RAAE----------------MAL----------GR.....--TLPCSFA
Q5DWB0_CLOPF/28-149-----------------------IEAI----NLAE----------------EML----------DL.....--KFSKLYR
Q5WIS2_BACSK/30-150-----------------------EELI----NLAE----------------EKL----------GL.....--KFTGLYL
Q7M7B0_PHOLL/28-131-----------------------DELI----SQYE----------------KEI----------GF.....--EFSNDYK
Q7N9I9_PHOLL/26-145-----------------------IDTI----REFE----------------SLL----------GV.....--TFPESYK
Q8GDM6_PHOLU/28-135-----------------------PEWI----NKTE----------------KAL----------SL.....--TLPDDYK

PF14567

A0KT76_SHESA/1-131MHDIIEQLQERSETVPVPLELPTFEQL----VEVE----------------EQI----------LI-------PLPRELK
Q0VNR5_ALCBS/1-133MDDIVDMLRERHDGGLIALELPDEDRL----VEIE----------------EQL----------LI-------SLPADYK
D4ZBL0_SHEVD/1-131MHEIIEQLQELSETVPIPLELPTFEQI----VVVE----------------EEI----------LM-------PLPPELK
A4SRI0_AERS4/1-119MQND.............PFRIPTDDEI----AIAE----------------RKL----------GI-------TFHNDYR
Q21KG4_SACD2/2-132INEIAEMLAARSLKTAYPLELPTMDDI----VEAH----------------EAM----------LI-------SVPADFR
A6X428_OCHA4/5-137IASIIEEINRIDDPTGRKLTLPDDALI----HKYE----------------SAT----------GF-------QFSEDYK
A8H7F8_SHEPA/1-132MNDIIEQLQEMSETVPVPLELATFEQI----VEVE----------------EEI----------LI-------PLPMELK
A0Y938_9GAMM/1-109MDDIID...............A.....----...E----------------EQI----------LL-------SLDPEFR
C1DFY0_AZOVD/1-133MEDVIEQLRELNEPVPVPLELPDEDLL----VEIE----------------EQL----------LI-------NLPFELR
C4S745_YERBE/5-136IDKVINELKILSGGEILNIELPDDALI----ASYE----------------KNI----------GF-------TFPEDYK
B0KR80_PSEPG/1-133MEEVIEQLREANEPVPVPLELPDEDQL----VEIE----------------EQL----------FI-------NIPFVFK
Q2BMU0_NEPCE/1-131MEDIIELLREKNAEVPVPLDLPDEDDL----VEIE----------------EQI----------LI-------SLPDEYK
B2C6T5_ACIBA/7-138LDNIIQELKELSGNSRLNIELPDDIFI----SAYE----------------RKI----------GF-------IFPKDYK
B8CKE3_SHEPW/1-119MEEF.............EIKIPSDIQI----ADAQ----------------KKL----------GF-------RFPKEYV
A0A030T0X2_PSEAI/1-131MEDVIEKLRELNEPVPVPLELPEEELL----VEIE----------------EEL----------LI-------GIPAEFR
Q086X2_SHEFN/1-131MNDIIEQLQELSETVPVPLELPTFEQL----VEVE----------------EQI----------LI-------GLPNDLK
F3IRY6_PSESL/5-136IRDVVAELKSVRMSLPNAQRLPDDALI----IAYE----------------REL----------GI-------SFLDEYK
B3PC71_CELJU/34-164MEDVIELLREYNEPVPVPLDLPDEDQL----VEIE----------------EEI----------LL-------PIPRDMR
D4RXT0_9FIRM/2-135MFEDLDKFIAENQEEVLVTGGWTDDKI----SELE----------------KQL----------SI-------AFREEVK
A4Y9N5_SHEPC/1-119MKIF.............EFVPPTDKEI----EEAQ----------------LKL----------GF-------KFSPEYI
Q12R95_SHEDO/1-131MHELIEQLQALNEPVPVPLELASFEQL----VEVE----------------EQI----------LI-------SLPRELK
D0WEZ4_9ACTN/5-134INDLMTRLGDKGSFTKVA...PTQEML----AEVE----------------EKL----------GF-------IVPEQFL
A3QH89_SHELP/1-131MHDLIEQLRELSETVPVPLELPSFDQL----VEVE----------------EQI----------LI-------PLPAELK
C1D4A4_DEIDV/3-141QEELFKRLRAGGVPAPLIPKLPDDREI----DALE----------------VLL----------ET-------RLPPSYR
A1S8W2_SHEAM/1-131MHELIEQLQEMSEQVPVPLELPSFDQL----LDVE----------------EAI----------LI-------PLPADLK
Q7M7B0_PHOLL/5-136LNDVIEEIERLSDGQRNDVDLPDDELI----SQYE----------------KEI----------GF-------EFSNDYK
D1W447_9BACT/1-147M.DYITRLKQ.NEEFEYWLE.ADNEQI----LYIE----------------NEL----------NI-------KLPKQYK

PF07348

SYDP_KLEP7/6-179-----------------------AEAL----RAFT----------------QRY----------CAVWQQQRHSLPR..S
SYDP_COLP3/9-191-----------------------TQAI----LNFS----------------KSY----------SQQHVEQFGHLPT..V
I2B5Z7_SHIBC/5-178-----------------------RSAL----AAFT----------------RQY----------CQRWQEQFGHGPQ..S
R5V7K9_9FIRM/4-185-----------------------KKAF----EKFF----------------EEM----------TQNYLNEWGVPPR..V
SYDP_YERPE/6-179-----------------------STAL----RSFT----------------QRY----------IDLWQQQTGHLPA..S
K7A551_9ALTE/8-182-----------------------TAAL----GEFV----------------KKY----------LI.AAKKHPEMLM..A
E0SCC1_DICD3/6-178-----------------------SQAL----NAFT----------------QRY----------VELWQRETGHPPA..S
X2H3P8_9GAMM/9-173-----------------------...L----IKFT----------------TR.----------...WLNQFDYAPQ..S
D4ZHN4_SHEVD/5-186-----------------------.PAL----DNLF----------------KIY----------QLAYFEKLGELPR..Y
D8MW85_ERWBE/6-178-----------------------SRAL----TEFT----------------QKY----------CDEWDRVCGHPPA..S
SYDP_CROS8/6-179-----------------------QQAL----AAFS----------------ARY----------CEAWRQQRGSLPV..S
F5Z4L7_ALTSS/6-183-----------------------SNEL----TQLI----------------GAF----------TS.HHERSGSLLT..I
SYDP_SHEAM/4-180-----------------------LAAL----TKFH----------------EIY----------KAAFVERLGELPR..C
J7U684_MORMO/6-178-----------------------SQAL----HQFT----------------RHY----------VGLWQEKTGLPPI..S
E1STK9_FERBD/4-172-----------------------.EAL----DAFH----------------QRY----------FTSWQQALGQHPV..S
I0DWV2_PROSM/6-180-----------------------SEAL----TQFT----------------QQY----------VTKWKEQTGLSPA..S
D5C956_ENTCC/6-179-----------------------ANAL----KTFT----------------TRY----------CDAWHDTRGTWPQ..S
G9AL81_PANAN/6-179-----------------------AEAL----TDFT----------------TRY----------CLHWQQNNGHAPA..S
SYDP_IDILO/6-175-----------------------.ESI----DALM----------------TRY----------KE.......NVPVRYT
C2X4F6_BACCE/19-188-----------------------KNAM----STYF----------------KLR----------KEYFDRGLNFLFK..T
SYDP_EDWI9/6-178-----------------------SAAL----REFT----------------QRY----------VAQWQQQHGDWPS..S
M4UN22_9GAMM/6-180-----------------------QTEL----LSVF----------------SRY----------ASLFQTEKESYPL..Q
H2IXL4_RAHAC/6-178-----------------------SVAL----REFT----------------QRY----------VDLWQEETGMPPA..S
G4QLZ8_GLANF/9-186-----------------------...F----DTLV----------------NAY----------ID.LAGDDDRQLL..T
E6WGC7_PANSA/6-178-----------------------.DAL----RDFT----------------ARY----------CDEWQQRTGHLPA..S
SYDP_ERWT9/6-179-----------------------SQAL----RDFS----------------QRY----------CDLWQQKSGHAPA..S
SYDP_VIBCH/6-179-----------------------VQAL----SAFS----------------QRF----------LQHCAQQTGQLPE..N
SYDP_PHOLL/6-180-----------------------TEAL----SNFT----------------RCY----------VDLWQKETGAPPA..S
W0HTY4_9ENTR/12-183-----------------------..AL----ADFT----------------ARY----------VEYWRQTTGGLPV..S
C3AMX1_BACMY/7-177-----------------------KREM----EQYF----------------HKL----------FKEWKNYNHSLPK..S
B4F2E3_PROMH/5-178-----------------------STEL----KQLT----------------QNY----------VDLWQQESGFPPA..S
SYDP_VIBF1/6-179-----------------------EQAL----ANFS----------------QRY----------VEAWKAQHDCLPI..N
SYDP_VIBSL/6-179-----------------------QDAL----LSFS----------------QRY----------VDAWQQQHQSLPR..N
A8GIF5_SERP5/18-190-----------------------.HAL----REFT----------------QRY----------VDLWQQERGHAPA..S
F7YLH7_VIBA7/10-183-----------------------EQAL----LSFT----------------QRY----------LDAYQTKHGESPR..N
SYDP_ALTMD/6-178-----------------------SAQL----DKFV----------------SSY----------VE...HAKGEGLK..I
SYDP_SHELP/5-184-----------------------.PAL----DQFF----------------TLY----------HQAYSDKLGESPR..Y
F0LVK8_VIBFN/6-179-----------------------VEAL----FSFS----------------QRY----------LDAVQHAHQQLPY..N
SYDP_HAHCH/7-185-----------------------TARL----SELT----------------NTF----------IERHHSSSRQRPC..I
SYDP_TOLAT/7-177-----------------------.CAL----SDVF----------------ARW----------FA.YQQQRGIQVC..C
SYDP_PECAS/6-179-----------------------VSAL----AAFT----------------QRY----------VACWQQEKGHLPA..S
SYDP_SHEON/4-180-----------------------LPAL----DKFL----------------QNY----------HQSYLSTLGELPR..Y
SYDP_PHOPR/6-179-----------------------AVAL----SDFS----------------SLF----------LQAWRDTGHGFPR..S
SYDP_AERHH/6-178-----------------------LSAL----EHFF----------------LRW----------QRDGEARRG.LPL..C
SYDP_SHEFN/4-180-----------------------SSAL----DCFI----------------KNY----------LKSYQDTLSEFPR..Y
D3VCK7_XENNA/6-179-----------------------TEAL----SDFT----------------RRY----------VELWYEKTGFPPV..S
D3UWF0_XENBS/6-179-----------------------TEAL----SDFT----------------RRY----------VELWQEETGLPPV..S
SYDP_SHEPW/5-180-----------------------.PAL----DIFL----------------SDY----------QQAYLDTLGEHPR..Y
R9VV65_9ENTR/6-179-----------------------AHAL----KAFT----------------ERY----------CNAWHTQRDSWPQ..S
SYDP_PSEA6/6-182-----------------------NQSL----DDFM----------------GRF----------AA.FVKEHAEAGA..I
SYDP_VIBPA/6-178-----------------------TQAL----QDFS----------------LRY----------QQAWQNKHNELPR..N
SYDP_ECOLI/6-179-----------------------AQAL----KDFT----------------ARY----------CDAWHEEHKSWPL..S
SYDP_SHEDO/4-180-----------------------SSAL----EKFI----------------NSY----------LNSYQNALSELPR..Y
SYDP_VIBVY/6-179-----------------------SLAL----ADFS----------------QRF----------QAAWQAQHNALPS..S
C3AMX8_BACMY/4-175-----------------------KNAM----QQYF----------------RLR----------IKLAHEGLDFLLK..T
H2FY10_OCESG/7-174-----------------------.TAL----SELF----------------DRY----------RRLYGQ.....PL..A
SYDP_PSYIN/6-180-----------------------QTQL----FDFF----------------ERF----------KAHWQTQKKSLPQ..A
SYDP_PSEHT/6-178-----------------------..QL----TQLH----------------QRF----------NDKTLKNTQKHPL..M

PF14435

Q11UH8_CYTH3/2-179----------------------IIQDYIDYWNEQDI.............ELDKI-------KLESVH....AIPLPVDIL
C3G535_BACTU/11-190----------------------SPQDFLVNWNEEIY.............GLIHY-------NEKIIH....SFSFSKETK
C3BLX0_9BACI/3-181----------------------APKEFCDRWNEKRD............GTLNKL-------DREIMQ....HANLSSDKR
C3G534_BACTU/3-181----------------------LPEDFREKWDVNKD............GPLITF-------PEKELI....NKNFSAEVK
D7C074_STRBB/3-186----------------------THAELVSAFGSLW...............VETM-------PPEVAE....RHFANPDDR
E0QLS9_9FIRM/4-167----------------------NLDYLLNNLAF..................NIK-------DTPYKK....LSLEELSHN
A3IE36_9BACI/4-165----------------------DIREIREYYDSET................REY-------DFNELV....NFGVSVENA
D3GZ30_ECO44/1-160----------------------MLIKLIDLQTI..................KIF-------EKINS.....SSSDLSKEI
B7LQU5_ESCF3/2-167----------------------SLNPFDVKINE..................KFC-------EINKSD....SKSNLLKEI
B1VPR4_STRGG/6-176----------------------LRAPHAYPTTERMI...............MSN-------ESIDEE....SPQFSMTQL
C6PRK9_9CLOT/16-217----------------------VRNKLKIRESEER................KEI-------MRDIIM....NLKLPQETK
B8CKE1_SHEPW/1-161----------------------MDAAIFDNYSKYP...............ITRL-------SELG.........LHLSTI
A3ZNI5_9PLAN/58-240----------------------QVESWISFFGADQ...............LTYL-------HPSD.......DQLRGDVQ
D3E916_GEOS4/1-200----------------------MEPQYHTLYDHG................VLPY-------TRESLD....GQGMHDKTV
E2N2L1_CAPSP/5-173----------------------TKDDIEALHQAG................ITAE-------LHSPQP..QLMSLDEVLQN
C0DUS3_EIKCO/1-171----------------------..MNLAQALTADH...............IPIL-------RPAAYSAGEPAGLNTVFKD
B5HAW8_STRPR/39-232----------------------GAHQVAEENGSGRYTPHWVRPGHWAQNGTLDL-------PTADAREVADWPAPVREAL
E8RXJ9_MICSL/4-174----------------------TREQLTALWGERG...............VIYF-------PDQRFD....AVLGPLGPE
D1A3F0_THECD/3-170----------------------SHQEMSDLWGEDG...............LLYI-------PPEHV......ERFRFDLR
Q47PK6_THEFY/247-430----------------------LDQLLADTRLP.................VQRY-------DADAVA....ESGLPEATH
E4NDB7_KITSK/233-420----------------------LGKRLAALFGEDG...............THRF-------EQAQTL....AADLPEEFS
C9YY18_STRSW/732-910----------------------IGQELAAAFGPG................VFRF-------DQQAVS....RQGVPPIVA
B5HAJ0_STRPR/6-189----------------------DLKSLERTVGEEN...............VHRL-------QPQVAE....AYGFNGEAL
D6K842_9ACTO/6-208----------------------RRGRLVRVFGEGR...............VPTV-------PAAAFP....PAAADTEGA
B5I6T5_9ACTO/6-184----------------------DRETLESEFDPEE...............LTTF-------SAAAVA....TIRHE.PSA
E4N1Q1_KITSK/249-422----------------------DRATAEAVFGADG...............TVTL-------DERTA.....AAVAHRPSR
D1A5L5_THECD/6-199----------------------TREQLAEAYGEEN...............LLTI-------PADRLP....DLLIHQPTR
D6K293_9ACTO/144-316----------------------PHRLLAQEFGAAA...............VVRF-------EEIDFP....PALTHEPTR
D6KEF7_9ACTO/214-404----------------------PDGLLDEVFGGGG...............MVRL-------ADDHLP....PALVHAPTR
Q82D46_STRAW/203-389----------------------PPRLLDEEFGAFG...............IVRF-------EDVDFP....AALTHEPTR
D9WNF8_9ACTO/13-197----------------------DAAWLEARFGAGS...............LWRP-------AEADLP....AELTDQESR
Q2U157_ASPOR/71-266----------------------NQAWLEKQFGPGS...............LWRP-------KEADLP....VDLTNKPAR

PF02393

D2K3J3_HCMV/211-336..GTE--------------LR.......----------------------------------------------------
B8YE72_HCMV/157-296.DECP--------------DTHFAFWTH----------------------------------------------------
A8T728_HCMV/200-332YGTVI--------------MRLMKTVQQ----------------------------------------------------
D2K4S5_HCMV/202-333TEVEP--------------LLMLGSIEG----------------------------------------------------
D3YS52_HCMVO/180-322H.AKT--------------LKLLTSFGC----------------------------------------------------
D2K3X0_HCMV/202-332M.TRP--------------LLLCGQAEN----------------------------------------------------
D2K5D0_HCMV/151-256IRVST--------------IR.......----------------------------------------------------
C8BKJ5_HCMV/34-153..GLY--------------VC.......----------------------------------------------------
D2K5D0_HCMV/11-135KDRCL--------------VI.......----------------------------------------------------
B9VXJ9_HCMVT/546-653P.ACT--------------FT.......----------------------------------------------------
B9VXD4_HCMVT/116-247Y.GFY--------------AR....VTP----------------------------------------------------
C3Y900_BRAFL/167-275I....--------------.........----------------------------------------------------
C3Z365_BRAFL/157-265R....--------------.........----------------------------------------------------
B9VXL1_HCMVT/265-382DGNEA--------------LT.......----------------------------------------------------
D3YRX5_HCMVO/17-135E.RCF--------------IQ....LRS----------------------------------------------------
Q14VM9_RAHV1/5-123RTNAY--------------ME.......----------------------------------------------------
D2K5D5_HCMV/214-331E.KHS--------------LV.......----------------------------------------------------
A8T728_HCMV/45-168..GWH--------------VM.......----------------------------------------------------
D2K4G8_HCMV/126-245N.GWF--------------FT.......----------------------------------------------------
D2K595_HCMV/6-123..GYT--------------LF.......----------------------------------------------------
C3RWK6_FRG3V/35-153..DLY--------------VR.......----------------------------------------------------
C3RWV3_FRG3V/65-186AKDMY--------------IR.......----------------------------------------------------
C1C3V1_LITCT/15-136TNNLH--------------IR.......----------------------------------------------------
D2E8A7_ANHV1/5-121..GIV--------------LR.......----------------------------------------------------
Q070N0_CPRVZ/47-172..RCC--------------LR.......----------------------------------------------------
B5XAY6_SALSA/21-139..SYE--------------LR.......----------------------------------------------------
B4YEM5_9ALPH/49-167..DFC--------------LR.......----------------------------------------------------
B1NFI8_ADEGX/15-131..KHF--------------LV.......----------------------------------------------------
F5HIG2_HCMV/399-518PLHGI--------------ML.......----------------------------------------------------
D3YRW4_HCMVO/69-190P.GWN--------------LV.......----------------------------------------------------
B9VXJ9_HCMVT/55-169..QCI--------------YV.......----------------------------------------------------
C8CFJ9_HCMV/42-158..NWF--------------LQ.......----------------------------------------------------
B9VXG6_HCMVT/274-510R.LQP--------------MVLLGAWQE----------------------------------------------------
Q4KS78_ISKNV/1-104P.GAT--------------LT.......----------------------------------------------------
C8CFJ8_HCMV/54-179..NWF--------------LV.......----------------------------------------------------
A8T729_HCMV/26-179P.GWR--------------LD.......----------------------------------------------------

PF14433

C3WDW2_FUSMR/11-172YYQKN.....----N----YILNDFAKK----------------------------------------------------
F0KCA1_CLOAE/2-150YYEKR.....----G----FEIFPEAKK----------------------------------------------------
C3BLQ7_9BACI/6-145FLEER.....----D----FEVFESAKK----------------------------------------------------
F0KCA3_CLOAE/3-152MLESE.....----G----YEVFEAARK----------------------------------------------------
B1HSL5_LYSSC/5-144YLEDK.....----G----YIVFDCVKE----------------------------------------------------
C0Z7L3_BREBN/2-133NLERL.....----G----YIVFPEVKN----------------------------------------------------
B7N9G4_ECOLU/6-148CLSIK.....----K----YFVNEIICD----------------------------------------------------
A8RVU3_CLOBW/13-150YYANH.....----G----VPMMKTTQR----------------------------------------------------
A9B4M5_HERA2/3-169ELRQQ.....----Q----YPIFPQLIE----------------------------------------------------
C2M481_CAPGI/2-151RYREA.....----G----YDDLPHELV----------------------------------------------------
A9B4M4_HERA2/9-180HIKQA.....----T----YPIFPLAEA----------------------------------------------------
A9B983_HERA2/9-180QPLTT....I----G----WPIFPEAQR----------------------------------------------------
D1ALL2_SEBTE/5-152YYEKI.....----R----YVCNDMQLK----------------------------------------------------
C2G2C6_9SPHI/5-144IE........----G----YPL..DAKK----------------------------------------------------
A9DRL2_9FLAO/4-142N.........----G----FHELPDFLK----------------------------------------------------
D7VVD7_9FLAO/4-136IN........----N----FGELPNHLK----------------------------------------------------
D6B4A2_9ACTO/10-151PLEGE.....----G----YRSHPLAEG----------------------------------------------------
C5UVJ4_CLOBO/2-147TFKEK.....----S----INMPEKIRV----------------------------------------------------
A4A0B2_9PLAN/1-122K.........----S----YLMFPAITQ----------------------------------------------------
A2W0F4_9BURK/45-178E.........----.----...HPGDA.----------------------------------------------------
B7WUX3_COMTE/6-150SALGRQ...P----S----LATHPAVA.----------------------------------------------------
C6DGM5_PECCP/1-142AITNF.....----G----YLVSDGLIS----------------------------------------------------
B7M4P5_ECO8A/11-152KIEEE.....----G----YSVFVAFYD----------------------------------------------------
C4GHT1_9NEIS/5-139RAAAC.....----G----YEIGENVRA----------------------------------------------------
D1A3E8_THECD/9-150ELSRT....S----G----FRMHTAAAR----------------------------------------------------
D9X9L6_STRVR/182-321ILLQT....G----G----FEIHDAARR----------------------------------------------------
Q82G08_STRAW/7-151DSERQ.....----G----VPLTPVSAA----------------------------------------------------
B1VX82_STRGG/7-150RYRAY.....----G----VDIEPSAAA----------------------------------------------------
D6K3Y2_9ACTO/7-151ARASFRNDGG----S----LDVIQPAVE----------------------------------------------------
A4X261_SALTO/97-242ADELA.....----G----LECFPAVRA----------------------------------------------------
D6K3Y4_9ACTO/15-161AMAQSH..GT----S----LSIFPAAKA----------------------------------------------------
B1VX84_STRGG/1-149AFVEPVAGGA----T----WVLFPAAEQ----------------------------------------------------
D9UTG4_STRS3/29-176TSPAG....H----E----HHVSPAAVE----------------------------------------------------
C4RQ15_9ACTO/292-437VTAVVGA.SH----S----HVAFPAAVE----------------------------------------------------
A4X254_SALTO/6-153AAPDG....R----Q----HTIVRAAVE----------------------------------------------------

PF09346

A0RE58_BACAH/19-133EVI......Q....Q----CTN...AEI-------------------------NVKN.................------
C2T3B2_BACCE/8-142KFL......S....E----YNG...GTS-------------------------KVRY................S------
A4YB72_SHEPC/14-135KFL......L....E----TNG...AET-------------------------PIGV.................------
A0A011W5W1_BACTI/32-156DFL......Q....V----CNG...GEL-------------------------FIPG.................------
B1YF81_EXIS2/16-130DLF......L....Q----TNG......-------------------------.....................------
A6FHD8_9GAMM/19-145YLI...........S----TYG...LVH-------------------------TPNV.................------
A4EPD0_9RHOB/35-163FQV...........L----SFGLPKPTL-------------------------ALLT.................------
A0RAV0_BACAH/42-162YLL......S....L----MNG...SFL-------------------------ANLV.................------
B8I5J3_CLOCE/15-125ELL...........Y----LSN...GFV-------------------------TDDG.................------
C3G559_BACTU/15-125ELL......R....C----TNG...FSI-------------------------GSGL.................------
A8FII6_BACP2/13-123TLL......K....Q----TNG...CSV-------------------------GGDV.................------
Q1DBU4_MYXXD/34-167HFI...........S----TYG......-------------------------.....................------
A5UV09_ROSS1/24-144EFL...........S----YTD...GLL-------------------------YNGL.................------
Q6HMR4_BACHK/23-143EFL......K....T----VNG......-------------------------.....................------
Q1CV91_HELPH/17-134DFI......K....R----SNY...GFS-------------------------QWRS.................------
B1YEX8_EXIS2/15-147KKM......E....E----QNG...GDI-------------------------AFNS.................------
A5TTY9_FUSNP/35-181DIL......L....N----YSSHFEYFW-------------------------STYK...........DEEEEQ------
Q47P53_THEFY/18-133ELL......R....E----TNG......-------------------------.....................------
A0JSM0_ARTS2/15-129QLL......A....E----TNG......-------------------------.....................------
Q82GY4_STRAW/63-178SVL......R....E----SNG......-------------------------.....................------
Q2BBP1_9BACI/47-165ELY......K....E----TNG......-------------------------.....................------
Q65PK7_BACLD/18-132SLL......K....M----TNG......-------------------------.....................------
C2T2Q4_BACCE/27-144QLL......Q....E----TNG.IEGEY-------------------------GDFI.................------
A5UTX3_ROSS1/55-202HFL......Q....L----TNG...AQL-------------------------YVAP..............LAW------
A6C6S9_9PLAN/31-128DFY......A....V----TNG......-------------------------.....................------
A5FCA9_FLAJ1/44-161LFY......E....T----FGI...ADI-------------------------GEQL.................------
B7X333_COMTE/152-284DYL......L....Q----LGV...LDW-------------------------AERL.................------
Q4K6P0_PSEF5/56-173DYH......R....Q----LGVLSLAEV-------------------------LCSV.................------
J8EZ11_BACCE/25-143DFY......K....E----IGY...GFL-------------------------EASD.................------
B8I223_CLOCE/15-131EFF......K....E----VGY...GFI-------------------------KGSD.................------
Q81BA7_BACCR/48-167EFY......Y....R----FAG...PFW-------------------------EVHV.................------
Q89MJ4_BRADU/28-170QFL......L....A----CAG...GYF-------------------------QGSA.................------
A3ZX28_9PLAN/24-139QFL......L....R----YGG......-------------------------.....................------
A0AMA9_LISW6/21-137NFI......K....R----FGG...AFA-------------------------GISI.................------
A5FMA4_FLAJ1/23-172TFY......K....T----VGGIESDET-------------------------FRIS.............SAEN------
D4Q174_LISMN/14-152AFY......R....Q----LNL...CSN-------------------------VGDT.................------
D6EFH2_STRLI/29-155ELY......L....R----IGD...GGF-------------------------GPEY.................------
Q3BQF4_XANC5/29-173ELY......A....R----YDG...GAV-------------------------QMAR.................------
Q4UXL8_XANC8/219-365RLY......G....V----QDG...GDT-------------------------GWCW..........APRTRFP------
A5FJY1_FLAJ1/42-170YFL......Q....E----IGT...GQF-------------------------FIGE.................------
Q1ZQF0_PHOAS/14-166EFV......S....D----IDA...GED-------------------------YCFN..............EYP------
Q5WBD2_BACSK/23-138DFI...........E----LMS...EYS-------------------------FPGD.................------
A5FGR4_FLAJ1/41-198AFL......L....H----IGN...GGI-------------------------SYQNSAAGPGYGIFPFGENVD------
Q0RKI3_FRAAA/56-185SFL...........A----TSD...GWP-------------------------NPAE..........WIDELHA------
Q9F3Q3_STRCO/47-179EFL......M....V----SDG......-------------------------..............WRHAGGF------
A6CDZ7_9PLAN/19-143HFL...........K----QYG...ATM-------------------------GVGF.................------
A6X425_OCHA4/20-140ELL...........Q----KYG...AVL-------------------------AGGL.................------
B3ZML8_BACCE/18-127KLL...........S----ELG......-------------------------.....................------
A4VZJ4_STRS2/19-128DYL...........K----EYG......-------------------------.....................------
A1RNF3_SHESW/21-128EYL......L.....----YAS...DVI-------------------------YGAI.................------
Q0VNR5_ALCBS/21-130AFL......L....S----ASDIVCGSL-------------------------EPAT.................------
Q7M7B0_PHOLL/25-133EVL......K....K----ISN......-------------------------.....................------
F3IRY6_PSESL/25-133FFA...........K----EAS...DSI-------------------------FNGK.................------
A4Y9N5_SHEPC/8-116EFI............----KSGYDLGDA-------------------------PIEA.................------
A4SRI0_AERS4/8-116CFL...........K----TGSDVANAI-------------------------FEAA.................------
A0A016B5A2_BACFG/47-168SFL......MT...D----TNG...LHL-------------------------FHHF.................------
Q82RV7_STRAW/96-236AFY......R....L----RNG..TGHP-------------------------GDFG.................------
A4FNW2_SACEN/30-166AWW...........T----CCG...GTA-------------------------TDVL.................------
A5FAZ7_FLAJ1/185-329NFY......KVQNVD----YDPVTAAFQ-------------------------FGIN.................------
A3I618_9BACI/42-194ELL......Q....D----VNGTYHCKH-------------------------GQEN................I------
B4SN74_STRM5/28-184ALL......S....R----VNGTHFREY-------------------------PGGE..............VCV------
Q39NE9_BURS3/28-182ELL......G....K----LDGTYWRDY-------------------------GGTT................V------
Q6HHY9_BACHK/33-185SLL......E....N----IDGTYWRKY-------------------------GENE................V------
A5TXY3_FUSNP/37-189ELL......K....I----VDGTYFREY-------------------------KGKT................V------
A1RPC3_SHESW/26-168ELW......G....Y----ANG...GNE-------------------------WSTV.................------
M2C2K9_TREDN/40-189ELY......R....Y----KNGSKYLSI-------------------------LPCV.................------
H2K898_STRHJ/18-144ALW...........R----LSA...GED-------------------------GVAG.................------
A6G0Q7_9DELT/31-170TWL...........K----TNRNALNFM-------------------------GNYG.................------
Q9RYT7_DEIRA/27-166ESL......L....R----HDGSVDDSW-------------------------PTGE.................------
Q93JL3_STRCO/163-310ALY...........R----VVRARWQDW-------------------------RGDY.................------
A1ZXR5_9BACT/30-166DFL......T....R----FNEYQSVTF-------------------------FEYK.................------
SMI1_CANGA/103-288ASY......R....I----HDGQEDLES-------------------------MTGT.................------
Q59YV1_CANAL/104-343QYF......K....L----VDG...QYS-------------------------DFES.................------
A5DZP7_LODEL/117-382AFF......K....L----TDG...QLN-------------------------FGSS.................------
SMI1_DEBHA/98-296EFY......K....I----TDG...QSY-------------------------FNDN.................------
Q55KB3_CRYNB/120-282ESI......Q....V----ADG...QDL-------------------------ETTG.................------
Q4PAY0_USTMA/184-339ESY......L....I----YDG...QEL-------------------------ESNQ.................------
SMI2_DEBHA/142-319QFY......K....R----HDGQFRGGK-------------------------PTGL.................------
A1C9R6_ASPCL/143-317ESL......M....S----HDGQERPGL-------------------------PTGV.................------
SMI1_YARLI/171-356DSC......L....I----HDG...QEK-------------------------FGRP.................------
A6EFN0_9SPHI/29-161ELY......L....F----ADGTNIDTV-------------------------TPSG.................------
O07689_LISSE/36-156EIL...........K----LSK......-------------------------.....................------
A3ZN04_9PLAN/36-149QFLKIARYVK....I----DDG...CEI-------------------------GGLD..........ANGV...------
B1YF88_EXIS2/9-123TYF......K....K----ENK......-------------------------.....................------
A7VFJ3_9CLOT/24-132EWM......L....F----SDG...GEL-------------------------FLPA.................------
A4X269_SALTO/103-245RWL......E....Q----TNG...AQP-------------------------EMEH.................------
A1RND9_SHESW/4-129EAM......K....I----DNG...GEA-------------------------STEE.................------
A0PQE6_MYCUA/4-131AKT......M....A----DNG...GAV-------------------------.ETS.................------
I0LI94_CORGK/4-116ERL......L....Q----NNG...GEV-------------------------IDNE.................------
Q0VKY9_ALCBS/4-130KKM......M....K----SNG...GGV-------------------------EVST.................------
Q9F2N4_STRCO/160-298SFL......K....A----AGG...CAP-------------------------VGTA.................------
A3KB11_9RHOB/18-152SFL......L....T----YGG...GAP-------------------------YPLI.................------
Q1DEQ7_MYXXD/33-153AFY......L....H----CDG...AEL-------------------------FRRL.................------
Q1CY42_MYXXD/19-141AFY......L....H----CDG...ADL-------------------------FGTV.................------
Q09D40_STIAD/24-149AFY......L....H----CNG...AEL-------------------------IERL.................------
B1YEY9_EXIS2/39-159TFL......E....L----HDG...AKL-------------------------FMLG.................------
Q5WJU2_BACSK/38-153EFL......S....L----HNG...ARI-------------------------YESM.................------
A7Z7P3_BACA2/41-156TFL......K....L----HNG...ARI-------------------------FDLL.................------
J7JW73_BACIU/42-161KFM......T....L----HNG...AKI-------------------------FEIL.................------
M1U9G8_BACIU/23-165DFL......K....K----YGG...CYL-------------------------ESKK.................------
A7Z5R7_BACA2/23-158EFL......N....L----YGE...CWI-------------------------EEDN...........VFFPVL------
A3ZX25_9PLAN/22-154TFL......R....Q----FGA...CDL-------------------------EEYA.................------
A7VE32_9CLOT/35-145WLL......L....N----FGG...CYL-------------------------AEPW.................------
A7MRN6_CROS8/1-150TFL......L....L----NNGFVVKSP-------------------------DYCN.................------
B3Z4D7_BACCE/12-154NFI......K....V----NNG...GSP-------------------------EKKS.................------
Q3IK24_PSEHT/8-124TVL......P....V----LNR...GKP-------------------------SKDQ.................------
A5Z4R3_9FIRM/12-152KFL......L....K----SNG...GYP-------------------------REEL.................------
A5Z4R9_9FIRM/9-151DFL......L....E----SNG...GTP-------------------------EEDL.................------
A1ZMA9_9BACT/9-138RFL......L....E----YNG...GVP-------------------------THRQ.................------
A0A011UV81_BACTI/12-152QFL......L....S----KNG...GKT-------------------------EQRR..............FKT------
C2SX01_BACCE/13-142ECV......K....K----YDG...GYP-------------------------TPDT.................------
A0A011VP76_BACTI/12-138ECI......K....K----NNG...GYP-------------------------EPNI.................------
Q6HGG3_BACHK/12-159ECV......M....K----NNG...AHV-------------------------SPEV.................------
Q6HGE4_BACHK/13-160DCV......K....I----NGG...AGV-------------------------LPEE.................------
A0RAF8_BACAH/19-149LCV......A....N----YNA...GRP-------------------------RPNV.................------
A7FEI4_YERP3/10-144EFL......K....K----YNG...GYP-------------------------EPD..................------
Q21ED8_SACD2/11-151EFM......L....K----YNG...GDP-------------------------LKCV...............FK------
A6CCT7_9PLAN/22-151VLL......D....T----VNG...GSP-------------------------SHDI.................------
Q6CS49_KLULA/64-193AFY......M....K----GNG...GKL-------------------------PDER.................------
B1J8X4_PSEPW/139-260RLY......L....S----SNG...GYI-------------------------GDAQ.................------
A7ML24_CROS8/19-151AHY......L....R----ING...GYL-------------------------AEED.................------
A5FLI6_FLAJ1/11-131DFY......L....L----NNG...GFL-------------------------PEEN.................------
A0A014N9J6_YERPE/11-153SHY......L....S----FNG...GVP-------------------------LRAW.................------
Q5LEK4_BACFN/167-306NFY......L....K----FNG...GMP-------------------------SPYC.................------
Q65VI9_MANSM/10-134NLY......L....K----FNG...GQP-------------------------TEYV.................------
B8I222_CLOCE/15-149KHY......L....L----YNG...GYP-------------------------EKCI.................------
F6BM79_SINMB/32-167RLY......A....A----HDGQPAGSP-------------------------ALYL.................------
Q28UU7_JANSC/42-166RLY......L....W----RDG.HGAYL-------------------------APSL.................------
Q5LEK4_BACFN/11-139EFY......L....K----WNG...GKP-------------------------KQQT.................------
Q5LEK9_BACFN/11-148EFY......L....Q----YNG...GST-------------------------KQTA.................------
A7RYE8_NEMVE/119-257CSY......R....I----HNG...QRL-------------------------VSPG.................------
G1S8C1_NOMLE/121-251CSY......R....I----HNG...QKL-------------------------VVPG.................------
Q52KV8_XENLA/36-166CSL......R....I----HNG...QKL-------------------------VVP..................------
A0RFK3_BACAH/36-159DFL......K....H----ANG......-------------------------.....................------
Q9CND2_PASMU/14-158ELI......T....K----HNAPGIIQS-------------------------YFDY.................------
A6DN67_9BACT/17-158EIL......L....I----QNG...GTV-------------------------EIPI.................------
A9B016_HERA2/24-146AFL...........Q----TFG......-------------------------.....................------
Q5WC01_BACSK/21-135NYY...........K----ALG...RSP-------------------------HITQ.................------
A1ZUI6_9BACT/29-147DFL......TVVGKT----IRG...FTW-------------------------APGF.................------
Q47R76_THEFY/31-145DFL...........R----CAGRSAGSL-------------------------FQGS.................------
A8M704_SALAI/21-139EFL...........T----NMGSRAGRV-------------------------LLGT.................------
H2GD97_CORD2/14-156DIL......E....C----CGG...GIL-------------------------SLKN.................------
A1IPF3_NEIMA/1-117KLA......Q....S----THA......-------------------------.....................------
A3I6Z7_9BACI/22-146WWL......M....N----YGK...ARL-------------------------NGGN.................------
Q4KGS7_PSEF5/46-175RWL......L....E----HNG...KAL-------------------------.....................------
Q38V57_LACSS/13-131ALC......Q....E----TNG...GFL-------------------------SRFS.................------
A4BCB8_9GAMM/14-147ELL......K....Q----QNG...GYT-------------------------TNFV.................------
A0R498_MYCS2/11-150ALL......R....R----QNG...GYL-------------------------QVGF.................------
A6VZI9_MARMS/37-168NIS...........K----SKETKVIRL-------------------------PPCD.................------
Q2BBP3_9BACI/17-145NLM......K....K----RNG...FYL-------------------------AKKY..............YPT------
C2T7X0_BACCE/16-147TLL......K....E----QNG...GTL-------------------------RLDV..............HPT------
A5TTM3_FUSNP/176-315VLM......K....I----QNG...GEL-------------------------RKNT..............FQR------
A4X5D2_SALTO/28-164DLA......R....R----HNG...GSF-------------------------ARDA.................------
Q11VT9_CYTH3/29-168ELM......K....Q----HNG...GTP-------------------------VNCC.................------
A1INP6_NEIMA/28-167ELM......A....V----QNG...GIF-------------------------VKNC.................------
H1GFW8_LISIO/124-264YLM......RH...T----QNG...GIV-------------------------STGS.................------
A8FAT3_BACP2/17-145KLI......L....E----QNG...GYT-------------------------LHNA.................------
B1KH37_SHEWM/28-163WFM...........K----NYG...MRI-------------------------IEDD.................------
B1KH38_SHEWM/29-165WFM...........K----NVG...RRL-------------------------IDDR.................------
Q8GDM6_PHOLU/25-137WFL......N....N----FGG...GDI-------------------------CGD..................------
Q7N9I9_PHOLL/23-147FFL......Q....K----YGT...LSF-------------------------GGD..................------
Q926X2_LISIN/25-149LFL...........E----KYG......-------------------------.....................------
Q5DWB0_CLOPF/25-151EFL......L....S----FGA...LSF-------------------------NGEE.................------
B1KPX6_SHEWM/17-136EFL......L....E----LGSLSIGDI-------------------------SISG.................------
A7Z5G8_BACA2/23-137WFL......R....K----YGS...GGV-------------------------YGID.................------
B1ESH1_BACAN/4-119WFL......K....Q----YGS...GGL-------------------------DGMD.................------
A7GQ33_BACCN/21-130EFV......K....K----FGS...GGI-------------------------CGVE.................------
A4IKF8_GEOTN/21-132AFL......K....E----YGS...GGI-------------------------CGVE.................------
A3ZX34_9PLAN/23-143TFL......A....E----YGG...GGV-------------------------VEE..................------
B7KWA7_METC4/14-155NFA......Q....S----CGA...GRI-------------------------GGHL........RIFTPVPVE------
Q2SDZ5_HAHCH/28-140NFL......L....Q----YGG...GYF-------------------------AFG..................------
Q4K9A1_PSEF5/28-140WFL......K....E----CGG...GYF-------------------------ALAM.................------
Q633D5_BACCZ/17-131SFM......L....E----SNG...AEG-------------------------AIGE.................------
A5Z4Q5_9FIRM/17-131QLI......L....F----SNG.IEGPI-------------------------GKAN.................------
A1TSU7_ACIAC/17-133EFL......L....W----SNG...GQA-------------------------QVGS.................------
G7QG99_LEPII/16-123QIL......L....W----SNG...GEG-------------------------KVGN.................------
Q5LEL2_BACFN/13-124SFL......L....W----SNG...GEG-------------------------KLGD.................------

PF14568

A0AMA9_LISW6/24-135NFI------K----R----FGG.A....-------------------------....-----------------------
A3I6Z7_9BACI/25-144WWL------M----N----YGK.AR...-------------------------....-----------------------
A3ZX34_9PLAN/26-141TFL------A----E----YGG.GG...-------------------------....-----------------------
A4IKF8_GEOTN/24-130AFL------K----E----YGS.GG...-------------------------....-----------------------
A4VZJ4_STRS2/22-126DYL------K----E----YGV.IS...-------------------------....-----------------------
A6CDZ7_9PLAN/22-141HFL------K----Q----YGA.TM...-------------------------....-----------------------
A6X425_OCHA4/23-138ELL------Q----K----YGA.VL...-------------------------....-----------------------
A7FEI4_YERP3/13-142EFL------K----K----YNG.GY...-------------------------....-----------------------
A7GQ33_BACCN/24-128EFV------K----K----FGS.GG...-------------------------....-----------------------
A7Z5G8_BACA2/26-135WFL------R----K----YGS.GG...-------------------------....-----------------------
A7ZAC8_BACA2/3-116RLL------H----K----KNP.AE...-------------------------....-----------------------
A8UFY5_9FLAO/12-126AHM------K----K----YNG.GS...-------------------------...I-----------------------
A9DRK0_9FLAO/13-128QFM------K----D----YNG.GIQ..-------------------------...I-----------------------
A9INX3_BART1/38-152VFL------K----K----YGG.GE...-------------------------....-----------------------
A9INY0_BART1/31-145SFL------K----N----YGR.AE...-------------------------....-----------------------
A9INY3_BART1/35-149SFL------K----N----YGG.GE...-------------------------....-----------------------
A9INY6_BART1/35-148SFF------K----H----YKG.GD...-------------------------....-----------------------
A9INZ4_BART1/35-149VFL------K----K----YVG.GE...-------------------------....-----------------------
A0A011PWV5_BACAN/9-120WFL------K----Q----YGS.GG...-------------------------....-----------------------
B1BP25_CLOPF/31-145RFL------I----N----FNG.GYLF.-------------------------....-----------------------
B1KH37_SHEWM/31-161WFM------K----N----YGM.RI...-------------------------....-----------------------
B1KPX6_SHEWM/20-134EFL------L----E----LGS.LS...-------------------------....-----------------------
B3ZML8_BACCE/21-125KLL------S----E----LGI.IS...-------------------------....-----------------------
B4AJF6_BACPU/18-123NLL------K----Q----TNG.CS...-------------------------....-----------------------
B5ULT3_BACCE/26-136CFI------E----.----.........-------------------------....-----------------------
B5UUA7_BACCE/17-130DLI------K----L----VNN.AE...-------------------------....-----------------------
B7INQ5_BACC2/11-140KFL------S----E----YNG.GTS..-------------------------...K-----------------------
B7JLP8_BACC0/25-134WFL------T----N----YGS.GG...-------------------------....-----------------------
B8DA94_LISMH/28-135WFL------E----T----YGG.GD...-------------------------....-----------------------
B8DD33_LISMH/29-148LFL------E----K----YGT.LT...-------------------------....-----------------------
B8DD37_LISMH/24-135HFI------K----Q----FGG.A....-------------------------....-----------------------
C2KY92_9FIRM/22-126EYV------K----A----FGC.ID...-------------------------....-----------------------
C2M8M5_CAPGI/23-138EML------L----N----YEF.IS...-------------------------....-----------------------
C2PY06_BACCE/26-128WFI------K----E----YGG.GG...-------------------------....-----------------------
C2TZ07_BACCE/17-130DLF------K----L----VNN.AE...-------------------------....-----------------------
C2ZR32_BACCE/17-130DLF------K----L----VNN.AE...-------------------------....-----------------------
C3BVU2_9BACI/35-154DFL------Q----V----YNG.GELFI-------------------------PGTV-----------------------
C3WVX7_FUSNU/23-127DYV------K----E----FGA.IS...-------------------------....-----------------------
C4L6I6_EXISA/20-124DIV------K----E----FGS.VE...-------------------------....-----------------------
C6ABU4_BARGA/31-145SFL------K----N----YGG.GE...-------------------------....-----------------------
C6ABU7_BARGA/31-144SFL------K----N----YGG.GE...-------------------------....-----------------------
C6AD58_BARGA/31-144SFL------K----N----YKG.GE...-------------------------....-----------------------
C6AD60_BARGA/31-146AFL------K----H----YKG.GD...-------------------------....-----------------------
C6AEU7_BARGA/31-145DFL------K----N----YKG.GE...-------------------------....-----------------------
C6CF14_DICZE/28-135WFL------S----E----FGG.GD...-------------------------....-----------------------
C7GI90_9FIRM/31-150EFY------K----K----YGY.LS...-------------------------....-----------------------
C7N7K9_SLAHD/25-127EYL------N----I----YSY.GG...-------------------------....-----------------------
C8K547_LISMN/28-148TFL------A----D----YGA.LT...-------------------------....-----------------------
D0KCB2_PECWW/28-147FFL------R----K----YGT.LT...-------------------------....-----------------------
D0KCZ5_PECWW/26-145LFL------K----K----YGA.LS...-------------------------....-----------------------
D1W447_9BACT/21-143KFL------S----Q----CGM.CN...-------------------------....-----------------------
D3EC77_GEOS4/25-144WWL------K----N----YGS.AT...-------------------------....-----------------------
D3FRA3_BACPE/26-146DYL------K----T----FGA.GN...-------------------------....-----------------------
D3FRA5_BACPE/24-128KFV------K----H----YGS.GG...-------------------------....-----------------------
D3I7I1_9BACT/41-148QFI------K----T----FGG......-------------------------...C-----------------------
D3I8Y5_9BACT/21-120EVL------A----N----YGS.LF...-------------------------....-----------------------
D4FV91_BACNB/25-133WFL------N----K----YGS.GG...-------------------------....-----------------------
D4FXH9_BACNB/26-163DFL------K----E----YGG.CY...-------------------------....-----------------------
D4FXI0_BACNB/26-142KFL------Q----T----VNG.LD...-------------------------....-----------------------
D4FXI1_BACNB/25-133WFL------E----K----YGA.GG...-------------------------....-----------------------
D5HHH7_9FIRM/25-128WFL------K----N----YGH.GG...-------------------------....-----------------------
D5SSH7_PLAL2/27-142KFL------E----E----YGG.GG...-------------------------....-----------------------
D6CWW7_9BACE/84-197IYL------K----.----YKH.FYE..-------------------------...I-----------------------
D7JDE8_9BACT/35-142FFL------L----N----YGG.SL...-------------------------....-----------------------
D7VC45_LACPN/26-146KFL------L----E----YGA.LT...-------------------------....-----------------------
E1UUR3_BACAS/39-142EFL------L----Q----HNGMEM...-------------------------....-----------------------
E1UUR6_BACAS/25-133WFL------T----E----YGS.GG...-------------------------....-----------------------
E2MKG2_PSEUB/45-159WFL------R----N----YAG.GE...-------------------------....-----------------------
E3YTZ2_9LIST/29-148VFL------E----K----YGT.LT...-------------------------....-----------------------
E3ZJV4_LISIV/35-139WFL------E----N----YGS.GG...-------------------------....-----------------------
E4LF31_9FIRM/27-134EFT------M----R----FGG.CV...-------------------------....-----------------------
E5W3S4_9BACI/29-137WFL------R----N----YGS.GG...-------------------------....-----------------------
E5W3S5_9BACI/24-128EFI------K----S----YGS.GG...-------------------------....-----------------------
E6UJN0_RUMA7/22-127EYV------A----H----YGT.IS...-------------------------....-----------------------
E8K361_9STRE/11-132QFV------L----K----YDG.GYP..-------------------------...S-----------------------
E9SF19_RUMAL/19-157EFM------M----K----NNG.GT...-------------------------....-----------------------
F0RDN6_CELLC/80-198LFL------K----Y----FGD......-------------------------....-----------------------
Q0VKY9_ALCBS/7-128KKM------M----K----SNG......-------------------------....-----------------------
Q2SDZ5_HAHCH/31-138NFL------L----Q----YGG.GY...-------------------------....-----------------------
Q4K9A1_PSEF5/31-138WFL------K----E----CGG.GY...-------------------------....-----------------------
Q4KGS7_PSEF5/49-173RWL------L----E----HNG.KA...-------------------------....-----------------------
Q5DWB0_CLOPF/28-149EFL------L----S----FGA.LS...-------------------------....-----------------------
Q5WIS2_BACSK/30-150DYL------K----T----FGA.GN...-------------------------....-----------------------
Q7M7B0_PHOLL/28-131EVL------K----K----ISN.IF...-------------------------....-----------------------
Q7N9I9_PHOLL/26-145FFL------Q----K----YGT.LS...-------------------------....-----------------------
Q8GDM6_PHOLU/28-135WFL------N----N----FGG.GD...-------------------------....-----------------------

PF14567

A0KT76_SHESA/1-131EYL-----------L----HAS----------------------------------------------------------
Q0VNR5_ALCBS/1-133AFL-----------L----SAS----------------------------------------------------------
D4ZBL0_SHEVD/1-131EYL-----------L----YAS----------------------------------------------------------
A4SRI0_AERS4/1-119CFL-----------K----TGS----------------------------------------------------------
Q21KG4_SACD2/2-132DYL-----------L----HSS----------------------------------------------------------
A6X428_OCHA4/5-137EFL-----------K----NVS----------------------------------------------------------
A8H7F8_SHEPA/1-132EYL-----------L----YAS----------------------------------------------------------
A0Y938_9GAMM/1-109QFL-----------L----RVS----------------------------------------------------------
C1DFY0_AZOVD/1-133EFL-----------L----KVS----------------------------------------------------------
C4S745_YERBE/5-136KAL-----------K----EVS----------------------------------------------------------
B0KR80_PSEPG/1-133EFL-----------L----TVS----------------------------------------------------------
Q2BMU0_NEPCE/1-131FFL-----------L----EVS----------------------------------------------------------
B2C6T5_ACIBA/7-138KVL-----------K----EIS----------------------------------------------------------
B8CKE3_SHEPW/1-119AFI-----------K----SGY----------------------------------------------------------
A0A030T0X2_PSEAI/1-131EFL-----------L----LVS----------------------------------------------------------
Q086X2_SHEFN/1-131EFL-----------L----YGS----------------------------------------------------------
F3IRY6_PSESL/5-136FFA-----------K----EAS----------------------------------------------------------
B3PC71_CELJU/34-164RFL-----------L----EVS----------------------------------------------------------
D4RXT0_9FIRM/2-135IFI-----------R----KYG----------------------------------------------------------
A4Y9N5_SHEPC/1-119EFI-----------K----SGY----------------------------------------------------------
Q12R95_SHEDO/1-131VYL-----------M----EAS----------------------------------------------------------
D0WEZ4_9ACTN/5-134EYL-----------N----IYS----------------------------------------------------------
A3QH89_SHELP/1-131EYL-----------L----YAS----------------------------------------------------------
C1D4A4_DEIDV/3-141AYL-----------L----TLS----------------------------------------------------------
A1S8W2_SHEAM/1-131EYL-----------L----NAS----------------------------------------------------------
Q7M7B0_PHOLL/5-136EVL-----------K----KIS----------------------------------------------------------
D1W447_9BACT/1-147KFL-----------S----QCG----------------------------------------------------------

PF07348

SYDP_KLEP7/6-179EEL------Y----G....VPSPCVVDT-------------------------QGE..........AVFWQPQP......
SYDP_COLP3/9-191EHD------E----Q....WPSPCDLGS-------------------------HDT.........SHHYWQAVAMESVQL
I2B5Z7_SHIBC/5-178SEL------A----G....IPSPCIVSA-------------------------GED..........QVEWQPVA......
R5V7K9_9FIRM/4-185PYT------E----K....NPTGLFLPE-------------------------TLN.......DKGYAQWKPKL......
SYDP_YERPE/6-179KEL------Y----G....VPSPCIVET-------------------------GED..........QVFWQPQA......
K7A551_9ALTE/8-182EYD------N----E....WPSDCYTAS-------------------------GNT........GDSVTWQPVK......
E0SCC1_DICD3/6-178DEL------Y----G....VASPCIVAT-------------------------QDS..........RVHWLPRA......
X2H3P8_9GAMM/9-173EEL------H----A....IPSPCILKT-------------------------EQL..........TVFWQPFT......
D4ZHN4_SHEVD/5-186.YP------R----G....EGSTCIEGE-------------------------YEPSNYHESDEEVSVCWKPVT......
D8MW85_ERWBE/6-178VEL------L----G....VPSPCVQQT-------------------------GAD..........ELYWLPQP......
SYDP_CROS8/6-179EEY------I----G....ISSPCIVST-------------------------HPD..........AVEWEPQP......
F5Z4L7_ALTSS/6-183PYD------S----Q....WPSPCYLKQ-------------------------GDE........GELVPWEPKR.....Q
SYDP_SHEAM/4-180.FT------H----G....RPSPCLADD-------------------------ALA......GSEEPQPWQMVP......
J7U684_MORMO/6-178HDL------Y----G....IPSPCIIRT-------------------------GDE..........CVYWEPAE......
E1STK9_FERBD/4-172DKP------E----S......GPAETGR-------------------------DAE.........GRALWQARR......
I0DWV2_PROSM/6-180CDL------Y----G....IPSPCVIRT-------------------------GEN..........WVYWEPQA......
D5C956_ENTCC/6-179ADL------Y----G....VPSPCIISS-------------------------VDD..........YVIWQPQP......
G9AL81_PANAN/6-179RDL------Y----G....VPSPCLIEN-------------------------RGE..........RALWQPQP......
SYDP_IDILO/6-175EYV------E----E....WNSPIYGTV-------------------------IDE.........NTVEWTPCR......
C2X4F6_BACCE/19-188PYN------E----K....VDFVIYQGE-------------------------IEE.........DEISWKPVE......
SYDP_EDWI9/6-178HAL------Y----G....IPSPCVVYS-------------------------RDD..........CVFWRPEP......
M4UN22_9GAMM/6-180PVD------K----D....WLSPCLFGD-------------------------EVQ.........GEKQWKSVV......
H2IXL4_RAHAC/6-178EAL------V----G....VDSPCVVKT-------------------------EED..........KVFWLTQT......
G4QLZ8_GLANF/9-186EYD------V----D....WFSPCLLLN-------------------------KTR..LADVADGEQTSWRPQL......
E6WGC7_PANSA/6-178SDL------H----G....VPSPCIQTT-------------------------LDD..........RVLWQPQP......
SYDP_ERWT9/6-179QEL------Y----G....IPSPCVMAT-------------------------DED..........EVWWQPRP......
SYDP_VIBCH/6-179DEL------L----G....LASPCVVEE-------------------------LTD..........VVRWRPVN......
SYDP_PHOLL/6-180REL------Y----G....VPSPCITQT-------------------------GDN..........IVYWLPQP......
W0HTY4_9ENTR/12-183HGV------S----D....IPSPCVVGG-------------------------DGD..........AVYWQPRP......
C3AMX1_BACMY/7-177VWI------E----E....ADSFIYVGE-------------------------PDA........EEYIFWKPIE......
B4F2E3_PROMH/5-178HEL------Y----G....VPSPCISRT-------------------------GDN..........VVYWLPQP......
SYDP_VIBF1/6-179EEL------V----G....LASPCIEET-------------------------RDL..........EISWQPIV......
SYDP_VIBSL/6-179EEL------V----D....IVSPCVEEK-------------------------SGD..........AVLWKHYP......
A8GIF5_SERP5/18-190QDL------Y----G....VPSPCLVEN-------------------------RDD..........EVLWLPQP......
F7YLH7_VIBA7/10-183DEL------A----E....LDSPCAVMN-------------------------DQD..........SVLWKPVV......
SYDP_ALTMD/6-178AFD------S----E....WPSPCYEET-------------------------AKD........GELVEWAPKR......
SYDP_SHELP/5-184.FP------L----G....EASPCVLEC-------------------------DQE..KVDASPERSVQWQAVK......
F0LVK8_VIBFN/6-179DEL------I----D....WPSPCVVEA-------------------------LED..........RVFWQPVP......
SYDP_HAHCH/7-185PLN------E----DTRYMLDSPCVEHV-------------------------DEE........AGVFYWTPRP......
SYDP_TOLAT/7-177PED------E----L....RPSPCRYDA-------------------------QHP...........ERWKPWS......
SYDP_PECAS/6-179EAL------Y----G....IPSPCIVEN-------------------------HED..........TVYWSPQP......
SYDP_SHEON/4-180.YP------R----G....ESSLCIQGE-------------------------FVE......ASTEAVGWLPVK......
SYDP_PHOPR/6-179EDL------V----G....LESPCVEHD-------------------------SGD..........EVTWKPIT......
SYDP_AERHH/6-178EWE------A----D....WRSPCELDE-------------------------PKE.........GRVAWRPHR......
SYDP_SHEFN/4-180.YP------L----G....EDSICIQGT-------------------------FNA......DTDDTVFWQPVK......
D3VCK7_XENNA/6-179CDL------Y----G....IPSPCIERT-------------------------GDE..........LVYWVSRP......
D3UWF0_XENBS/6-179SDL------Y----G....VPSSCIERT-------------------------GDG..........VVYWLPKL......
SYDP_SHEPW/5-180.YA------Q----Q....QASECIVGD-------------------------VDV......ETEEALQWKSVV......
R9VV65_9ENTR/6-179EAL------Y----G....IPSPCIISS-------------------------TDK..........YVIWQPKP......
SYDP_PSEA6/6-182EYD------E----D....WPSPCYATD-------------------------VTP......ESGTSIPWKPVL......
SYDP_VIBPA/6-178EEL------A----D....LVSPCVEEK-------------------------CDG..........AVLWKAFP......
SYDP_ECOLI/6-179EEL------Y----G....VPSPCIIST-------------------------TED..........AVYWQPQP......
SYDP_SHEDO/4-180.YP------M----G....VASPCIAQT-------------------------FDE......QSEDAVFWQPVK......
SYDP_VIBVY/6-179EEL------A----D....LPSPCVVES-------------------------KGD..........EVLWRSVS......
C3AMX8_BACMY/4-175PVL------E----E....MNPILYDGE-------------------------IDE........EGYILWKPVE......
H2FY10_OCESG/7-174EHD------P----E....QSSPAELLP-------------------------AHQ.........GRVGWRPFL......
SYDP_PSYIN/6-180IFE------P----Q....WISPCQIGE-------------------------VEN.........QLIFWSPIK......
SYDP_PSEHT/6-178VHD------E----Q....WPSPCEIGN-------------------------VDQ........QGNIQWQAVL......

PF14435

Q11UH8_CYTH3/2-179EFL-----------S----MVGLPKEAA....PYLTFNITS............FPAFVSPDDL.YDLE............
C3G535_BACTU/11-190DFL-----------I----KAGFPESAP....PFLTFEPAD............NGGGIRLSEIQHEL.............
C3BLX0_9BACI/3-181RFL-----------S----EAGLPASAA....PFIEFDNA.............TELMQNVTRK.FGM.............
C3G534_BACTU/3-181RFL-----------S----IGGLPETPP....PYLEFTSS.............QSFVRSIINV.FHM.............
D7C074_STRBB/3-186RLL-----------T----EVGMPQSLL....GHLYFGNVR............TDPPQTISQA.VDTGTPDK........
E0QLS9_9FIRM/4-167LFS-----------Y----LEDYQKMG......FSFINL.................PNKLIDI.................
A3IE36_9BACI/4-165DFM-----------I----DIGVPKEFD....DFEFYEFTS..............FRKTVIKE.................
D3GZ30_ECO44/1-160KIK-----------S----PLLIPYEN.....QGVTFYCD.................ELYVFD.................
B7LQU5_ESCF3/2-167RDK-----------V----YLIQPYDN.....YALTFYHN.................TLYYFT.A...............
B1VPR4_STRGG/6-176HFR-----------E----SVEDPRVP.....KYFDVPDE.............AIGSVYQALD.FLEPVT..........
C6PRK9_9CLOT/16-217DFL-----------L----KTKIEKDEFQDINIKFFNKEHGVLCDVVEWTKINDSTVTNLDEK.FVSEFLK.........
B8CKE1_SHEPW/1-161RFL-----------S----DIGLPEWCA....PNMFFGEE.............DCWLPELLIQ.................
A3ZNI5_9PLAN/58-240GFL-----------Q----SFGLPHTVQFSGAQELKISFAP...........LTSPIVGYNSL.IGWGIFFDSE......
D3E916_GEOS4/1-200ETL-----------V----HRGMPVFD.....PQEPPLG..................LLFHEA.LPL.............
E2N2L1_CAPSP/5-173KFA-----------L----LNDYPQMG.....FYFIRFPD.................ELVPM..................
C0DUS3_EIKCO/1-171GIA-----------Y----LADYPPAR.....FHFVRLPD.................ETIDI..................
B5HAW8_STRPR/39-232EVA-----------R----RYGLPHGDT....MCLPVPG..................SAPFS..................
E8RXJ9_MICSL/4-174VFP-----------P----DGALPVEVP....ILFTVDVSV.............PEVELFSTL.SIELG...........
D1A3F0_THECD/3-170MLS-----------P----EAAIPAEVP....LLFTAYIDD..............EIKLFNVL.EIQVG...........
Q47PK6_THEFY/247-430DAL-----------T----RFGLPSLIP....HFFVADPPH............QPPAGGLFCD.AATHLHARGTPASDPT
E4NDB7_KITSK/233-420RPL-----------Q----RVGLPRELP....GFFALHLPEADGI....AEQAAPPLPDLAEY.LAGLGRGRRATAA...
C9YY18_STRSW/732-910HTL-----------V----VAGLPVDMG....PFFWAQAQP............GRPVPTLAEL.AQERGVQ.........
B5HAJ0_STRPR/6-189RFL-----------T----EIGLPDDEE....FEITF................RMPVTFDAAF.IWDRASREARGWH...
D6K842_9ACTO/6-208RLL-----------R----TVGVPDGT.....VLLRQPGED............DGLLPLVQGV.VSVGDLEDFEGFEGLE
B5I6T5_9ACTO/6-184DFL-----------R----NVGIPARPN....PWFDLVDGS............PEQARTLGDA.YDDLRERWTD......
E4N1Q1_KITSK/249-422VFL-----------R----EVGLPEDA.....AFLALEPEI.............RWGGSLIGD.EYWVSRA.........
D1A5L5_THECD/6-199DFL-----------T----SVGLPNST.....AGGLVDVDEA..........FAAGLPPMSEH.EYFGSGEHGGWE....
D6K293_9ACTO/144-316RFL-----------R----ETGLPEAD.....RVFHPADPD............DAPLPTLTEP.PQPCE...........
D6KEF7_9ACTO/214-404RFL-----------T----EVGLPGDG.....FMFYGPAP..............EPLPTLPQR.WAESRSDPRLAHLWKG
Q82D46_STRAW/203-389RFL-----------R----EVGLPENG.....YWFEVDTD..............VPLPTLAEH.YADELSGAFTDGE...
D9WNF8_9ACTO/13-197DFL-----------T----TVGFPAVTI....GLIRFDSTH........LRDAERRHTFDADE.LYGRRYPDD.......
Q2U157_ASPOR/71-266EFL-----------I----NIGFPSVKL....PRIGFNSTH........LKTFADKGDSLCRY.TGEELYGIYDP.....

PF02393

D2K3J3_HCMV/211-336--------...LCNLRCFE..NSVEG------------------GH----LLRNI-------------------------
B8YE72_HCMV/157-296--------NTEVMKFKETS..FSVVR------------------AG----GSIQT-------------------------
A8T728_HCMV/200-332--------LHRIWPF..CA..LTEVE------------------SR----RWWWA-------------------------
D2K4S5_HCMV/202-333--------LRACRPFDHMS..AADFR------------------DL----LNFIR-------------------------
D3YS52_HCMVO/180-322--------LTDCWPFEVAP..AARLA------------------EC----EMYVT-------------------------
D2K3X0_HCMV/202-332--------LKGVWPFICME..TEQFN------------------DL----LKFFV-------------------------
D2K5D0_HCMV/151-256--------...LYDW...........------------------SE----INDWR-------------------------
C8BKJ5_HCMV/34-153--------...ICD.PSYE..FLQMN------------------LS----KISWL-------------------------
D2K5D0_HCMV/11-135--------...RRRWRLVR..DEGRD------------------AQ----RLAS.-------------------------
B9VXJ9_HCMVT/546-653--------...FGSWNVAE..ADEAN------------------NF----.....-------------------------
B9VXD4_HCMVT/116-247--------RSQMNGVGATD..LRQLS------------------PR----DAWIV-------------------------
C3Y900_BRAFL/167-275--------...FTPLEEGS..SDMER------------------FR----VWKCS-------------------------
C3Z365_BRAFL/157-265--------...FTPWKGGS..SDMAR------------------FR----LLECS-------------------------
B9VXL1_HCMVT/265-382--------...TVVLNGSQ..TYEDP------------------AH----GNWLK-------------------------
D3YRX5_HCMVO/17-135--------RSALGPFVGKM..GTVCS------------------QG----A....-------------------------
Q14VM9_RAHV1/5-123--------...VCALADTQ..YVTRP------------------QV----VEDWN-------------------------
D2K5D5_HCMV/214-331--------...LRTARDLG..LSAS.------------------.M----LRRFQ-------------------------
A8T728_HCMV/45-168--------...LRTEDGII......T------------------AA----KQAAS-------------------------
D2K4G8_HCMV/126-245--------...YCDLLRVG..YFGHL------------------NI----KGLEK-------------------------
D2K595_HCMV/6-123--------...VCDVEETI....LTP------------------RD----VEYWK-------------------------
C3RWK6_FRG3V/35-153--------...ICDLSGTI..YSGET------------------FM----LESWR-------------------------
C3RWV3_FRG3V/65-186--------...ICGLDGTM..YSGEQ------------------YT----LESWE-------------------------
C1C3V1_LITCT/15-136--------...ICGLDGTV..YSGEN------------------YR----LESWG-------------------------
D2E8A7_ANHV1/5-121--------...IAPLDGTI..HWGDD------------------DI----VSAWE-------------------------
Q070N0_CPRVZ/47-172--------...VGDLSSTF..YGDLE------------------HQ----MEDWA-------------------------
B5XAY6_SALSA/21-139--------...IGGLEDTV..HAGDG------------------EQ----LEVWK-------------------------
B4YEM5_9ALPH/49-167--------...IGGLEASF..HKGQE------------------EL----LEYCE-------------------------
B1NFI8_ADEGX/15-131--------...IGDLEGTL..HAG.Q------------------HL----KEYCE-------------------------
F5HIG2_HCMV/399-518--------.......GDTQ..YFGVV------------------RD----HKTYR-------------------------
D3YRW4_HCMVO/69-190--------...LQEIETDE..DF.KP------------------ED----VKAWS-------------------------
B9VXJ9_HCMVT/55-169--------...VGG.EHSP..HSLTE------------------ID----LEHCQ-------------------------
C8CFJ9_HCMV/42-158--------...VRPG......STMPE------------------LR----DQLLD-------------------------
B9VXG6_HCMVT/274-510--------LAQYEPFASAPHPASLLT------------------AV----RRHLN-------------------------
Q4KS78_ISKNV/1-104--------...FASAADTA..Y..DS------------------NT----IRGWS-------------------------
C8CFJ8_HCMV/54-179--------......MREQA..AIPQI------------------YA----RSLAA-------------------------
A8T729_HCMV/26-179--------...FVEFEDIFGSAAVTD------------------GP----ETPWG-------------------------

PF14433

C3WDW2_FUSMR/11-172--------..FLQEFSGIKENWFFKYIG.............KNGEV----RIDGN-------------------------
F0KCA1_CLOAE/2-150--------..FLEEFGMIDVYCPINPRIPE..........EDIKKY----HFNRY-------------------------
C3BLQ7_9BACI/6-145--------..FMEEFGELQFNVERIWPD..............GVTK----DISEH-------------------------
F0KCA3_CLOAE/3-152--------..FMEEFGEVHIIA......................KY----IDSFG-------------------------
B1HSL5_LYSSC/5-144--------..ALEQFGELKCIY......................EY----NGKLD-------------------------
C0Z7L3_BREBN/2-133--------..FLKEFGNLVIEDSIND..................ET----HNTSI-------------------------
B7N9G4_ECOLU/6-148--------..FLSEFGGLIVRHESY...................SD----PNEYD-------------------------
A8RVU3_CLOBW/13-150--------..FYRKYFGLCCEWYLEQK................KMN----WAADF-------------------------
A9B4M5_HERA2/3-169--------..ILSRYGGFRLNSLDIAQPWTLD.....ASLEALFVW----TDSPL-------------------------
C2M481_CAPGI/2-151--------.TFLTIFDGKDI........................KR----RDGYM-------------------------
A9B4M4_HERA2/9-180--------..FLRQFGEL.TTLGCYNRFIFDN.....QVFEHQGTP----YRLWR-------------------------
A9B983_HERA2/9-180--------..IFTALGMLNLNLQHLPPIPPDPRTTTPDPIALRDHL----WYADI-------------------------
D1ALL2_SEBTE/5-152--------..FLKNFSYLEITFENPHVK.............KFPRL----KNIPV-------------------------
C2G2C6_9SPHI/5-144--------..FLQEYGLLKVQDVEYDN................EYQ----RYIAS-------------------------
A9DRL2_9FLAO/4-142--------.EFLYEYGDLLV........................ET----NDPNN-------------------------
D7VVD7_9FLAO/4-136--------.EFLIFYGDLVIEDCKPY.................KSD----VVNTL-------------------------
D6B4A2_9ACTO/10-151--------..ILAAMGGLSIEPVNRV.................GPN----FSNDE-------------------------
C5UVJ4_CLOBO/2-147--------..FLQKYGMLEIKFKRKM..................QA----IAIDE-------------------------
A4A0B2_9PLAN/1-122--------..IFAEFGNLKLAT......................AR----ETIWI-------------------------
A2W0F4_9BURK/45-178--------..ILREFGTLIVGAEPARR................SGE----TCAPM-------------------------
B7WUX3_COMTE/6-150--------..ALQNLAGLHIGQVGK...................GR----ECASS-------------------------
C6DGM5_PECCP/1-142--------..FLQEYNGLQGNHSAYK..................NN----DAPSK-------------------------
B7M4P5_ECO8A/11-152--------..FIKKYGGLYGFHSAY...................KD----TTINE-------------------------
C4GHT1_9NEIS/5-139--------..FVREFDGLSV........................GY----PNGNF-------------------------
D1A3E8_THECD/9-150--------..FLAEFGGLKVPEGPNE.................PGQ----QVASD-------------------------
D9X9L6_STRVR/182-321--------..FLAEFGAVGVPYREP...................WD----SMPWM-------------------------
Q82G08_STRAW/7-151--------VRFIHTYGMLRLD.......................HP----KASGC-------------------------
B1VX82_STRGG/7-150--------LSFIREHVSLRA........................VI----DTAPE-------------------------
D6K3Y2_9ACTO/7-151--------..FLREHIGLVAP.......................LH----DSPED-------------------------
A4X261_SALTO/97-242--------..ALIEFGGLILPQLGRS..................GE----PGAGF-------------------------
D6K3Y4_9ACTO/15-161--------..FLSEFYGLDHRPMES...................GR----EVASV-------------------------
B1VX84_STRGG/1-149--------..ALRAFHGLRVSPVGP...................GR----SVAAT-------------------------
D9UTG4_STRS3/29-176--------..AWAEFGGLTPHPTAK...................GR----HLAPA-------------------------
C4RQ15_9ACTO/292-437--------..AITRFPGLIGARRGP...................GE----QVWIS-------------------------
A4X254_SALTO/6-153--------..AYGEFGGLLVRPQGD...................GE----QIAPS-------------------------

PF09346

A0RE58_BACAH/19-133---....-.....EIYIRILGP---------------------IDC....IEMNE.........................
C2T3B2_BACCE/8-142---KFFV-KELNQEIPLDVLYG---------------------IG.....VKKTF.........................
A4YB72_SHEPC/14-135---....-...QEPDDSVVLWS---------------------AKE....ISEL..........................
A0A011W5W1_BACTI/32-156---....-.........TVLSE---------------------IHT....AAQGP.........................
B1YF81_EXIS2/16-130---....-....AQFGEWTLYP---------------------IPT..................................
A6FHD8_9GAMM/19-145---....-........LTKICD---------------------LNS....DISEV.........................
A4EPD0_9RHOB/35-163---....-...AITDREIDLHD---------------------LSE....LYQP..........................
A0RAV0_BACAH/42-162---....-....RIAGQPKVGG---------------------LSD....EEEYF.........................
B8I5J3_CLOCE/15-125---....-.........IAIFG---------------------TDI....IAE...........................
C3G559_BACTU/15-125---..LI-YGTEHIAERNEVWE---------------------VDE..................................
A8FII6_BACP2/13-123---....-..........LIYG---------------------TED....IAE...........................
Q1DBU4_MYXXD/34-167---....-.TFKVLHGGRELIG---------------------MEE....PGFLR.........................
A5UV09_ROSS1/24-144---....-..........MIYA---------------------SNE....SFLQG.........................
Q6HMR4_BACHK/23-143---....-....LDFDGLVLYG---------------------VDS..SLLETKK.........................
Q1CV91_HELPH/17-134---....-.....FMVGNESYT---------------------FKH....VLHF..........................
B1YEX8_EXIS2/15-147---....-....VVVNFKNSWS---------------------DEE....TGLYL.........................
A5TTY9_FUSNP/35-181---IEFP-ENFRAVFSGDLHWG---------------------LDF....LLNFE.........................
Q47P53_THEFY/18-133---....-..VWNEYGDAVVWS---------------------AER....IIEDN.........................
A0JSM0_ARTS2/15-129---....-..IEGEYGLGLLWS---------------------TQR....IASDN.........................
Q82GY4_STRAW/63-178---....-..IVGEYGNHLVSP---------------------IET....IVQRN.........................
Q2BBP1_9BACI/47-165---....-..VYGNYGISFVWS---------------------IEQMIKENLFFW.........................
Q65PK7_BACLD/18-132---....-..INDTFGDHLIWP---------------------ADR....IIEEN.........................
C2T2Q4_BACCE/27-144---....-..WSASKIKTENMS---------------------MRN....IVDFK.........................
A5UTX3_ROSS1/55-202---KPSW-STKGDYIHYHIFST---------------------LEL....VTINQ.........................
A6C6S9_9PLAN/31-128---....-...........MDL---------------------LSA..................................
A5FCA9_FLAJ1/44-161---....-.........QDFEE---------------------VDW....IKDIW.........................
B7X333_COMTE/152-284---..LS-PRFDLMAPDADMDA---------------------IGP....VQVVF.........................
Q4K6P0_PSEF5/56-173---....-........GPGHTP---------------------IQP....LLEAY.........................
J8EZ11_BACCE/25-143---....-.....RFFFNRFMD---------------------PFS....VSDFR.........................
B8I223_CLOCE/15-131---....-..STAINRMIDPGT---------------------IAD....IRLRK.........................
Q81BA7_BACCR/48-167---....-.....PYELLDIID---------------------EEN....NIEYY.........................
Q89MJ4_BRADU/28-170---EFNW-PQGHWAGAVQEVLG---------------------LRR..................................
A3ZX28_9PLAN/24-139---....-....AMVGPYPVFG---------------------LRGSDVMEDDRW.........................
A0AMA9_LISW6/21-137---....-....HAFSNESLIG---------------------KATVVDFTLKFR.........................
A5FMA4_FLAJ1/23-172---LIRY-MKQRTAFSHNSAGI---------------------IDM....IIAFW.........................
D4Q174_LISMN/14-152---....-...CWFLLEEDFLE---------------------NED....DAFSW.........................
D6EFH2_STRLI/29-155---....-..........GLLP---------------------LLD....HDPSG.........................
Q3BQF4_XANC5/29-173---GQSL-EEPDNWLKAEWLFP---------------------RARLLGSAELFS.........................
Q4UXL8_XANC8/219-365---SDRY-VDWECVLVDRYLSP---------------------LAQIGSVLDFAA.........................
A5FJY1_FLAJ1/42-170---....-.....YFAKFELYN---------------------LEQ....LKNYN.........................
Q1ZQF0_PHOAS/14-166---EEYP-DFEGRYWAFFDEEL---------------------LCENIEMSRVGR.........................
Q5WBD2_BACSK/23-138---....-...........ILN---------------------VSS....GKTNG.........................
A5FGR4_FLAJ1/41-198---EFVY-SNPENCLSQDCFIY---------------------PKM....SDEFW.........................
Q0RKI3_FRAAA/56-185---SAEV-AWFRDTPDGTGFID---------------------LYG....EPRND.........................
Q9F3Q3_STRCO/47-179---VWLL-AGTADARWHDDASG---------------------LAD....TFEE..........................
A6CDZ7_9PLAN/19-143---....-.......EIAGLFD---------------------SSD..DSAPPMW.........................
A6X425_OCHA4/20-140---....-..........EVYG---------------------LPKMERNDPPLW.........................
B3ZML8_BACCE/18-127---....-...........IIS---------------------LNG....HEVFG.........................
A4VZJ4_STRS2/19-128---....-...VISFYGTEWNG---------------------LKG......DTW.........................
A1RNF3_SHESW/21-128---....-..........EPVT---------------------VAD..................................
Q0VNR5_ALCBS/21-130---....-...VMDDYAHNFLP---------------------EMA.....ANSW.........................
Q7M7B0_PHOLL/25-133---....-....IFYGTIDLLS---------------------VTR....DKKYY.........................
F3IRY6_PSESL/25-133---....-..........DALR---------------------LTVDRNSP.............................
A4Y9N5_SHEPC/8-116---....-.........LEISN---------------------PPS....HADIF.........................
A4SRI0_AERS4/8-116---....-..........VILP---------------------GAGRLDIF.............................
A0A016B5A2_BACFG/47-168---....-.............S---------------------LYG....MRKSY.........................
Q82RV7_STRAW/96-236---....-....WTPEPDTGLP---------------------LQG....QETAW.........................
A4FNW2_SACEN/30-166---....-..ADVLPPFYTPYS---------------------PSA....ALRAW.........................
A5FAZ7_FLAJ1/185-329---....-......NWSYDLIP---------------------FQD....IAEEW.........................
A3I618_9BACI/42-194---SVLV-LGSDLGDYPYYLKA---------------------VEQILADAQNQR.........................
B4SN74_STRM5/28-184---LMLG-SDVEGGGYPYYLRS---------------------VAQVFEDQRQWD.........................
Q39NE9_BURS3/28-182---NVLV-LGSDVYEYPYYLLS---------------------AGQ....MLEEG.........................
Q6HHY9_BACHK/33-185---TVCI-LGSDVEEYPYYLLS---------------------TQE....MIESS.........................
A5TXY3_FUSNP/37-189---ASYF-LGSDVEEYPYYLLS---------------------SSQILETKNEAY.........................
A1RPC3_SHESW/26-168---....-FARKDYFCRYDFLS---------------------LASSLKFRDRMK.........................
M2C2K9_TREDN/40-189---...I-DEIEMPFNLMSLQT---------------------VTN....TKEHF.........................
H2K898_STRHJ/18-144---....-..SGLMLGNWALMP---------------------LDA....VIEVY.........................
A6G0Q7_9DELT/31-170---....-.ANDPKRIAEGIRG---------------------TRE....IDFSR.........................
Q9RYT7_DEIRA/27-166---....-...........LLS---------------------LER....MADER.........................
Q93JL3_STRCO/163-310---..AA-QERVVDAVGCELLP---------------------LDQLYVADARSR.........................
A1ZXR5_9BACT/30-166---...S-LSISDIYDNWRLLT---------------------NLK....TQGEF.........................
SMI1_CANGA/103-288---....-...SGLIYGLQLMT---------------------LDEIVAMTQRWR.........................
Q59YV1_CANAL/104-343---....-...SGLIFGLKLMS---------------------LDEITTATENWR.......................RV
A5DZP7_LODEL/117-382---..LN-IETNGLIFGLKLMS---------------------LDEIMVQTENWRKVSDYINNEARLENYKLNNLSKLPT
SMI1_DEBHA/98-296---....-.GSGGLVFGLKLMP---------------------IDEVMVMTEHWR.........................
Q55KB3_CRYNB/120-282---..NI-SGSGGLFFGLYFLP---------------------LEE....VMREW.........................
Q4PAY0_USTMA/184-339---....-SCQDGLFFGAALLS---------------------LDQ....VAQEW.........................
SMI2_DEBHA/142-319---....-......VMGLTLLD---------------------LEG....IIEEY.........................
A1C9R6_ASPCL/143-317---....-......IFGCMLLD---------------------CEE....IVQEW.........................
SMI1_YARLI/171-356---....-...SGIIFGITLLD---------------------LET....IAEEW.........................
A6EFN0_9SPHI/29-161---....-..LTGLIPIHNFLS---------------------LQD....AISYY.........................
O07689_LISSE/36-156---....-....KIYWYWTLFG---------------------KTI....IPSDF.........................
A3ZN04_9PLAN/36-149---....-..........YVTE---------------------RLW....VSDQH.........................
B1YF88_EXIS2/9-123---....-....FEAGEWQFHP---------------------IKD.EQYIKRTW.........................
A7VFJ3_9CLOT/24-132---....-........GVQLYG---------------------IEH..................................
A4X269_SALTO/103-245---....-....HVPGRPFVL.---------------------.......IPERP.........................
A1RND9_SHESW/4-129---....-.......DDWEFYP---------------------IKD....ISNRK.........................
A0PQE6_MYCUA/4-131---....-......SDVWDLHP---------------------FFD....TSDKQ.........................
I0LI94_CORGK/4-116---....-......NNDWILHP---------------------VRD....DSDRK.........................
Q0VKY9_ALCBS/4-130---....-....DYFEIHPFYD---------------------TSD....KKRIK.........................
Q9F2N4_STRCO/160-298---...L-DAELGLLVDQPFFT---------------------VRE..................................
A3KB11_9RHOB/18-152---....-.........FDYAP---------------------DED....DPERF.........................
Q1DEQ7_MYXXD/33-153---....-.....PDANYSILS---------------------LEG....IAAAT.........................
Q1CY42_MYXXD/19-141---....-......DPAFSFFP---------------------LAE....IRRAR.........................
Q09D40_STIAD/24-149---....-.....PNSPYLILP---------------------LGE..................................
B1YEY9_EXIS2/39-159---....-......DEGLVLYP---------------------LEE....VIEKT.........................
Q5WJU2_BACSK/38-153---....-YSGEPAGGGLELFA---------------------LDQ..................................
A7Z7P3_BACA2/41-156---....-FYGENVGGGLHILN---------------------VEE....IEKYM.........................
J7JW73_BACIU/42-161---....-SDGENIGGGLQLFS---------------------LEE....IEEEL.........................
M1U9G8_BACIU/23-165---....-.TTDEIEYDVCYKP---------------------LEK......DPW.........................
A7Z5R7_BACA2/23-158---EDNP-LADNGNLRLGYFYG---------------------LNNNDANIIKLK.........................
A3ZX25_9PLAN/22-154---....-..........VILT---------------------EDG....SIAPG.........................
A7VE32_9CLOT/35-145---....-........IFTLKE---------------------LEKAYPIFQEAY.........................
A7MRN6_CROS8/1-150---...L-AYGGVDEGAIAFNA---------------------LFG....LGTEN.........................
B3Z4D7_BACCE/12-154---...F-VCNNHSYAVIRFLC---------------------ILEAPENIEIGM.........................
Q3IK24_PSEHT/8-124---....-.....LDISNRLEC---------------------VVD....YFINL.........................
A5Z4R3_9FIRM/12-152---....-.......FTHPFIE---------------------INPNTNIEFVQE.........................
A5Z4R9_9FIRM/9-151---..AF-DFIDIASNKKNSTD---------------------IRE....FYIFY.........................
A1ZMA9_9BACT/9-138---.THV-GDLDETIIVNSFFS---------------------LEQ....IQEEC.........................
A0A011UV81_BACTI/12-152---NDTT-KKGVITSSVSMFFP---------------------LSI..................................
C2SX01_BACCE/13-142---....-.........FNIPN---------------------QDE....DSLNN.........................
A0A011VP76_BACTI/12-138---.YDI-NDDEGGAVFDCLLS---------------------FTS..................................
Q6HGG3_BACHK/12-159---.FEV-EGKRKVFGTLLTYD---------------------MDD....DENII.........................
Q6HGE4_BACHK/13-160---...F-NVGNVERCFGSLFS---------------------FDE..................................
A0RAF8_BACAH/19-149---..FD-TAQRKELVAKALLS---------------------FDQ..TNVENIW.........................
A7FEI4_YERP3/10-144---....-..........GFYF---------------------IDSKDGSCVDKF.........................
Q21ED8_SACD2/11-151---FQNA-TGPYSDSIIRYFFA---------------------FSD....DYDES.........................
A6CCT7_9PLAN/22-151---....-......FSYKDPET---------------------YQE....IRSCL.........................
Q6CS49_KLULA/64-193---CMYV-SSDGREFDIKNFLP---------------------ISY....PRFDG.........................
B1J8X4_PSEPW/139-260---....-..GGNDLLLTGFVP---------------------IKYGRIPMDIAY.........................
A7ML24_CROS8/19-151---...V-EADRWGMPVGGFNP---------------------IKY....GPLPI.........................
A5FLI6_FLAJ1/11-131---....-...YNRFILGGFNS---------------------IKYGKLPIERIY.........................
A0A014N9J6_YERPE/11-153---.WAC-DDGCEPLEIAAFKP---------------------FKY....HKMTN.........................
Q5LEK4_BACFN/167-306---FQPQ-DEDLDWVEINAFFP---------------------IKE....RTNAF.........................
Q65VI9_MANSM/10-134---....-HDDNYLYPIWAFSC---------------------LSE....IEDDL.........................
B8I222_CLOCE/15-149---..FV-DADGRRYEVEHFIP---------------------IKN....SNNKR.........................
F6BM79_SINMB/32-167---....-........NQRWLP---------------------LDL....VLIAW.........................
Q28UU7_JANSC/42-166---....-......IHNLMFPP---------------------LAS....VADTK.........................
Q5LEK4_BACFN/11-139---..IC-INRYYEVEIMRFMA---------------------LNT....VEEK..........................
Q5LEK9_BACFN/11-148---...S-INKYQEVEIEDFFP---------------------FKY....NKDFK.........................
A7RYE8_NEMVE/119-257---....-...........LIG---------------------SMS....ISSHY.........................
G1S8C1_NOMLE/121-251---....-...........LLG---------------------SMA....LSNHY.........................
Q52KV8_XENLA/36-166---....-..........GLMG---------------------SMA....LSNHY.........................
A0RFK3_BACAH/36-159---....-..WKGFYQTVDLFG---------------------IEQ....LKKST.........................
Q9CND2_PASMU/14-158---.YDS-YRNEDEYSSFGFEG---------------------FET....ESNKY.........................
A6DN67_9BACT/17-158---...F-KLKSKKHHIDSIYG---------------------INE....SKSEY.........................
A9B016_HERA2/24-146---....-KTNTWRWFDGDYAS---------------------IDR....FDETL.........................
Q5WC01_BACSK/21-135---....-....GCNNQYEPLP---------------------LEK..................................
A1ZUI6_9BACT/29-147---....-........FYSFIM---------------------YET..................................
Q47R76_THEFY/31-145---....-.....DIHYPDCLG---------------------INA....YAEEF.........................
A8M704_SALAI/21-139---....-.....DAFFPTILE---------------------MSE....WADEF.........................
H2GD97_CORD2/14-156---.SFI-NLPLDDRSEYYELS---------------------IDQ....ILGNG.........................
A1IPF3_NEIMA/1-117---....-......INYDEQYS---------------------FPW....WFENA.........................
A3I6Z7_9BACI/22-146---....-...ILTVSQPEYRD---------------------IDD..................................
Q4KGS7_PSEF5/46-175---....-.......GALEVFP---------------------VFD....ARDPR.........................
Q38V57_LACSS/13-131---....-............LP---------------------TSE....PTSDG.........................
A4BCB8_9GAMM/14-147---...F-PTDQENSWAEDHVP---------------------LNELFGIVTDEA.........................
A0R498_MYCS2/11-150---....-PEDRDYNTTHDIIR---------------------GIG....TRFPR.........................
A6VZI9_MARMS/37-168---....-NETLKYYFGEGFYE---------------------IGT....FSNID.........................
Q2BBP3_9BACI/17-145---TVPN-SWANNSVYVNELYG---------------------IGE..................................
C2T7X0_BACCE/16-147---SKPN-SWADDHVNVSGLYG---------------------ISF..................................
A5TTM3_FUSNP/176-315---PFRR-SWSRGFFDVHYIYG---------------------VDS....SSDYS.........................
A4X5D2_SALTO/28-164---HPAP-SPTSWAEEHIGVDI---------------------LAA....IGHTA.........................
Q11VT9_CYTH3/29-168---FPVT-EETSGTEYHVEISG---------------------IMG....IGRSK.........................
A1INP6_NEIMA/28-167---FPTT-QRNSWAKDHVQICE---------------------VSG....IGFEK.........................
H1GFW8_LISIO/124-264---VPTT-EPSSWSENCVAITG---------------------IMG....IGDCG.........................
A8FAT3_BACP2/17-145---FPTD-QPNGWAEDHVSFDH---------------------LRG....IAKGE.........................
B1KH37_SHEWM/28-163---...R-VNLNLNGVSMSFLS---------------------MFS....AADDA.........................
B1KH38_SHEWM/29-165---....-.RINIKLNGVSLSF---------------------LDW....FRDAI.........................
Q8GDM6_PHOLU/25-137---....-..........EIYS---------------------IYC....IPFE..........................
Q7N9I9_PHOLL/23-147---....-..........DYYG---------------------ITK....KGING.........................
Q926X2_LISIN/25-149---....-...TLTFNGVSFYG---------------------ISK..RGLSAAS.........................
Q5DWB0_CLOPF/25-151---....-........IFGIVS---------------------SED....LTIKG.........................
B1KPX6_SHEWM/17-136---....-............IT---------------------CEN....LDDGG.........................
A7Z5G8_BACA2/23-137---....-...........LLG---------------------YDF....GGASV.........................
B1ESH1_BACAN/4-119---....-...........IHG---------------------CET....TAAD..........................
A7GQ33_BACCN/21-130---....-...........VLG---------------------VEG....MEYA..........................
A4IKF8_GEOTN/21-132---....-...........ILG---------------------IEG....NLGA..........................
A3ZX34_9PLAN/23-143---....-.............E---------------------VSG....IEDDD.........................
B7KWA7_METC4/14-155---AADL-GSRAHLISHGVALA---------------------LDG....LRDED.........................
Q2SDZ5_HAHCH/28-140---....-..........NVFS---------------------LEA.....GSEW.........................
Q4K9A1_PSEF5/28-140---....-...........LYS---------------------LDS....SSDFH.........................
Q633D5_BACCZ/17-131---....-......NGYLQLWS---------------------IDV....LIQHN.........................
A5Z4Q5_9FIRM/17-131---....-..YLSIWPINELIE---------------------LNQ..................................
A1TSU7_ACIAC/17-133---....-....AYFSFWRVWD---------------------IVD..................................
G7QG99_LEPII/16-123---....-.......RYLSLWK---------------------IEE....LVQFN.........................
Q5LEL2_BACFN/13-124---....-..........NYIY---------------------IWA....IEDV..........................

PF14568

A0AMA9_LISW6/24-135--------------FAGISIHA.....FSNESL..........IGK----ATVVD-------------------------
A3I6Z7_9BACI/25-144--------------LNGGNILT.....VSQPEYRD........IDD----SDILY-------------------------
A3ZX34_9PLAN/26-141--------------VVEEEVSG.....IE..............DDD----PTLEH-------------------------
A4IKF8_GEOTN/24-130--------------ICGVEILG........................----IEGNL-------------------------
A4VZJ4_STRS2/22-126--------------FYGTEWNG.....LKGDTWTD........VVA----TTLEA-------------------------
A6CDZ7_9PLAN/22-141--------------GVGFEIAG.....LFDSSD..........DSA----PPMWR-------------------------
A6X425_OCHA4/23-138--------------AGGLEVYG.....LPK.............MER----NDPPL-------------------------
A7FEI4_YERP3/13-142--------------PEPDGFYF....................IDSK----DGSCV-------------------------
A7GQ33_BACCN/24-128--------------ICGVEVLG........................----VEGME-------------------------
A7Z5G8_BACA2/26-135--------------VYGIDLLG........................----.YDFG-------------------------
A7ZAC8_BACA2/3-116--------------IGEWIFSP.....IRE.............QSR----LQKTW-------------------------
A8UFY5_9FLAO/12-126--------------PSGKEYFF.....................SFR----NKELV-------------------------
A9DRK0_9FLAO/13-128--------------KEGNLWYP...................NYVSE----EGELV-------------------------
A9INX3_BART1/38-152--------------IGGDEVFS.....IYGDYGEG........IPA----GDIVY-------------------------
A9INY0_BART1/31-145--------------ICGEEILS.....VYNTNFEI........ARS----DDIVY-------------------------
A9INY3_BART1/35-149--------------IGSEEIFS.....IYNASFEE........HPA----GDIVD-------------------------
A9INY6_BART1/35-148--------------IGGDEIFS.....LY.EHPIG........VSV----NDIVY-------------------------
A9INZ4_BART1/35-149--------------IGGEEVYS.....LYKECGAD........IPG----GDIVF-------------------------
A0A011PWV5_BACAN/9-120--------------LDGMDIHG.......................C----ETTAA-------------------------
B1BP25_CLOPF/31-145--------------VGPSEIML.....................LSL----SEDKY-------------------------
B1KH37_SHEWM/31-161--------------IEDDRVNL.........NLNGVSMSFLSMFSA----ADDAL-------------------------
B1KPX6_SHEWM/20-134--------------IGDISISG.....IT..............CEN----LDDGG-------------------------
B3ZML8_BACCE/21-125--------------LNGHEVFG.....LGTSGYLN........VVE----STLEE-------------------------
B4AJF6_BACPU/18-123--------------IGGDVLLY......................GT----EDMVE-------------------------
B5ULT3_BACCE/26-136--------------LMSEYVFP.....................GDI----LNVSR-------------------------
B5UUA7_BACCE/17-130--------------IGEWILYP.....IKD.............NRN----VTKTW-------------------------
B7INQ5_BACC2/11-140--------------VRYSKFFV.....KELNQEIPLDV.....LYG----IGVTK-------------------------
B7JLP8_BACC0/25-134--------------LFGVDILG........................----VAKSN-------------------------
B8DA94_LISMH/28-135--------------ICGEEIYS.....IYSIPFDE........AVG----GDIVY-------------------------
B8DD33_LISMH/29-148--------------FKGESFYG.....VSHNGLSA........TSI----PDVRY-------------------------
B8DD37_LISMH/24-135--------------FGGISIHA.....FNNGSL..........IGK----ATVID-------------------------
C2KY92_9FIRM/22-126--------------FGSTEWTG.....LNIQGRLN........TVT----ATQQE-------------------------
C2M8M5_CAPGI/23-138--------------VCGIDFKT.....IAPPEYQE........DAD----IDIYY-------------------------
C2PY06_BACCE/26-128--------------.NGLYVND........................----.....-------------------------
C2TZ07_BACCE/17-130--------------IGEWILYP.....IKD.............NKN----VAKTW-------------------------
C2ZR32_BACCE/17-130--------------IGEWILYP.....IKD.............SRN----LKKTW-------------------------
C3BVU2_9BACI/35-154--------------LSEIYIAA......................WG----PKQRG-------------------------
C3WVX7_FUSNU/23-127--------------FLGNEWTG.....LNVDGYLN........VVN----MTEEE-------------------------
C4L6I6_EXISA/20-124--------------VDSEEIFG.....LGVEGYLN........VVE----TTLKE-------------------------
C6ABU4_BARGA/31-145--------------IGYEEIMS.....VYLIDFEI........ARS----DDIVY-------------------------
C6ABU7_BARGA/31-144--------------IGGEEIFS.....IYEICAG.........IPA----GDIVY-------------------------
C6AD58_BARGA/31-144--------------IGSEEIFS.....VY.AEYKG........IHA----GDIVY-------------------------
C6AD60_BARGA/31-146--------------IAGYEIYS.....LYKECGED........IPF----DDIVL-------------------------
C6AEU7_BARGA/31-145--------------IGGYEIFS.....IYNASFDK........CPA----GDIVF-------------------------
C6CF14_DICZE/28-135--------------ICGEEIYS.....IYCLPFDE........AVG----GDLVY-------------------------
C7GI90_9FIRM/31-150--------------FFGNEIYG.....IDPEDDSG........ILE----GNSVA-------------------------
C7N7K9_SLAHD/25-127--------------INGTEILG........................----IGMTG-------------------------
C8K547_LISMN/28-148--------------FGSIEIYG.....VFKEDFED........SGI----PDTVW-------------------------
D0KCB2_PECWW/28-147--------------FNGESFYG.....ISKKGLSA........ISA----PDVRY-------------------------
D0KCZ5_PECWW/26-145--------------FCGDTYYG.....ITQDGKEA........NEV----PCVYF-------------------------
D1W447_9BACT/21-143--------------YGDVNILG.....................IAK----DENSV-------------------------
D3EC77_GEOS4/25-144--------------LSGTGILM.....LAPPDVRE........YTD----TDILY-------------------------
D3FRA3_BACPE/26-146--------------FGAQEIYG.....ILNDEFEN........SSV----PDAIW-------------------------
D3FRA5_BACPE/24-128--------------ICGVDILG........................----IKGVD-------------------------
D3I7I1_9BACT/41-148--------------YVGVDIYG.....IRSSNDLKEKT.....VVD----LTKLY-------------------------
D3I8Y5_9BACT/21-120--------------LKGEEIFG.....................IDV----VDITL-------------------------
D4FV91_BACNB/25-133--------------IYGVNILG........................----.HGKV-------------------------
D4FXH9_BACNB/26-163--------------LESKKTSD....EIEYDVCYKPIEKDPWMGKG----DDTQL-------------------------
D4FXI0_BACNB/26-142--------------FNGLVIYG.....LDQELLREENDEEVYGFIE----TNEQW-------------------------
D4FXI1_BACNB/25-133--------------LFGVLVLG........................----.YNFD-------------------------
D5HHH7_9FIRM/25-128--------------LDGIETLG........................----VGKNG-------------------------
D5SSH7_PLAL2/27-142--------------IVGEEISG.....IE..............DDN----PSLDY-------------------------
D6CWW7_9BACE/84-197--------------FWDLDVRL.....................YPK----PIHSW-------------------------
D7JDE8_9BACT/35-142--------------IKEKEIYG.....LRNSEMMGDDD.....IIN----LTKVF-------------------------
D7VC45_LACPN/26-146--------------FGAAEIYG.....VFTEDFEN........SGV----PDAVW-------------------------
E1UUR3_BACAS/39-142--------------FDGIEILS........................----.....-------------------------
E1UUR6_BACAS/25-133--------------AYGTMILG........................----.YDSH-------------------------
E2MKG2_PSEUB/45-159--------------VGTEEIYS.....IYGMDFDD........ING----GDIVF-------------------------
E3YTZ2_9LIST/29-148--------------FNGESFYG.....ISKRGLSA........ASI----PDVRF-------------------------
E3ZJV4_LISIV/35-139--------------VLGIDVLG.....................IAR----NNIAT-------------------------
E4LF31_9FIRM/27-134--------------VRDTQIYG.....IHNSEFLGEDT.....IID----LNKEF-------------------------
E5W3S4_9BACI/29-137--------------SFGVEILG........................----.HGLV-------------------------
E5W3S5_9BACI/24-128--------------ICGVEVLG........................----VEGDG-------------------------
E6UJN0_RUMA7/22-127--------------FNGHELTG.....ISCDRNLD........VVA----VTEKQ-------------------------
E8K361_9STRE/11-132--------------PNHFKVDG........................----KVEIF-------------------------
E9SF19_RUMAL/19-157--------------PEEDLAYGFIDVVTNKTNDSDLRELFVFYEDE----ENDNF-------------------------
F0RDN6_CELLC/80-198--------------.GGTWIYT......................NS----IDSIR-------------------------
Q0VKY9_ALCBS/7-128--------------.GGVEVST...DYFEIHPFYDTSD.....KKR----IKRTC-------------------------
Q2SDZ5_HAHCH/31-138--------------FAFGNVFS.....LEAGSEWN........LID----INAEF-------------------------
Q4K9A1_PSEF5/31-138--------------FALAMLYS.....LDSSSDFH........LVQ----INRAH-------------------------
Q4KGS7_PSEF5/49-173--------------LGALEVFP.....VFDARDP.........RKT----WESIV-------------------------
Q5DWB0_CLOPF/28-149--------------FNGEEIFG....IVSSEDLTI........KGE----PNGIW-------------------------
Q5WIS2_BACSK/30-150--------------FGAQEIYG.....IIDADFEN........SSV----PDAIW-------------------------
Q7M7B0_PHOLL/28-131--------------YGTIDLLS.....................VTR----DKKYY-------------------------
Q7N9I9_PHOLL/26-145--------------FGGDDYYG.....ITKKGING........NQA----PCILY-------------------------
Q8GDM6_PHOLU/28-135--------------ICGDEIYS.....IYCIPFEE........AIG----GDLVY-------------------------

PF14567

A0KT76_SHESA/1-131-----------DVIYGAIEPVT---------------------AADPYSHTY..L-------------------------
Q0VNR5_ALCBS/1-133-----------DIVCGSLEPAT---------------------VMDDYAHNF..L-------------------------
D4ZBL0_SHEVD/1-131-----------DVIYGSLEPVT---------------------ASDPYSHTY..L-------------------------
A4SRI0_AERS4/1-119-----------DVANAIFEAAV---------------------ILPGAGRLD..I-------------------------
Q21KG4_SACD2/2-132-----------NCIYGRLEPVT---------------------VADRNSHTY..L-------------------------
A6X428_OCHA4/5-137-----------NAFVGYLSPLI---------------------LNEEMGGVYGEL-------------------------
A8H7F8_SHEPA/1-132-----------DVICGSLEPVT---------------------ASDPNSHTY..L-------------------------
A0Y938_9GAMM/1-109-----------DVVCGSIEPVT---------------------VADVNSHTY..L-------------------------
C1DFY0_AZOVD/1-133-----------DVIYGSLEPVT---------------------VSDPQSHTY..L-------------------------
C4S745_YERBE/5-136-----------NVFYGTVELLS---------------------VTKD.GNYYGEL-------------------------
B0KR80_PSEPG/1-133-----------DVVYGSLEPVT---------------------CTDPQSHTY..L-------------------------
Q2BMU0_NEPCE/1-131-----------DVVFGSIEPAT---------------------VTDSSSHTF..L-------------------------
B2C6T5_ACIBA/7-138-----------NIFYGTIELAS---------------------LTDE.KECYRGL-------------------------
B8CKE3_SHEPW/1-119-----------DLGDAPLEALE---------------------IVDPPSYAD..I-------------------------
A0A030T0X2_PSEAI/1-131-----------DVVYGRLEPVT---------------------VTDPHSHTY..L-------------------------
Q086X2_SHEFN/1-131-----------DVIYGTLEPVT---------------------AADPSSHTY..L-------------------------
F3IRY6_PSESL/5-136-----------DSIFNGKDALR---------------------LTVD.RNSPREL-------------------------
B3PC71_CELJU/34-164-----------DVVYGSIEPVT---------------------AADPHSHTY..L-------------------------
D4RXT0_9FIRM/2-135-----------VLIGYGVEIVA---------------------CGRN.GHSR..L-------------------------
A4Y9N5_SHEPC/1-119-----------DLGDAPIEALE---------------------ISNPPSHAD..I-------------------------
Q12R95_SHEDO/1-131-----------DVVYGHIEPVT---------------------ASDPQSHTY..L-------------------------
D0WEZ4_9ACTN/5-134-----------HGGIG.FEILG---------------------VGFDGSISF..L-------------------------
A3QH89_SHELP/1-131-----------DVIHGTLEPVT---------------------AADPYAHTY..L-------------------------
C1D4A4_DEIDV/3-141-----------DVLAGAYWPLV---------------------IHHELTGGR..L-------------------------
A1S8W2_SHEAM/1-131-----------DVIVGSLEPVT---------------------VADPHSHTY..L-------------------------
Q7M7B0_PHOLL/5-136-----------NIFYGTIDLLS---------------------VTRD.KKYYGEL-------------------------
D1W447_9BACT/1-147-----------MCNYGDVNILG---------------------IAKDENSVTYSV-------------------------

PF07348

SYDP_KLEP7/6-179...FSLA.QNISAVERALDIVV---------------------QQP----LHSYY-------------------------
SYDP_COLP3/9-191ADNKEEA.LSFENVESALNIEL---------------------HPD----IKIYF-------------------------
I2B5Z7_SHIBC/5-178...CEPA.ADLSAVERALEITL---------------------QPG----AHQFW-------------------------
R5V7K9_9FIRM/4-185...QEKP.VSFDAMEKELGFSI---------------------HPQ----IKAFL-------------------------
SYDP_YERPE/6-179...FLPE.ATLTNIERALEIQL---------------------HPD----IHDFY-------------------------
K7A551_9ALTE/8-182...RSGE.INFNDLENALDMKI---------------------HQD----VISFY-------------------------
E0SCC1_DICD3/6-178...QSVA.ARLDGVERALEIQL---------------------HPD----AHAFF-------------------------
X2H3P8_9GAMM/9-173...LQPP.RDLSIVEEVVGIIL---------------------HPS----SHIFY-------------------------
D4ZHN4_SHEVD/5-186...RPEP.GSFSNIETALELEF---------------------GPD----IDAFF-------------------------
D8MW85_ERWBE/6-178...FTLA.QNLEAVERAIEFRI---------------------QPS----VAAWY-------------------------
SYDP_CROS8/6-179...FTPE.DSLGAVEKALDIVI---------------------QPD----VHAFY-------------------------
F5Z4L7_ALTSS/6-183SDSQQSA.LSFKNVEEALDIKL---------------------NAD----FCQFF-------------------------
SYDP_SHEAM/4-180...RREV.AVFNNVSHAMDIEL---------------------HHD----IDDFY-------------------------
J7U684_MORMO/6-178...FTAD.KHLQPVEKALDIQL---------------------HPD----ISEFY-------------------------
E1STK9_FERBD/4-172...RETV.AGFDNVAQALELTL---------------------HPA----LTDLY-------------------------
I0DWV2_PROSM/6-180...FPIADKNLNKVATALDIEL---------------------QPM----IHPFY-------------------------
D5C956_ENTCC/6-179...WSVE.ENVNAVERAMDIVV---------------------QPA----VHAFY-------------------------
G9AL81_PANAN/6-179...FSLP.PSLDAVERALDIQL---------------------QPQ----ITAFY-------------------------
SYDP_IDILO/6-175...QPEA.LNFDDLESALEMSF---------------------HQS----IKTLF-------------------------
C2X4F6_BACCE/19-188...KYIE.TDLTILEEQFAIKF---------------------HDS----VYHYF-------------------------
SYDP_EDWI9/6-178...GR.G.EDLEGIGRALDIRL---------------------HPA----LAPFF-------------------------
M4UN22_9GAMM/6-180...RTAP.VDLSNIESALEITL---------------------HPS----IHAFF-------------------------
H2IXL4_RAHAC/6-178...FIPE.ATLQNVERALELQL---------------------RPE----AHAFY-------------------------
G4QLZ8_GLANF/9-186...QPAS.SHLGDLAKALEIEI---------------------HPQ----LETLF-------------------------
E6WGC7_PANSA/6-178...FTLP.ATLAAVERALDLEL---------------------QPD----ITAFY-------------------------
SYDP_ERWT9/6-179...FTLA.PNLDAVERALDIRL---------------------QPA----VTAFY-------------------------
SYDP_VIBCH/6-179...REVW.ADFSNVERAIELTL---------------------HED----IKAFY-------------------------
SYDP_PHOLL/6-180...FPLE.EKLNSVEVALDIQL---------------------QPA----IHDFY-------------------------
W0HTY4_9ENTR/12-183...AAPD.QTLAGVERALALRL---------------------QPA----AQAYY-------------------------
C3AMX1_BACMY/7-177...KDLF.HDFSDIEKKLAVQL---------------------HHS----IKEYY-------------------------
B4F2E3_PROMH/5-178...FTGR.DKLEKVEKAMGIII---------------------RSE----LHDYF-------------------------
SYDP_VIBF1/6-179...RDEA.IRLHNIEQGIELDL---------------------HDD----FHAFY-------------------------
SYDP_VIBSL/6-179...REQF.ADFTNVETGIELTL---------------------HED----VKTFY-------------------------
A8GIF5_SERP5/18-190...FTPA.ATLEKVETALELRL---------------------QPD----INLFY-------------------------
F7YLH7_VIBA7/10-183...RSVA.ADFSNVEAAIELTL---------------------HSD----IKAFY-------------------------
SYDP_ALTMD/6-178...QSPP.LSFNNVEDALSLKL---------------------HAD----YCCYF-------------------------
SYDP_SHELP/5-184...RDSQ.GPFDNIEHALSITL---------------------HPS----IQAFY-------------------------
F0LVK8_VIBFN/6-179...RTPA.ADLANVEQGIELTL---------------------QQD----IAPFY-------------------------
SYDP_HAHCH/7-185...HMDF.TLFDGLEQGLEVAI---------------------HPS----ITAFY-------------------------
SYDP_TOLAT/7-177...RPEM.SDLQNIASALECVF---------------------HPA----IHAYY-------------------------
SYDP_PECAS/6-179...FAPS.VALDGVERALEISL---------------------HPD----VHAFY-------------------------
SYDP_SHEON/4-180...REQP.GSFTNVEHALELKL---------------------WPD----IHSFY-------------------------
SYDP_PHOPR/6-179...RQPQ.GDLAGVEKGIEIEL---------------------HKD----IIDFY-------------------------
SYDP_AERHH/6-178...RAEP.ADFTAMNEALELTL---------------------HPA----AQALF-------------------------
SYDP_SHEFN/4-180...RDNV.ADFSNVEHALNIQL---------------------HQD----IHAFY-------------------------
D3VCK7_XENNA/6-179...FSIQ.GKLNKVETALGLRL---------------------QDS----IHDYY-------------------------
D3UWF0_XENBS/6-179...FSVH.EKLSKVETALDIRL---------------------QDS----IHDYY-------------------------
SYDP_SHEPW/5-180...RVDT.GRFDNVEHALELSL---------------------HGD----INAFY-------------------------
R9VV65_9ENTR/6-179...FVPE.RNVNPIEQAMEIVV---------------------QTP----LHTFY-------------------------
SYDP_PSEA6/6-182...REQT.SEFKDLSEALELTL---------------------HPD----VAQFY-------------------------
SYDP_VIBPA/6-178...REEM.ADFTNVENAIELTL---------------------HED----IKAFY-------------------------
SYDP_ECOLI/6-179...FTGE.QNVNAVERAFDIVI---------------------QPT----IHTFY-------------------------
SYDP_SHEDO/4-180...REPA.GDFDNVASALAITL---------------------HQD----INHFY-------------------------
SYDP_VIBVY/6-179...LSAP.VDFANVEQAIELTL---------------------HDD----IKAFY-------------------------
C3AMX8_BACMY/4-175...KNIV.HDFIRLEQEMDIHF---------------------HQT----VITYF-------------------------
H2FY10_OCESG/7-174...RTEP.GSFDNLAHALDMPV---------------------HPS----LTALF-------------------------
SYDP_PSYIN/6-180...REPA.LDMSNIEQALDIKL---------------------HPS----IVDFF-------------------------
SYDP_PSEHT/6-178...QQPA.GSLNDLAKALDVTF---------------------PSG----LNALY-------------------------

PF14435

Q11UH8_CYTH3/2-179..........DRPDLSDWFIIG---------------------ETG----N...S-------------------------
C3G535_BACTU/11-190...........GTMYDKFIYFG---------------------FTG----S...G-------------------------
C3BLX0_9BACI/3-181...........PIDFEFYWFIG---------------------TTG----S...G-------------------------
C3G534_BACTU/3-181...........PEEFRKYWYLG---------------------TTS----S...G-------------------------
D7C074_STRBB/3-186..........FPPEVRDDIVIA---------------------AGM----....G-------------------------
E0QLS9_9FIRM/4-167...........SDGQDTYSLFG---------------------ECF----....L-------------------------
A3IE36_9BACI/4-165...............VQFIKVG---------------------NCS----SY..E-------------------------
D3GZ30_ECO44/1-160..............SDGYIVFG---------------------HDL----....D-------------------------
B7LQU5_ESCF3/2-167.............NSKRYIVFG---------------------HDL----....E-------------------------
B1VPR4_STRGG/6-176..........IGA.HGEFVKFG---------------------STG----L...F-------------------------
C6PRK9_9CLOT/16-217..........DLEKFRSYYVVA---------------------DNL----DS..G-------------------------
B8CKE1_SHEPW/1-161..............NEKLAVLG---------------------SDR----D...D-------------------------
A3ZNI5_9PLAN/58-240..........LDARLGEQLVIG---------------------QED----SAAGV-------------------------
D3E916_GEOS4/1-200...........QDIHGAYIAIG---------------------REI----WS.EG-------------------------
E2N2L1_CAPSP/5-173...........QQQGQHFQCFE---------------------KCC----Y....-------------------------
C0DUS3_EIKCO/1-171...........QTPRGEARCFG---------------------KYG----Y...G-------------------------
B5HAW8_STRPR/39-232............RVAGRFWSLG---------------------LTD----TW.PA-------------------------
E8RXJ9_MICSL/4-174...........DQGPRPYVVLG---------------------ASP----ED.PA-------------------------
D1A3F0_THECD/3-170...........DNEPMGLLALG---------------------AVP----DE..K-------------------------
Q47PK6_THEFY/247-430..........LAATLGEYVRIG---------------------SDG----....G-------------------------
E4NDB7_KITSK/233-420..........ARAALLGQRLIG---------------------TDG----....W-------------------------
C9YY18_STRSW/732-910..........PAADAGSYLVMG---------------------SDF----....G-------------------------
B5HAJ0_STRPR/6-189..........FPAGVESVVKIG---------------------AFP----....I-------------------------
D6K842_9ACTO/6-208GLEGFEGFGDAAGGVGGWPVIG---------------------WLL----....H-------------------------
B5I6T5_9ACTO/6-184..........LPEGAEGWLLLG---------------------MVP----....Y-------------------------
E4N1Q1_KITSK/249-422..........APLDATAWLPLG---------------------RFG----....E-------------------------
D1A5L5_THECD/6-199..........LPAMCADFLLLG---------------------DWN----SA.VL-------------------------
D6K293_9ACTO/144-316..........LPPAADRLIRLG---------------------DLT----G...D-------------------------
D6KEF7_9ACTO/214-404DEQ.......LPPDAEHLVVLG---------------------GLV----H...D-------------------------
Q82D46_STRAW/203-389..........LPAGADHLIRLG---------------------HLL----E...D-------------------------
D9WNF8_9ACTO/13-197..........HSPPESFCFCFG---------------------TRY----....E-------------------------
Q2U157_ASPOR/71-266..........DDEVPALSFCLG---------------------EVY----....T-------------------------

PF02393

D2K3J3_HCMV/211-336--------------------------------------------------------------------------------
B8YE72_HCMV/157-296--------------------------------------------------------------------------------
A8T728_HCMV/200-332--------------------------------------------------------------------------------
D2K4S5_HCMV/202-333--------------------------------------------------------------------------------
D3YS52_HCMVO/180-322--------------------------------------------------------------------------------
D2K3X0_HCMV/202-332--------------------------------------------------------------------------------
D2K5D0_HCMV/151-256--------------------------------------------------------------------------------
C8BKJ5_HCMV/34-153--------------------------------------------------------------------------------
D2K5D0_HCMV/11-135--------------------------------------------------------------------------------
B9VXJ9_HCMVT/546-653--------------------------------------------------------------------------------
B9VXD4_HCMVT/116-247--------------------------------------------------------------------------------
C3Y900_BRAFL/167-275--------------------------------------------------------------------------------
C3Z365_BRAFL/157-265--------------------------------------------------------------------------------
B9VXL1_HCMVT/265-382--------------------------------------------------------------------------------
D3YRX5_HCMVO/17-135--------------------------------------------------------------------------------
Q14VM9_RAHV1/5-123--------------------------------------------------------------------------------
D2K5D5_HCMV/214-331--------------------------------------------------------------------------------
A8T728_HCMV/45-168--------------------------------------------------------------------------------
D2K4G8_HCMV/126-245--------------------------------------------------------------------------------
D2K595_HCMV/6-123--------------------------------------------------------------------------------
C3RWK6_FRG3V/35-153--------------------------------------------------------------------------------
C3RWV3_FRG3V/65-186--------------------------------------------------------------------------------
C1C3V1_LITCT/15-136--------------------------------------------------------------------------------
D2E8A7_ANHV1/5-121--------------------------------------------------------------------------------
Q070N0_CPRVZ/47-172--------------------------------------------------------------------------------
B5XAY6_SALSA/21-139--------------------------------------------------------------------------------
B4YEM5_9ALPH/49-167--------------------------------------------------------------------------------
B1NFI8_ADEGX/15-131--------------------------------------------------------------------------------
F5HIG2_HCMV/399-518--------------------------------------------------------------------------------
D3YRW4_HCMVO/69-190--------------------------------------------------------------------------------
B9VXJ9_HCMVT/55-169--------------------------------------------------------------------------------
C8CFJ9_HCMV/42-158--------------------------------------------------------------------------------
B9VXG6_HCMVT/274-510--------------------------------------------------------------------------------
Q4KS78_ISKNV/1-104--------------------------------------------------------------------------------
C8CFJ8_HCMV/54-179--------------------------------------------------------------------------------
A8T729_HCMV/26-179--------------------------------------------------------------------------------

PF14433

C3WDW2_FUSMR/11-172--------------------------------------------------------------------------------
F0KCA1_CLOAE/2-150--------------------------------------------------------------------------------
C3BLQ7_9BACI/6-145--------------------------------------------------------------------------------
F0KCA3_CLOAE/3-152--------------------------------------------------------------------------------
B1HSL5_LYSSC/5-144--------------------------------------------------------------------------------
C0Z7L3_BREBN/2-133--------------------------------------------------------------------------------
B7N9G4_ECOLU/6-148--------------------------------------------------------------------------------
A8RVU3_CLOBW/13-150--------------------------------------------------------------------------------
A9B4M5_HERA2/3-169--------------------------------------------------------------------------------
C2M481_CAPGI/2-151--------------------------------------------------------------------------------
A9B4M4_HERA2/9-180--------------------------------------------------------------------------------
A9B983_HERA2/9-180--------------------------------------------------------------------------------
D1ALL2_SEBTE/5-152--------------------------------------------------------------------------------
C2G2C6_9SPHI/5-144--------------------------------------------------------------------------------
A9DRL2_9FLAO/4-142--------------------------------------------------------------------------------
D7VVD7_9FLAO/4-136--------------------------------------------------------------------------------
D6B4A2_9ACTO/10-151--------------------------------------------------------------------------------
C5UVJ4_CLOBO/2-147--------------------------------------------------------------------------------
A4A0B2_9PLAN/1-122--------------------------------------------------------------------------------
A2W0F4_9BURK/45-178--------------------------------------------------------------------------------
B7WUX3_COMTE/6-150--------------------------------------------------------------------------------
C6DGM5_PECCP/1-142--------------------------------------------------------------------------------
B7M4P5_ECO8A/11-152--------------------------------------------------------------------------------
C4GHT1_9NEIS/5-139--------------------------------------------------------------------------------
D1A3E8_THECD/9-150--------------------------------------------------------------------------------
D9X9L6_STRVR/182-321--------------------------------------------------------------------------------
Q82G08_STRAW/7-151--------------------------------------------------------------------------------
B1VX82_STRGG/7-150--------------------------------------------------------------------------------
D6K3Y2_9ACTO/7-151--------------------------------------------------------------------------------
A4X261_SALTO/97-242--------------------------------------------------------------------------------
D6K3Y4_9ACTO/15-161--------------------------------------------------------------------------------
B1VX84_STRGG/1-149--------------------------------------------------------------------------------
D9UTG4_STRS3/29-176--------------------------------------------------------------------------------
C4RQ15_9ACTO/292-437--------------------------------------------------------------------------------
A4X254_SALTO/6-153--------------------------------------------------------------------------------

PF09346

A0RE58_BACAH/19-133................................................................................
C2T3B2_BACCE/8-142................................................................................
A4YB72_SHEPC/14-135................................................................................
A0A011W5W1_BACTI/32-156................................................................................
B1YF81_EXIS2/16-130................................................................................
A6FHD8_9GAMM/19-145............................................................................QDFL
A4EPD0_9RHOB/35-163................................................................................
A0RAV0_BACAH/42-162............................................................................QPFD
B8I5J3_CLOCE/15-125................................................................................
C3G559_BACTU/15-125................................................................................
A8FII6_BACP2/13-123................................................................................
Q1DBU4_MYXXD/34-167............................................................................AAAP
A5UV09_ROSS1/24-144............................................................................RQDL
Q6HMR4_BACHK/23-143................................................................................
Q1CV91_HELPH/17-134................................................................................
B1YEX8_EXIS2/15-147............................................................................PLYE
A5TTY9_FUSNP/35-181............................................................................ESRQ
Q47P53_THEFY/18-133................................................................................
A0JSM0_ARTS2/15-129................................................................................
Q82GY4_STRAW/63-178................................................................................
Q2BBP1_9BACI/47-165................................................................................
Q65PK7_BACLD/18-132................................................................................
C2T2Q4_BACCE/27-144................................................................................
A5UTX3_ROSS1/55-202............................................................................NLLK
A6C6S9_9PLAN/31-128................................................................................
A5FCA9_FLAJ1/44-161................................................................................
B7X333_COMTE/152-284............................................................................PGIA
Q4K6P0_PSEF5/56-173................................................................................
J8EZ11_BACCE/25-143................................................................................
B8I223_CLOCE/15-131................................................................................
Q81BA7_BACCR/48-167................................................................................
Q89MJ4_BRADU/28-170................................................................................
A3ZX28_9PLAN/24-139................................................................................
A0AMA9_LISW6/21-137................................................................................
A5FMA4_FLAJ1/23-172............................................................................ANDR
D4Q174_LISMN/14-152............................................................................NSFE
D6EFH2_STRLI/29-155............................................................................EPAA
Q3BQF4_XANC5/29-173............................................................................FAQV
Q4UXL8_XANC8/219-365................................................................................
A5FJY1_FLAJ1/42-170............................................................................ALVQ
Q1ZQF0_PHOAS/14-166............................................................................APAH
Q5WBD2_BACSK/23-138................................................................................
A5FGR4_FLAJ1/41-198............................................................................EESI
Q0RKI3_FRAAA/56-185................................................................................
Q9F3Q3_STRCO/47-179................................................................................
A6CDZ7_9PLAN/19-143................................................................................
A6X425_OCHA4/20-140................................................................................
B3ZML8_BACCE/18-127............................................................................LGTS
A4VZJ4_STRS2/19-128................................................................................
A1RNF3_SHESW/21-128................................................................................
Q0VNR5_ALCBS/21-130................................................................................
Q7M7B0_PHOLL/25-133................................................................................
F3IRY6_PSESL/25-133................................................................................
A4Y9N5_SHEPC/8-116................................................................................
A4SRI0_AERS4/8-116................................................................................
A0A016B5A2_BACFG/47-168............................................................................NRDL
Q82RV7_STRAW/96-236............................................................................LLPR
A4FNW2_SACEN/30-166............................................................................RGHR
A5FAZ7_FLAJ1/185-329............................................................................NSIQ
A3I618_9BACI/42-194................................................................................
B4SN74_STRM5/28-184............................................................................DSIR
Q39NE9_BURS3/28-182................................................................................
Q6HHY9_BACHK/33-185............................................................................KEGE
A5TXY3_FUSNP/37-189................................................................................
A1RPC3_SHESW/26-168............................................................................KQAQ
M2C2K9_TREDN/40-189............................................................................QNRD
H2K898_STRHJ/18-144............................................................................RMQM
A6G0Q7_9DELT/31-170................................................................................
Q9RYT7_DEIRA/27-166................................................................................
Q93JL3_STRCO/163-310...............................................................................P
A1ZXR5_9BACT/30-166................................................................................
SMI1_CANGA/103-288.....................................................SVADKLNKQATMSKHSSVGVSNGSSMG
Q59YV1_CANAL/104-343AGHLNEELKQNFKSGLTKLPSSHSNSNQLTRKFTSTSNNADTSLNSIGAINDIDMANIGQDPISTRSSIDISTTTSRTSS
A5DZP7_LODEL/117-382SHANNGQYQKKIGLGVGVNTSSTTNLININNNNNNSSNNNNNNNNSNNNINNNNSNNNNINTSEMSSRRTSFDLSQVESR
SMI1_DEBHA/98-296.........................................KVADYLNSKLLHANQTNKLQELSKLETSHANSSQLKFSS
Q55KB3_CRYNB/120-282............................................................................AFWR
Q4PAY0_USTMA/184-339............................................................................NFWR
SMI2_DEBHA/142-319....................................AIWAKVNQRLEKQQYMFQHQQQQQQ.......HQKATSSADASE
A1C9R6_ASPCL/143-317....................................KNWRT....VNEEF..LSGSNVMNPPPL...PKATASSSSTVPP
SMI1_YARLI/171-356....................................YSWKKAAIRINREIARATGQTPTKQGGIFINPNAGSPNSSTPGS
A6EFN0_9SPHI/29-161............................................................................H...
O07689_LISSE/36-156............................................................................EQIK
A3ZN04_9PLAN/36-149................................................................................
B1YF88_EXIS2/9-123................................................................................
A7VFJ3_9CLOT/24-132................................................................................
A4X269_SALTO/103-245............................................................................LCGV
A1RND9_SHESW/4-129............................................................................RLSR
A0PQE6_MYCUA/4-131............................................................................RLKR
I0LI94_CORGK/4-116................................................................................
Q0VKY9_ALCBS/4-130................................................................................
Q9F2N4_STRCO/160-298................................................................................
A3KB11_9RHOB/18-152............................................................................LDRL
Q1DEQ7_MYXXD/33-153............................................................................PRLR
Q1CY42_MYXXD/19-141................................................................................
Q09D40_STIAD/24-149................................................................................
B1YEY9_EXIS2/39-159............................................................................IEAK
Q5WJU2_BACSK/38-153................................................................................
A7Z7P3_BACA2/41-156................................................................................
J7JW73_BACIU/42-161................................................................................
M1U9G8_BACIU/23-165............................................................................MGKG
A7Z5R7_BACA2/23-158................................................................................
A3ZX25_9PLAN/22-154................................................................................
A7VE32_9CLOT/35-145................................................................................
A7MRN6_CROS8/1-150................................................................................
B3Z4D7_BACCE/12-154............................................................................FDID
Q3IK24_PSEHT/8-124................................................................................
A5Z4R3_9FIRM/12-152............................................................................TDVE
A5Z4R9_9FIRM/9-151............................................................................PEGE
A1ZMA9_9BACT/9-138................................................................................
A0A011UV81_BACTI/12-152................................................................................
C2SX01_BACCE/13-142............................................................................LLTL
A0A011VP76_BACTI/12-138................................................................................
Q6HGG3_BACHK/12-159................................................................................
Q6HGE4_BACHK/13-160................................................................................
A0RAF8_BACAH/19-149................................................................................
A7FEI4_YERP3/10-144............................................................................LSTN
Q21ED8_SACD2/11-151................................................................................
A6CCT7_9PLAN/22-151............................................................................GALI
Q6CS49_KLULA/64-193................................................................................
B1J8X4_PSEPW/139-260................................................................................
A7ML24_CROS8/19-151................................................................................
A5FLI6_FLAJ1/11-131................................................................................
A0A014N9J6_YERPE/11-153............................................................................DNPN
Q5LEK4_BACFN/167-306................................................................................
Q65VI9_MANSM/10-134................................................................................
B8I222_CLOCE/15-149............................................................................SLDK
F6BM79_SINMB/32-167................................................................................
Q28UU7_JANSC/42-166................................................................................
Q5LEK4_BACFN/11-139................................................................................
Q5LEK9_BACFN/11-148................................................................................
A7RYE8_NEMVE/119-257................................................................................
G1S8C1_NOMLE/121-251................................................................................
Q52KV8_XENLA/36-166............................................................................RSED
A0RFK3_BACAH/36-159............................................................................IMEY
Q9CND2_PASMU/14-158................................................................................
A6DN67_9BACT/17-158............................................................................VLTN
A9B016_HERA2/24-146................................................................................
Q5WC01_BACSK/21-135................................................................................
A1ZUI6_9BACT/29-147................................................................................
Q47R76_THEFY/31-145................................................................................
A8M704_SALAI/21-139................................................................................
H2GD97_CORD2/14-156............................................................................KTSS
A1IPF3_NEIMA/1-117............................................................................ESNI
A3I6Z7_9BACI/22-146................................................................................
Q4KGS7_PSEF5/46-175...............................................................................K
Q38V57_LACSS/13-131............................................................................LDHV
A4BCB8_9GAMM/14-147................................................................................
A0R498_MYCS2/11-150............................................................................LEKD
A6VZI9_MARMS/37-168................................................................................
Q2BBP3_9BACI/17-145................................................................................
C2T7X0_BACCE/16-147................................................................................
A5TTM3_FUSNP/176-315................................................................................
A4X5D2_SALTO/28-164................................................................................
Q11VT9_CYTH3/29-168................................................................................
A1INP6_NEIMA/28-167................................................................................
H1GFW8_LISIO/124-264................................................................................
A8FAT3_BACP2/17-145................................................................................
B1KH37_SHEWM/28-163............................................................................LIGT
B1KH38_SHEWM/29-165................................................................................
Q8GDM6_PHOLU/25-137................................................................................
Q7N9I9_PHOLL/23-147................................................................................
Q926X2_LISIN/25-149................................................................................
Q5DWB0_CLOPF/25-151............................................................................EPNG
B1KPX6_SHEWM/17-136................................................................................
A7Z5G8_BACA2/23-137................................................................................
B1ESH1_BACAN/4-119................................................................................
A7GQ33_BACCN/21-130................................................................................
A4IKF8_GEOTN/21-132................................................................................
A3ZX34_9PLAN/23-143................................................................................
B7KWA7_METC4/14-155............................................................................SDEP
Q2SDZ5_HAHCH/28-140................................................................................
Q4K9A1_PSEF5/28-140................................................................................
Q633D5_BACCZ/17-131................................................................................
A5Z4Q5_9FIRM/17-131................................................................................
A1TSU7_ACIAC/17-133................................................................................
G7QG99_LEPII/16-123................................................................................
Q5LEL2_BACFN/13-124................................................................................

PF14568

A0AMA9_LISW6/24-135--------------------------------------------------------------------------------
A3I6Z7_9BACI/25-144--------------------------------------------------------------------------------
A3ZX34_9PLAN/26-141--------------------------------------------------------------------------------
A4IKF8_GEOTN/24-130--------------------------------------------------------------------------------
A4VZJ4_STRS2/22-126--------------------------------------------------------------------------------
A6CDZ7_9PLAN/22-141--------------------------------------------------------------------------------
A6X425_OCHA4/23-138--------------------------------------------------------------------------------
A7FEI4_YERP3/13-142--------------------------------------------------------------------------------
A7GQ33_BACCN/24-128--------------------------------------------------------------------------------
A7Z5G8_BACA2/26-135--------------------------------------------------------------------------------
A7ZAC8_BACA2/3-116--------------------------------------------------------------------------------
A8UFY5_9FLAO/12-126--------------------------------------------------------------------------------
A9DRK0_9FLAO/13-128--------------------------------------------------------------------------------
A9INX3_BART1/38-152--------------------------------------------------------------------------------
A9INY0_BART1/31-145--------------------------------------------------------------------------------
A9INY3_BART1/35-149--------------------------------------------------------------------------------
A9INY6_BART1/35-148--------------------------------------------------------------------------------
A9INZ4_BART1/35-149--------------------------------------------------------------------------------
A0A011PWV5_BACAN/9-120--------------------------------------------------------------------------------
B1BP25_CLOPF/31-145--------------------------------------------------------------------------------
B1KH37_SHEWM/31-161--------------------------------------------------------------------------------
B1KPX6_SHEWM/20-134--------------------------------------------------------------------------------
B3ZML8_BACCE/21-125--------------------------------------------------------------------------------
B4AJF6_BACPU/18-123--------------------------------------------------------------------------------
B5ULT3_BACCE/26-136--------------------------------------------------------------------------------
B5UUA7_BACCE/17-130--------------------------------------------------------------------------------
B7INQ5_BACC2/11-140--------------------------------------------------------------------------------
B7JLP8_BACC0/25-134--------------------------------------------------------------------------------
B8DA94_LISMH/28-135--------------------------------------------------------------------------------
B8DD33_LISMH/29-148--------------------------------------------------------------------------------
B8DD37_LISMH/24-135--------------------------------------------------------------------------------
C2KY92_9FIRM/22-126--------------------------------------------------------------------------------
C2M8M5_CAPGI/23-138--------------------------------------------------------------------------------
C2PY06_BACCE/26-128--------------------------------------------------------------------------------
C2TZ07_BACCE/17-130--------------------------------------------------------------------------------
C2ZR32_BACCE/17-130--------------------------------------------------------------------------------
C3BVU2_9BACI/35-154--------------------------------------------------------------------------------
C3WVX7_FUSNU/23-127--------------------------------------------------------------------------------
C4L6I6_EXISA/20-124--------------------------------------------------------------------------------
C6ABU4_BARGA/31-145--------------------------------------------------------------------------------
C6ABU7_BARGA/31-144--------------------------------------------------------------------------------
C6AD58_BARGA/31-144--------------------------------------------------------------------------------
C6AD60_BARGA/31-146--------------------------------------------------------------------------------
C6AEU7_BARGA/31-145--------------------------------------------------------------------------------
C6CF14_DICZE/28-135--------------------------------------------------------------------------------
C7GI90_9FIRM/31-150--------------------------------------------------------------------------------
C7N7K9_SLAHD/25-127--------------------------------------------------------------------------------
C8K547_LISMN/28-148--------------------------------------------------------------------------------
D0KCB2_PECWW/28-147--------------------------------------------------------------------------------
D0KCZ5_PECWW/26-145--------------------------------------------------------------------------------
D1W447_9BACT/21-143--------------------------------------------------------------------------------
D3EC77_GEOS4/25-144--------------------------------------------------------------------------------
D3FRA3_BACPE/26-146--------------------------------------------------------------------------------
D3FRA5_BACPE/24-128--------------------------------------------------------------------------------
D3I7I1_9BACT/41-148--------------------------------------------------------------------------------
D3I8Y5_9BACT/21-120--------------------------------------------------------------------------------
D4FV91_BACNB/25-133--------------------------------------------------------------------------------
D4FXH9_BACNB/26-163--------------------------------------------------------------------------------
D4FXI0_BACNB/26-142--------------------------------------------------------------------------------
D4FXI1_BACNB/25-133--------------------------------------------------------------------------------
D5HHH7_9FIRM/25-128--------------------------------------------------------------------------------
D5SSH7_PLAL2/27-142--------------------------------------------------------------------------------
D6CWW7_9BACE/84-197--------------------------------------------------------------------------------
D7JDE8_9BACT/35-142--------------------------------------------------------------------------------
D7VC45_LACPN/26-146--------------------------------------------------------------------------------
E1UUR3_BACAS/39-142--------------------------------------------------------------------------------
E1UUR6_BACAS/25-133--------------------------------------------------------------------------------
E2MKG2_PSEUB/45-159--------------------------------------------------------------------------------
E3YTZ2_9LIST/29-148--------------------------------------------------------------------------------
E3ZJV4_LISIV/35-139--------------------------------------------------------------------------------
E4LF31_9FIRM/27-134--------------------------------------------------------------------------------
E5W3S4_9BACI/29-137--------------------------------------------------------------------------------
E5W3S5_9BACI/24-128--------------------------------------------------------------------------------
E6UJN0_RUMA7/22-127--------------------------------------------------------------------------------
E8K361_9STRE/11-132--------------------------------------------------------------------------------
E9SF19_RUMAL/19-157--------------------------------------------------------------------------------
F0RDN6_CELLC/80-198--------------------------------------------------------------------------------
Q0VKY9_ALCBS/7-128--------------------------------------------------------------------------------
Q2SDZ5_HAHCH/31-138--------------------------------------------------------------------------------
Q4K9A1_PSEF5/31-138--------------------------------------------------------------------------------
Q4KGS7_PSEF5/49-173--------------------------------------------------------------------------------
Q5DWB0_CLOPF/28-149--------------------------------------------------------------------------------
Q5WIS2_BACSK/30-150--------------------------------------------------------------------------------
Q7M7B0_PHOLL/28-131--------------------------------------------------------------------------------
Q7N9I9_PHOLL/26-145--------------------------------------------------------------------------------
Q8GDM6_PHOLU/28-135--------------------------------------------------------------------------------

PF14567

A0KT76_SHESA/1-131--------------------------------------------------------------------------------
Q0VNR5_ALCBS/1-133--------------------------------------------------------------------------------
D4ZBL0_SHEVD/1-131--------------------------------------------------------------------------------
A4SRI0_AERS4/1-119--------------------------------------------------------------------------------
Q21KG4_SACD2/2-132--------------------------------------------------------------------------------
A6X428_OCHA4/5-137--------------------------------------------------------------------------------
A8H7F8_SHEPA/1-132--------------------------------------------------------------------------------
A0Y938_9GAMM/1-109--------------------------------------------------------------------------------
C1DFY0_AZOVD/1-133--------------------------------------------------------------------------------
C4S745_YERBE/5-136--------------------------------------------------------------------------------
B0KR80_PSEPG/1-133--------------------------------------------------------------------------------
Q2BMU0_NEPCE/1-131--------------------------------------------------------------------------------
B2C6T5_ACIBA/7-138--------------------------------------------------------------------------------
B8CKE3_SHEPW/1-119--------------------------------------------------------------------------------
A0A030T0X2_PSEAI/1-131--------------------------------------------------------------------------------
Q086X2_SHEFN/1-131--------------------------------------------------------------------------------
F3IRY6_PSESL/5-136--------------------------------------------------------------------------------
B3PC71_CELJU/34-164--------------------------------------------------------------------------------
D4RXT0_9FIRM/2-135--------------------------------------------------------------------------------
A4Y9N5_SHEPC/1-119--------------------------------------------------------------------------------
Q12R95_SHEDO/1-131--------------------------------------------------------------------------------
D0WEZ4_9ACTN/5-134--------------------------------------------------------------------------------
A3QH89_SHELP/1-131--------------------------------------------------------------------------------
C1D4A4_DEIDV/3-141--------------------------------------------------------------------------------
A1S8W2_SHEAM/1-131--------------------------------------------------------------------------------
Q7M7B0_PHOLL/5-136--------------------------------------------------------------------------------
D1W447_9BACT/1-147--------------------------------------------------------------------------------

PF07348

SYDP_KLEP7/6-179--------------------------------------------------------------------------------
SYDP_COLP3/9-191--------------------------------------------------------------------------------
I2B5Z7_SHIBC/5-178--------------------------------------------------------------------------------
R5V7K9_9FIRM/4-185--------------------------------------------------------------------------------
SYDP_YERPE/6-179--------------------------------------------------------------------------------
K7A551_9ALTE/8-182--------------------------------------------------------------------------------
E0SCC1_DICD3/6-178--------------------------------------------------------------------------------
X2H3P8_9GAMM/9-173--------------------------------------------------------------------------------
D4ZHN4_SHEVD/5-186--------------------------------------------------------------------------------
D8MW85_ERWBE/6-178--------------------------------------------------------------------------------
SYDP_CROS8/6-179--------------------------------------------------------------------------------
F5Z4L7_ALTSS/6-183--------------------------------------------------------------------------------
SYDP_SHEAM/4-180--------------------------------------------------------------------------------
J7U684_MORMO/6-178--------------------------------------------------------------------------------
E1STK9_FERBD/4-172--------------------------------------------------------------------------------
I0DWV2_PROSM/6-180--------------------------------------------------------------------------------
D5C956_ENTCC/6-179--------------------------------------------------------------------------------
G9AL81_PANAN/6-179--------------------------------------------------------------------------------
SYDP_IDILO/6-175--------------------------------------------------------------------------------
C2X4F6_BACCE/19-188--------------------------------------------------------------------------------
SYDP_EDWI9/6-178--------------------------------------------------------------------------------
M4UN22_9GAMM/6-180--------------------------------------------------------------------------------
H2IXL4_RAHAC/6-178--------------------------------------------------------------------------------
G4QLZ8_GLANF/9-186--------------------------------------------------------------------------------
E6WGC7_PANSA/6-178--------------------------------------------------------------------------------
SYDP_ERWT9/6-179--------------------------------------------------------------------------------
SYDP_VIBCH/6-179--------------------------------------------------------------------------------
SYDP_PHOLL/6-180--------------------------------------------------------------------------------
W0HTY4_9ENTR/12-183--------------------------------------------------------------------------------
C3AMX1_BACMY/7-177--------------------------------------------------------------------------------
B4F2E3_PROMH/5-178--------------------------------------------------------------------------------
SYDP_VIBF1/6-179--------------------------------------------------------------------------------
SYDP_VIBSL/6-179--------------------------------------------------------------------------------
A8GIF5_SERP5/18-190--------------------------------------------------------------------------------
F7YLH7_VIBA7/10-183--------------------------------------------------------------------------------
SYDP_ALTMD/6-178--------------------------------------------------------------------------------
SYDP_SHELP/5-184--------------------------------------------------------------------------------
F0LVK8_VIBFN/6-179--------------------------------------------------------------------------------
SYDP_HAHCH/7-185--------------------------------------------------------------------------------
SYDP_TOLAT/7-177--------------------------------------------------------------------------------
SYDP_PECAS/6-179--------------------------------------------------------------------------------
SYDP_SHEON/4-180--------------------------------------------------------------------------------
SYDP_PHOPR/6-179--------------------------------------------------------------------------------
SYDP_AERHH/6-178--------------------------------------------------------------------------------
SYDP_SHEFN/4-180--------------------------------------------------------------------------------
D3VCK7_XENNA/6-179--------------------------------------------------------------------------------
D3UWF0_XENBS/6-179--------------------------------------------------------------------------------
SYDP_SHEPW/5-180--------------------------------------------------------------------------------
R9VV65_9ENTR/6-179--------------------------------------------------------------------------------
SYDP_PSEA6/6-182--------------------------------------------------------------------------------
SYDP_VIBPA/6-178--------------------------------------------------------------------------------
SYDP_ECOLI/6-179--------------------------------------------------------------------------------
SYDP_SHEDO/4-180--------------------------------------------------------------------------------
SYDP_VIBVY/6-179--------------------------------------------------------------------------------
C3AMX8_BACMY/4-175--------------------------------------------------------------------------------
H2FY10_OCESG/7-174--------------------------------------------------------------------------------
SYDP_PSYIN/6-180--------------------------------------------------------------------------------
SYDP_PSEHT/6-178--------------------------------------------------------------------------------

PF14435

Q11UH8_CYTH3/2-179--------------------------------------------------------------------------------
C3G535_BACTU/11-190--------------------------------------------------------------------------------
C3BLX0_9BACI/3-181--------------------------------------------------------------------------------
C3G534_BACTU/3-181--------------------------------------------------------------------------------
D7C074_STRBB/3-186--------------------------------------------------------------------------------
E0QLS9_9FIRM/4-167--------------------------------------------------------------------------------
A3IE36_9BACI/4-165--------------------------------------------------------------------------------
D3GZ30_ECO44/1-160--------------------------------------------------------------------------------
B7LQU5_ESCF3/2-167--------------------------------------------------------------------------------
B1VPR4_STRGG/6-176--------------------------------------------------------------------------------
C6PRK9_9CLOT/16-217--------------------------------------------------------------------------------
B8CKE1_SHEPW/1-161--------------------------------------------------------------------------------
A3ZNI5_9PLAN/58-240--------------------------------------------------------------------------------
D3E916_GEOS4/1-200--------------------------------------------------------------------------------
E2N2L1_CAPSP/5-173--------------------------------------------------------------------------------
C0DUS3_EIKCO/1-171--------------------------------------------------------------------------------
B5HAW8_STRPR/39-232--------------------------------------------------------------------------------
E8RXJ9_MICSL/4-174--------------------------------------------------------------------------------
D1A3F0_THECD/3-170--------------------------------------------------------------------------------
Q47PK6_THEFY/247-430--------------------------------------------------------------------------------
E4NDB7_KITSK/233-420--------------------------------------------------------------------------------
C9YY18_STRSW/732-910--------------------------------------------------------------------------------
B5HAJ0_STRPR/6-189--------------------------------------------------------------------------------
D6K842_9ACTO/6-208--------------------------------------------------------------------------------
B5I6T5_9ACTO/6-184--------------------------------------------------------------------------------
E4N1Q1_KITSK/249-422--------------------------------------------------------------------------------
D1A5L5_THECD/6-199--------------------------------------------------------------------------------
D6K293_9ACTO/144-316--------------------------------------------------------------------------------
D6KEF7_9ACTO/214-404--------------------------------------------------------------------------------
Q82D46_STRAW/203-389--------------------------------------------------------------------------------
D9WNF8_9ACTO/13-197--------------------------------------------------------------------------------
Q2U157_ASPOR/71-266--------------------------------------------------------------------------------

PF02393

D2K3J3_HCMV/211-336------------KTAFGMR.............................................................
B8YE72_HCMV/157-296------------MELMIRT.............................................................
A8T728_HCMV/200-332------------VRANLAT.............................................................
D2K4S5_HCMV/202-333------------QRLCCEW.............................................................
D3YS52_HCMVO/180-322------------LQLRCRW.............................................................
D2K3X0_HCMV/202-332------------DRLCCET.............................................................
D2K5D0_HCMV/151-256------------VMVGSNH.............................................................
C8BKJ5_HCMV/34-153------------ERHCPPL.............................................................
D2K5D0_HCMV/11-135------------.YLCCPE.............................................................
B9VXJ9_HCMVT/546-653------------.VIGVLE.............................................................
B9VXD4_HCMVT/116-247------------LVATVVH.............................................................
C3Y900_BRAFL/167-275------------.FAYVNP.............................................................
C3Z365_BRAFL/157-265------------.FGYVNP.............................................................
B9VXL1_HCMVT/265-382------------.ETCSLN.............................................................
D3YRX5_HCMVO/17-135------------.YVCCQE.............................................................
Q14VM9_RAHV1/5-123------------.SCYLET.............................................................
D2K5D5_HCMV/214-331------------RSLYTRE.............................................................
A8T728_HCMV/45-168------------KLICCRE.............................................................
D2K4G8_HCMV/126-245------------TFLCCDK.............................................................
D2K595_HCMV/6-123------------LLVVTQG.............................................................
C3RWK6_FRG3V/35-153------------.VLYLPK.............................................................
C3RWV3_FRG3V/65-186------------.ELYLPE.............................................................
C1C3V1_LITCT/15-136------------.QNFLPK.............................................................
D2E8A7_ANHV1/5-121------------.TLFLPT.............................................................
Q070N0_CPRVZ/47-172------------.YLYLPR.............................................................
B5XAY6_SALSA/21-139------------.DCYLPE.............................................................
B4YEM5_9ALPH/49-167------------.ALYLPQ.............................................................
B1NFI8_ADEGX/15-131------------.VLYLPS.............................................................
F5HIG2_HCMV/399-518------------RFSCLRQ.............................................................
D3YRW4_HCMVO/69-190------------HYLCCQT.............................................................
B9VXJ9_HCMVT/55-169------------.NDFFGE.............................................................
C8CFJ9_HCMV/42-158------------DVICCPE.............................................................
B9VXG6_HCMVT/274-510------------QRLCCGWLALGAVLPARWLGCAAGPATMTAGTTAMATGTTLPAGASGTETEAAGGDAPCAIAGAVGSA
Q4KS78_ISKNV/1-104------------.KFYLPD.............................................................
C8CFJ8_HCMV/54-179------------DYLCCDD.............................................................
A8T729_HCMV/26-179------------QLICCEE.............................................................

PF14433

C3WDW2_FUSMR/11-172------------DFSFSIP-------------------------------------------------------------
F0KCA1_CLOAE/2-150------------DLYTTNM-------------------------------------------------------------
C3BLQ7_9BACI/6-145------------TTCIKEV-------------------------------------------------------------
F0KCA3_CLOAE/3-152------------DEDYDEH-------------------------------------------------------------
B1HSL5_LYSSC/5-144------------DFVIDPE-------------------------------------------------------------
C0Z7L3_BREBN/2-133------------RFTNY..-------------------------------------------------------------
B7N9G4_ECOLU/6-148------------KSDFDPI-------------------------------------------------------------
A8RVU3_CLOBW/13-150------------QFALFPY-------------------------------------------------------------
A9B4M5_HERA2/3-169------------EIQLLPQ-------------------------------------------------------------
C2M481_CAPGI/2-151------------VFIYSQN-------------------------------------------------------------
A9B4M4_HERA2/9-180------------MFENFIP-------------------------------------------------------------
A9B983_HERA2/9-180------------RIDFDPA-------------------------------------------------------------
D1ALL2_SEBTE/5-152------------RFMLYPL-------------------------------------------------------------
C2G2C6_9SPHI/5-144------------YFEINPM-------------------------------------------------------------
A9DRL2_9FLAO/4-142------------TFTGTLN-------------------------------------------------------------
D7VVD7_9FLAO/4-136------------NTKID..-------------------------------------------------------------
D6B4A2_9ACTO/10-151------------PYNFDPI-------------------------------------------------------------
C5UVJ4_CLOBO/2-147------------VIEFNPI-------------------------------------------------------------
A4A0B2_9PLAN/1-122------------GVEADP.-------------------------------------------------------------
A2W0F4_9BURK/45-178------------GIAFRAL-------------------------------------------------------------
B7WUX3_COMTE/6-150------------DIEFDWL-------------------------------------------------------------
C6DGM5_PECCP/1-142------------YFYINPE-------------------------------------------------------------
B7M4P5_ECO8A/11-152------------AFFIDPE-------------------------------------------------------------
C4GHT1_9NEIS/5-139------------LFEFRAR-------------------------------------------------------------
D1A3E8_THECD/9-150------------EFDLDPL-------------------------------------------------------------
D9X9L6_STRVR/182-321------------EFSLDPL-------------------------------------------------------------
Q82G08_STRAW/7-151------------AWVMKPT-------------------------------------------------------------
B1VX82_STRGG/7-150------------NFAIFTP-------------------------------------------------------------
D6K3Y2_9ACTO/7-151------------VVMFFPR-------------------------------------------------------------
A4X261_SALTO/97-242------------ASGIQPT-------------------------------------------------------------
D6K3Y4_9ACTO/15-161------------GFSLDPE-------------------------------------------------------------
B1VX84_STRGG/1-149------------GCVVDPT-------------------------------------------------------------
D9UTG4_STRS3/29-176------------SLDLDPL-------------------------------------------------------------
C4RQ15_9ACTO/292-437------------RFDITPH-------------------------------------------------------------
A4X254_SALTO/6-153------------TFHLDPF-------------------------------------------------------------

PF09346

A0RE58_BACAH/19-133.................AH-------------------------------------------------------------
C2T3B2_BACCE/8-142............DLS..EC-------------------------------------------------------------
A4YB72_SHEPC/14-135............TEA..YC-------------------------------------------------------------
A0A011W5W1_BACTI/32-156............KQRGGSY-------------------------------------------------------------
B1YF81_EXIS2/16-130............RRT..VS-------------------------------------------------------------
A6FHD8_9GAMM/19-145SLE.........DVA..SL-------------------------------------------------------------
A4EPD0_9RHOB/35-163............EMI..VT-------------------------------------------------------------
A0RAV0_BACAH/42-162LYN.........FQQ..LY-------------------------------------------------------------
B8I5J3_CLOCE/15-125............RNL..TY-------------------------------------------------------------
C3G559_BACTU/15-125...................-------------------------------------------------------------
A8FII6_BACP2/13-123............RNA..TW-------------------------------------------------------------
Q1DBU4_MYXXD/34-167DPS.........DAV..NG-------------------------------------------------------------
A5UV09_ROSS1/24-144SVW.........GII..EA-------------------------------------------------------------
Q6HMR4_BACHK/23-143............DEH..IC-------------------------------------------------------------
Q1CV91_HELPH/17-134............NLE..SL-------------------------------------------------------------
B1YEX8_EXIS2/15-147FMP.........LTI..GK-------------------------------------------------------------
A5TTY9_FUSNP/35-181GWV.........DIC..YP-------------------------------------------------------------
Q47P53_THEFY/18-133............LAM..RS-------------------------------------------------------------
A0JSM0_ARTS2/15-129............AYF..RN-------------------------------------------------------------
Q82GY4_STRAW/63-178............VEL..RS-------------------------------------------------------------
Q2BBP1_9BACI/47-165............TLH..ER-------------------------------------------------------------
Q65PK7_BACLD/18-132............LDM..RC-------------------------------------------------------------
C2T2Q4_BACCE/27-144............DLY....-------------------------------------------------------------
A5UTX3_ROSS1/55-202DFR.........AML..GN-------------------------------------------------------------
A6C6S9_9PLAN/31-128............ELF..DA-------------------------------------------------------------
A5FCA9_FLAJ1/44-161SDA.........PQY..GP-------------------------------------------------------------
B7X333_COMTE/152-284DIV.........EMS..AP-------------------------------------------------------------
Q4K6P0_PSEF5/56-173............PGIVEIG-------------------------------------------------------------
J8EZ11_BACCE/25-143.................LR-------------------------------------------------------------
B8I223_CLOCE/15-131............GFYESDP-------------------------------------------------------------
Q81BA7_BACCR/48-167............TII..AR-------------------------------------------------------------
Q89MJ4_BRADU/28-170............DEC..SL-------------------------------------------------------------
A3ZX28_9PLAN/24-139............SVI..DV-------------------------------------------------------------
A0AMA9_LISW6/21-137.................DT-------------------------------------------------------------
A5FMA4_FLAJ1/23-172PEL.........QEY..KL-------------------------------------------------------------
D4Q174_LISMN/14-152QMS.........LEA..AE-------------------------------------------------------------
D6EFH2_STRLI/29-155VAQ.........YLA..NR-------------------------------------------------------------
Q3BQF4_XANC5/29-173RAR.........EEY..RD-------------------------------------------------------------
Q4UXL8_XANC8/219-365............AFE..DP-------------------------------------------------------------
A5FJY1_FLAJ1/42-170QEI.........EGE..DE-------------------------------------------------------------
Q1ZQF0_PHOAS/14-166RQL.........ELY..LK-------------------------------------------------------------
Q5WBD2_BACSK/23-138............NDT..IE-------------------------------------------------------------
A5FGR4_FLAJ1/41-198KNI.........EEN..DD-------------------------------------------------------------
Q0RKI3_FRAAA/56-185............DED..DS-------------------------------------------------------------
Q9F3Q3_STRCO/47-179DLD.........EEA..GP-------------------------------------------------------------
A6CDZ7_9PLAN/19-143............RHV..VK-------------------------------------------------------------
A6X425_OCHA4/20-140............QDV..VA-------------------------------------------------------------
B3ZML8_BACCE/18-127GYL.........NVV..ES-------------------------------------------------------------
A4VZJ4_STRS2/19-128............TDV..VA-------------------------------------------------------------
A1RNF3_SHESW/21-128PYS.........HTY..LP-------------------------------------------------------------
Q0VNR5_ALCBS/21-130............NQG....-------------------------------------------------------------
Q7M7B0_PHOLL/25-133.................GE-------------------------------------------------------------
F3IRY6_PSESL/25-133.................RE-------------------------------------------------------------
A4Y9N5_SHEPC/8-116............ETLANAR-------------------------------------------------------------
A4SRI0_AERS4/8-116.................EM-------------------------------------------------------------
A0A016B5A2_BACFG/47-168NAT.........PAP..FG-------------------------------------------------------------
Q82RV7_STRAW/96-236KHGIPPVQ....HLP..YW-------------------------------------------------------------
A4FNW2_SACEN/30-166ELWTA.......RWE..RP-------------------------------------------------------------
A5FAZ7_FLAJ1/185-329DLQ.....FDEDDLP..EQ-------------------------------------------------------------
A3I618_9BACI/42-194............ETI..FE-------------------------------------------------------------
B4SN74_STRM5/28-184SIY.........EEW..LD-------------------------------------------------------------
Q39NE9_BURS3/28-182............AKYRDSI-------------------------------------------------------------
Q6HHY9_BACHK/33-185DVS.........YLLEYQD-------------------------------------------------------------
A5TXY3_FUSNP/37-189............DFYADYV-------------------------------------------------------------
A1RPC3_SHESW/26-168YYA.........DYQ..EP-------------------------------------------------------------
M2C2K9_TREDN/40-189ALL.........TEF..TD-------------------------------------------------------------
H2K898_STRHJ/18-144RFQ.........EEN..GE-------------------------------------------------------------
A6G0Q7_9DELT/31-170............HFANVTS-------------------------------------------------------------
Q9RYT7_DEIRA/27-166KVWMDLLQDGTFDGN..AS-------------------------------------------------------------
Q93JL3_STRCO/163-310CLW.........QFAATDA-------------------------------------------------------------
A1ZXR5_9BACT/30-166............EHL..TP-------------------------------------------------------------
SMI1_CANGA/103-288STASIGSSSQQQREK..PR-------------------------------------------------------------
Q59YV1_CANAL/104-343THSTNTATSMCYNSNILPS-------------------------------------------------------------
A5DZP7_LODEL/117-382SSTSTTSHDALNIET..AT-------------------------------------------------------------
SMI1_DEBHA/98-296SNLDLIEPVKIAKQQ..RH-------------------------------------------------------------
Q55KB3_CRYNB/120-282YAEDDPTVGGNPAIL..AT-------------------------------------------------------------
Q4PAY0_USTMA/184-339AVDEDPETAANPQLR..NL-------------------------------------------------------------
SMI2_DEBHA/142-319THGHENKINN..SFI..AN-------------------------------------------------------------
A1C9R6_ASPCL/143-317PQATNPLWRN..ELL..ER-------------------------------------------------------------
SMI1_YARLI/171-356PVASVARQKNISSWL..AS-------------------------------------------------------------
A6EFN0_9SPHI/29-161............ESM..EF-------------------------------------------------------------
O07689_LISSE/36-156GTF.........SIN..LE-------------------------------------------------------------
A3ZN04_9PLAN/36-149K...........RGH..KH-------------------------------------------------------------
B1YF88_EXIS2/9-123............EDV..VH-------------------------------------------------------------
A7VFJ3_9CLOT/24-132............KPL..ID-------------------------------------------------------------
A4X269_SALTO/103-245HPQ.........HPS..RD-------------------------------------------------------------
A1RND9_SHESW/4-129TCN.........HII..NE-------------------------------------------------------------
A0PQE6_MYCUA/4-131TCN.........DIV..RE-------------------------------------------------------------
I0LI94_CORGK/4-116............RLVRTAN-------------------------------------------------------------
Q0VKY9_ALCBS/4-130............RTC..NS-------------------------------------------------------------
Q9F2N4_STRCO/160-298............EAA..VN-------------------------------------------------------------
A3KB11_9RHOB/18-152NRP.........ARV..QE-------------------------------------------------------------
Q1DEQ7_MYXXD/33-153QRA.........QGA..SE-------------------------------------------------------------
Q1CY42_MYXXD/19-141............VTMRKKD-------------------------------------------------------------
Q09D40_STIAD/24-149............IVR..AR-------------------------------------------------------------
B1YEY9_EXIS2/39-159ED..........GLI..DE-------------------------------------------------------------
Q5WJU2_BACSK/38-153.................MK-------------------------------------------------------------
A7Z7P3_BACA2/41-156............QNG....-------------------------------------------------------------
J7JW73_BACIU/42-161............KYEDLFE-------------------------------------------------------------
M1U9G8_BACIU/23-165DDT.........QLL..EG-------------------------------------------------------------
A7Z5R7_BACA2/23-158............EDL..SE-------------------------------------------------------------
A3ZX25_9PLAN/22-154............SFF..GD-------------------------------------------------------------
A7VE32_9CLOT/35-145............EDY..MS-------------------------------------------------------------
A7MRN6_CROS8/1-150............EYC..DI-------------------------------------------------------------
B3Z4D7_BACCE/12-154VTW.........TQL..DE-------------------------------------------------------------
Q3IK24_PSEHT/8-124............SLV..IQ-------------------------------------------------------------
A5Z4R3_9FIRM/12-152KFF.........SLN..EM-------------------------------------------------------------
A5Z4R9_9FIRM/9-151SSY.........DDI..IK-------------------------------------------------------------
A1ZMA9_9BACT/9-138............KKY..KN-------------------------------------------------------------
A0A011UV81_BACTI/12-152............ENE..IN-------------------------------------------------------------
C2SX01_BACCE/13-142DSE.........RKI..SM-------------------------------------------------------------
A0A011VP76_BACTI/12-138............KDA..NI-------------------------------------------------------------
Q6HGG3_BACHK/12-159............EVF..ND-------------------------------------------------------------
Q6HGE4_BACHK/13-160ESS.........EYI..VK-------------------------------------------------------------
A0RAF8_BACAH/19-149............TTY..EN-------------------------------------------------------------
A7FEI4_YERP3/10-144GDK.........SDS..IA-------------------------------------------------------------
Q21ED8_SACD2/11-151............IKH..NH-------------------------------------------------------------
A6CCT7_9PLAN/22-151SFN.........SED..EN-------------------------------------------------------------
Q6CS49_KLULA/64-193............DMT..VE-------------------------------------------------------------
B1J8X4_PSEPW/139-260............REL..VE-------------------------------------------------------------
A7ML24_CROS8/19-151............ETL..IN-------------------------------------------------------------
A5FLI6_FLAJ1/11-131............KDL..IE-------------------------------------------------------------
A0A014N9J6_YERPE/11-153SLI.........DGC..YN-------------------------------------------------------------
Q5LEK4_BACFN/167-306ETI.........EVI..AK-------------------------------------------------------------
Q65VI9_MANSM/10-134............QLI..DE-------------------------------------------------------------
B8I222_CLOCE/15-149VLS.........LHY..DD-------------------------------------------------------------
F6BM79_SINMB/32-167............EDL..CL-------------------------------------------------------------
Q28UU7_JANSC/42-166............AFL..DD-------------------------------------------------------------
Q5LEK4_BACFN/11-139............NLAQRSS-------------------------------------------------------------
Q5LEK9_BACFN/11-148............NDP..RY-------------------------------------------------------------
A7RYE8_NEMVE/119-257............QSESLLD-------------------------------------------------------------
G1S8C1_NOMLE/121-251............RSEDLLD-------------------------------------------------------------
Q52KV8_XENLA/36-166FLD.........IDT..AA-------------------------------------------------------------
A0RFK3_BACAH/36-159AQM.........LLT..VI-------------------------------------------------------------
Q9CND2_PASMU/14-158............EPP..EN-------------------------------------------------------------
A6DN67_9BACT/17-158VNL......YHDEKY..SL-------------------------------------------------------------
A9B016_HERA2/24-146............EVV....-------------------------------------------------------------
Q5WC01_BACSK/21-135............LFI..PD-------------------------------------------------------------
A1ZUI6_9BACT/29-147............EML..IA-------------------------------------------------------------
Q47R76_THEFY/31-145............ARD..DD-------------------------------------------------------------
A8M704_SALAI/21-139............FEE..NA-------------------------------------------------------------
H2GD97_CORD2/14-156GDN.........NDL..LT-------------------------------------------------------------
A1IPF3_NEIMA/1-117SEV.........IDI..YF-------------------------------------------------------------
A3I6Z7_9BACI/22-146............SDI..LY-------------------------------------------------------------
Q4KGS7_PSEF5/46-175TWE.........SIV..RH-------------------------------------------------------------
Q38V57_LACSS/13-131ECH.........YLA..GI-------------------------------------------------------------
A4BCB8_9GAMM/14-147............VET..AQ-------------------------------------------------------------
A0R498_MYCS2/11-150AWW.........HDD..ED-------------------------------------------------------------
A6VZI9_MARMS/37-168PNA.........ENS..IF-------------------------------------------------------------
Q2BBP3_9BACI/17-145............KSG..II-------------------------------------------------------------
C2T7X0_BACCE/16-147NEN.........ESS..IL-------------------------------------------------------------
A5TTM3_FUSNP/176-315.................LC-------------------------------------------------------------
A4X5D2_SALTO/28-164............PFS..LC-------------------------------------------------------------
Q11VT9_CYTH3/29-168............TYS..LG-------------------------------------------------------------
A1INP6_NEIMA/28-167............EGS..LC-------------------------------------------------------------
H1GFW8_LISIO/124-264............VST..LN-------------------------------------------------------------
A8FAT3_BACP2/17-145............GIM..DS-------------------------------------------------------------
B1KH37_SHEWM/28-163EMW.........SDS..KN-------------------------------------------------------------
B1KH38_SHEWM/29-165............DVLTFTQ-------------------------------------------------------------
Q8GDM6_PHOLU/25-137............EAI..GG-------------------------------------------------------------
Q7N9I9_PHOLL/23-147NQA.........PCI..LY-------------------------------------------------------------
Q926X2_LISIN/25-149.................IP-------------------------------------------------------------
Q5DWB0_CLOPF/25-151IWL.........TLK..ER-------------------------------------------------------------
B1KPX6_SHEWM/17-136............GSV..LS-------------------------------------------------------------
A7Z5G8_BACA2/23-137.................VE-------------------------------------------------------------
B1ESH1_BACAN/4-119.................SS-------------------------------------------------------------
A7GQ33_BACCN/21-130............SVV..DD-------------------------------------------------------------
A4IKF8_GEOTN/21-132.................SV-------------------------------------------------------------
A3ZX34_9PLAN/23-143PTL.........EHR..GT-------------------------------------------------------------
B7KWA7_METC4/14-155HRF.........TIE..GD-------------------------------------------------------------
Q2SDZ5_HAHCH/28-140NLI.........DIN..AE-------------------------------------------------------------
Q4K9A1_PSEF5/28-140.................LV-------------------------------------------------------------
Q633D5_BACCZ/17-131............EGY....-------------------------------------------------------------
A5Z4Q5_9FIRM/17-131............EYA..VD-------------------------------------------------------------
A1TSU7_ACIAC/17-133............RNI..SA-------------------------------------------------------------
G7QG99_LEPII/16-123............EDY....-------------------------------------------------------------
Q5LEL2_BACFN/13-124............IAY..NH-------------------------------------------------------------

PF14568

A0AMA9_LISW6/24-135------------FTLKFRD-------------------------------------------------------------
A3I6Z7_9BACI/25-144------------IHRLNLA-------------------------------------------------------------
A3ZX34_9PLAN/26-141------------RGTVYGD-------------------------------------------------------------
A4IKF8_GEOTN/24-130------------GASVVKA-------------------------------------------------------------
A4VZJ4_STRS2/22-126------------RSLY...-------------------------------------------------------------
A6CDZ7_9PLAN/22-141------------HVVKTSV-------------------------------------------------------------
A6X425_OCHA4/23-138------------WQDVVAV-------------------------------------------------------------
A7FEI4_YERP3/13-142------------DKFLSTN-------------------------------------------------------------
A7GQ33_BACCN/24-128------------YASVVDD-------------------------------------------------------------
A7Z5G8_BACA2/26-135------------GASVVET-------------------------------------------------------------
A7ZAC8_BACA2/3-116------------DDVI.RQ-------------------------------------------------------------
A8UFY5_9FLAO/12-126------------LSSL.DE-------------------------------------------------------------
A9DRK0_9FLAO/13-128------------LKKI.HR-------------------------------------------------------------
A9INX3_BART1/38-152------------RNLL.DR-------------------------------------------------------------
A9INY0_BART1/31-145------------YHIT.DI-------------------------------------------------------------
A9INY3_BART1/35-149------------KNLY.HR-------------------------------------------------------------
A9INY6_BART1/35-148------------QNLN.AR-------------------------------------------------------------
A9INZ4_BART1/35-149------------QNLN.DR-------------------------------------------------------------
A0A011PWV5_BACAN/9-120------------DSSVVYH-------------------------------------------------------------
B1BP25_CLOPF/31-145------------LEKCLLS-------------------------------------------------------------
B1KH37_SHEWM/31-161------------IGTEMWS-------------------------------------------------------------
B1KPX6_SHEWM/20-134------------GSVL.SD-------------------------------------------------------------
B3ZML8_BACCE/21-125------------RQFE...-------------------------------------------------------------
B4AJF6_BACPU/18-123------------RNATWEV-------------------------------------------------------------
B5ULT3_BACCE/26-136------------GKTNGND-------------------------------------------------------------
B5UUA7_BACCE/17-130------------DDIV.RQ-------------------------------------------------------------
B7INQ5_BACC2/11-140------------TFDL.SE-------------------------------------------------------------
B7JLP8_BACC0/25-134------------IASVVIE-------------------------------------------------------------
B8DA94_LISMH/28-135------------QNVI...-------------------------------------------------------------
B8DD33_LISMH/29-148------------ATEQ...-------------------------------------------------------------
B8DD37_LISMH/24-135------------LTLKFRK-------------------------------------------------------------
C2KY92_9FIRM/22-126------------KNVN...-------------------------------------------------------------
C2M8M5_CAPGI/23-138------------TYQVNLQ-------------------------------------------------------------
C2PY06_BACCE/26-128------------CNDILHY-------------------------------------------------------------
C2TZ07_BACCE/17-130------------DDVV.RQ-------------------------------------------------------------
C2ZR32_BACCE/17-130------------DDII.RQ-------------------------------------------------------------
C3BVU2_9BACI/35-154------------GSYLNDS-------------------------------------------------------------
C3WVX7_FUSNU/23-127------------RALN...-------------------------------------------------------------
C4L6I6_EXISA/20-124------------REVS...-------------------------------------------------------------
C6ABU4_BARGA/31-145------------NHLT.DI-------------------------------------------------------------
C6ABU7_BARGA/31-144------------RNLL.DR-------------------------------------------------------------
C6AD58_BARGA/31-144------------RNLN.DI-------------------------------------------------------------
C6AD60_BARGA/31-146------------QNLNYYR-------------------------------------------------------------
C6AEU7_BARGA/31-145------------YHLT.DI-------------------------------------------------------------
C6CF14_DICZE/28-135------------QNVI...-------------------------------------------------------------
C7GI90_9FIRM/31-150------------YALN...-------------------------------------------------------------
C7N7K9_SLAHD/25-127------------KIMFLEE-------------------------------------------------------------
C8K547_LISMN/28-148------------STMN...-------------------------------------------------------------
D0KCB2_PECWW/28-147------------VTLE...-------------------------------------------------------------
D0KCZ5_PECWW/26-145------------STVD...-------------------------------------------------------------
D1W447_9BACT/21-143------------TYSVVEV-------------------------------------------------------------
D3EC77_GEOS4/25-144------------IHRLNQD-------------------------------------------------------------
D3FRA3_BACPE/26-146------------FTLT...-------------------------------------------------------------
D3FRA5_BACPE/24-128------------YASVVEK-------------------------------------------------------------
D3I7I1_9BACT/41-148------------KEAGWAI-------------------------------------------------------------
D3I8Y5_9BACT/21-120------------KAKE.KN-------------------------------------------------------------
D4FV91_BACNB/25-133------------SARVVTV-------------------------------------------------------------
D4FXH9_BACNB/26-163------------LEGFYGL-------------------------------------------------------------
D4FXI0_BACNB/26-142------------HENDEQK-------------------------------------------------------------
D4FXI1_BACNB/25-133------------HASVVNR-------------------------------------------------------------
D5HHH7_9FIRM/25-128------------KMIFVEK-------------------------------------------------------------
D5SSH7_PLAL2/27-142------------RGTIYGD-------------------------------------------------------------
D6CWW7_9BACE/84-197------------NKILIEN-------------------------------------------------------------
D7JDE8_9BACT/35-142------------RENESEN-------------------------------------------------------------
D7VC45_LACPN/26-146------------ATLD...-------------------------------------------------------------
E1UUR3_BACAS/39-142------------...L.EG-------------------------------------------------------------
E1UUR6_BACAS/25-133------------GAEVVEQ-------------------------------------------------------------
E2MKG2_PSEUB/45-159------------QHIN.GL-------------------------------------------------------------
E3YTZ2_9LIST/29-148------------ATEQ...-------------------------------------------------------------
E3ZJV4_LISIV/35-139------------VENI...-------------------------------------------------------------
E4LF31_9FIRM/27-134------------SDYLKDG-------------------------------------------------------------
E5W3S4_9BACI/29-137------------SPEVVEF-------------------------------------------------------------
E5W3S5_9BACI/24-128------------YASVVEA-------------------------------------------------------------
E6UJN0_RUMA7/22-127------------WNKN...-------------------------------------------------------------
E8K361_9STRE/11-132------------NNLISLD-------------------------------------------------------------
E9SF19_RUMAL/19-157------------DDIM.RI-------------------------------------------------------------
F0RDN6_CELLC/80-198------------NRSWLSD-------------------------------------------------------------
Q0VKY9_ALCBS/7-128------------NSIL.HE-------------------------------------------------------------
Q2SDZ5_HAHCH/31-138------------AHLRAGR-------------------------------------------------------------
Q4K9A1_PSEF5/31-138------------PAITGRH-------------------------------------------------------------
Q4KGS7_PSEF5/49-173------------RHFEGGW-------------------------------------------------------------
Q5DWB0_CLOPF/28-149------------LTLK...-------------------------------------------------------------
Q5WIS2_BACSK/30-150------------YTLT...-------------------------------------------------------------
Q7M7B0_PHOLL/28-131------------GELS..Q-------------------------------------------------------------
Q7N9I9_PHOLL/26-145------------VTKQ...-------------------------------------------------------------
Q8GDM6_PHOLU/28-135------------QNTI...-------------------------------------------------------------

PF14567

A0KT76_SHESA/1-131--------------------------------------------------------------------------------
Q0VNR5_ALCBS/1-133--------------------------------------------------------------------------------
D4ZBL0_SHEVD/1-131--------------------------------------------------------------------------------
A4SRI0_AERS4/1-119--------------------------------------------------------------------------------
Q21KG4_SACD2/2-132--------------------------------------------------------------------------------
A6X428_OCHA4/5-137--------------------------------------------------------------------------------
A8H7F8_SHEPA/1-132--------------------------------------------------------------------------------
A0Y938_9GAMM/1-109--------------------------------------------------------------------------------
C1DFY0_AZOVD/1-133--------------------------------------------------------------------------------
C4S745_YERBE/5-136--------------------------------------------------------------------------------
B0KR80_PSEPG/1-133--------------------------------------------------------------------------------
Q2BMU0_NEPCE/1-131--------------------------------------------------------------------------------
B2C6T5_ACIBA/7-138--------------------------------------------------------------------------------
B8CKE3_SHEPW/1-119--------------------------------------------------------------------------------
A0A030T0X2_PSEAI/1-131--------------------------------------------------------------------------------
Q086X2_SHEFN/1-131--------------------------------------------------------------------------------
F3IRY6_PSESL/5-136--------------------------------------------------------------------------------
B3PC71_CELJU/34-164--------------------------------------------------------------------------------
D4RXT0_9FIRM/2-135--------------------------------------------------------------------------------
A4Y9N5_SHEPC/1-119--------------------------------------------------------------------------------
Q12R95_SHEDO/1-131--------------------------------------------------------------------------------
D0WEZ4_9ACTN/5-134--------------------------------------------------------------------------------
A3QH89_SHELP/1-131--------------------------------------------------------------------------------
C1D4A4_DEIDV/3-141--------------------------------------------------------------------------------
A1S8W2_SHEAM/1-131--------------------------------------------------------------------------------
Q7M7B0_PHOLL/5-136--------------------------------------------------------------------------------
D1W447_9BACT/1-147--------------------------------------------------------------------------------

PF07348

SYDP_KLEP7/6-179------------TTQFAGD-------------------------------------------------------------
SYDP_COLP3/9-191------------TTIFSGD-------------------------------------------------------------
I2B5Z7_SHIBC/5-178------------CSQYAGD-------------------------------------------------------------
R5V7K9_9FIRM/4-185------------STYWFLA-------------------------------------------------------------
SYDP_YERPE/6-179------------TQQYAGD-------------------------------------------------------------
K7A551_9ALTE/8-182------------SAYWSDN-------------------------------------------------------------
E0SCC1_DICD3/6-178------------TSQFAGD-------------------------------------------------------------
X2H3P8_9GAMM/9-173------------GTQYAGN-------------------------------------------------------------
D4ZHN4_SHEVD/5-186------------GEYFSAP-------------------------------------------------------------
D8MW85_ERWBE/6-178------------STQFAGD-------------------------------------------------------------
SYDP_CROS8/6-179------------ASQYAGD-------------------------------------------------------------
F5Z4L7_ALTSS/6-183------------TQFFSNN-------------------------------------------------------------
SYDP_SHEAM/4-180------------GHLFGGP-------------------------------------------------------------
J7U684_MORMO/6-178------------TQQFAGD-------------------------------------------------------------
E1STK9_FERBD/4-172------------GHFYAGN-------------------------------------------------------------
I0DWV2_PROSM/6-180------------TTQLAGD-------------------------------------------------------------
D5C956_ENTCC/6-179------------TTQFAGD-------------------------------------------------------------
G9AL81_PANAN/6-179------------THQFAGD-------------------------------------------------------------
SYDP_IDILO/6-175------------GRWYAGD-------------------------------------------------------------
C2X4F6_BACCE/19-188------------NSYWFAD-------------------------------------------------------------
SYDP_EDWI9/6-178------------TTQYAGD-------------------------------------------------------------
M4UN22_9GAMM/6-180------------CSVYSAG-------------------------------------------------------------
H2IXL4_RAHAC/6-178------------TTQYAGD-------------------------------------------------------------
G4QLZ8_GLANF/9-186------------CRYYSHD-------------------------------------------------------------
E6WGC7_PANSA/6-178------------TTQFAGD-------------------------------------------------------------
SYDP_ERWT9/6-179------------TSQFAGD-------------------------------------------------------------
SYDP_VIBCH/6-179------------ASQFSAD-------------------------------------------------------------
SYDP_PHOLL/6-180------------TSQLAGD-------------------------------------------------------------
W0HTY4_9ENTR/12-183------------CSQYAGD-------------------------------------------------------------
C3AMX1_BACMY/7-177------------NSYWFLD-------------------------------------------------------------
B4F2E3_PROMH/5-178------------TTQYAGD-------------------------------------------------------------
SYDP_VIBF1/6-179------------GTQYSAD-------------------------------------------------------------
SYDP_VIBSL/6-179------------GAQFSAD-------------------------------------------------------------
A8GIF5_SERP5/18-190------------TQQYAGD-------------------------------------------------------------
F7YLH7_VIBA7/10-183------------GVQFCAD-------------------------------------------------------------
SYDP_ALTMD/6-178------------TTYYSDN-------------------------------------------------------------
SYDP_SHELP/5-184------------GRYFAAP-------------------------------------------------------------
F0LVK8_VIBFN/6-179------------GAQFSAD-------------------------------------------------------------
SYDP_HAHCH/7-185------------GSYWSDG-------------------------------------------------------------
SYDP_TOLAT/7-177------------GHGYAGQ-------------------------------------------------------------
SYDP_PECAS/6-179------------TAQYAGD-------------------------------------------------------------
SYDP_SHEON/4-180------------GQYFAAP-------------------------------------------------------------
SYDP_PHOPR/6-179------------STQFSGD-------------------------------------------------------------
SYDP_AERHH/6-178------------GGWFSRP-------------------------------------------------------------
SYDP_SHEFN/4-180------------GQYFSAP-------------------------------------------------------------
D3VCK7_XENNA/6-179------------VTQFAGD-------------------------------------------------------------
D3UWF0_XENBS/6-179------------VTQLAGD-------------------------------------------------------------
SYDP_SHEPW/5-180------------GSHFAAS-------------------------------------------------------------
R9VV65_9ENTR/6-179------------TTQFAGD-------------------------------------------------------------
SYDP_PSEA6/6-182------------SRYWSDN-------------------------------------------------------------
SYDP_VIBPA/6-178------------GSQYSAD-------------------------------------------------------------
SYDP_ECOLI/6-179------------TTQFAGD-------------------------------------------------------------
SYDP_SHEDO/4-180------------ASFFSAP-------------------------------------------------------------
SYDP_VIBVY/6-179------------GSQLSAD-------------------------------------------------------------
C3AMX8_BACMY/4-175------------NSYWFAE-------------------------------------------------------------
H2FY10_OCESG/7-174------------GHYYAGH-------------------------------------------------------------
SYDP_PSYIN/6-180------------CSAYSAG-------------------------------------------------------------
SYDP_PSEHT/6-178------------GHMYGGN-------------------------------------------------------------

PF14435

Q11UH8_CYTH3/2-179------------DPICIDP-------------------------------------------------------------
C3G535_BACTU/11-190------------NPICIDE-------------------------------------------------------------
C3BLX0_9BACI/3-181------------DPLCIDE-------------------------------------------------------------
C3G534_BACTU/3-181------------DPICIIE-------------------------------------------------------------
D7C074_STRBB/3-186------------GFACMSR-------------------------------------------------------------
E0QLS9_9FIRM/4-167------------GYFVID.-------------------------------------------------------------
A3IE36_9BACI/4-165------------YGLYLKE-------------------------------------------------------------
D3GZ30_ECO44/1-160------------GYFIVSV-------------------------------------------------------------
B7LQU5_ESCF3/2-167------------GHFAIEE-------------------------------------------------------------
B1VPR4_STRGG/6-176------------GSILWDP-------------------------------------------------------------
C6PRK9_9CLOT/16-217------------NLIAIQE-------------------------------------------------------------
B8CKE1_SHEPW/1-161------------NHICIST-------------------------------------------------------------
A3ZNI5_9PLAN/58-240------------ASLCVDR-------------------------------------------------------------
D3E916_GEOS4/1-200------------LHVAIQK-------------------------------------------------------------
E2N2L1_CAPSP/5-173------------GYFVLN.-------------------------------------------------------------
C0DUS3_EIKCO/1-171------------GSYFVVA-------------------------------------------------------------
B5HAW8_STRPR/39-232------------PEYVLD.-------------------------------------------------------------
E8RXJ9_MICSL/4-174------------LLFCLDA-------------------------------------------------------------
D1A3F0_THECD/3-170------------MYYCLDG-------------------------------------------------------------
Q47PK6_THEFY/247-430------------SVVAVRR-------------------------------------------------------------
E4NDB7_KITSK/233-420------------ALLTVDT-------------------------------------------------------------
C9YY18_STRSW/732-910------------KALCVQY-------------------------------------------------------------
B5HAJ0_STRPR/6-189------------NAVVIDP-------------------------------------------------------------
D6K842_9ACTO/6-208------------AHLVLDP-------------------------------------------------------------
B5I6T5_9ACTO/6-184------------DDIALDG-------------------------------------------------------------
E4N1Q1_KITSK/249-422------------DSFHLDT-------------------------------------------------------------
D1A5L5_THECD/6-199------------GVVGLNP-------------------------------------------------------------
D6K293_9ACTO/144-316------------AEAVLDG-------------------------------------------------------------
D6KEF7_9ACTO/214-404------------FEVLIDG-------------------------------------------------------------
Q82D46_STRAW/203-389------------TSLVVDG-------------------------------------------------------------
D9WNF8_9ACTO/13-197------------DMLMLAG-------------------------------------------------------------
Q2U157_ASPOR/71-266------------QLVMLEN-------------------------------------------------------------

PF02393

D2K3J3_HCMV/211-336.......................VL....GLGTVS...........LKGENAP---FPHLRWPVD..-------.LIPI-
B8YE72_HCMV/157-296................VPR....ITCYHQLLGALG..........HEVPERKE---FLV........-------.RQYV-
A8T728_HCMV/200-332..................P....WY....VLGVTG..........RPRPGRSF---VAE........-------.VL.V-
D2K4S5_HCMV/202-333........................Y....VVGLVG...........YYLAYGP---FVPS.......-------.GL.V-
D3YS52_HCMVO/180-322........................Y....LLGAVG...........SYRAGGF---FDTS.......-------.FL.I-
D2K3X0_HCMV/202-332........................M....IMGVVG...........ESLPSGV---FHAD.......-------.FV.I-
D2K5D0_HCMV/151-256.......................VE....PLGWLV................SP---YD.........-------.VINL-
C8BKJ5_HCMV/34-153................DQE....LI....MFGVIE...........AWEEASV---RPTRQ......-------.LV.L-
D2K5D0_HCMV/11-135..................P....LR....FVGSIC......TYNFLKHKGDHN---VP.........-------.SE.L-
B9VXJ9_HCMVT/546-653................QAH....FV....VIGWME...........PVN....---...........-------.KA.V-
B9VXD4_HCMVT/116-247................EVD....PA....ADPTVG...........DKAGHPE---GLCAQDG....-------.LY.L-
C3Y900_BRAFL/167-275................PEK....LT....VIGYLE...........DDA....---...........-------.VV.M-
C3Z365_BRAFL/157-265................PEK....LI....VIGYLQ...........DDA....---...........-------.VV.M-
B9VXL1_HCMVT/265-382................VLQ....VF....VVRAVP............VESQQR---LD.........-------.IS.I-
D3YRX5_HCMVO/17-135..................Y....LH....PFGFVE............GPGFMR---YQ.........-------.LI.V-
Q14VM9_RAHV1/5-123................SVN....FM....VVGRCA............HRSVQN---TRR........-------.PV.V-
D2K5D5_HCMV/214-331..................P....VM....PLGEIE...........GAEDKTF---FHR........-------.VR.I-
A8T728_HCMV/45-168..................P....LT....PLGYAV..ILLPEPRRDHHDGMVA---TP.........-------.YV.V-
D2K4G8_HCMV/126-245..................F....LL....PVGTVS...........RCEAIGR---PP.........-------.LP.V-
D2K595_HCMV/6-123..................Q....LR....VIGTIG............LANLFS---WDR........-------.SV.A-
C3RWK6_FRG3V/35-153................PTQ....ME....VLGTLE...........NCCGIPP---FPE........-------.CI.V-
C3RWV3_FRG3V/65-186................PTK....ME....VFGVLE...........SSKGMAP---FPQ........-------.WI.V-
C1C3V1_LITCT/15-136................PTK....MK....VLGIIE...........SSSGMLL---FPQ........-------.WI.V-
D2E8A7_ANHV1/5-121................PEK....MV....VLGAID...........HIDGEWI---CQ.........-------.VI.V-
Q070N0_CPRVZ/47-172................PQR....LA....VLGSIN....NILGTVNSIRQMEN---WQQ........-------.LV.I-
B5XAY6_SALSA/21-139................RME....MV....VIGALD...........DFRCSAA---GWQ........-------.LV.L-
B4YEM5_9ALPH/49-167................HVK....ME....IVGIVD...........DVPCLAT---GMQ........-------.LL.I-
B1NFI8_ADEGX/15-131................PKR....MT....VIGIVD...........NVISFAD---GLQ........-------.VV.I-
F5HIG2_HCMV/399-518................AGR....LY....FIGLVS...........VYECVPD---ANT........-------.APEI-
D3YRW4_HCMVO/69-190..................R....LA....FVGRFV............NEGVLS---PDQQKKT....-------.AV.C-
B9VXJ9_HCMVT/55-169................FRA....LH....LIGTVS...........HATCRYQ---...........-------....V-
C8CFJ9_HCMV/42-158..................R....LI....VLGKCV..........IMVEDHYE---ETE........-------.LV.L-
B9VXG6_HCMVT/274-510VTLPPQPYGAAGGSAVCVPNADTHA....VVGTDAAAAAAAAPTVMVGPTAMA---GPAASGTVPRA-------MLV.V-
Q4KS78_ISKNV/1-104................VVQ....ME....VVGIVE...........GLPCSDQ---MV.........-------....L-
C8CFJ8_HCMV/54-179..................T....LE....AVGVLA...........VRPPDSD---LTRNTKQAQEL-------PCV.L-
A8T729_HCMV/26-179................SLESLGVLQFSTTVLPRVHGPRSSSEDEDSDDDDFFV---YVEEIEPPSQA-------RLV.L-

PF14433

C3WDW2_FUSMR/11-172-----------------------YDLPFEEEDKEYELKQIPEE.....VRDKV---IPIVETG..WH-------IGGTL-
F0KCA1_CLOAE/2-150-----------------------IKSLNG.MLSRDCISEYEEE....YVEEKL---VVVGSL....N-------GNQYL-
C3BLQ7_9BACI/6-145-----------------------IG......VLDSSCFGLDDF.....IDDKV---IPIGSLY...D-------FGLDL-
F0KCA3_CLOAE/3-152-----------------------STCYEDMKYYYEHNANYDEK.....VGERT---IPVCKLY...Q-------GEYIV-
B1HSL5_LYSSC/5-144-----------------------EGLGD...LDRRHYKRYEVI.....IGEDL---VVIGTAF...R-------DNAVL-
C0Z7L3_BREBN/2-133-----------------------........DNCGSFKSEEKY.....AGESL---VPVGMID...S-------GYLVL-
B7N9G4_ECOLU/6-148-----------------------KAAGW..IDSKWITEVYEPL.....VNKRL---CPVGVGF...S-------EHMTY-
A8RVU3_CLOBW/13-150-----------------------........LVNGIKNHLEE......PISGI---CPAVSWR...R-------SNRLP-
A9B4M5_HERA2/3-169-----------------------LAPAFS.EATFWRSHAYVQL.....RNLQI---APIGRLSCPNR-------GVSSL-
C2M481_CAPGI/2-151-----------------------L.......PTREEMLYYES.D...AGVTKL---IPFGAIN...A-------DEILL-
A9B4M4_HERA2/9-180-----------------------AYSQH..ADYEAAPYWLNHPLI.ANYGRLL---CPIGSYD...V-------ENTIF-
A9B983_HERA2/9-180-----------------------EAFAI...DDEDFIVYWSSHPLVQLHGGGI---CPIGSYH...P-------WDTLL-
D1ALL2_SEBTE/5-152-----------------------DAAES...VFRMRVRDYEIH.....FNKNM---IPIAEVP...T-------EEMTV-
C2G2C6_9SPHI/5-144-----------------------IGKGH..YDSDGDFTYYSSI.....LGKQI---FNLGYFK...P-------DGYYI-
A9DRL2_9FLAO/4-142-----------------------LKAVP...RKRLKIKSYLQKPS.LEGNVLT---FPVGFYQN.AH-------FPYTV-
D7VVD7_9FLAO/4-136-----------------------........FLKNNVSANLP......FPGIY---YKVGYF...YP-------DHYMI-
D6B4A2_9ACTO/10-151-----------------------AAGS....GQRDLAAEVESV.....LGGDY---FPIGEW....L-------SYSSV-
C5UVJ4_CLOBO/2-147-----------------------KAIGDN.LDSEYFMEIFDEY....DIDDVV---YPIGIAN...R-------GNLLM-
A4A0B2_9PLAN/1-122-----------------------........ECIEECSEFEAH.....VDTQL---FPIGHCS...G-------CDFIY-
A2W0F4_9BURK/45-178-----------------------E.......HQDEQIAAWERA.....LDTTM---IGIAEDD...L-------GYVEF-
B7WUX3_COMTE/6-150-----------------------EACFTG.EDADDALLSWEQR.....LHTRL---IAVAEVH...H-------AHGQL-
C6DGM5_PECCP/1-142-----------------------KAILE...LYREQVESYEQI.....TQCPL---VPIGECD...N-------GYIIL-
B7M4P5_ECO8A/11-152-----------------------RASNR...IFIERVNDYIER.....AGYNM---IPVGECS...N-------GHITL-
C4GHT1_9NEIS/5-139-----------------------SEY.....CSREWFLEIANM.....VGENG---LVVGSTP...A-------..VFL-
D1A3E8_THECD/9-150-----------------------EGE.....KMRPYFQRVGRA.....AVGEL---YPIGSVA...G-------GHALL-
D9X9L6_STRVR/182-321-----------------------LAL.....WDAEIIDDLAEQ.....AGVDL---YPIGMRD...R-------GNQHL-
Q82G08_STRAW/7-151-----------------------IGYD....GDAGNIKELGAG.....LGVEL---FPVGYEA...S-------EFGIL-
B1VX82_STRGG/7-150-----------------------HLVFK...GDAEEIDELAGD.....LGVKL---FPVGYDT...Y-------DGSTI-
D6K3Y2_9ACTO/7-151-----------------------LMYR....GAAEDVQELADG.....LGKKV---FPIAHDT...Y-------DGGTF-
A4X261_SALTO/97-242-----------------------RTGG....VLADCSEIFAEE.....FNNPV---FPLGNNA...D-------GPSEL-
D6K3Y4_9ACTO/15-161-----------------------KAR.....FQLIKLDRLSAE.....LRVAL---FPVGVT....E-------NDSAL-
B1VX84_STRGG/1-149-----------------------EAR.....SALRPFMLLGES.....LGSRM---FPFGRT....D-------ADALL-
D9UTG4_STRS3/29-176-----------------------HGL.....HLARTLGDLGHA.....LGTHL---CPLGLDT...T-------THAAL-
C4RQ15_9ACTO/292-437-----------------------LVA.....HNADTLADFAAV.....LGVRL---FPIGTE....N-------QESIL-
A4X254_SALTO/6-153-----------------------LVG.....RSVGTLAELAAA.....IGAPL---TPIGEEG...D-------GVGIL-

PF09346

A0RE58_BACAH/19-133-----------------------D..IQK..................YIP.NS...LAI------GD..D....EGGMA.
C2T3B2_BACCE/8-142-----------------------Y..EEF.....EEDM.........LPT.S....LII------GD..D....PSSGL.
A4YB72_SHEPC/14-135-----------------------Y..EQY..................LP..GL...VAI------GS..D....GGGES.
A0A011W5W1_BACTI/32-156-----------------------L..NDSFKKERRPTK.........MPD.TY...LII------AD..L....NYGDS.
B1YF81_EXIS2/16-130-----------------------I..DLVRHNEKRPAG.........LPD.DL...ICI------GE..N....MTGDK.
A6FHD8_9GAMM/19-145-----------------------S..QLY.....EMSG.........MPK.GH...ILF------AS..D....CKGNM.
A4EPD0_9RHOB/35-163-----------------------Q..TLD...WCKIG..........MPE.SL...VAI------GS..D....SLGNL.
A0RAV0_BACAH/42-162-----------------------A..SKK..................NPD.SY...FVF------AD..SM...DLGTI.
B8I5J3_CLOCE/15-125-----------------------E..VPE..................YAE.GY...IAV------GS..N....GGGKF.
C3G559_BACTU/15-125-----------------------........................YAR.GY...VSI------GD..D....GGGNV.
A8FII6_BACP2/13-123-----------------------E..VHH..................YAN.GY...VAI------GD..D....GGGQV.
Q1DBU4_MYXXD/34-167-----------------------D..DPE.VEEAINQA..................LFF------QRADDD...AVDNF.
A5UV09_ROSS1/24-144-----------------------N..ILH.....RSDP.........FYN.DF...LVF------GQ.......GNMDY.
Q6HMR4_BACHK/23-143-----------------------G..FIDTNEIWYENE.........FQK.EY...LFF------GD.......SNIAW.
Q1CV91_HELPH/17-134-----------------------F..VDF.MQSLKEWL.........EPE.E....IVF------AN..D....GYGGY.
B1YEX8_EXIS2/15-147-----------------------F..VEN.TSVLNEWG.........LAG.KK...MIF------GE.......GEGSY.
A5TTY9_FUSNP/35-181-----------------------D..YND..EYDKVWH.............NK...LAF------YE..V....GNGDY.
Q47P53_THEFY/18-133-----------------------E..PDY.....RELY.........APFDNL...MFF------GD..S....DMGPQ.
A0JSM0_ARTS2/15-129-----------------------D..ADVSDSF..............MPFTGL...VFF------AD..A....GNGDQ.
Q82GY4_STRAW/63-178-----------------------S........FSELYM.........AFD.QL...LFF------SD.....IPGNGDL.
Q2BBP1_9BACI/47-165-----------------------S..DFM..................KPLDTF...LFF------SD..A....GNGDL.
Q65PK7_BACLD/18-132-----------------------T..DCF..................KPFDCL...LFI------AG..A....GNGDL.
C2T2Q4_BACCE/27-144-----------------------........................MPFDCL...LFF------AD..G....GNGDL.
A5UTX3_ROSS1/55-202-----------------------D..PDF.RDLHTLNY..................VAF------CD..A....HDGNY.
A6C6S9_9PLAN/31-128-----------------------D..SLQ..................YVQ.GF...ITF------HS..F....GNGDF.
A5FCA9_FLAJ1/44-161-----------------------D..FTE.....EDKL.........LLP.YL...ISF------SD..YL...GNGNM.
B7X333_COMTE/152-284-----------------------Q..QAQ.....ALKA.........KLS.EL...VVF------GD..YL...GNGNL.
Q4K6P0_PSEF5/56-173-----------------------D..VDL..................ALAGKL...VAF------GDYL.....GNGNL.
J8EZ11_BACCE/25-143-----------------------E..DIYEYTPNIDGV.........DDEESL...VFF------EV.......TELNF.
B8I223_CLOCE/15-131-----------------------D..LDG...VYDEES.............ML...IFF------EV.......NEGVY.
Q81BA7_BACCR/48-167-----------------------K..EHG..................FPN.KY...LVL------TE.......MTANA.
Q89MJ4_BRADU/28-170-----------------------V..QTR...QTPQWP.........TVD.EL...LWI------MS..D....HGGNP.
A3ZX28_9PLAN/24-139-----------------------T..NEVRQSVTDGVS.............DW...VIF------SE..D....HSGNP.
A0AMA9_LISW6/21-137-----------------------Y..GES..................VPR.ELRNSYVI------SD..D....GSGNP.
A5FMA4_FLAJ1/23-172-----------------------L..TEE.QTQKINEA.........FPCIGW...MMS------EEDIN....ESGEY.
D4Q174_LISMN/14-152-----------------------G..DTN.LENEVKLF.........WNA.H....LPI------MMSVG....GCYEY.
D6EFH2_STRLI/29-155-----------------------D..SGA...KDPDWP.........WPE.GV...LPI------SH..W....GCAMY.
Q3BQF4_XANC5/29-173-----------------------D..AFA...GLAAGG.........DDR.HL...IVI------AA.......DDRSPS
Q4UXL8_XANC8/219-365-----------------------Q...DF...S.SAAY.........LHA.GLDQVLVL------SS..H....NVDCL.
A5FJY1_FLAJ1/42-170-----------------------A..SED.NYFMIGSHL........SMG.DW...IGF------CT..TKQDTNNFDV.
Q1ZQF0_PHOAS/14-166-----------------------Y..YQE.FSNSDFVY.........SSE.GD...LPI------SR..V....ANGFV.
Q5WBD2_BACSK/23-138-----------------------F..TYD..YEIKQGG.........WKE.EL...IPF------YS..I....GNGDY.
A5FGR4_FLAJ1/41-198-----------------------I..SEE.DFEAELGR.........IFA.GI...LPL------GT.......EGCTY.
Q0RKI3_FRAAA/56-185-----------------------D..MLS..................LFR.RS...LVI------AS.......GEDFW.
Q9F3Q3_STRCO/47-179-----------------------Q..ERR.....EAGI.........WRR.GLQ..LDV------AS........DATY.
A6CDZ7_9PLAN/19-143-----------------------T..SVQ.LGRVNQGH.........LPP.TL...VPI------SD..D....GCGTT.
A6X425_OCHA4/20-140-----------------------V..TKQLREWKQIGA.........DRQ.SF...IPI------CD..D....GSGVY.
B3ZML8_BACCE/18-127-----------------------T..LEE...RQFEKA.........LTT.DY...IVI------EN..M....GSEGI.
A4VZJ4_STRS2/19-128-----------------------T..TLEARSLYEN...........FPK.EK...FIL------ED..L....HLDDM.
A1RNF3_SHESW/21-128-----------------------E..VTC...YAWSIG.........MPR.DM...IAI------CQ.......MGDDF.
Q0VNR5_ALCBS/21-130-----------------------........................LPR.YL...IPV------CE.......TPNGI.
Q7M7B0_PHOLL/25-133-----------------------L..SQALSDAREQG..........LPE.NL...LPI------CE.......DNGSY.
F3IRY6_PSESL/25-133-----------------------L..LNVVAE.AREQG.........VPK.SW...LPI------CE.......DNGNY.
A4Y9N5_SHEPC/8-116-----------------------K..YFQ..................LPS.EL...CPI------CE.......DNSDY.
A4SRI0_AERS4/8-116-----------------------ARIAWEIIG...............VSR.DL...LPF------IE.......DNGDY.
A0A016B5A2_BACFG/47-168-----------------------L..LEP.NIYEKPKN.........AKD.TY...FFI------GGYRY....DGSKL.
Q82RV7_STRAW/96-236-----------------------D..EGP.HTIGRPDD.........PMV.RY...LAF------AA..T....DRSGL.
A4FNW2_SACEN/30-166-----------------------S..CDY.YAGSAGSS.........FHP.AW...IPI------AG..D....GFADE.
A5FAZ7_FLAJ1/185-329-----------------------E..LDF.EKINTNNY.........TNP.KW...IPF------AT..G....RNGDY.
A3I618_9BACI/42-194-----------------------R..YQDFLEYVDIDKRINMH....VPLNER...LCF------ADCMN....NGGTS.
B4SN74_STRM5/28-184-----------------------D..EPEILGEGIDAD.........LPMNRR...LCF------SHCMN....NGGTS.
Q39NE9_BURS3/28-182-----------------------A..EIYGDDANDDGELVDSRIDIALPMNRR...LCF------SHCMN....NGGTS.
Q6HHY9_BACHK/33-185-----------------------D..EDVVDSKINPEG.........LLPGTY...IHF------SDCMN....NGGTS.
A5TXY3_FUSNP/37-189-----------------------D..REYEEVEIDEEIISD......SKKMKW...LHF------SDCMN....NGGTS.
A1RPC3_SHESW/26-168-----------------------E..VRD.PKIQSGW..........YQE.GW...LPF------AQ..F....GGGTL.
M2C2K9_TREDN/40-189-----------------------Y..FTN...EDIENMKDSRIKPYLFNK.KW...IPF------AE.......YCDSC.
H2K898_STRHJ/18-144-----------------------D..EDA.LVL..............WKP.SW...IPF------CS..F....NPDDTV
A6G0Q7_9DELT/31-170-----------------------WGDGRFDDGRLARTY.........WQP.QW...VPL------AQ..D....GCGNE.
Q9RYT7_DEIRA/27-166-----------------------H..NESSEALQPGW..........WNP.AW...IPL------DA..D....GGGNG.
Q93JL3_STRCO/163-310-----------------------A..VTAPDAAVQGLV.........GSP.GW...IAF------GD..N....GGGDR.
A1ZXR5_9BACT/30-166-----------------------W..YIKEKGAVKFKW.........WHK.GW...IPF------AE..D....NNGNL.
SMI1_CANGA/103-288-----------------------N..KFKLPYIPEQKSIPPETVLPLYAHAMW...IPV------LT..D....NAGNH.
Q59YV1_CANAL/104-343-----------------------T..KKRGMNIPKQRSIPPNFIRETFAHPMW...IPL------IT..D....GVGNY.
A5DZP7_LODEL/117-382-----------------------K..KHKTKKMPRQRAIPPGTIHETFAHPMW...IPM------VT..D....EVGNY.
SMI1_DEBHA/98-296-----------------------E..SAGSPNIPRQKSIPPGTIHDSFAHPMW...IPI------IT..D....EVGNC.
Q55KB3_CRYNB/120-282-----------------------M..ASVPPQWIKTVY.........ACK.GW...IPL------LS..D....RTGNY.
Q4PAY0_USTMA/184-339-----------------------M..ASCPHKWIRAEY.........SCR.GW...IPL------IT..D....HAGNY.
SMI2_DEBHA/142-319-----------------------Q..KSIPPNAIQPYY.........AHR.GW...IPF------LK..D....FCGNQ.
A1C9R6_ASPCL/143-317-----------------------Q..DSQPPGAVQKAY.........AHP.AW...IPL------AR..D....WGGNH.
SMI1_YARLI/171-356-----------------------Q..DSVPEGAVQLVY.........AHP.GW...IPL------AN..D....RAGNN.
A6EFN0_9SPHI/29-161-----------------------E..QSF.HNWTRGFS.........PGK.QL...FPF------LE..D....GAGNC.
O07689_LISSE/36-156-----------------------E..IEF.FTAPLVKI.........KVR.RL...LKI------AK..S....IDGED.
A3ZN04_9PLAN/36-149-----------------------I....V...F.A..............N.YWM.....------....Y....ADGDQ.
B1YF88_EXIS2/9-123-----------------------V..NST.....DAED.........YPD.GF...FRI------AA..D....GSGDE.
A7VFJ3_9CLOT/24-132-----------------------V..NDN.SR...............PSD.DY...IVI------GA..F....ASGDP.
A4X269_SALTO/103-245-----------------------L..VHA.QRVHRDPW.........LSP.DW...LVI------AN..L....GGGLL.
A1RND9_SHESW/4-129-----------------------T..ESC.QGF...GY.........FPE.SA...ITI------AG..N....GFGDQ.
A0PQE6_MYCUA/4-131-----------------------T...AS...S.KEWF........GFPV.NA...VAI------GA..N....GCGDR.
I0LI94_CORGK/4-116-----------------------D..IIRETESAREWDN........FPE.NA...IAI------AN..D....GTGDL.
Q0VKY9_ALCBS/4-130-----------------------I..LHETKIAREHYR.........LPE.NL...IVI------GN..N....GGGDV.
Q9F2N4_STRCO/160-298-----------------------D..LVY.VNKCLRDH.........LTK.DY...LGV------AF.......VQGGL.
A3KB11_9RHOB/18-152-----------------------L..ANG...KTFGDG.........TPQ.GF...API------GE.......DPGGL.
Q1DEQ7_MYXXD/33-153-----------------------T..ASL...........................YPL------VD..C....QDSDF.
Q1CY42_MYXXD/19-141-----------------------T..DKA..................GPS.SW...YAL------CD..V....RDSNY.
Q09D40_STIAD/24-149-----------------------V..AIFGKRKDDDQH.........GPA.SV...YAI------CD..V....QDGNF.
B1YEY9_EXIS2/39-159-----------------------D.......................YDH.YW....II------GE.......VNEGY.
Q5WJU2_BACSK/38-153-----------------------E..AQK..................YLDTKD...IPI------AF.......LLEEC.
A7Z7P3_BACA2/41-156-----------------------........................FLKPQF...IPV------AH..L....LDGCY.
J7JW73_BACIU/42-161-----------------------D..ING...........................IPI------GY.......LLEEC.
M1U9G8_BACIU/23-165-----------------------F..YGL.ANDHNSLQKAIDTYSDRFPR.NI...IPI------AS..S....AGGNE.
A7Z5R7_BACA2/23-158-----------------------Q.......................MPD.WI...IPI------AD..G....DGGDQ.
A3ZX25_9PLAN/22-154-----------------------D..LAG.ALNDFSER.........LPR.LV...IPI------ND..D....GAGNL.
A7VE32_9CLOT/35-145-----------------------E..YDH..................GPA......FPI------GG..L....GDGSI.
A7MRN6_CROS8/1-150-----------------------E..YNNEELFSELDF.........IDS.K....LII------GD..D....PGGNY.
B3Z4D7_BACCE/12-154-----------------------R..LTD.....DGDL.........LGV.AL...LPI------AV..L....FAGDF.
Q3IK24_PSEHT/8-124-----------------------I..SKD..................INQENF...IAV------AS..D....PFGNY.
A5Z4R3_9FIRM/12-152-----------------------E..FEY.GDIVDEDY.........ISE.EY...VPF------AR..T....SFGNL.
A5Z4R9_9FIRM/9-151-----------------------V..NYI...MKSEGL.........VPE.EC...LVF------AD..D....SAGNP.
A1ZMA9_9BACT/9-138-----------------------I.......................LPE.HL...LPI------GF..D....ELGNR.
A0A011UV81_BACTI/12-152-----------------------L..EEKLRSYNLMQV.........VPS.NF...LPI------GI..D....PAGSL.
C2SX01_BACCE/13-142-----------------------L..QTY...NSIKDR.........LVD.KV...YPF------AR..D....PFGNL.
A0A011VP76_BACTI/12-138-----------------------E..VVY.....ELTS.........LPE.GI...IPF------AR..D....PFGGL.
Q6HGG3_BACHK/12-159-----------------------Y..NGT..................LPS.AL...VPF------AF..D....PAGNL.
Q6HGE4_BACHK/13-160-----------------------K...YE...I.YKPT.........LPQ.KV...FPI------AI..D....PAGNL.
A0RAF8_BACAH/19-149-----------------------L..KNQ..................LPK.QI...VPF------MS..D....QFGNY.
A7FEI4_YERP3/10-144-----------------------A..CYD...L.YKKR.........IPQ.GF...VPI------AT..D....PGGNL.
Q21ED8_SACD2/11-151-----------------------E...AY...T.LADR.........VPK.NI...LPI------AE..D....PGGNI.
A6CCT7_9PLAN/22-151-----------------------N..ILD.YLSRPSEG.........MSS.EL...APF------AA..V....GNGNL.
Q6CS49_KLULA/64-193-----------------------Q..AYE.ILVENKYL.........VPR.DY...IPI------VI..D....GGGFP.
B1J8X4_PSEPW/139-260-----------------------D..FPQ..................MK..GR...VPF------AF..D....EGGNY.
A7ML24_CROS8/19-151-----------------------D..IFSISPADSEYGP........WHEKEF...IPF------AY..D....NGGNP.
A5FLI6_FLAJ1/11-131-----------------------D..FNN..................LNQ..M...IPF------AY..D....YGGNC.
A0A014N9J6_YERPE/11-153-----------------------E........MIRKNV.........IPS.NI...IPF------GN..D....WGGNF.
Q5LEK4_BACFN/167-306-----------------------D........IWSKNL.........MPC.NL...LPF------AM..D....SGGNY.
Q65VI9_MANSM/10-134-----------------------N........WCPNGF.........APQ.EL...LPF------AY..N....AVGGF.
B8I222_CLOCE/15-149-----------------------K.......................LLP.SWL..IPL------AD..E....AGGDL.
F6BM79_SINMB/32-167-----------------------R..YGG.EVYPSRGDGRQFLGTMVWSP.NW...LPL------FG..S....PRGDH.
Q28UU7_JANSC/42-166-----------------------M..IGY..DFPDSGF.........WER.HW...IPF------LD..N....GGGDY.
Q5LEK4_BACFN/11-139-----------------------D..SNYINILIFAIS.........WMG.ER...IAV------NI.......TNGAI.
Q5LEK9_BACFN/11-148-----------------------T..AEGETLELRKAG.........AISDSI...LIF------AMEST....DEGRI.
A7RYE8_NEMVE/119-257-----------------------L..NVASSGLQHRDG.........LRN.CLLISLCI------YT.......GNGQF.
G1S8C1_NOMLE/121-251-----------------------V..DTAAGGFQQRQG.........LKY.CLPLTFCI------HT.......GLSQY.
Q52KV8_XENLA/36-166-----------------------G...GF...Q.RRMG.........LNQ.CLP..ITF------CI.HT....GLSQY.
A0RFK3_BACAH/36-159-----------------------D..DDV...LKESGV.........VRQ.EL...LPI------AV..T....EFDKDL
Q9CND2_PASMU/14-158-----------------------I..FAQ.YLYDDEIY.........GYE.HV...YSF------GR..S....GCGDF.
A6DN67_9BACT/17-158-----------------------Y..FTR.SKFKKENL.........DPN.KI...LIF------YT.......DYDNF.
A9B016_HERA2/24-146-----------------------...QDLIAEGLIPW..........LDDRAI...IPF------TQ.......HAGYV.
Q5WC01_BACSK/21-135-----------------------S..TFF..................TTDKAF...LVF------YQ..V....EESVI.
A1ZUI6_9BACT/29-147-----------------------P..KGL...WNYENV.........IPK.DA...LIF------EG.FD....DCRKF.
Q47R76_THEFY/31-145-----------------------P..GLT...................TE.GR...FFF------YV.......HQGYA.
A8M704_SALAI/21-139-----------------------S..NLA..................RPK.DA...LVF------AM.......HQGYL.
H2GD97_CORD2/14-156-----------------------Y..GRF...LTEEYE.........IPD.EV...LLC------AISEA....GMHEY.
A1IPF3_NEIMA/1-117-----------------------E..ITG..................IP..NL...LPF------AR.......NQEWA.
A3I6Z7_9BACI/22-146-----------------------I..HRL.NLADEDWYKK.......YPN.RL...DLF------VS.......DADEL.
Q4KGS7_PSEF5/46-175-----------------------F...EG...GWRAWQDNVCADPAGFS..NL...LPF------AQ..F....GTGDY.
Q38V57_LACSS/13-131-----------------------A..TGS.QAVIEVAQ.........WPD.YL...IPF------SQ.......HGTQY.
A4BCB8_9GAMM/14-147-----------------------N..ILDTEYMTEEWG.........LPE.RQ...VLL------S........GAGHW.
A0R498_MYCS2/11-150-----------------------F..........EPRP.........SDA.EWL..VPF------....D....GDGHW.
A6VZI9_MARMS/37-168-----------------------S..SMS...SGREWG.........LPK.TY...VPL------EG.......DGHTW.
Q2BBP3_9BACI/17-145-----------------------D..SIY...LRQEWG.........IRS.KKL..III------SA.......EPPAF.
C2T7X0_BACCE/16-147-----------------------E..SRY...LIREWE.........MPE.NI...VLL------SG.......DGHTW.
A5TTM3_FUSNP/176-315-----------------------G..KFGHKFWIEKSK.........YPNIG....IAI------CGSVS....GGHDM.
A4X5D2_SALTO/28-164-----------------------G..ELGSAFWVAEWG.........YPDIG....IYI------ADCPS....AGHDM.
Q11VT9_CYTH3/29-168-----------------------G..SFGSRFMIDEWG.........YPDTG....IYV------CTCPS....AGHEM.
A1INP6_NEIMA/28-167-----------------------G..ETGQKLWMEEWE.........YPPIG....VYF------ANDPS....GGHAM.
H1GFW8_LISIO/124-264-----------------------G..MHNTNFWTEEWG.........YPDVG....LAI------ADCPS....AGHDM.
A8FAT3_BACP2/17-145-----------------------D..YLI.....EEWE.........LPE.GL...VLI------CG.......DGHTW.
B1KH37_SHEWM/28-163-----------------------Q..SPR..................ILP.ET...LII------AD..S....ISNDL.
B1KH38_SHEWM/29-165-----------------------M..ASEKEDKMQTSF.............NL...VVI------SS..S....ISHDE.
Q8GDM6_PHOLU/25-137-----------------------D..LVY.QNTIANNY.........LNE.GR...LVV------SN..T....DFGEE.
Q7N9I9_PHOLL/23-147-----------------------V..TKQ...ARDSGD.........IDE.GM...IKI------KS..S....GYGPS.
Q926X2_LISIN/25-149-----------------------D..VKFATEQARTFG.........DINKEM...IMI------KN..S....GYGSI.
Q5DWB0_CLOPF/25-151-----------------------E..SSN..................LPN.NL...IVI------YN..T....GYSEL.
B1KPX6_SHEWM/17-136-----------------------D..TLY...FQRDYD.........LPE.NL...IVI------QP.......DEDAP.
A7Z5G8_BACA2/23-137-----------------------T..TRE...YHEYRG.........LPS.GL...VVI------EH.......VDFFG.
B1ESH1_BACAN/4-119-----------------------V..VYHTKSYRETYN.........LPE.QY...IVL------ND.......IDGTM.
A7GQ33_BACCN/21-130-----------------------T..ERY.....RKLG.........LPE.NY...LVI------EN.......VDEFV.
A4IKF8_GEOTN/21-132-----------------------V..KAT.ERW.RKLG.........LDK.KL...IVI------ED.......SGEFV.
A3ZX34_9PLAN/23-143-----------------------V..YGD.TLLCREDYS........LPE.NL...VVI------YL.......GADDV.
B7KWA7_METC4/14-155-----------------------A..DAG..................LME.RA...CFF------GQ..T....ERGDF.
Q2SDZ5_HAHCH/28-140-----------------------F..AHL.....RAGR..................VLI------SE..N....SNGDF.
Q4K9A1_PSEF5/28-140-----------------------Q..INRAHPAITGRH..................LLF------SE..N....GCGDF.
Q633D5_BACCZ/17-131-----------------------E..VKE..................FAP.GV...TLF------GS.......DGGNV.
A5Z4Q5_9FIRM/17-131-----------------------E.......................FLP.GI...KYF------GS.......DGGDM.
A1TSU7_ACIAC/17-133-----------------------S..IKK..................YMSPLF...VGI------GT..N....GGGEC.
G7QG99_LEPII/16-123-----------------------Q..IKK..................YIP.EI...VSI------GT.......DGGEF.
Q5LEL2_BACFN/13-124-----------------------D........YGIQKY.........LQK.EY...WAF------GM..D....GDIGY.

PF14568

A0AMA9_LISW6/24-135-----------------------T--YGESVPRELRNS---------Y.........VI------SD--D----GSGNP-
A3I6Z7_9BACI/25-144-----------------------D--EDWYKKYPNRLD---------L.........FV------SD--A----DELYF-
A3ZX34_9PLAN/26-141-----------------------T--LLCREDYSLPEN---------LV........VI------YL--G----ADDVV-
A4IKF8_GEOTN/24-130-----------------------T--ERWRKL.GLDKK---------L.........IV------IE--D----SGEFV-
A4VZJ4_STRS2/22-126-----------------------E--NFPKEKFILEDL---------HLDDM.....LV------LA--D----STGKV-
A6CDZ7_9PLAN/22-141-----------------------Q--LGRVNQGHLPPT---------L...V.....PI------SD--D----GCGTT-
A6X425_OCHA4/23-138-----------------------T--KQLREWKQIGAD---------RQSFI.....PI------CD--D----GSGVY-
A7FEI4_YERP3/13-142-----------------------G--DKSDSIAACYDL---------YKKRIPQGFVPI------AT--D----PGGNL-
A7GQ33_BACCN/24-128-----------------------T--ERYRKL.GLPEN---------Y.........LV------IE--N----VDEFV-
A7Z5G8_BACA2/26-135-----------------------T--REYHEYRGLPSG---------L.........VV------IE--H----VDFFG-
A7ZAC8_BACA2/3-116-----------------------N--SVCREESMPDDL---------I.........VI------AD--N----GTGDK-
A8UFY5_9FLAO/12-126-----------------------V--EEVKDFFRLKKS---------F...LYPKLLSI------GT--L----EGGYL-
A9DRK0_9FLAO/13-128-----------------------L--EIAISLTEIYDF---------LPKAV.....NI------GG--F----FGGII-
A9INX3_BART1/38-152-----------------------K--DGFATPEQL...---------..........VV------SR--T----DFGET-
A9INY0_BART1/31-145-----------------------E--NGLATPQQL...---------..........VV------SR--T----DFGET-
A9INY3_BART1/35-149-----------------------K--YGFVTLEQL...---------..........VV------SR--T----DFGET-
A9INY6_BART1/35-148-----------------------K--RGFMTAEQL...---------..........FV------SS--T----DFDET-
A9INZ4_BART1/35-149-----------------------K--RGFTTPEQL...---------..........IV------CD--A----DFGET-
A0A011PWV5_BACAN/9-120-----------------------T--KSYRETYNLPEQ---------Y.........IV------LN--D----IDGTM-
B1BP25_CLOPF/31-145-----------------------E--EEVLGCGLDKGN---------YL........VI------SS--E----CDGSL-
B1KH37_SHEWM/31-161-----------------------D--SKNQSPRILPET---------L.........II------AD--S----ISNDL-
B1KPX6_SHEWM/20-134-----------------------T--LYFQRDYDLPEN---------L.........IV------IQ--P----DEDAP-
B3ZML8_BACCE/21-125-----------------------K--ALTTDYIVIENM---------GSEGI.....LI------LL--H----KDGMV-
B4AJF6_BACPU/18-123-----------------------Q--QYASGYV.....---------..........AI------GD--D----GGGRV-
B5ULT3_BACCE/26-136-----------------------T--IEFIYDYEMKEG---------FWKKELI...PF------YS--I----GNGDY-
B5UUA7_BACCE/17-130-----------------------N--VDMRDEYMPENL---------I.........II------GD--D----GSGDK-
B7INQ5_BACC2/11-140-----------------------C--YEEFEEDMLPTS---------L.........II------GD--D----PNSGL-
B7JLP8_BACC0/25-134-----------------------T--ESYRDL.GMSEN---------L.........VV------IE--N----IGEYA-
B8DA94_LISMH/28-135-----------------------S--SNNIMNGYV...---------..........VV------SN--T----DFGEE-
B8DD33_LISMH/29-148-----------------------.--..ARVLGDINEE---------LI........IV------KN--S----GYGSI-
B8DD37_LISMH/24-135-----------------------I--YGETISKELSES---------Y.........VV------SD--D----GSGNP-
C2KY92_9FIRM/22-126-----------------------N--AFPKKSFVLEDL---------AIDAK.....KI------VV--D----EDGKV-
C2M8M5_CAPGI/23-138-----------------------N--NLFQKDELA...---------..........FL------EM--D----EETYF-
C2PY06_BACCE/26-128-----------------------H--DRFKSF.NIPKG---------Y.........II------IE--H----CDEYS-
C2TZ07_BACCE/17-130-----------------------N--IELRDEYISEDL---------M.........II------GD--D----GSGDK-
C2ZR32_BACCE/17-130-----------------------N--IEMREEDIPENL---------I.........II------GD--D----GSGDK-
C3BVU2_9BACI/35-154-----------------------F--KKERRPTGMPDM---------YL........II------AD--L----NYGDT-
C3WVX7_FUSNU/23-127-----------------------E--FFPKKYFVIENI---------GVDRM.....LV------IS--D----EKGKI-
C4L6I6_EXISA/20-124-----------------------Q--GKLNGYIVLQNI---------GMEGI.....LI------VV--D----EQDRV-
C6ABU4_BARGA/31-145-----------------------K--NGLAKPQQL...---------..........VV------CT--N----DLDES-
C6ABU7_BARGA/31-144-----------------------R--DGFTDPKQL...---------..........VI------CT--T----DFGET-
C6AD58_BARGA/31-144-----------------------K--NGLAKPQRL...---------..........VV------SR--T----DFGET-
C6AD60_BARGA/31-146-----------------------K--HGFVTPEQL...---------..........AV------SR--T----DFGET-
C6AEU7_BARGA/31-145-----------------------K--NGFAKPNQL...---------..........AV------NR--T----DFGET-
C6CF14_DICZE/28-135-----------------------S--SDNVSIGKI...---------..........VL------SN--T----DFGEE-
C7GI90_9FIRM/31-150-----------------------.--..DREEYNLPKE---------WI........PI------YD--F----GDGNM-
C7N7K9_SLAHD/25-127-----------------------T--LEYRRY.GLPNN---------L.........IV------VE--N----CDEWV-
C8K547_LISMN/28-148-----------------------.--..ERKLVDMPKH---------LT........IL------LN--T----GMGEL-
D0KCB2_PECWW/28-147-----------------------.--..TRKLGDIDNG---------MV........QI------KS--S----GCGPV-
D0KCZ5_PECWW/26-145-----------------------.--..AREQGDISSS---------MI........KI------KS--S----GYGPS-
D1W447_9BACT/21-143-----------------------T--KQMRNEVNLSND---------L.........IV------LN--Y----EVGEY-
D3EC77_GEOS4/25-144-----------------------D--EEWREQYPHRLD---------L.........FV------PD--E----DELYF-
D3FRA3_BACPE/26-146-----------------------.--..ERRESNLPAN---------LL........VI------YD--T----GSDEL-
D3FRA5_BACPE/24-128-----------------------T--QQYREL.GLPKK---------Y.........IV------IE--N----VGEFV-
D3I7I1_9BACT/41-148-----------------------A--DDCY........---------..........II------SF--D----SSGNP-
D3I8Y5_9BACT/21-120-----------------------P--DFPKDMYVISNT---------YIDGI.....LL------VQ--D----TTGVI-
D4FV91_BACNB/25-133-----------------------T--EEYRTHYDLSDG---------I.........IV------IE--Y----VDEFS-
D4FXH9_BACNB/26-163-----------------------A--NDHDSLQKAIDT---------YSDRFPRNIIPI------AS--S----AGGNE-
D4FXI0_BACNB/26-142-----------------------K--Y...........---------..........LF------FG--D----SDTAW-
D4FXI1_BACNB/25-133-----------------------T--NEYKEHYGLTDG---------L.........VV------IE--D----VDYFA-
D5HHH7_9FIRM/25-128-----------------------T--LEFRSY.GLNDD---------K.........IV------IE--N----CDEWI-
D5SSH7_PLAL2/27-142-----------------------T--MLSRTDYGLPLN---------LI........VV------YL--G----SDDVV-
D6CWW7_9BACE/84-197-----------------------N--EELQEEILNKGY---------F.........AI------GR--Y----SDYGV-
D7JDE8_9BACT/35-142-----------------------N--DWL.........---------..........II------GT--D----YAGNP-
D7VC45_LACPN/26-146-----------------------.--..ERRVVKMPTN---------LV........MI------YN--T----EMGEI-
E1UUR3_BACAS/39-142-----------------------I--IEYNEVQDFPEG---------Y...V.....LI------GY--H----FDGRY-
E1UUR6_BACAS/25-133-----------------------T--NEYKKYYNLSDG---------L.........VV------IE--Y----VDEFS-
E2MKG2_PSEUB/45-159-----------------------K--NKSTTPEKL...---------..........VI------SK--T----DLGEV-
E3YTZ2_9LIST/29-148-----------------------.--..ARALGDINKE---------LI........MI------KN--S----GYGSV-
E3ZJV4_LISIV/35-139-----------------------T--ERLRKEFNLDNK---------M.........YI------VE--D----CDEFF-
E4LF31_9FIRM/27-134-----------------------Q--SNL.........---------..........II------GT--D----GWGNP-
E5W3S4_9BACI/29-137-----------------------T--KDYRELYDLPNH---------I.........VV------IV--D----VDAFA-
E5W3S5_9BACI/24-128-----------------------T--ERFRNF.GLPEK---------Y.........LV------IE--N----VDEFV-
E6UJN0_RUMA7/22-127-----------------------L--IEEHLLYVIEEA---------HIDGI.....VI------WQ--S----PSGEI-
E8K361_9STRE/11-132-----------------------E--NEYDNIYEILED---------LQDRLSDQLIPF------AE--D----GFGNL-
E9SF19_RUMAL/19-157-----------------------Y--KSMVNEKLIPPF---------F...F.....PI------GD--D----SGGDP-
F0RDN6_CELLC/80-198-----------------------Y--RNELNEKIELDN---------KEIKVDSLLCLM------SE--D----SNGGA-
Q0VKY9_ALCBS/7-128-----------------------T--KIAREHYRLPEN---------L...I.....VI------GN--N----GGGDV-
Q2SDZ5_HAHCH/31-138-----------------------V--............---------..........LI------SE--N----SNGDF-
Q4K9A1_PSEF5/31-138-----------------------L--............---------..........LF------SE--N----GCGDF-
Q4KGS7_PSEF5/49-173-----------------------R--AWQDNVCADPAG---------FSNLL.....PF------AQ--F----GTGDY-
Q5DWB0_CLOPF/28-149-----------------------.--..ERESSNLPNN---------LI........VI------YN--T----GYSEL-
Q5WIS2_BACSK/30-150-----------------------.--..ERKEIRLPDN---------LL........VI------YD--T----GSDEL-
Q7M7B0_PHOLL/28-131-----------------------A--LSDAREQGLPEN---------L.........LP------IC--E----DNGSY-
Q7N9I9_PHOLL/26-145-----------------------.--..ARDSGDIDEG---------MI........KI------KS--S----GYGPS-
Q8GDM6_PHOLU/28-135-----------------------A--NNYLNEGRL...---------..........VV------SN--T----DFGEE-

PF14567

A0KT76_SHESA/1-131--------------------------PEVTCYAWS.IG---------LPR-DL---IAI.-----CQ-------LGDDF-
Q0VNR5_ALCBS/1-133--------------------------PEMAANSWN.QG---------LPR-YL---IPV.-----CE-------TPNGI-
D4ZBL0_SHEVD/1-131--------------------------AEVTAYAWS.IG---------MSR-EY---VAI.-----CQ-------QGNSF-
A4SRI0_AERS4/1-119--------------------------FEMARIAWEIIG---------VSR-DL---LPF.-----IE-------DNGDY-
Q21KG4_SACD2/2-132--------------------------PEVAAEAWS.RG---------MPR-EM---IPL.-----CV-------DGDNV-
A6X428_OCHA4/5-137--------------------------LTTIQQARS.VG---------LPD-NW---LPI.-----CE-------DNGDY-
A8H7F8_SHEPA/1-132--------------------------SEVTSYAWS.IG---------LPR-EF---VPI.-----CQ-------QGDNF-
A0Y938_9GAMM/1-109--------------------------PEVAAMAWS.LG---------VSR-EL---IPV.-----CE-------YQGGY-
C1DFY0_AZOVD/1-133--------------------------PEVAAVAWD.QG---------MPR-DL---VPL.-----CQ-------VGDDY-
C4S745_YERBE/5-136--------------------------AQALRDAKE.QG---------LPE-GW---LPI.-----CE-------DNGSY-
B0KR80_PSEPG/1-133--------------------------PEVAATAWD.AG---------VPR-EL---IPL.-----CQ-------DGDNY-
Q2BMU0_NEPCE/1-131--------------------------PEMAATAWD.RG---------MPR-EF---IPI.-----CE-------HATGY-
B2C6T5_ACIBA/7-138--------------------------SQILNDARE.QG---------LPE-DW---LPI.-----CE-------DNGSY-
B8CKE3_SHEPW/1-119--------------------------YEALESARKFYD---------LPA-EL---LPI.-----CE-------DSSDY-
A0A030T0X2_PSEAI/1-131--------------------------PEVAATAWD.LG---------VPR-EL---IPL.-----CQ-------DDGSY-
Q086X2_SHEFN/1-131--------------------------PEVACYAWS.IG---------LPR-EQ---IAI.-----CQ-------IGDSF-
F3IRY6_PSESL/5-136--------------------------LNVVAEARE.QG---------VPK-SW---LPI.-----CE-------DNGNY-
B3PC71_CELJU/34-164--------------------------PEVTATAWS.LG---------VPR-YL---MPL.-----CE-------VNGNY-
D4RXT0_9FIRM/2-135--------------------------VEDTLRFRK.NG---------LEK-KY---IVI.-----EG-------DGELA-
A4Y9N5_SHEPC/1-119--------------------------FETLANARKYFQ---------LPS-EL---CPI.-----CE-------DNSDY-
Q12R95_SHEDO/1-131--------------------------PEVTCYAWS.IG---------LPR-EL---IAI.-----CQ-------QGDNF-
D0WEZ4_9ACTN/5-134--------------------------EETLEYRED..G---------LPD-SL---LVI.-----ES-------CDEWL-
A3QH89_SHELP/1-131--------------------------PEVTSYAWS.IG---------MPR-EY---IAI.-----CQ-------QGDDF-
C1D4A4_DEIDV/3-141--------------------------LDQTRDLRA.IG---------LPQ-FL---VPFE-----TS-------QDGDA-
A1S8W2_SHEAM/1-131--------------------------SEVAAYAWS.IG---------LPR-EM---IPI.-----CQ-------NGDNF-
Q7M7B0_PHOLL/5-136--------------------------SQALSDARE.QG---------LPE-NL---LPI.-----CE-------DNGSY-
D1W447_9BACT/1-147--------------------------VEVTKQMRNEVN---------LSN-DL---IVL.-----NY-------EVGEY-

PF07348

SYDP_KLEP7/6-179-----------------------MSGRFAGETLTLLQT---------WSEEDF---QRVQ.....EN-------LIGHL-
SYDP_COLP3/9-191-----------------------IEAQSDDGELSLLFA---------WNKDDF---ERLQ.....EN-------IIGHI-
I2B5Z7_SHIBC/5-178-----------------------MDATLEGKPLTLLQA---------WSEEDF---LRAE.....EN-------LIGHL-
R5V7K9_9FIRM/4-185-----------------------LDG........IIQT---------SRGEAE---LRLNGLTPYSN-------LGKHI-
SYDP_YERPE/6-179-----------------------MMADLGNHRFTLLQV---------WSEDDF---IRLQ.....EN-------LIGHL-
K7A551_9ALTE/8-182-----------------------LSAETNKGYLQLLQP---------WNQHDF---ERLQ.....QN-------LVGHI-
E0SCC1_DICD3/6-178-----------------------MTARFDDLECTLLQA---------WSEDDF---IRLQ.....EN-------LIGHL-
X2H3P8_9GAMM/9-173-----------------------MTAKLADIKLTLIQA---------WNDDDF---SNLE.....QN-------LIAHL-
D4ZHN4_SHEVD/5-186-----------------------LLFNCEWGQGELLQV---------WNQTDF---EYLQ.....QN-------IIGHL-
D8MW85_ERWBE/6-178-----------------------MTATFGGKACTLLQT---------WSEEDY---LRVQ.....EN-------LIGHL-
SYDP_CROS8/6-179-----------------------MAARYDDVALTLLQA---------WSQDDF---RRVQ.....EN-------LIGHL-
F5Z4L7_ALTSS/6-183-----------------------LPVAAEHGACELLQV---------WNEEDF---ERLQ.....QN-------LIGHL-
SYDP_SHEAM/4-180-----------------------LQFDSPWGEGELIQI---------WNEDDF---VLLQ.....QN-------ILGHL-
J7U684_MORMO/6-178-----------------------MQAVFEDIQLSLVQV---------WSEDDF---IRLQ.....EN-------LIGHL-
E1STK9_FERBD/4-172-----------------------LYFEAPFGRGELLQV---------WCDEDF---QFLQ.....EN-------LIGHL-
I0DWV2_PROSM/6-180-----------------------MKAQFEGHLLNLVQV---------WSEEDF---IRLQ.....EN-------LIGHL-
D5C956_ENTCC/6-179-----------------------MPARFGEVTLTLLQT---------WSEDDL---QRVQ.....EN-------LIGHL-
G9AL81_PANAN/6-179-----------------------MRATHDQIRLTLLQV---------WSEEDF---VRLQ.....EN-------LIGHL-
SYDP_IDILO/6-175-----------------------LALDYQGHTISLLQT---------QSAEDG---ERLL.....EN-------ITGHI-
C2X4F6_BACCE/19-188-----------------------LDGFIGDHYISLEAV---------LPNKEL---DSFK.....EK-------LEGYE-
SYDP_EDWI9/6-178-----------------------MRARWNEIEMDLVQV---------WSVEDL---HRLQ.....EN-------QIGHL-
M4UN22_9GAMM/6-180-----------------------IPCLFESHPIELIQV---------WNEEDF---QLLQ.....EN-------MIAHF-
H2IXL4_RAHAC/6-178-----------------------MTASWQGNALTLLQV---------WSEDDF---TRLQ.....EN-------LIGHL-
G4QLZ8_GLANF/9-186-----------------------LPASTDRGDLDILQA---------WNQDDF---ERLQ.....KN-------LISHV-
E6WGC7_PANSA/6-178-----------------------MTARFQQRDITLLQV---------WSEDDF---TRLQ.....EN-------LIGHL-
SYDP_ERWT9/6-179-----------------------MTGTLDGRPLSLVQV---------WSEDDF---IRVQ.....EN-------LIGHL-
SYDP_VIBCH/6-179-----------------------MPAQWRGRELTLLQV---------WSEDDF---TRLQ.....EN-------ILGHL-
SYDP_PHOLL/6-180-----------------------MTVTFEGQRLSLIQV---------WSEDDF---IRLQ.....EN-------LIGHL-
W0HTY4_9ENTR/12-183-----------------------MPAAFEGEPLELVQV---------WSESDF---VRVQ.....EN-------LIGHL-
C3AMX1_BACMY/7-177-----------------------LAGSYLEYNIELNSV---------IPGIEL---RDFY.....TF-------LQDYK-
B4F2E3_PROMH/5-178-----------------------MQVRFDSLNFTLLQI---------WSEEDF---IRLQ.....EN-------MIGHL-
SYDP_VIBF1/6-179-----------------------MTAKFEDMNIELLQV---------WSDEDL---ERLQ.....GN-------MLGHL-
SYDP_VIBSL/6-179-----------------------MNATFDGNELTLLQI---------WSDDDF---ECLQ.....EN-------ILGHL-
A8GIF5_SERP5/18-190-----------------------MSAQFGEHHVTLLQV---------WSEDDF---IRLQ.....EN-------LIGHL-
F7YLH7_VIBA7/10-183-----------------------MPAKWQGNELALLQV---------WSEDDF---VRLQ.....EN-------ILGHL-
SYDP_ALTMD/6-178-----------------------LKAKAPQGDCELLQV---------FNREDF---ERLQ.....QN-------LIGHL-
SYDP_SHELP/5-184-----------------------LMFESEFGEGELLQP---------WNQQDF---EYLQ.....QN-------LIGHL-
F0LVK8_VIBFN/6-179-----------------------MPARWRGRELTLLQV---------WSDADF---QRLQ.....EN-------ILGHL-
SYDP_HAHCH/7-185-----------------------LWCSSPFGEISLIQL---------WNEDDM---ETLR.....EN-------LLGHA-
SYDP_TOLAT/7-177-----------------------ITASFKGLAVTLVQP---------WNEEDF---ERLQ.....QN-------LVAHV-
SYDP_PECAS/6-179-----------------------MAAQFDSLSCQLLQV---------WSEEDF---TRMQ.....EN-------LIGHL-
SYDP_SHEON/4-180-----------------------VLFDSTWGTGELLQV---------WNEADF---DALQ.....QN-------IIGHL-
SYDP_PHOPR/6-179-----------------------MAAKFGEIELDLLQV---------FSEQDG---VRLQ.....EN-------ILGHL-
SYDP_AERHH/6-178-----------------------VPCLYKGLRLEFVLP---------WNEADL---DLLK.....EN-------LIGHL-
SYDP_SHEFN/4-180-----------------------LPFTASFGDGELLQA---------WNQDDF---ENLQ.....QN-------VIGHL-
D3VCK7_XENNA/6-179-----------------------MAASFEGQNLSLIQV---------WSEDDF---IRLQ.....EN-------IIGHL-
D3UWF0_XENBS/6-179-----------------------MTASFEGQNLSLIQV---------WSDDDF---IRLQ.....EN-------LIGHL-
SYDP_SHEPW/5-180-----------------------LMFDSQWGTGELLQA---------WSQSDF---EHLQ.....QN-------MIGHL-
R9VV65_9ENTR/6-179-----------------------MTARFGELTLTLLQT---------WSEDDF---VRMQ.....EN-------LIGHL-
SYDP_PSEA6/6-182-----------------------IVAQHPSGKLQILQA---------WNEEDF---ERLQ.....QN-------IVGHI-
SYDP_VIBPA/6-178-----------------------MDATWQTNPLTLLQV---------WSDDDF---VRLQ.....EN-------ILGHL-
SYDP_ECOLI/6-179-----------------------MHAQFGDIKLTLLQT---------WSEDDF---RRVQ.....EN-------LIGHL-
SYDP_SHEDO/4-180-----------------------LQFNSPWGEGELLLA---------WSLEDF---EYLQ.....QN-------IIGHL-
SYDP_VIBVY/6-179-----------------------MTATWEGNELTLLQV---------WNDDDF---TRLQ.....EN-------ILGHL-
C3AMX8_BACMY/4-175-----------------------LNGFYKNYYIELEAV---------LPNIEL---HSFK.....ER-------LKGYK-
H2FY10_OCESG/7-174-----------------------LPLCYKGLFITLLQP---------WHRDDF---ERLQ.....QN-------QIGHQ-
SYDP_PSYIN/6-180-----------------------LPAVYQDHPIELIQA---------WNDEDF---NLLQ.....EN-------MLAHF-
SYDP_PSEHT/6-178-----------------------IQASIDGHQVELLQV---------WNSDDF---DLLQ.....QN-------ITGHV-

PF14435

Q11UH8_CYTH3/2-179-----------------------M--GGYRICYVETEN---------E.....FNAVFM------NS-------SLDKL-
C3G535_BACTU/11-190-----------------------.--SKSQLVYIDYDN---------E.....NKVVLI------NS-------TIEKF-
C3BLX0_9BACI/3-181-----------------------.--RTNKVVYLHHDN---------N.....YEEIFI------NS-------SIHQF-
C3G534_BACTU/3-181-----------------------.--KQEKIVFLNNSD---------A.....YKEVFM------NS-------SIQQF-
D7C074_STRBB/3-186-----------------------.--ADYRIYWYEPGS---------SN....RKFALV------NT-------SLERF-
E0QLS9_9FIRM/4-167-----------------------.--KEGKVLLICNDE---------AYEVFQNRIVFV------NS-------SLELF-
A3IE36_9BACI/4-165-----------------------.--GSDELFTSSSVH---------H.....PLIYTL------NQ-------NLRTF-
D3GZ30_ECO44/1-160-----------------------.--KNKKVYYLYDID---------ECAN..FTMMYC------NS-------GINDF-
B7LQU5_ESCF3/2-167-----------------------.--KSRKIYHISNGK---------NDQCS.YSLIFC------NT-------NINHF-
B1VPR4_STRGG/6-176-----------------------.--RTGHVVQSGKSL---------......EHVVLV------NT-------NLERF-
C6PRK9_9CLOT/16-217-----------------------.--VTGEIYELEHEV---------IEE...VVTYFV------NS-------SFSKF-
B8CKE1_SHEPW/1-161-----------------------.--TSNEVFRLNN..---------......SNLDFV------AT-------NPALF-
A3ZNI5_9PLAN/58-240-----------------------.--ITGVVNRLDITA---------A.....PPQMFV------NS-------SVLQF-
D3E916_GEOS4/1-200-----------------------.--DTGGVWAVTEGG---------T.....QKPTYM------NA-------SIDSL-
E2N2L1_CAPSP/5-173-----------------------.--TKGNVYLLSTND---------DYTD..ASVVWV------NH-------SLDEF-
C0DUS3_EIKCO/1-171-----------------------.--ADDAVWLYSPRA---------KNAW.EQEWVLV------NS-------SLALF-
B5HAW8_STRPR/39-232-----------------------.--ETGRVWVLAEGV---------D.....PAKRFV------NS-------SMIDF-
E8RXJ9_MICSL/4-174-----------------------.--GTGAVILLDLET---------......PNLETV------NS-------TFAAF-
D1A3F0_THECD/3-170-----------------------.--DTGRVLLLDLGD---------Q.....VGLEPV------NS-------SLATF-
Q47PK6_THEFY/247-430-----------------------.--AEPDAGTVWAID---------MRS...GAARYI------NR-------SVADF-
E4NDB7_KITSK/233-420-----------------------.--AQGRVRAVDPDT---------......CEARYC------NA-------DLTAF-
C9YY18_STRSW/732-910-----------------------.--GTANIVAVPVEA---------GPGGAPVPPQFV------NT-------GLPEF-
B5HAJ0_STRPR/6-189-----------------------.--NTGVVYQFTDAI---------......KELIPV------HG-------DLSSL-
D6K842_9ACTO/6-208-----------------------.--ASGTVYALDPDE---------......ETVRGL------HT-------DVSSL-
B5I6T5_9ACTO/6-184-----------------------.--VSGVVYCLPGDE---------......SEIYPL------NK-------DLPSF-
E4N1Q1_KITSK/249-422-----------------------.--VTGRVHNVPDG.---------......EAPQLA------AT-------RIDAF-
D1A5L5_THECD/6-199-----------------------.--RTGAVYVVSEME---------YE....DEAALL------NS-------DITCL-
D6K293_9ACTO/144-316-----------------------.--ATGEVWLRTAQG---------......PALHPL------AK-------DVSTF-
D6KEF7_9ACTO/214-404-----------------------.--RTGALFYTEFQA---------......DHVVPV------NA-------DVSTL-
Q82D46_STRAW/203-389-----------------------.--ATGAVLCWSEPD---------......GMLRPL------NT-------DISTL-
D9WNF8_9ACTO/13-197-----------------------.--ALGDIDLYDPNG---------WDHG.RGYKGTV------AS-------SLPSL-
Q2U157_ASPOR/71-266-----------------------.--EHGHVFWYNGDC---------YDSL.GRDRGLV------AQ-------GLDSL-

PF02393

D2K3J3_HCMV/211-336--VV----------------------------A----YTGA--------VYAC.D.VRDD.-------------------
B8YE72_HCMV/157-296--LV----------------------------D----TFGV--------VYGY.D.PAMD.-------------------
A8T728_HCMV/200-332--LL----------------------------D----WFGA--------VYAIQMDDPNH.-------------------
D2K4S5_HCMV/202-333--LL----------------------------D----KFGV--------VYLH.K.IEDS.-------------------
D3YS52_HCMVO/180-322--IF----------------------------D----RFCR--------FYVV.I.VKSHL-------------------
D2K3X0_HCMV/202-332--LV----------------------------D----RACE--------FFYF.D.VSRR.-------------------
D2K5D0_HCMV/151-256--FV----------------------------D----DCMR--------VFAV.N...NQ.-------------------
C8BKJ5_HCMV/34-153--FM----------------------------T----PKWD--------VFAY.D...SG.-------------------
D2K5D0_HCMV/11-135--YL----------------------------G----ASGA--------MYLWTDHIYSD.-------------------
B9VXJ9_HCMVT/546-653--FM----------------------------D----AHGG--------IHVL.L..YGT.-------------------
B9VXD4_HCMVT/116-247--AL----------------------------G----AGFR--------VFVY.D.LANN.-------------------
C3Y900_BRAFL/167-275--VG----------------------------T----LSGK--------VYMD.K...DD.-------------------
C3Z365_BRAFL/157-265--VG----------------------------T----QSGK--------VYLD.K...DE.-------------------
B9VXL1_HCMVT/265-382--LV----------------------------N----ESGA--------VFGV.H.PETR.-------------------
D3YRX5_HCMVO/17-135--LI----------------------------G----QRGG--------VYCY.D.DLRD.-------------------
Q14VM9_RAHV1/5-123--LL----------------------------A----DSGR--------IYLY....YKH.-------------------
D2K5D5_HCMV/214-331--LC----------------------------G----DTGT--------VYAA.L.VGQD.-------------------
A8T728_HCMV/45-168--FM----------------------------G----RFSR--------VYAY.D.TREK.-------------------
D2K4G8_HCMV/126-245--LI----------------------------G----EGGR--------VYVY.S.PVVE.-------------------
D2K595_HCMV/6-123--GV----------------------------A----ADGS--------VLCY.EISREN.-------------------
C3RWK6_FRG3V/35-153--LV----------------------------G----EDQC--------VYAY....GDE.-------------------
C3RWV3_FRG3V/65-186--LV----------------------------G----EDGH--------VYGY.E...DE.-------------------
C1C3V1_LITCT/15-136--LV----------------------------A----KNGR--------VYGY.K...EE.-------------------
D2E8A7_ANHV1/5-121--LV----------------------------G----EGGC--------VYFV.D...AD.-------------------
Q070N0_CPRVZ/47-172--LV----------------------------S----EFGT--------VFAA.D...CQ.-------------------
B5XAY6_SALSA/21-139--LL----------------------------C----EDGN--------VYAY.E...FE.-------------------
B4YEM5_9ALPH/49-167--LV----------------------------A----EGGE--------VYAY.E...ED.-------------------
B1NFI8_ADEGX/15-131--LV----------------------------A----EDKT--------VYGY.E...ED.-------------------
F5HIG2_HCMV/399-518--WV----------------------------S----GHGH--------AFAY.L.PGED.-------------------
D3YRW4_HCMVO/69-190--LI----------------------------S----DEGY--------VFCY.V.REDT.-------------------
B9VXJ9_HCMVT/55-169--FV----------------------------D----AYGA--------VFAY.D.AQED.-------------------
C8CFJ9_HCMV/42-158--CM----------------------------G----GGTR--------LYIY.E.PSQE.-------------------
B9VXG6_HCMVT/274-510--VL----------------------------D----ELGA--------VFGY.C.PLDG.-------------------
Q4KS78_ISKNV/1-104--MT----------------------------C----GDSH--------VYVY.D...GD.-------------------
C8CFJ8_HCMV/54-179--ML----------------------------S----HYGT--------VYVY.D.WETD.-------------------
A8T729_HCMV/26-179--LL----------------------------G----RYET--------VWCL.D.RDRG.-------------------

PF14433

C3WDW2_FUSMR/11-172--WI----------------------------D....DKGK--------FYHTLYYRNDCM-------------------
F0KCA1_CLOAE/2-150--MI----------------------------S....ESGK--------MFTE........-------------------
C3BLQ7_9BACI/6-145--YI---------------