Sequence alignment for CL0526

PF02393

D2K3J3_HCMV/211-336------------------------------------------WSLGLD--------------------------------
B8YE72_HCMV/157-296------------------------------------------YRGDVE--------------------------------
A8T728_HCMV/200-332------------------------------------------NDTTPE--------------------------------
D2K4S5_HCMV/202-333------------------------------------------DPTDAA--------------------------------
D3YS52_HCMVO/180-322------------------------------------------HGHDAD--------------------------------
D2K3X0_HCMV/202-332------------------------------------------HDNSIS--------------------------------
D2K5D0_HCMV/151-256------------------------------------------GCMHIH--------------------------------
C8BKJ5_HCMV/34-153------------------------------------------SALGKV--------------------------------
D2K5D0_HCMV/11-135------------------------------------------LLDRWR--------------------------------
B9VXJ9_HCMVT/546-653------------------------------------------ILHDRT--------------------------------
B9VXD4_HCMVT/116-247------------------------------------------ANSTGR--------------------------------
C3Y900_BRAFL/167-275------------------------------------------AYKSPT--------------------------------
C3Z365_BRAFL/157-265------------------------------------------AYKSPK--------------------------------
B9VXL1_HCMVT/265-382------------------------------------------LARDLL--------------------------------
D3YRX5_HCMVO/17-135------------------------------------------RAGDFN--------------------------------
Q14VM9_RAHV1/5-123------------------------------------------SAKWRA--------------------------------
D2K5D5_HCMV/214-331------------------------------------------ACEDTA--------------------------------
A8T728_HCMV/45-168------------------------------------------FCLEPM--------------------------------
D2K4G8_HCMV/126-245------------------------------------------TADARK--------------------------------
D2K595_HCMV/6-123------------------------------------------APDGGL--------------------------------
C3RWK6_FRG3V/35-153------------------------------------------KPGDLA--------------------------------
C3RWV3_FRG3V/65-186------------------------------------------DPANLV--------------------------------
C1C3V1_LITCT/15-136------------------------------------------ADSHDL--------------------------------
D2E8A7_ANHV1/5-121------------------------------------------VQATFE--------------------------------
Q070N0_CPRVZ/47-172------------------------------------------PLAGPD--------------------------------
B5XAY6_SALSA/21-139------------------------------------------AVEFLG--------------------------------
B4YEM5_9ALPH/49-167------------------------------------------TIADLE--------------------------------
B1NFI8_ADEGX/15-131------------------------------------------YWGTLE--------------------------------
F5HIG2_HCMV/399-518------------------------------------------ERASGV--------------------------------
D3YRW4_HCMVO/69-190------------------------------------------AEFGLG--------------------------------
B9VXJ9_HCMVT/55-169------------------------------------------VRRDYE--------------------------------
C8CFJ9_HCMV/42-158------------------------------------------CQYSAD--------------------------------
B9VXG6_HCMVT/274-510------------------------------------------AEEATA--------------------------------
Q4KS78_ISKNV/1-104------------------------------------------......--------------------------------
C8CFJ8_HCMV/54-179------------------------------------------RQYDPP--------------------------------
A8T729_HCMV/26-179------------------------------------------CQDSRQ--------------------------------

PF14433

A9B4M4_HERA2/8-176------------------------------------------LSQLAE--------------------------------
A9B983_HERA2/8-176------------------------------------------LTDQTI--------------------------------
A9B4M5_HERA2/2-165------------------------------------------IESIIH--------------------------------
A6LWQ5_CLOB8/2-136------------------------------------------FEANVK--------------------------------
Q97CY9_CLOAB/2-136------------------------------------------LEERVK--------------------------------
Q97CZ0_CLOAB/1-146------------------------------------------MKEKTI--------------------------------
G8LY23_CLOCD/3-138------------------------------------------FSQSTK--------------------------------
C0Z7L3_BREBN/1-129------------------------------------------MSKETL--------------------------------
D1ALL2_SEBTE/4-148------------------------------------------FDKDIL--------------------------------
G8LVN3_CLOCD/3-139------------------------------------------KYEVAK--------------------------------
R7KV91_9FIRM/6-151------------------------------------------LSERAR--------------------------------
B1HSL5_LYSSC/4-140------------------------------------------LSIKTK--------------------------------
X2GUJ6_9BACI/4-141------------------------------------------FSEKTY--------------------------------
K9X3G6_9NOST/4-142------------------------------------------FSEETT--------------------------------
A4X261_SALTO/96-238------------------------------------------FPPDVR--------------------------------
F4F239_VERMA/96-237------------------------------------------FPPDVR--------------------------------
A4X254_SALTO/5-149------------------------------------------FPPLVT--------------------------------
F4F315_VERMA/5-149------------------------------------------FPSEVA--------------------------------
B1VUI9_STRGG/11-155------------------------------------------FPVAVD--------------------------------
G2NEF9_STREK/19-163------------------------------------------FPGPVE--------------------------------
B5GPR4_STRC2/10-154------------------------------------------FPVAVD--------------------------------
D6X5Y7_STRPR/10-154------------------------------------------FPVAVD--------------------------------
F2R7E3_STRVP/10-154------------------------------------------FPVNVD--------------------------------
V6JXA9_STRNV/9-153------------------------------------------FPVAVD--------------------------------
F8JWB4_STREN/11-156------------------------------------------FPVAVD--------------------------------
B5I7H7_9ACTN/11-155------------------------------------------FPVPVD--------------------------------
K4R8Z5_9ACTN/11-155------------------------------------------FPVPVD--------------------------------
H2JSV2_STRHJ/11-155------------------------------------------FPVPVD--------------------------------
V6K5C4_STRRC/24-168------------------------------------------FPVLVD--------------------------------
S5VNY2_STRCU/11-155------------------------------------------FPVPVD--------------------------------
Q9F2N2_STRCO/11-155------------------------------------------FPVPVD--------------------------------
C9YY15_STRSW/11-155------------------------------------------FAVAVD--------------------------------
Q82HF0_STRAW/11-155------------------------------------------FSVPVD--------------------------------
D7BTM5_STRBB/9-153------------------------------------------FSVPVD--------------------------------
G2PAB9_STRVO/37-181------------------------------------------FSVAVD--------------------------------
V4J1P0_9ACTN/10-159------------------------------------------FPITVD--------------------------------
F3ZHS7_9ACTN/28-172------------------------------------------FPDAAD--------------------------------
D9TC01_MICAI/257-399------------------------------------------FPDDVA--------------------------------
F4F5L1_VERMA/256-398------------------------------------------FPADVT--------------------------------
R4LXK7_9ACTN/252-397------------------------------------------FPDAVA--------------------------------
U5WFU2_9ACTN/252-397------------------------------------------FPDHVA--------------------------------
B1VX82_STRGG/6-147------------------------------------------TVEEVD--------------------------------
F2RCB0_STRVP/3-144------------------------------------------RDEAVS--------------------------------
Q82G08_STRAW/6-147------------------------------------------PTQEVL--------------------------------
D1A3E8_THECD/8-146------------------------------------------WPPEVT--------------------------------
F4FAN2_VERMA/7-145------------------------------------------FYRRTR--------------------------------
D0J054_COMT2/5-146------------------------------------------ESPVVI--------------------------------

PF14435

A7HBV7_ANADF/6-194------------------------------------------FAGRPL--------------------------------
B1VPR4_STRGG/19-175------------------------------------------IMSNES--------------------------------
B1VUJ2_STRGG/672-850------------------------------------------AVAEEL--------------------------------
B1VYJ1_STRGG/2-183------------------------------------------ATYDQL--------------------------------
B5H683_STRPR/212-402------------------------------------------LPKGLL--------------------------------
B5HAJ0_STRPR/5-188------------------------------------------VDLKSL--------------------------------
B5HAW8_STRPR/38-231------------------------------------------RGAHQV--------------------------------
B5HNY7_9ACTN/216-393------------------------------------------LPPRLL--------------------------------
B5I6T5_9ACTN/5-183------------------------------------------IDRETL--------------------------------
D1A3F0_THECD/2-169------------------------------------------ISHQEM--------------------------------
D1A5L5_THECD/5-198------------------------------------------LTREQL--------------------------------
D7C074_STRBB/2-188------------------------------------------VTHAEL--------------------------------
D9T329_MICAI/3-173------------------------------------------VTREQL--------------------------------
E2Q6I7_STRC2/663-841------------------------------------------ALAQEL--------------------------------
E4N1Q1_KITSK/248-421------------------------------------------LDRATA--------------------------------
E4NG11_KITSK/606-780------------------------------------------QLAAEL--------------------------------
F3ZHT0_9ACTN/605-784------------------------------------------EVAREL--------------------------------
F5XQA6_MICPN/2-160------------------------------------------IDAATA--------------------------------
F9GD57_FUSOF/7-186------------------------------------------LTRDML--------------------------------
G8WZI2_STREN/529-708------------------------------------------AIGQEL--------------------------------
H2JJX8_STRHJ/242-430------------------------------------------LTAARV--------------------------------
H2JNL8_STRHJ/197-379------------------------------------------VPARVL--------------------------------
H2JQV0_STRHJ/213-403------------------------------------------LPEGLL--------------------------------
H2K7D5_STRHJ/5-186------------------------------------------VTRSEL--------------------------------
I0H563_ACTM4/37-227------------------------------------------ILEGAL--------------------------------
I0H8Z2_ACTM4/10-174------------------------------------------PDFEAV--------------------------------
I0HE25_ACTM4/11-180------------------------------------------VDARDL--------------------------------
Q47PK6_THEFY/246-429------------------------------------------VLDQLL--------------------------------
Q82D46_STRAW/202-388------------------------------------------LPPRLL--------------------------------
Q9K3X2_STRCO/5-185------------------------------------------VSRGEL--------------------------------
Q9L1R9_STRCO/109-254------------------------------------------LPPRFL--------------------------------
S5VHB8_STRCU/197-386------------------------------------------VPARLL--------------------------------
S5YXS3_PARAH/2-168------------------------------------------ISEKLL--------------------------------
V6JYL3_STRNV/5-177------------------------------------------VTPDEV--------------------------------
V6K0N1_STRRC/197-380------------------------------------------VPARLL--------------------------------

PF09346

A0RE58_BACAH/19-133--------------------------------------------PTSK--------------------------------
Q81B84_BACCR/8-142--------------------------------------------KATE--------------------------------
A4YB72_SHEPC/14-135--------------------------------------------PAST--------------------------------
A0A0B5R2A8_BACTU/32-156--------------------------------------------GINL--------------------------------
B1YF81_EXIS2/16-130--------------------------------------------GVSA--------------------------------
A6FHD8_9GAMM/19-145--------------------------------------------PING--------------------------------
A4EPD0_9RHOB/35-163--------------------------------------------RVDP--------------------------------
A0RAV0_BACAH/42-162--------------------------------------------PLSK--------------------------------
B8I5J3_CLOCE/15-125--------------------------------------------AVNS--------------------------------
C3G559_BACTU/15-125--------------------------------------------AASD--------------------------------
Q1DBU4_MYXXD/34-167--------------------------------------------PVTA--------------------------------
A5UV09_ROSS1/24-144--------------------------------------------GCTR--------------------------------
Q6HMR4_BACHK/23-143--------------------------------------------PATD--------------------------------
Q1CV91_HELPH/17-134--------------------------------------------PLNE--------------------------------
A5TTY9_FUSNP/35-181--------------------------------------------PVKE--------------------------------
Q47P53_THEFY/18-133--------------------------------------------PAKE--------------------------------
A0JSM0_ARTS2/15-129--------------------------------------------PASA--------------------------------
Q82GY4_STRAW/63-178--------------------------------------------PVSD--------------------------------
Q81BW2_BACCR/27-144--------------------------------------------PATK--------------------------------
A5UTX3_ROSS1/55-202--------------------------------------------PALP--------------------------------
A6C6S9_9PLAN/31-128--------------------------------------------PLSA--------------------------------
A5FCA9_FLAJ1/44-161--------------------------------------------PVSK--------------------------------
B7X333_COMTE/152-284--------------------------------------------PFSL--------------------------------
Q4K6P0_PSEF5/56-173--------------------------------------------PVSE--------------------------------
Q63C14_BACCZ/25-143--------------------------------------------PLKS--------------------------------
Q81BA7_BACCR/48-167--------------------------------------------REDK--------------------------------
Q89MJ4_BRADU/28-170--------------------------------------------QPTL--------------------------------
A3ZX28_9PLAN/24-139--------------------------------------------VPTS--------------------------------
A0AMA9_LISW6/21-137--------------------------------------------PATS--------------------------------
A5FMA4_FLAJ1/23-172--------------------------------------------LASD--------------------------------
A0A0B8QYA4_LISMN/14-152--------------------------------------------NNWQ--------------------------------
Q9F2V0_STRCO/29-155--------------------------------------------PVDG--------------------------------
Q3BQF4_XANC5/29-173--------------------------------------------PATE--------------------------------
A5FJY1_FLAJ1/42-170--------------------------------------------NIST--------------------------------
Q1ZQF0_PHOAS/14-166--------------------------------------------KGKI--------------------------------
Q5WBD2_BACSK/23-138--------------------------------------------IPSV--------------------------------
A5FGR4_FLAJ1/41-198--------------------------------------------TAAV--------------------------------
Q0RKI3_FRAAA/56-185--------------------------------------------PAAE--------------------------------
Q9F3Q3_STRCO/47-179--------------------------------------------PADE--------------------------------
A6CDZ7_9PLAN/19-143--------------------------------------------PATD--------------------------------
B3ZML8_BACCE/18-127--------------------------------------------GVSS--------------------------------
A4Y3I6_SHEPC/21-128--------------------------------------------LPTF--------------------------------
A4Y9N5_SHEPC/8-116--------------------------------------------PPTD--------------------------------
A4SRI0_AERS4/8-116--------------------------------------------IPTD--------------------------------
Q5LEK2_BACFN/47-168--------------------------------------------TLNE--------------------------------
Q82RV7_STRAW/96-236--------------------------------------------PAPE--------------------------------
A4FNW2_SACEN/30-166--------------------------------------------PPDP--------------------------------
A5FAZ7_FLAJ1/185-329--------------------------------------------GIST--------------------------------
A3I618_9BACI/42-194--------------------------------------------GATD--------------------------------
B4SN74_STRM5/28-184--------------------------------------------GASA--------------------------------
Q39NE9_BURL3/28-182--------------------------------------------GATP--------------------------------
Q6HHY9_BACHK/33-185--------------------------------------------GATK--------------------------------
A5TXY3_FUSNP/37-189--------------------------------------------GASE--------------------------------
E6XGA7_SHEP2/26-168--------------------------------------------GLSN--------------------------------
Q73QC3_TREDE/40-189--------------------------------------------GASE--------------------------------
H2K898_STRHJ/18-144--------------------------------------------GASD--------------------------------
A6G0Q7_9DELT/31-170--------------------------------------------PATD--------------------------------
Q9RYT7_DEIRA/27-166--------------------------------------------GATA--------------------------------
Q93JL3_STRCO/163-310--------------------------------------------GATE--------------------------------
A1ZXR5_9BACT/30-166--------------------------------------------GAAK--------------------------------
SMI1_CANGA/103-288--------------------------------------------PCTA--------------------------------
Q59YV1_CANAL/104-343--------------------------------------------KCTD--------------------------------
A5DZP7_LODEL/117-382--------------------------------------------KCTS--------------------------------
SMI1_DEBHA/98-296--------------------------------------------PCTD--------------------------------
Q55KB3_CRYNB/120-282--------------------------------------------PVNP--------------------------------
SMI2_DEBHA/142-319--------------------------------------------GVTT--------------------------------
A1C9R6_ASPCL/143-317--------------------------------------------GCTQ--------------------------------
SMI1_YARLI/171-356--------------------------------------------PATA--------------------------------
A6EFN0_9SPHI/29-161--------------------------------------------PATL--------------------------------
O07689_LISSE/36-156--------------------------------------------GATD--------------------------------
A3ZN04_9PLAN/36-149--------------------------------------------GATA--------------------------------
A7VFJ3_9CLOT/24-132--------------------------------------------ETTE--------------------------------
A4X269_SALTO/103-245--------------------------------------------HLDE--------------------------------
E6XKF4_SHEP2/4-129--------------------------------------------DLSE--------------------------------
A0PQE6_MYCUA/4-131--------------------------------------------PVAE--------------------------------
Q8NRK2_CORGL/4-116--------------------------------------------PVTE--------------------------------
Q0VKY9_ALCBS/4-130--------------------------------------------PVDE--------------------------------
Q9F2N4_STRCO/160-298--------------------------------------------AVTE--------------------------------
A3KB11_9RHOB/18-152--------------------------------------------AALA--------------------------------
Q1DEQ7_MYXXD/33-153--------------------------------------------PVTA--------------------------------
Q1CY42_MYXXD/19-141--------------------------------------------PATP--------------------------------
Q09D40_STIAD/24-149--------------------------------------------PAHP--------------------------------
B1YEY9_EXIS2/39-159--------------------------------------------PVRS--------------------------------
Q5WJU2_BACSK/38-153--------------------------------------------PVTE--------------------------------
A7Z7P3_BACA2/41-156--------------------------------------------GATD--------------------------------
YOBM_BACSU/42-161--------------------------------------------KATL--------------------------------
A7Z5R7_BACA2/23-158--------------------------------------------INSH--------------------------------
A3ZX25_9PLAN/22-154--------------------------------------------PLSE--------------------------------
A7VE32_9CLOT/35-145--------------------------------------------PEPE--------------------------------
A7MRN6_CROS8/1-150--------------------------------------------MITE--------------------------------
B3Z4D7_BACCE/12-154--------------------------------------------LPSD--------------------------------
A5Z4R3_9FIRM/12-152--------------------------------------------KLTV--------------------------------
A5Z4R9_9FIRM/9-151--------------------------------------------KITK--------------------------------
A1ZMA9_9BACT/9-138--------------------------------------------TITQ--------------------------------
A0A0B5R450_BACTU/12-152--------------------------------------------PIGI--------------------------------
J7Z7X1_BACCE/12-138--------------------------------------------AIDE--------------------------------
Q6HGG3_BACHK/12-159--------------------------------------------PLLR--------------------------------
Q6HGE4_BACHK/13-160--------------------------------------------EVSE--------------------------------
A0RAF8_BACAH/19-149--------------------------------------------LGNE--------------------------------
A7FEI4_YERP3/10-144--------------------------------------------PADE--------------------------------
Q21ED8_SACD2/11-151--------------------------------------------AISE--------------------------------
A6CCT7_9PLAN/22-151--------------------------------------------KPTV--------------------------------
Q6CS49_KLULA/64-193--------------------------------------------PLND--------------------------------
B1J8X4_PSEPW/139-260--------------------------------------------AISC--------------------------------
A7ML24_CROS8/19-151--------------------------------------------KISN--------------------------------
A5FLI6_FLAJ1/11-131--------------------------------------------KLTI--------------------------------
Q7CL34_YERPE/11-153--------------------------------------------NIDL--------------------------------
Q5LEK4_BACFN/167-306--------------------------------------------PLTK--------------------------------
Q65VI9_MANSM/10-134--------------------------------------------PITA--------------------------------
B8I222_CLOCE/15-149--------------------------------------------KLSE--------------------------------
Q92KA2_RHIME/32-167--------------------------------------------GADC--------------------------------
Q28UU7_JANSC/42-166--------------------------------------------GVDE--------------------------------
Q5LEK4_BACFN/11-139--------------------------------------------SLTL--------------------------------
Q5LEK9_BACFN/11-148--------------------------------------------SLTL--------------------------------
A7RYE8_NEMVE/119-257--------------------------------------------GLTE--------------------------------
G1S8C1_NOMLE/121-251--------------------------------------------GARE--------------------------------
Q52KV8_XENLA/36-166--------------------------------------------GVLE--------------------------------
A0RFK3_BACAH/36-159--------------------------------------------GTSE--------------------------------
Q9CND2_PASMU/14-158--------------------------------------------MVSQ--------------------------------
A6DN67_9BACT/17-158--------------------------------------------IVTQ--------------------------------
A9B016_HERA2/24-146--------------------------------------------GVDE--------------------------------
Q5WC01_BACSK/21-135--------------------------------------------GIPE--------------------------------
A1ZUI6_9BACT/29-147--------------------------------------------GCTE--------------------------------
Q47R76_THEFY/31-145--------------------------------------------GCTP--------------------------------
A8M704_SALAI/21-139--------------------------------------------GLEP--------------------------------
Q6NG79_CORDI/14-156--------------------------------------------KCTA--------------------------------
Q7DD43_NEIMB/1-117--------------------------------------------MIKQ--------------------------------
A3I6Z7_9BACI/22-146--------------------------------------------NVKD--------------------------------
Q38V57_LACSS/13-131--------------------------------------------LIDP--------------------------------
A4BCB8_9GAMM/14-147--------------------------------------------ELTD--------------------------------
A0R498_MYCS2/11-150--------------------------------------------PLTD--------------------------------
A6VZI9_MARMS/37-168--------------------------------------------YSAE--------------------------------
Q2BBP3_9BACI/17-145--------------------------------------------ELHE--------------------------------
Q816C2_BACCR/16-147--------------------------------------------PIKD--------------------------------
A5TTM3_FUSNP/176-315--------------------------------------------TATD--------------------------------
A4X5D2_SALTO/28-164--------------------------------------------PLTD--------------------------------
Q11VT9_CYTH3/29-168--------------------------------------------TPTD--------------------------------
A1INP6_NEIMA/28-167--------------------------------------------PFTP--------------------------------
H1GFW8_LISIO/124-264--------------------------------------------YPTP--------------------------------
B1KH37_SHEWM/28-163--------------------------------------------CASD--------------------------------
B1KH38_SHEWM/29-165--------------------------------------------LSSN--------------------------------
Q8GDM6_PHOLU/25-137--------------------------------------------APSP--------------------------------
Q926X2_LISIN/25-149--------------------------------------------TGTP--------------------------------
Q5DWB0_CLOPF/25-151--------------------------------------------GASI--------------------------------
B1KPX6_SHEWM/17-136--------------------------------------------GASL--------------------------------
A7Z5G8_BACA2/23-137--------------------------------------------GIGE--------------------------------
A7GQ33_BACCN/21-130--------------------------------------------EISD--------------------------------
A4IKF8_GEOTN/21-132--------------------------------------------GASE--------------------------------
A3ZX34_9PLAN/23-143--------------------------------------------KASQ--------------------------------
B7KWA7_METC4/14-155--------------------------------------------TSSE--------------------------------
Q4K9A1_PSEF5/28-140--------------------------------------------LASQ--------------------------------
Q633D5_BACCZ/17-131--------------------------------------------PTSL--------------------------------
A5Z4Q5_9FIRM/17-131--------------------------------------------PATK--------------------------------
A1TSU7_ACIAC/17-133--------------------------------------------PADE--------------------------------
Q8F615_LEPIN/16-123--------------------------------------------GTNL--------------------------------
Q5LEL2_BACFN/13-124--------------------------------------------GASS--------------------------------

PF14568

Q7N9I9_PHOLL/26-145-----------------------------------------------I--------------------------------
G2TJC9_BACCO/28-148-----------------------------------------------N--------------------------------
V5XPU7_ENTMU/27-147-----------------------------------------------D--------------------------------
D3FRA3_BACPE/26-146-----------------------------------------------L--------------------------------
Q4KGS7_PSEF5/49-173-----------------------------------------------I--------------------------------
H6NAP1_9BACL/27-148-----------------------------------------------D--------------------------------
X2H814_9GAMM/28-135-----------------------------------------------N--------------------------------
A6X425_OCHA4/23-138-----------------------------------------------D--------------------------------
H8H3I1_DEIGI/15-142-----------------------------------------------Q--------------------------------
H1Y7D2_9SPHI/29-143-----------------------------------------------D--------------------------------
Q8DV31_STRMU/18-125-----------------------------------------------S--------------------------------
R5BF88_9FIRM/22-126-----------------------------------------------S--------------------------------
R4TCF2_AMYOR/45-152-----------------------------------------------E--------------------------------
B1HSL3_LYSSC/34-146-----------------------------------------------E--------------------------------
B8I223_CLOCE/18-129-----------------------------------------------E--------------------------------
B9T8U5_RICCO/20-128-----------------------------------------------A--------------------------------
B1YF88_EXIS2/12-121-----------------------------------------------E--------------------------------
D3EC76_GEOS4/35-147-----------------------------------------------Q--------------------------------
YOKK_BACSU/26-163-----------------------------------------------N--------------------------------
D1AMU4_SEBTE/16-153-----------------------------------------------N--------------------------------
D5DHK7_BACMD/19-130-----------------------------------------------R--------------------------------
D3V9F7_XENNA/31-140-----------------------------------------------K--------------------------------
F2F0G1_SOLSS/15-152-----------------------------------------------D--------------------------------
A8FII6_BACP2/16-121-----------------------------------------------D--------------------------------
F0RDN6_CELLC/80-198-----------------------------------------------E--------------------------------
L0DJE0_SINAD/14-143-----------------------------------------------E--------------------------------
D3FRA7_BACPE/19-130-----------------------------------------------K--------------------------------
C2X0Q7_BACCE/18-123-----------------------------------------------D--------------------------------
R5ZM16_9FIRM/11-125-----------------------------------------------I--------------------------------
W6EF85_SULMU/15-166-----------------------------------------------S--------------------------------
H8H3H9_DEIGI/15-154-----------------------------------------------T--------------------------------
D1AK41_SEBTE/28-142-----------------------------------------------E--------------------------------
B1HQ89_LYSSC/39-149-----------------------------------------------E--------------------------------
D1BM01_VEIPT/30-141-----------------------------------------------E--------------------------------
Q2SDZ5_HAHCH/31-138-----------------------------------------------Q--------------------------------
A9C331_DELAS/17-129-----------------------------------------------L--------------------------------
D1BM10_VEIPT/30-159-----------------------------------------------D--------------------------------
YNAB_BACSU/14-117-----------------------------------------------P--------------------------------
Q65PK7_BACLD/21-130-----------------------------------------------T--------------------------------
E3EFQ0_PAEPS/15-152-----------------------------------------------D--------------------------------
E3E4D6_PAEPS/30-142-----------------------------------------------E--------------------------------
C3AIQ8_BACMY/23-155-----------------------------------------------D--------------------------------
D1AI41_SEBTE/179-313-----------------------------------------------D--------------------------------
D5DG34_BACMD/42-148-----------------------------------------------K--------------------------------
G8LVX3_CLOCD/46-166-----------------------------------------------E--------------------------------
D7C627_STRBB/27-150-----------------------------------------------R--------------------------------
B1HSJ7_LYSSC/16-121-----------------------------------------------E--------------------------------
E6UH30_RUMA7/13-149-----------------------------------------------E--------------------------------
W0EAP9_9FIRM/31-139-----------------------------------------------D--------------------------------
C7PR05_CHIPD/29-163-----------------------------------------------D--------------------------------
F2IDG4_FLUTR/12-130-----------------------------------------------E--------------------------------
Q8A449_BACTN/32-166-----------------------------------------------E--------------------------------
X5DYB7_9CORY/26-162-----------------------------------------------E--------------------------------
Q81H93_BACCR/16-140-----------------------------------------------D--------------------------------
K9VSA2_9CYAN/26-156-----------------------------------------------E--------------------------------
A5FC92_FLAJ1/15-125-----------------------------------------------K--------------------------------
M5E8L2_9GAMM/13-128-----------------------------------------------E--------------------------------
R6VPC4_9FIRM/166-289-----------------------------------------------E--------------------------------
X2GNV0_9BACI/171-305-----------------------------------------------D--------------------------------
C5ANN1_BURGB/12-131-----------------------------------------------D--------------------------------
C3AJS9_BACMY/32-166-----------------------------------------------D--------------------------------
YXXD_BACSU/19-130-----------------------------------------------Q--------------------------------
R6UAS7_9CLOT/11-122-----------------------------------------------E--------------------------------
E6TT52_BACCJ/18-135-----------------------------------------------E--------------------------------
Q81XQ3_BACAN/19-145-----------------------------------------------D--------------------------------
Q3IK24_PSEHT/11-122-----------------------------------------------I--------------------------------
H6NG08_9BACL/105-217-----------------------------------------------E--------------------------------
A8FAT3_BACP2/20-143-----------------------------------------------E--------------------------------
C3AMY1_BACMY/25-162-----------------------------------------------D--------------------------------
C3AU00_BACMY/12-136-----------------------------------------------L--------------------------------
D3FZU7_BACPE/33-153-----------------------------------------------E--------------------------------
E6UJV2_RUMA7/27-143-----------------------------------------------E--------------------------------
F4AXJ4_DOKS4/15-148-----------------------------------------------N--------------------------------
B1YEX8_EXIS2/18-145-----------------------------------------------K--------------------------------
C3ATZ9_BACMY/28-146-----------------------------------------------E--------------------------------
C3ATZ8_BACMY/15-152-----------------------------------------------E--------------------------------
Q9X366_BACAN/16-140-----------------------------------------------D--------------------------------
C2X3A0_BACCE/19-143-----------------------------------------------D--------------------------------
K9ZKW6_ANACC/21-135-----------------------------------------------D--------------------------------
F0SMF1_RUBBR/22-135-----------------------------------------------E--------------------------------
R5LQ27_9SPIR/14-127-----------------------------------------------N--------------------------------
F3ZZP4_MAHA5/26-131-----------------------------------------------Q--------------------------------
U5L8D3_9BACI/50-163-----------------------------------------------E--------------------------------

PF14567

Q81B94_BACCR/6-143---IANLLDSMLDK..........------------..ELEDLDSPSD--------------------------------
C7N7K9_SLAHD/5-132---IKELISKYEDE...GFFTRV.------------........PPTP--------------------------------
K4KKC1_SIMAS/1-134---MEEILEQLQAA.........A------------QSSAWGLEKPEH--------------------------------
Q0VNR5_ALCBS/1-133---MDDIVDMLRER.........H------------DGGLIALELPDE--------------------------------
D4ZBL0_SHEVD/1-131---MHEIIEQLQEL.........S------------ETVPIPLELPTF--------------------------------
Q21KG4_SACD2/2-132---INEIAEMLAAR.........S------------LKTAYPLELPTM--------------------------------
A6X428_OCHA4/5-137---IASIIEEINRI.........D------------DPTGRKLTLPDD--------------------------------
Q81Q97_BACAN/1-122---MNNAVDQANKG..........------------............--------------------------------
S6B2A8_PSERE/1-133---MEEVIEQLREL.........N------------EPVPVPLELPDE--------------------------------
YOBK_BACSU/6-138---VENFINENKQN...AIFTE..------------........GASH--------------------------------
F2K758_PSEBN/1-133---MEEIIEQLREA.........N------------EPVPVPLELPDE--------------------------------
Q880E4_PSESM/5-136---IRDVVAELKSV.........R------------MSLPNAQRLPDD--------------------------------
X2GZW0_9GAMM/4-146---IKNLVTRLNHG......AQDE------------VYWLG...ACDE--------------------------------
U5MVI7_CLOSA/6-138---IEKFINENEED...AFFTG..------------........GIDY--------------------------------
Q5WIS2_BACSK/1-155---MEMSVETYQKA...KEIILDE------------EEIADFVGGRTE--------------------------------
Q8EAQ0_SHEON/1-131---MHDIIEQLQER.........S------------ETVPVPLELPTF--------------------------------
B8CQS9_SHEPW/1-121---M...................S------------ETVPVPLELATF--------------------------------
I0GP53_SELRL/13-146---IKKIIERNKEE...VLFISG.------------........GLSD--------------------------------
B3PC71_CELJU/34-164---MEDVIELLREY.........N------------EPVPVPLDLPDE--------------------------------
D3FRA5_BACPE/5-133---IEEMINEYIED...GDFIG..------------........KVSD--------------------------------
M4X311_PSEDE/1-131---MEDVIELLREA.........N------------EPVPVPLELPDE--------------------------------
Q12R95_SHEDO/1-131---MHELIEQLQAL.........N------------EPVPVPLELASF--------------------------------
D5HHH7_9FIRM/5-133---IVKIISQYEEK...GDFTHP.------------........NVDD--------------------------------
D5SSH7_PLAL2/5-147---IKLLIEKLKDA......GSD.------------IYWLG...NASR--------------------------------
N0B2R8_9BACI/1-137---MNDVINLIETS...KP.....------------........RVTD--------------------------------
G8M281_CLOCD/7-139---ILRLIQDYGEE...DDFTG..------------........GSNS--------------------------------
G2Z5P5_FLABF/2-145---TEELLKKLSNY...IIPNESI------------NLAGM...PAND--------------------------------
A3QH89_SHELP/1-131---MHDLIEQLREL.........S------------ETVPVPLELPSF--------------------------------
R6FTE9_9CLOT/5-133---IIDMIKRYGEE...NDFYG..------------........KISE--------------------------------
R5TPA4_9FIRM/24-155---ELKFIIQQNQAIFGNAFLGK.------------........RATD--------------------------------
Q086X2_SHEFN/1-131---MNDIIEQLQEL.........S------------ETVPVPLELPTF--------------------------------
C1D4A4_DEIDV/3-141---QEELFKRLRAG.........G------------VPAPLIPKLPDD--------------------------------
D3FZM0_BACPE/6-143---IANLLDGILDK..........------------..ELGNLDTPLA--------------------------------
A1S8W2_SHEAM/1-131---MHELIEQLQEM.........S------------EQVPVPLELPSF--------------------------------
Q7M7B0_PHOLL/5-136---LNDVIEEIERL.........S------------DGQRNDVDLPDD--------------------------------

PF07348

SYDP_KLEP7/6-179AEALRAFTQRYCAVWQQQRHSLPR..SEELYG....VPSPCVVDTQGE..........AVFWQPQP.........FSLA.
SYDP_COLP3/9-191TQAILNFSKSYSQQHVEQFGHLPT..VEHDEQ....WPSPCDLGSHDT.........SHHYWQAVAMESVQLADNKEEA.
I2B5Z7_SHIBC/5-178RSALAAFTRQYCQRWQEQFGHGPQ..SSELAG....IPSPCIVSAGED..........QVEWQPVA.........CEPA.
R5V7K9_9FIRM/4-185KKAFEKFFEEMTQNYLNEWGVPPR..VPYTEK....NPTGLFLPETLN.......DKGYAQWKPKL.........QEKP.
SYDP_YERPE/6-179STALRSFTQRYIDLWQQQTGHLPA..SKELYG....VPSPCIVETGED..........QVFWQPQA.........FLPE.
K7A551_9ALTE/8-182TAALGEFVKKYLI.AAKKHPEMLM..AEYDNE....WPSDCYTASGNT........GDSVTWQPVK.........RSGE.
E0SCC1_DICD3/6-178SQALNAFTQRYVELWQRETGHPPA..SDELYG....VASPCIVATQDS..........RVHWLPRA.........QSVA.
X2H3P8_9GAMM/9-173...LIKFTTR....WLNQFDYAPQ..SEELHA....IPSPCILKTEQL..........TVFWQPFT.........LQPP.
D4ZHN4_SHEVD/5-186.PALDNLFKIYQLAYFEKLGELPR..Y.YPRG....EGSTCIEGEYEPSNYHESDEEVSVCWKPVT.........RPEP.
D8MW85_ERWBE/6-178SRALTEFTQKYCDEWDRVCGHPPA..SVELLG....VPSPCVQQTGAD..........ELYWLPQP.........FTLA.
SYDP_CROS8/6-179QQALAAFSARYCEAWRQQRGSLPV..SEEYIG....ISSPCIVSTHPD..........AVEWEPQP.........FTPE.
F5Z4L7_ALTSS/6-183SNELTQLIGAFTS.HHERSGSLLT..IPYDSQ....WPSPCYLKQGDE........GELVPWEPKR.....QSDSQQSA.
SYDP_SHEAM/4-180LAALTKFHEIYKAAFVERLGELPR..C.FTHG....RPSPCLADDALA......GSEEPQPWQMVP.........RREV.
J7U684_MORMO/6-178SQALHQFTRHYVGLWQEKTGLPPI..SHDLYG....IPSPCIIRTGDE..........CVYWEPAE.........FTAD.
E1STK9_FERBD/4-172.EALDAFHQRYFTSWQQALGQHPV..SDKPES......GPAETGRDAE.........GRALWQARR.........RETV.
I0DWV2_PROSM/6-180SEALTQFTQQYVTKWKEQTGLSPA..SCDLYG....IPSPCVIRTGEN..........WVYWEPQA.........FPIAD
SYDP_IDILO/6-175.ESIDALMTRYKE.......NVPVRYTEYVEE....WNSPIYGTVIDE.........NTVEWTPCR.........QPEA.
C2X4F6_BACCE/19-188KNAMSTYFKLRKEYFDRGLNFLFK..TPYNEK....VDFVIYQGEIEE.........DEISWKPVE.........KYIE.
SYDP_EDWI9/6-178SAALREFTQRYVAQWQQQHGDWPS..SHALYG....IPSPCVVYSRDD..........CVFWRPEP.........GR.G.
M4UN22_9GAMM/6-180QTELLSVFSRYASLFQTEKESYPL..QPVDKD....WLSPCLFGDEVQ.........GEKQWKSVV.........RTAP.
H2IXL4_RAHAC/6-178SVALREFTQRYVDLWQEETGMPPA..SEALVG....VDSPCVVKTEED..........KVFWLTQT.........FIPE.
G4QLZ8_GLANF/9-186...FDTLVNAYID.LAGDDDRQLL..TEYDVD....WFSPCLLLNKTR..LADVADGEQTSWRPQL.........QPAS.
E6WGC7_PANSA/6-178.DALRDFTARYCDEWQQRTGHLPA..SSDLHG....VPSPCIQTTLDD..........RVLWQPQP.........FTLP.
SYDP_ERWT9/6-179SQALRDFSQRYCDLWQQKSGHAPA..SQELYG....IPSPCVMATDED..........EVWWQPRP.........FTLA.
SYDP_VIBCH/6-179VQALSAFSQRFLQHCAQQTGQLPE..NDELLG....LASPCVVEELTD..........VVRWRPVN.........REVW.
SYDP_PHOLL/6-180TEALSNFTRCYVDLWQKETGAPPA..SRELYG....VPSPCITQTGDN..........IVYWLPQP.........FPLE.
W0HTY4_9ENTR/12-183..ALADFTARYVEYWRQTTGGLPV..SHGVSD....IPSPCVVGGDGD..........AVYWQPRP.........AAPD.
B4F2E3_PROMH/5-178STELKQLTQNYVDLWQQESGFPPA..SHELYG....VPSPCISRTGDN..........VVYWLPQP.........FTGR.
SYDP_VIBF1/6-179EQALANFSQRYVEAWKAQHDCLPI..NEELVG....LASPCIEETRDL..........EISWQPIV.........RDEA.
SYDP_VIBTL/6-179QDALLSFSQRYVDAWQQQHQSLPR..NEELVD....IVSPCVEEKSGD..........AVLWKHYP.........REQF.
A8GIF5_SERP5/18-190.HALREFTQRYVDLWQQERGHAPA..SQDLYG....VPSPCLVENRDD..........EVLWLPQP.........FTPA.
F7YLH7_VIBA7/10-183EQALLSFTQRYLDAYQTKHGESPR..NDELAE....LDSPCAVMNDQD..........SVLWKPVV.........RSVA.
SYDP_ALTMD/6-178SAQLDKFVSSYVE...HAKGEGLK..IAFDSE....WPSPCYEETAKD........GELVEWAPKR.........QSPP.
SYDP_SHELP/5-184.PALDQFFTLYHQAYSDKLGESPR..Y.FPLG....EASPCVLECDQE..KVDASPERSVQWQAVK.........RDSQ.
F0LVK8_VIBFN/6-179VEALFSFSQRYLDAVQHAHQQLPY..NDELID....WPSPCVVEALED..........RVFWQPVP.........RTPA.
SYDP_HAHCH/7-185TARLSELTNTFIERHHSSSRQRPC..IPLNEDTRYMLDSPCVEHVDEE........AGVFYWTPRP.........HMDF.
SYDP_TOLAT/7-177.CALSDVFARWFA.YQQQRGIQVC..CPEDEL....RPSPCRYDAQHP...........ERWKPWS.........RPEM.
SYDP_PECAS/6-179VSALAAFTQRYVACWQQEKGHLPA..SEALYG....IPSPCIVENHED..........TVYWSPQP.........FAPS.
SYDP_SHEON/4-180LPALDKFLQNYHQSYLSTLGELPR..Y.YPRG....ESSLCIQGEFVE......ASTEAVGWLPVK.........REQP.
SYDP_PHOPR/6-179AVALSDFSSLFLQAWRDTGHGFPR..SEDLVG....LESPCVEHDSGD..........EVTWKPIT.........RQPQ.
SYDP_AERHH/6-178LSALEHFFLRWQRDGEARRG.LPL..CEWEAD....WRSPCELDEPKE.........GRVAWRPHR.........RAEP.
SYDP_SHEFN/4-180SSALDCFIKNYLKSYQDTLSEFPR..Y.YPLG....EDSICIQGTFNA......DTDDTVFWQPVK.........RDNV.
D3VCK7_XENNA/6-179TEALSDFTRRYVELWYEKTGFPPV..SCDLYG....IPSPCIERTGDE..........LVYWVSRP.........FSIQ.
D3UWF0_XENBS/6-179TEALSDFTRRYVELWQEETGLPPV..SSDLYG....VPSSCIERTGDG..........VVYWLPKL.........FSVH.
SYDP_PSEA6/6-182NQSLDDFMGRFAA.FVKEHAEAGA..IEYDED....WPSPCYATDVTP......ESGTSIPWKPVL.........REQT.
SYDP_VIBPA/6-178TQALQDFSLRYQQAWQNKHNELPR..NEELAD....LVSPCVEEKCDG..........AVLWKAFP.........REEM.
SYDP_ECOLI/6-179AQALKDFTARYCDAWHEEHKSWPL..SEELYG....VPSPCIISTTED..........AVYWQPQP.........FTGE.
SYDP_SHEDO/4-180SSALEKFINSYLNSYQNALSELPR..Y.YPMG....VASPCIAQTFDE......QSEDAVFWQPVK.........REPA.
SYDP_VIBVY/6-179SLALADFSQRFQAAWQAQHNALPS..SEELAD....LPSPCVVESKGD..........EVLWRSVS.........LSAP.
H2FY10_OCESG/7-174.TALSELFDRYRRLYGQ.....PL..AEHDPE....QSSPAELLPAHQ.........GRVGWRPFL.........RTEP.
SYDP_PSYIN/6-180QTQLFDFFERFKAHWQTQKKSLPQ..AIFEPQ....WISPCQIGEVEN.........QLIFWSPIK.........REPA.
SYDP_PSEHT/6-178..QLTQLHQRFNDKTLKNTQKHPL..MVHDEQ....WPSPCEIGNVDQ........QGNIQWQAVL.........QQPA.

PF02393

D2K3J3_HCMV/211-336TMA----R---------------------FIIRHH---GQ-------FMPLTYPP-----------...GTEL-------
B8YE72_HCMV/157-296SLS----A---------------------EVTKRG---YA-------SYTIDDPF-----------..DECPD-------
A8T728_HCMV/200-332GSY----A---------------------TAERIL---GC-------DVKLHTPG-----------.YGTVIM-------
D2K4S5_HCMV/202-333AVA----K---------------------TAREMS---GL-------NLVIRTPG-----------RTEVEPL-------
D3YS52_HCMVO/180-322ALA----A---------------------CVGEHH---GR-------DVNFHTPG-----------RH.AKTL-------
D2K3X0_HCMV/202-332ELQ----R---------------------VTCRYR---GE-------CVPLRTPG-----------EM.TRPL-------
D2K5D0_HCMV/151-256AFA----Q---------------------WRATYR---GR-------LMVMGDYS-----------VIRVSTI-------
C8BKJ5_HCMV/34-153ALR----Y---------------------AVRKLM---KR-------GARLRHDS-----------...GLYV-------
D2K5D0_HCMV/11-135PPK----T---------------------SRPWKP---GQ-------RVAL..VW-----------PKDRCLV-------
B9VXJ9_HCMVT/546-653NLL----R---------------------VCQLHA---GS-------KIRL..GG-----------SP.ACTF-------
B9VXD4_HCMVT/116-247AMR----K---------------------WSQRDA---GT-------LLPL..GR-----------PY.GFYA-------
C3Y900_BRAFL/167-275KLQ----A---------------------FFQENY---SI-------SVPLGSNG-----------DI.....-------
C3Z365_BRAFL/157-265KLK----A---------------------FFQEYR---KT-------TLAVGSNG-----------ER.....-------
B9VXL1_HCMVT/265-382ALW----R---------------------LCMKRE---GS-------IF....SW-----------RDGNEAL-------
D3YRX5_HCMVO/17-135GLN----D---------------------FLEQEC---GT-------RLHV..AW-----------PE.RCFI-------
Q14VM9_RAHV1/5-123EGD----R---------------------FLEKFR---GC-------KLRI..KG-----------LRTNAYM-------
D2K5D5_HCMV/214-331ARC----A---------------------YVEAHR---EA-------QLTL..IW-----------PE.KHSL-------
A8T728_HCMV/45-168EIT----R---------------------YVHRNE---GR-------CLSLGPPK-----------...GWHV-------
D2K4G8_HCMV/126-245DLQ----K---------------------LVRRVS---GT-------VLRL..SW-----------PN.GWFF-------
D2K595_HCMV/6-123NLD----D---------------------FMRRQR---GR-------HLDLPYPR-----------...GYTL-------
C3RWK6_FRG3V/35-153VVS----D---------------------FVKSNT---GK-------RLPIGKRS-----------...DLYV-------
C3RWV3_FRG3V/65-186LVA----D---------------------FVKKNR---DA-------KLHPPASE-----------AAKDMYI-------
C1C3V1_LITCT/15-136LVD----N---------------------FVENFS---DD-------LIRPPDNE-----------VTNNLHI-------
D2E8A7_ANHV1/5-121ELP----Q---------------------LVDDRR---GD-------RILLKR..-----------...GIVL-------
Q070N0_CPRVZ/47-172LIA----C---------------------YADRHR---GR-------HLYFAKQQ-----------...RCCL-------
B5XAY6_SALSA/21-139QIK----E---------------------IVSKHR---NN-------KILLAKPK-----------...SYEL-------
B4YEM5_9ALPH/49-167GIR----E---------------------LVRKFR---GR-------LLPFEKCP-----------...DFCL-------
B1NFI8_ADEGX/15-131EID----R---------------------YAKANR---GT-------VAPIGSG.-----------...KHFL-------
F5HIG2_HCMV/399-518HLQ----R---------------------YVRATA---GR-------WLPL..CW-----------PPLHGIM-------
D3YRW4_HCMVO/69-190CLE----A---------------------YVRINA---GQ-------VLPV..VW-----------PP.GWNL-------
B9VXJ9_HCMVT/55-169GLR----R---------------------YLRRFE---GS-------CVSLGWPS-----------...QCIY-------
C8CFJ9_HCMV/42-158VLR----D---------------------WVRNHV---DQ-------VLSLGIPH-----------...NWFL-------
B9VXG6_HCMVT/274-510LGR----E---------------------LRRRWA---GT-------TVALQTPG-----------RR.LQPM-------
Q4KS78_ISKNV/1-104...----.---------------------.MESTH---GT-------TIAL..PH-----------PP.GATL-------
C8CFJ8_HCMV/54-179ALR----T---------------------YVQRHQ---GT-------TVALRNPA-----------...NWFL-------
A8T729_HCMV/26-179DIR----H---------------------LVRSYA---DM-------NISLPVSA-----------PP.GWRL-------

PF14433

A9B4M4_HERA2/8-176TVY----R---------------------QLGWTP---DR-------DI...DPT-----------PHLEH.I-------
A9B983_HERA2/8-176FLL----T---------------------AAGWSP---ER-------TY...DPT-----------TTIIQPL-------
A9B4M5_HERA2/2-165SLL----M---------------------TAGWQP---DT-------TI...DPE-----------PWLYE.L-------
A6LWQ5_CLOB8/2-136EIL----V---------------------RAGWFE---NR-------KIDITDYV-----------KILES..-------
Q97CY9_CLOAB/2-136KIL----K---------------------RSGWIE---NQ-------KIDITNQV-----------KMLES..-------
Q97CZ0_CLOAB/1-146EIL----K---------------------KSGWHP---NR-------KIDITDLV-----------VYYEK..-------
G8LY23_CLOCD/3-138ELL----I---------------------KSGWYE---NR-------KIDTTELE-----------RLIES..-------
C0Z7L3_BREBN/1-129KIL----R---------------------DSGWYE---GR-------SIDIKEIE-----------ENLER..-------
D1ALL2_SEBTE/4-148ETL----K---------------------KSGWQE---NR-------EIPIHNIL-----------EYYEK..-------
G8LVN3_CLOCD/3-139KKL----I---------------------DSGWYE---GR-------KI...DIS-----------DLEKS.L-------
R7KV91_9FIRM/6-151KLI----E---------------------SCGYGK---PH-------FMSEDDVA-----------ERQAF.F-------
B1HSL5_LYSSC/4-140KIL----K---------------------QSGWTP---ER-------KKDISSQV-----------KYLED..-------
X2GUJ6_9BACI/4-141KIL----N---------------------EAGWYQ---NR-------KIDISSTV-----------LFLES..-------
K9X3G6_9NOST/4-142TLL----Y---------------------HAEWHE---SW-------NIDTTEYK-----------EVLES..-------
A4X261_SALTO/96-238EVL----D---------------------QAGWFP---GR-------DMTA.AVD-----------LWLAR.F-------
F4F239_VERMA/96-237HVL----E---------------------SAGWFP---GR-------DVTS.AVD-----------HWMVR.F-------
A4X254_SALTO/5-149EAL----Q---------------------AAGWVP---GR-------RDDD.RAQ-----------QWALR.L-------
F4F315_VERMA/5-149EIL----A---------------------AAGWSP---GW-------RDEE.RAR-----------EWALR.I-------
B1VUI9_STRGG/11-155AAL----R---------------------EAGWQP---GR-------WDIR.QAE-----------EWADA.L-------
G2NEF9_STREK/19-163AAL----R---------------------EAGWQP---GR-------WDIR.QAE-----------EWADA.L-------
B5GPR4_STRC2/10-154AAL----R---------------------DAGWQP---GR-------WDIK.LAE-----------HWADA.L-------
D6X5Y7_STRPR/10-154AAL----R---------------------DAGWQP---GR-------WDIK.QAE-----------HWADT.L-------
F2R7E3_STRVP/10-154AAL----R---------------------EAGWQP---GR-------WDIK.LAE-----------EWADT.L-------
V6JXA9_STRNV/9-153VAL----R---------------------EAGWQP---GR-------WDMR.QAE-----------EWADT.L-------
F8JWB4_STREN/11-156AAL----T---------------------GAGWHP---GR-------WDIK.RAE-----------QWADE.L-------
B5I7H7_9ACTN/11-155AVL----R---------------------AAGWQP---GR-------WDIK.QAE-----------IWADA.L-------
K4R8Z5_9ACTN/11-155AAL----R---------------------AAGWQP---GR-------WDIK.QAE-----------IWADV.L-------
H2JSV2_STRHJ/11-155AAL----R---------------------AAGWQP---GR-------WDIK.QAE-----------IWADA.L-------
V6K5C4_STRRC/24-168AAL----R---------------------AAGWQP---GR-------WDIK.QAE-----------IWADA.L-------
S5VNY2_STRCU/11-155AAL----R---------------------TAGWQP---GR-------WDIK.QAE-----------YWADT.L-------
Q9F2N2_STRCO/11-155AAL----R---------------------DAGWQP---GR-------WDIK.QAE-----------IWADT.L-------
C9YY15_STRSW/11-155AAL----R---------------------TAGWLP---GR-------WDIK.QAE-----------IWADA.L-------
Q82HF0_STRAW/11-155AAL----R---------------------TAGWQP---GR-------WDIK.QAE-----------FWADT.L-------
D7BTM5_STRBB/9-153AAL----R---------------------EAGWQP---GR-------RDIH.QAE-----------YWADT.L-------
G2PAB9_STRVO/37-181AAL----R---------------------DAGWQP---GR-------WDMH.RAE-----------VWADT.L-------
V4J1P0_9ACTN/10-159AAL----R---------------------AAGWQP---GR-------WDIK.QAE-----------IWADT.L-------
F3ZHS7_9ACTN/28-172SAL----R---------------------TAGWTP---GR-------WDIA.QAE-----------IWADT.L-------
D9TC01_MICAI/257-399HAL----M---------------------DGGWQI---..-------SMF...NE-----------ALAMG.A-------
F4F5L1_VERMA/256-398NAL----V---------------------AAGWRP---..-------HFG...DE-----------VVATS.A-------
R4LXK7_9ACTN/252-397GAL----A---------------------DAGWRP---MP-------RTV...AE-----------VLADG.M-------
U5WFU2_9ACTN/252-397GAL----A---------------------DAGWRP---MQ-------QVV...AE-----------VLADG.M-------
B1VX82_STRGG/6-147AWL----T---------------------EAGWYP---GR-------DAAQ.EAA-----------EAVAT.V-------
F2RCB0_STRVP/3-144ARL----A---------------------EAGWFP---GR-------DVGA.RLP-----------GLLAF.V-------
Q82G08_STRAW/6-147GWL----T---------------------ERGWFP---GR-------DIGE.QAE-----------ELVRV.R-------
D1A3E8_THECD/8-146AHM----T---------------------AAGWSP---ER-------RV...DVS-----------AWEEE.L-------
F4FAN2_VERMA/7-145DIL----K---------------------QVGWSA---GR-------AV...DTA-----------QWEAD.L-------
D0J054_COMT2/5-146ELL----Q---------------------ARGWTP---QR-------EV...AIP-----------ALIQSAL-------

PF14435

A7HBV7_ANADF/6-194APS----RGHGMMRAVVVTERHRLREKLPEL....---..-------...................GAAARTL...AM..
B1VPR4_STRGG/19-175IDE----ESPQFSMTQLHFRESVEDPRVPKYFDVP---DE-------AIGSV..............YQALDFL.......
B1VUJ2_STRGG/672-850AQA----FGPQ..................GILRFD---QR-------AVSRQGVP...........EIVARTL...VW..
B1VYJ1_STRGG/2-183TAW----AGPG..................HVTRAG---RD-------DVAGWRIP...........GSAKAQL...VE..
B5H683_STRPR/212-402DEE----FGAD..................GIVRVA---PS-------EIPAALTH...........EPTRRFL...TD..
B5HAJ0_STRPR/5-188ERT----VGEE..................NVHRLQ---PQ-------VAEAYGFN...........GEALRFL...TE..
B5HAW8_STRPR/38-231AEE----NGSGRYTPHWVRPGHWAQNGTLDLPTAD---AR-------EVADWP.............APVREALEVARR..
B5HNY7_9ACTN/216-393DQE----FGRS..................HVVRFE---DI-------DFPSTLTH...........APTRRFL...AE..
B5I6T5_9ACTN/5-183ESE----FDPE..................ELTTFS---AA-------AVATIRH............EPSADFL...RN..
D1A3F0_THECD/2-169SDL----WGED..................GLLYIP---PE-------HVERFRFD...........LRMLSPE.......
D1A5L5_THECD/5-198AEA----YGEE..................NLLTIP---AD-------RLPDLLIH...........QPTRDFL...TS..
D7C074_STRBB/2-188VSA----FGSL..................WVETMP---PE-------VAERHFAN...........PDDRRLL...TE..
D9T329_MICAI/3-173TAL----WGER..................GVIYFP---DQ-------RFDAILGPLGPEVFPPDGALPVEVPILFTVD..
E2Q6I7_STRC2/663-841AAA----FGPQ..................GICRFD---QR-------AVSRQGVP...........EAVSATL...AW..
E4N1Q1_KITSK/248-421EAV----FGAD..................GTVTLD---ER-------TAAAVAH............RPSRVFL...RE..
E4NG11_KITSK/606-780GGM----FGP...................SMFRFE---QR-------AVARQGVP...........EVVAHVL...MW..
F3ZHT0_9ACTN/605-784AGA----FGPQ..................GVFRFE---PQ-------AVARAGVP...........EVVAASL...TT..
F5XQA6_MICPN/2-160ADV----WG....................SLARVS---PE-------ALSQLGIG...........PRAAYVL...GE..
F9GD57_FUSOF/7-186ELV----FQPE..................ELVTTP---ES-------ALDGVTH............PDTRHVL...AT..
G8WZI2_STREN/529-708AQA----FGPQ..................AVFRFD---QR-------AVARAGVP...........DVVAQTL...VW..
H2JJX8_STRHJ/242-430DDA----FGGAR.................HVVRIA---ES-------DLPEGLVH...........AGSRRYL...RD..
H2JNL8_STRHJ/197-379DQQ----FGHG..................RVARFE---EV-------DFPKTLTH...........EPTRRFL...RE..
H2JQV0_STRHJ/213-403DEA----FGAE..................GMVRLT---DD-------QVPAALGH...........APTRRFL...TE..
H2K7D5_STRHJ/5-186AGL----FGED..................RLVVLP---AT-------AFPPAAAD...........CEGARLL...QT..
I0H563_ACTM4/37-227GEL----TGPG..................GPPVLP---AS-------ALEDWRLP...........APAKSAL...LS..
I0H8Z2_ACTM4/10-174ENW----AGAG..................RVIRAA---GP-------DVAAWQLP...........DQQKTAL...TS..
I0HE25_ACTM4/11-180EGW----AGVG..................NVLRLT---PA-------TVARWRVP...........EQARTLL...VD..
Q47PK6_THEFY/246-429ADT----RL....................PVQRYD---AD-------AVAESGLP...........EATHDAL...TR..
Q82D46_STRAW/202-388DEE----FGAF..................GIVRFE---DV-------DFPAALTH...........EPTRRFL...RE..
Q9K3X2_STRCO/5-185ADT----FGEH..................RLATLP---AS-------AFPPLAAD...........TEGARLL...RT..
Q9L1R9_STRCO/109-254DRE----FGRH..................RVTRFE---DI-------DFPRTLTH...........EPTRRFL...RE..
S5VHB8_STRCU/197-386DQE----FGHG..................RVTRHE---EV-------DLPATLTH...........EPTRRFL...RE..
S5YXS3_PARAH/2-168EQM----RALGF.................ATTRHA---PE-------KLSLKDLE...........NDRLKFL...ADDP
V6JYL3_STRNV/5-177ITT----FGLS..................GVVYFP---RY-------NTAHHQVN...........DRTALFL...SG..
V6K0N1_STRRC/197-380DQE----FGHG..................RVTRFE---EV-------DFPATLTH...........EPTRRFL...RE..

PF09346

A0RE58_BACAH/19-133EAI....Q---------------------KLQKFS...SI.......DVPLDYLE-------------------------
Q81B84_BACCR/8-142ESI....E---------------------ELEEFL...GF.......LLPEDYKK-------------------------
A4YB72_SHEPC/14-135EEI....Q---------------------ALEKWL...GT.......DLPSEHKK-------------------------
A0A0B5R2A8_BACTU/32-156EDI....T---------------------SLQNEL...NI.......QIPDIYKD-------------------------
B1YF81_EXIS2/16-130VDL....K---------------------KAEHAL...GV.......LFPDEYKD-------------------------
A6FHD8_9GAMM/19-145DDI....T---------------------ELESKL...NC.......FLPESYKY-------------------------
A4EPD0_9RHOB/35-163GQL....D---------------------QAEQLL...GI.......KLPMDYRF-------------------------
A0RAV0_BACAH/42-162EEI....Q---------------------VFEDEM...GT.......RFPEPYKY-------------------------
B8I5J3_CLOCE/15-125VEI....D---------------------RIESEM...GL.......KLPKVFKE-------------------------
C3G559_BACTU/15-125IEI....Q---------------------AVENRM...NV.......TLPNVYKE-------------------------
Q1DBU4_MYXXD/34-167DEV....A---------------------QLEKKF...KL.......KLPPSYVH-------------------------
A5UV09_ROSS1/24-144DQLDQLIQ---------------------KVQNEL...GA.......KLPEGYIE-------------------------
Q6HMR4_BACHK/23-143TEVQSLRE---------------------RVKEKF...NV.......DLPREYEE-------------------------
Q1CV91_HELPH/17-134KAL....N---------------------GLEDQL...KT.......GLSDAFKD-------------------------
A5TTY9_FUSNP/35-181EEI....L---------------------DVEQKL...GY.......RIPEDFRD-------------------------
Q47P53_THEFY/18-133ALF....W---------------------RIEEAL...GM.......PVPWELVE-------------------------
A0JSM0_ARTS2/15-129DAI....Q---------------------ACEAQL...GH.......RLPDYLRQ-------------------------
Q82GY4_STRAW/63-178DAL....T---------------------WAAGVL...GS.......PLPDELIS-------------------------
Q81BW2_BACCR/27-144DEL....T---------------------DIQKCL...HV.......ELPNDLYQ-------------------------
A5UTX3_ROSS1/55-202EDI....R---------------------AIEQSL...GF.......ALPESLHH-------------------------
A6C6S9_9PLAN/31-128DEL....K---------------------SLIDNI............PLPQELCD-------------------------
A5FCA9_FLAJ1/44-161EEI....L---------------------ALETKL...GT.......ALPENLKL-------------------------
B7X333_COMTE/152-284AEL....R---------------------LCEWRL...GC.......NLSQSLRD-------------------------
Q4K6P0_PSEF5/56-173DAL....Q---------------------ALEQRL...GC.......PLPRSLRD-------------------------
Q63C14_BACCZ/25-143EEI....E---------------------EAEELL...KM.......KFPKELKD-------------------------
Q81BA7_BACCR/48-167GQV....N---------------------EVINRL...GV.......EVSNTFRE-------------------------
Q89MJ4_BRADU/28-170AAL....E---------------------AFEKSI...GC.......RLPDEYRQ-------------------------
A3ZX28_9PLAN/24-139DEV....D---------------------SASQQV...CI.......PFSEDYRQ-------------------------
A0AMA9_LISW6/21-137DQI....N---------------------EAQKLL...NV.......QFNEQYIN-------------------------
A5FMA4_FLAJ1/23-172EEI....Q---------------------ELTSYF...SL.......PLPQELIT-------------------------
A0A0B8QYA4_LISMN/14-152VDL....S---------------------AVEKNL...PEQILKRYGKLPDAYKA-------------------------
Q9F2V0_STRCO/29-155EAP....A---------------------RAEAAL...GF.......PLPALLTE-------------------------
Q3BQF4_XANC5/29-173AAI....A---------------------AAQARL...GV.......RLPAWLRE-------------------------
A5FJY1_FLAJ1/42-170EEL....Q---------------------DIKSLT...NN.......NLEDSYYY-------------------------
Q1ZQF0_PHOAS/14-166VNI....S---------------------EIQKER...GM.......DLPSDYLE-------------------------
Q5WBD2_BACSK/23-138RDW....E---------------------KIEKKF...GC.......EFPEEFKD-------------------------
A5FGR4_FLAJ1/41-198DDI....F---------------------EFEKKY...NV.......SLPDCYRA-------------------------
Q0RKI3_FRAAA/56-185QTV....V---------------------AAEQRL...AV.......RLPPTFRS-------------------------
Q9F3Q3_STRCO/47-179ERV....A---------------------AAEARL...GR.......RLPPSYRE-------------------------
A6CDZ7_9PLAN/19-143EMI....T---------------------EAEEQL...SV.......RFPASYRH-------------------------
B3ZML8_BACCE/18-127AEI....K---------------------QAEEEL...QF.......NFPEQYKK-------------------------
A4Y3I6_SHEPC/21-128EQL....V---------------------EVEEQI...LI.......SLPRELKE-------------------------
A4Y9N5_SHEPC/8-116KEI....E---------------------EAQLKL...GF.......KFSPEYIE-------------------------
A4SRI0_AERS4/8-116DEI....A---------------------IAERKL...GI.......TFHNDYRC-------------------------
Q5LEK2_BACFN/47-168DDI....V---------------------ELERDL...KR.......EIPSQFRS-------------------------
Q82RV7_STRAW/96-236ADI....R---------------------EVEQEL...DL.......TVPPGLKA-------------------------
A4FNW2_SACEN/30-166AEL....V---------------------ALEAEF...HV.......QLPADLRA-------------------------
A5FAZ7_FLAJ1/185-329EDI....Q---------------------EHIELE..DDI.......KIPPALIN-------------------------
A3I618_9BACI/42-194AQI....E---------------------SLLEIF...PQ.......S.PQSFIE-------------------------
B4SN74_STRM5/28-184EDL....Q---------------------RLRAQW...P........QVPDSLVA-------------------------
Q39NE9_BURL3/28-182AQL....D---------------------ALRDAY..PQC.........PASLLE-------------------------
Q6HHY9_BACHK/33-185EDI....D---------------------ILRLKY..PNC.........PESLIS-------------------------
A5TXY3_FUSNP/37-189ENI....K---------------------KLKEEY...P........EVPDSLIE-------------------------
E6XGA7_SHEP2/26-168SAL....D---------------------EAEKQL...GF.......TLISPLRE-------------------------
Q73QC3_TREDE/40-189EEI....S---------------------AFEEKL...GI.......TLPEDFKE-------------------------
H2K898_STRHJ/18-144DEI....A---------------------ALEEAL...GV.......GAPEELKA-------------------------
A6G0Q7_9DELT/31-170DEL....A---------------------AIAEAA...GA.......ELPGELKT-------------------------
Q9RYT7_DEIRA/27-166EAL....A---------------------QAEKDM...GL.......TFPPEMRE-------------------------
Q93JL3_STRCO/163-310AEI....A---------------------EAQTRL...GV.......TLPDELKA-------------------------
A1ZXR5_9BACT/30-166EDI....A---------------------KLSAKI...GY.......ELPEDFQD-------------------------
SMI1_CANGA/103-288NDI....K---------------------HAEEDL...EV.......VLPKALKA-------------------------
Q59YV1_CANAL/104-343SDL....Q---------------------DFQKDL...SI.......KLPNCVIQ-------------------------
A5DZP7_LODEL/117-382DDL....R---------------------DFQKDL...NI.......TLPNCVVA-------------------------
SMI1_DEBHA/98-296ADL....S---------------------DFQKDL...NI.......KLPNCLIE-------------------------
Q55KB3_CRYNB/120-282TLL....A---------------------TFEAEI...GC.......PLPRSVRE-------------------------
SMI2_DEBHA/142-319ADL....N---------------------EFENDL...GCG......SLPVEIRQ-------------------------
A1C9R6_ASPCL/143-317NDI....N---------------------ELEHEL...DC.......SLPLEVRE-------------------------
SMI1_YARLI/171-356SDL....N---------------------ELEADL...DC.......SLPLDVRD-------------------------
A6EFN0_9SPHI/29-161QDI....E---------------------HTEKSI...GV.......AFNNELKE-------------------------
O07689_LISSE/36-156AQL....A---------------------EVEKML...DI.......SLPDDLKE-------------------------
A3ZN04_9PLAN/36-149DEL....V---------------------ALEGEL...GI.......SLPTEYRQ-------------------------
A7VFJ3_9CLOT/24-132EKI....L---------------------EFEKEK...EI.......TLPSKYKE-------------------------
A4X269_SALTO/103-245VQL....Q---------------------AVEAEL...GT.......RLPPSYRR-------------------------
E6XKF4_SHEP2/4-129EQL....K---------------------RTEEEL...GA.......KLPHEYRE-------------------------
A0PQE6_MYCUA/4-131KYI....L---------------------DTEEKL...GV.......TFPAAFRA-------------------------
Q8NRK2_CORGL/4-116DKI....L---------------------AAEETL...GR.......RLPETLRE-------------------------
Q0VKY9_ALCBS/4-130KYI....E---------------------NTKNEL...GV.......KFPDSFRK-------------------------
Q9F2N4_STRCO/160-298QQV....Q---------------------GVEEDL...GY.......RLPGAYRS-------------------------
A3KB11_9RHOB/18-152DAV....A---------------------ELETAL...GT.......ALPEPYRS-------------------------
Q1DEQ7_MYXXD/33-153ARI....A---------------------AFEAQM...GW.......RLDDDLRA-------------------------
Q1CY42_MYXXD/19-141AQI....A---------------------AFEQSV...GW.......RLDPDLRA-------------------------
Q09D40_STIAD/24-149DEL....A---------------------DFERRM...GW.......KLDPDLRA-------------------------
B1YEY9_EXIS2/39-159ETL....D---------------------AFEAEF...KQ.......PLPSEYQT-------------------------
Q5WJU2_BACSK/38-153NHL....S---------------------QFEKDQ...GI.......NIPSDFKE-------------------------
A7Z7P3_BACA2/41-156LEI....E---------------------SFEKKI...KV.......SLPEDYKT-------------------------
YOBM_BACSU/42-161NDI....Q---------------------SFEAKH...QL.......TLPQDYQK-------------------------
A7Z5R7_BACA2/23-158QVL....K---------------------KFEDEN...SF.......DISDDYKE-------------------------
A3ZX25_9PLAN/22-154DEL....E---------------------RLENSV...GV.......AFPDDYRT-------------------------
A7VE32_9CLOT/35-145DAV....K---------------------RFESRY....T.......PIPAEYRW-------------------------
A7MRN6_CROS8/1-150ADI....Q---------------------RLEKTY...CI.......SLPEDYKT-------------------------
B3Z4D7_BACCE/12-154SLI....L---------------------KKEEFW...RV.......QLPVDYKN-------------------------
A5Z4R3_9FIRM/12-152DEI....Q---------------------SFEKKI...GK.......IFPNDFKK-------------------------
A5Z4R9_9FIRM/9-151EDI....L---------------------EFEEKL...NT.......KFPEAYVD-------------------------
A1ZMA9_9BACT/9-138QDI....D---------------------NWEQKE...GI.......VLDKTFQR-------------------------
A0A0B5R450_BACTU/12-152EDI....E---------------------DFENKY...GI.......LLPDDYKQ-------------------------
J7Z7X1_BACCE/12-138QVI....I---------------------AVENSF...GV.......RFPDDYRE-------------------------
Q6HGG3_BACHK/12-159ENV....K---------------------NVEREL...GI.......HFPLDYIE-------------------------
Q6HGE4_BACHK/13-160TKI....K---------------------EIGLQL...GF.......QLPQDYID-------------------------
A0RAF8_BACAH/19-149EAV....V---------------------RFENML...EI.......VLPNDYKL-------------------------
A7FEI4_YERP3/10-144LSI....V---------------------NIEKKL...GI.......TFPNDYRE-------------------------
Q21ED8_SACD2/11-151SAI....R---------------------DFEENI...GM.......PFPPDYRE-------------------------
A6CCT7_9PLAN/22-151DAI....K---------------------QFEVVI...GR.......ELPETLKV-------------------------
Q6CS49_KLULA/64-193EDV....K---------------------KFEKFV...GT.......VLSSGVRA-------------------------
B1J8X4_PSEPW/139-260ADL....D---------------------FLEEVL...GG.......RLPPEFRR-------------------------
A7ML24_CROS8/19-151IEW....T---------------------EFAKCF...PA.......RLPESFKA-------------------------
A5FLI6_FLAJ1/11-131KEI....I---------------------EFEKLF...NC.......LLPDSFKD-------------------------
Q7CL34_YERPE/11-153SDI....K---------------------SVEKTL...GY.......SFPEAFVS-------------------------
Q5LEK4_BACFN/167-306EDI....K---------------------DFEMEL...NI.......KIPAAMKN-------------------------
Q65VI9_MANSM/10-134NEL....L---------------------AIEKRL...NI.......VLPQEMKN-------------------------
B8I222_CLOCE/15-149WDL....Q---------------------EIEKKF...SF.......KIPSDIYK-------------------------
Q92KA2_RHIME/32-167GTI....Q---------------------RVEAKF...GR.......RLPPDIRR-------------------------
Q28UU7_JANSC/42-166AAL....D---------------------AFEARF...DI.......VLPEAFRR-------------------------
Q5LEK4_BACFN/11-139KDF....E---------------------EIESNL...GY.......VLPKRLKE-------------------------
Q5LEK9_BACFN/11-148KDF....E---------------------EIESKL...GY.......ALPERLKE-------------------------
A7RYE8_NEMVE/119-257TEI....S---------------------RIEERH.LKGL.......SLPLDVKC-------------------------
G1S8C1_NOMLE/121-251EDL....D---------------------AVEAQI...GC.......KLPDDYRC-------------------------
Q52KV8_XENLA/36-166RDL....N---------------------GVEEKI...GC.......KLPDDYRC-------------------------
A0RFK3_BACAH/36-159EYV....H---------------------AFEQEW...GY.......KLDLKYRD-------------------------
Q9CND2_PASMU/14-158EII....S---------------------DFEGTF...GI.......KLLKLYIE-------------------------
A6DN67_9BACT/17-158KDI....S---------------------VFEKKY...NI.......KLPKKYKE-------------------------
A9B016_HERA2/24-146AVI....A---------------------ELEQAR...GY.......RLPACYRA-------------------------
Q5WC01_BACSK/21-135SEI....E---------------------AKEREL...GF.......SLPLVLRN-------------------------
A1ZUI6_9BACT/29-147AEI....Q---------------------ELEALH.PSGL.......SIPQIFKD-------------------------
Q47R76_THEFY/31-145EEV....A---------------------EVLAEK..KDV.......SVPQAYVD-------------------------
A8M704_SALAI/21-139SEV....Q---------------------QVQAAW..DMI.......RLPSAYEE-------------------------
Q6NG79_CORDI/14-156LDT....A---------------------RIENEL...GK.......KLPQSYRD-------------------------
Q7DD43_NEIMB/1-117NSF....V---------------------PYPEAMLPKGF.......KYPQSYLK-------------------------
A3I6Z7_9BACI/22-146SWI....T---------------------DAEIEL...GF.......QLPPSYCW-------------------------
Q38V57_LACSS/13-131RFI....K---------------------P........NA.......ALPADYLA-------------------------
A4BCB8_9GAMM/14-147EML....E---------------------VAEKKL...GV.......KLPAEYVE-------------------------
A0R498_MYCS2/11-150ELL....D---------------------ATEQRL...GV.......RLPESLVA-------------------------
A6VZI9_MARMS/37-168EAL....S---------------------CFEEKY...GF.......LLPKEYVN-------------------------
Q2BBP3_9BACI/17-145ETL....Q---------------------KVQREL...QV.......DLPESYIN-------------------------
Q816C2_BACCR/16-147ELI....K---------------------KAEEVL...NV.......KLPESYIT-------------------------
A5TTM3_FUSNP/176-315EDF....K---------------------KVEKEL...GY.......RLPEAYKV-------------------------
A4X5D2_SALTO/28-164EVL....Q---------------------VVEAQL...GH.......KLPTAYVD-------------------------
Q11VT9_CYTH3/29-168ALI....D---------------------SIEQEL...GY.......KLPASYIE-------------------------
A1INP6_NEIMA/28-167EIL....A---------------------AVESEL...GY.......KLPQSFIE-------------------------
H1GFW8_LISIO/124-264QRV....A---------------------AIEAEL...GY.......KLPKSYIY-------------------------
B1KH37_SHEWM/28-163KQL....F---------------------DIEAFL...GT.......SLPSDYKW-------------------------
B1KH38_SHEWM/29-165EEL....I---------------------AIERFL...QA.......KLPDDYLW-------------------------
Q8GDM6_PHOLU/25-137EWI....N---------------------KTEKAL...SL.......TLPDDYKW-------------------------
Q926X2_LISIN/25-149ELI....K---------------------IYQDAL...GN.......EFPETYKL-------------------------
Q5DWB0_CLOPF/25-151EAI....N---------------------LAEEML...DL.......KFSKLYRE-------------------------
B1KPX6_SHEWM/17-136GLV....S---------------------NLEEAL...GV.......ILPETYKE-------------------------
A7Z5G8_BACA2/23-137DKI....L---------------------KIEQDL...QV.......TLPDSYKW-------------------------
A7GQ33_BACCN/21-130ENI....V---------------------MIEKKL...GC.......TFPPQYRE-------------------------
A4IKF8_GEOTN/21-132QEI....R---------------------KAEEIL...GL.......QFPESYRA-------------------------
A3ZX34_9PLAN/23-143ESI....E---------------------KLESLL...GS.......RLPVSFKT-------------------------
B7KWA7_METC4/14-155ADL....A---------------------RAEAEL...GF.......PLPQSYRN-------------------------
Q4K9A1_PSEF5/28-140TQI....L---------------------EAQQAL...GL.......QLPADYTW-------------------------
Q633D5_BACCZ/17-131ENI....T---------------------VIESQL...NI.......SFPTDYIS-------------------------
A5Z4Q5_9FIRM/17-131IMI....E---------------------KVEKEW...NI.......SLPCEYKQ-------------------------
A1TSU7_ACIAC/17-133RAI....A---------------------RVESEL...DV.......VFPVDYRE-------------------------
Q8F615_LEPIN/16-123NTI....Q---------------------KIESIF...KV.......TFPEDYKQ-------------------------
Q5LEL2_BACFN/13-124ASI....D---------------------DVEKLL...NT.......TLPKQYKS-------------------------

PF14568

Q7N9I9_PHOLL/26-145DTI----R---------------------EFESLL---GV-------TFPESYKF-------------------------
G2TJC9_BACCO/28-148HLI----F---------------------MAEKKL---GL-------TFSNLYRD-------------------------
V5XPU7_ENTMU/27-147VII----R---------------------KAQVEL---NL-------RFPEDYKR-------------------------
D3FRA3_BACPE/26-146ELI----R---------------------AAEDKI---GL-------KFTGAYLD-------------------------
Q4KGS7_PSEF5/49-173EAI----R---------------------AAEMAL---GR-------TLPCSFAR-------------------------
H6NAP1_9BACL/27-148ELI----H---------------------VAEKKL---GI-------KFRGIYRD-------------------------
X2H814_9GAMM/28-135DWI----N---------------------AAEKAL---LV-------SFPADYKW-------------------------
A6X425_OCHA4/23-138LAI----A---------------------QAEADL---GV-------QFPLEYRE-------------------------
H8H3I1_DEIGI/15-142EHL----R---------------------TIEDTV---GQ-------PFPTDYLH-------------------------
H1Y7D2_9SPHI/29-143LWI----D---------------------EAQQRL---NI-------IFPPSYIW-------------------------
Q8DV31_STRMU/18-125KEV----A---------------------KAETIL---GI-------TFAKDYRE-------------------------
R5BF88_9FIRM/22-126IEI----S---------------------KAQKCL---GV-------QFSTDYID-------------------------
R4TCF2_AMYOR/45-152EEI----E---------------------RVEQEL---DV-------RLPGQYKE-------------------------
B1HSL3_LYSSC/34-146NEI----K---------------------ELEKEI---GH-------SFPTMYRT-------------------------
B8I223_CLOCE/18-129DDI----I---------------------NAERKM---GL-------ELPRELKE-------------------------
B9T8U5_RICCO/20-128DSI----R---------------------TLEQKL---SF-------PLSSEYQS-------------------------
B1YF88_EXIS2/12-121ERL----Q---------------------EVETEL---GF-------SLPSELRT-------------------------
D3EC76_GEOS4/35-147EEI----A---------------------HAEQQL---NV-------RFHEDYVH-------------------------
YOKK_BACSU/26-163EQL----K---------------------ELEMNI---GN-------QLPSDYKD-------------------------
D1AMU4_SEBTE/16-153ERI----A---------------------DFEKAY---RI-------EFPSEYKD-------------------------
D5DHK7_BACMD/19-130NDI----E---------------------EVEGTL---GL-------KFPFELKK-------------------------
D3V9F7_XENNA/31-140EDI----E---------------------QVELLV---GG-------TLPDEYVY-------------------------
F2F0G1_SOLSS/15-152TLL----S---------------------EKEGKW---RI-------NLPETYKE-------------------------
A8FII6_BACP2/16-121KQI----K---------------------KAESQL---NM-------VLPHAHKT-------------------------
F0RDN6_CELLC/80-198TEI----I---------------------EIEKQI---NL-------TLPLSYKL-------------------------
L0DJE0_SINAD/14-143DDI----R---------------------SLERRI---GV-------DLPVDYRT-------------------------
D3FRA7_BACPE/19-130DEI----K---------------------EVEKEL---NL-------IFPRELVN-------------------------
C2X0Q7_BACCE/18-123IEI----Q---------------------AVENHM---NV-------TLPNAYKE-------------------------
R5ZM16_9FIRM/11-125EQI----E---------------------EFEIRN---KI-------LLEENYKN-------------------------
W6EF85_SULMU/15-166KVI----I---------------------DFAKSM---DV-------IFPNSYIE-------------------------
H8H3H9_DEIGI/15-154AEL----D---------------------HFEQEH---NL-------IIPEVYRA-------------------------
D1AK41_SEBTE/28-142SNL----Q---------------------DFETKF---QV-------NIPLDYRW-------------------------
B1HQ89_LYSSC/39-149EEI----I---------------------CAQQML---SV-------QFHKDYVQ-------------------------
D1BM01_VEIPT/30-141KDI----S---------------------EFENKF---EP-------.IPSEYRY-------------------------
Q2SDZ5_HAHCH/31-138DSL----A---------------------RAERLL---EV-------RLPQEYKN-------------------------
A9C331_DELAS/17-129ENV----E---------------------MLEKNA---SL-------SLPLQYRE-------------------------
D1BM10_VEIPT/30-159EDI----K---------------------AAEAEL---GY-------TLPAAYIE-------------------------
YNAB_BACSU/14-117QEI----S---------------------DIEQKL---GV-------TFPNDYKE-------------------------
Q65PK7_BACLD/21-130GKL----Q---------------------KAEELL---GV-------SFPDELVS-------------------------
E3EFQ0_PAEPS/15-152ELL----N---------------------VVERSL---RV-------SFPKTYRF-------------------------
E3E4D6_PAEPS/30-142QAI----V---------------------DFEKKH---NV-------ILPESYRD-------------------------
C3AIQ8_BACMY/23-155EMI----R---------------------IAEEKL---GY-------KLPDSYIR-------------------------
D1AI41_SEBTE/179-313TEI----E---------------------EAEAEL---GY-------RLPESYKA-------------------------
D5DG34_BACMD/42-148NQL----N---------------------VFEEEM---HV-------SLPEDYKQ-------------------------
G8LVX3_CLOCD/46-166EQL----A---------------------SAEKYL---GH-------SIDKDYRE-------------------------
D7C627_STRBB/27-150GDW----E---------------------AAEAAL---GV-------RLPTDFKA-------------------------
B1HSJ7_LYSSC/16-121HDI----L---------------------LIEQTM---AI-------HLPQEYKN-------------------------
E6UH30_RUMA7/13-149ERL----S---------------------KIEKIW---GV-------RLPEEIRI-------------------------
W0EAP9_9FIRM/31-139EDI----T---------------------FIETNL---ML-------RLPKEYKE-------------------------
C7PR05_CHIPD/29-163ELI----A---------------------NIEEEL---GF-------KLPASYIE-------------------------
F2IDG4_FLUTR/12-130KNF----Q---------------------IIENLV---EG-------KFSNNFKE-------------------------
Q8A449_BACTN/32-166EMI----E---------------------ETEREL---GY-------KLPESYIW-------------------------
X5DYB7_9CORY/26-162ARL----A---------------------NIESTL---GK-------VLPPRYRE-------------------------
Q81H93_BACCR/16-140EQI----E---------------------QLEEYF---GI-------KFPNDFIE-------------------------
K9VSA2_9CYAN/26-156EKL----Q---------------------AFEFET---GI-------TLPADYKT-------------------------
A5FC92_FLAJ1/15-125PEI----E---------------------EIDNQI---SF-------SLPPDYKA-------------------------
M5E8L2_9GAMM/13-128SLI----S---------------------DVEKKL---DY-------KFTDSFVS-------------------------
R6VPC4_9FIRM/166-289QQV----A---------------------AFEARL---QI-------LLPACYRD-------------------------
X2GNV0_9BACI/171-305ELI----A---------------------SIEKEL---GY-------KLPASYIY-------------------------
C5ANN1_BURGB/12-131EEI----R---------------------DFEKKA---RV-------KLPEAFKR-------------------------
C3AJS9_BACMY/32-166EMI----S---------------------KLENEL---GY-------KLPESYIW-------------------------
YXXD_BACSU/19-130SEI----E---------------------EVEKNL---NL-------KLPSELVN-------------------------
R6UAS7_9CLOT/11-122NEI----V---------------------EVEKKY---NI-------NLPESLKN-------------------------
E6TT52_BACCJ/18-135KSL----N---------------------NLENEF---DI-------LLPSTYRI-------------------------
Q81XQ3_BACAN/19-145ELI----K---------------------KAEEVL---NV-------KLPESYIN-------------------------
Q3IK24_PSEHT/11-122EDV----H---------------------GIEKHF---NV-------ILPDDYKT-------------------------
H6NG08_9BACL/105-217EEL----R---------------------NFEMEN---NL-------RLPGSYRN-------------------------
A8FAT3_BACP2/20-143KGI----A---------------------KAEKKL---GV-------ILPDTYKK-------------------------
C3AMY1_BACMY/25-162TLL----E---------------------RIEGNL---EV-------KFPSEFCM-------------------------
C3AU00_BACMY/12-136EEL----E---------------------AFEEKH---QL-------RLPKYYRE-------------------------
D3FZU7_BACPE/33-153NAI----H---------------------QIEYLL---DV-------ELPLMYKK-------------------------
E6UJV2_RUMA7/27-143EKL----R---------------------AIEKEI---GY-------KLPESYIA-------------------------
F4AXJ4_DOKS4/15-148AEI----E---------------------KAEKIW---NT-------KFPLEYKE-------------------------
B1YEX8_EXIS2/18-145EEI----K---------------------HIEKQL---GS-------RLPKSYLK-------------------------
C3ATZ9_BACMY/28-146AEI----C---------------------LVEKKI---GY-------KLDQKYRD-------------------------
C3ATZ8_BACMY/15-152DLI----F---------------------KKEEAW---RV-------ELPLDYKN-------------------------
Q9X366_BACAN/16-140ENI----Q---------------------KVEHYF---NI-------KFPMDFVE-------------------------
C2X3A0_BACCE/19-143EEI----Q---------------------KIEQYF---NI-------KLPNDFVA-------------------------
K9ZKW6_ANACC/21-135LEI----I---------------------QLERQQ---GI-------TLPNRYKG-------------------------
F0SMF1_RUBBR/22-135QEL----A---------------------SAEEQL---RL-------ELPVQLRR-------------------------
R5LQ27_9SPIR/14-127NVF----E---------------------NIEKKY---KI-------KIPDNLKK-------------------------
F3ZZP4_MAHA5/26-131KQI----F---------------------DVEKSL---GY-------KLPTDLKE-------------------------
U5L8D3_9BACI/50-163AET----A---------------------LIKKEL---KV-------ELPDKLAE-------------------------

PF14567

Q81B94_BACCR/6-143NDW----R---------------------ELEKKF---GC-------QFPKEFKC-------------------------
C7N7K9_SLAHD/5-132EMV----K---------------------EAQEKL---GV-------EIPEQFLE-------------------------
K4KKC1_SIMAS/1-134EHT----V---------------------DAEEQM---LL-------PFPRDFRE-------------------------
Q0VNR5_ALCBS/1-133DRL----V---------------------EIEEQL---LI-------SLPADYKA-------------------------
D4ZBL0_SHEVD/1-131EQI----V---------------------VVEEEI---LM-------PLPPELKE-------------------------
Q21KG4_SACD2/2-132DDI----V---------------------EAHEAM---LI-------SVPADFRD-------------------------
A6X428_OCHA4/5-137ALI----H---------------------KYESAT---GF-------QFSEDYKE-------------------------
Q81Q97_BACAN/1-122...----.---------------------.IQQML---NI-------KFPNSYHW-------------------------
S6B2A8_PSERE/1-133ELL----V---------------------EIEEQM---LI-------NLPFELRE-------------------------
YOBK_BACSU/6-138ENI----G---------------------RIEENL---QC-------DLPNSYKW-------------------------
F2K758_PSEBN/1-133DLL----V---------------------EIEEQL---FI-------DIPFVFRE-------------------------
Q880E4_PSESM/5-136ALI----I---------------------AYEREL---GI-------SFLDEYKF-------------------------
X2GZW0_9GAMM/4-146SQI----N---------------------ILENKL---NL-------SLPNELKE-------------------------
U5MVI7_CLOSA/6-138IKI----N---------------------DIEKQL---CI-------NFPESYKW-------------------------
Q5WIS2_BACSK/1-155ELI----N---------------------LAEEKL---GL-------KFTGLYLD-------------------------
Q8EAQ0_SHEON/1-131EQL----V---------------------EVEEQI---LI-------PLPRELKE-------------------------
B8CQS9_SHEPW/1-121EQI----V---------------------EVEEEI---LI-------PLPLALKE-------------------------
I0GP53_SELRL/13-146VDI----F---------------------EMEKEL---GV-------RFPIEYRM-------------------------
B3PC71_CELJU/34-164DQL----V---------------------EIEEEI---LL-------PIPRDMRR-------------------------
D3FRA5_BACPE/5-133EAI----E---------------------KAEEVL---KV-------KFPRDYRK-------------------------
M4X311_PSEDE/1-131ELL----V---------------------EIEEAL---LI-------GIPSEFRE-------------------------
Q12R95_SHEDO/1-131EQL----V---------------------EVEEQI---LI-------SLPRELKV-------------------------
D5HHH7_9FIRM/5-133KDL----Y---------------------DAEKIL---NL-------KIPEQYVW-------------------------
D5SSH7_PLAL2/5-147GSI----E---------------------RLQELL---HT-------RLPLSLQK-------------------------
N0B2R8_9BACI/1-137INI----K---------------------SAEEQL---GV-------AFPNQYKD-------------------------
G8M281_CLOCD/7-139ADI----L---------------------KVEEML---GL-------KLPKSYKW-------------------------
G2Z5P5_FLABF/2-145DEI----K---------------------DAEKQL---NI-------KFHDDYIS-------------------------
A3QH89_SHELP/1-131DQL----V---------------------EVEEQI---LI-------PLPAELKE-------------------------
R6FTE9_9CLOT/5-133DDI----K---------------------LVEKSL---GI-------IFPESYKW-------------------------
R5TPA4_9FIRM/24-155AEI----A---------------------QAEQKL---AL-------KIPDPFIW-------------------------
Q086X2_SHEFN/1-131EQL----V---------------------EVEEQI---LI-------GLPNDLKE-------------------------
C1D4A4_DEIDV/3-141REI----D---------------------ALEVLL---ET-------RLPPSYRA-------------------------
D3FZM0_BACPE/6-143SDW----E---------------------YIEKKF---GC-------QFPSEFKF-------------------------
A1S8W2_SHEAM/1-131DQL----L---------------------DVEEAI---LI-------PLPADLKE-------------------------
Q7M7B0_PHOLL/5-136ELI----S---------------------QYEKEI---GF-------EFSNDYKE-------------------------

PF07348

SYDP_KLEP7/6-179QNI----S---------------------AVERAL---DI-------VVQQPLHS-------------------------
SYDP_COLP3/9-191LSF----E---------------------NVESAL---NI-------ELHPDIKI-------------------------
I2B5Z7_SHIBC/5-178ADL----S---------------------AVERAL---EI-------TLQPGAHQ-------------------------
R5V7K9_9FIRM/4-185VSF----D---------------------AMEKEL---GF-------SIHPQIKA-------------------------
SYDP_YERPE/6-179ATL----T---------------------NIERAL---EI-------QLHPDIHD-------------------------
K7A551_9ALTE/8-182INF----N---------------------DLENAL---DM-------KIHQDVIS-------------------------
E0SCC1_DICD3/6-178ARL----D---------------------GVERAL---EI-------QLHPDAHA-------------------------
X2H3P8_9GAMM/9-173RDL----S---------------------IVEEVV---GI-------ILHPSSHI-------------------------
D4ZHN4_SHEVD/5-186GSF----S---------------------NIETAL---EL-------EFGPDIDA-------------------------
D8MW85_ERWBE/6-178QNL----E---------------------AVERAI---EF-------RIQPSVAA-------------------------
SYDP_CROS8/6-179DSL----G---------------------AVEKAL---DI-------VIQPDVHA-------------------------
F5Z4L7_ALTSS/6-183LSF----K---------------------NVEEAL---DI-------KLNADFCQ-------------------------
SYDP_SHEAM/4-180AVF----N---------------------NVSHAM---DI-------ELHHDIDD-------------------------
J7U684_MORMO/6-178KHL----Q---------------------PVEKAL---DI-------QLHPDISE-------------------------
E1STK9_FERBD/4-172AGF----D---------------------NVAQAL---EL-------TLHPALTD-------------------------
I0DWV2_PROSM/6-180KNL----N---------------------KVATAL---DI-------ELQPMIHP-------------------------
SYDP_IDILO/6-175LNF----D---------------------DLESAL---EM-------SFHQSIKT-------------------------
C2X4F6_BACCE/19-188TDL----T---------------------ILEEQF---AI-------KFHDSVYH-------------------------
SYDP_EDWI9/6-178EDL----E---------------------GIGRAL---DI-------RLHPALAP-------------------------
M4UN22_9GAMM/6-180VDL----S---------------------NIESAL---EI-------TLHPSIHA-------------------------
H2IXL4_RAHAC/6-178ATL----Q---------------------NVERAL---EL-------QLRPEAHA-------------------------
G4QLZ8_GLANF/9-186SHL----G---------------------DLAKAL---EI-------EIHPQLET-------------------------
E6WGC7_PANSA/6-178ATL----A---------------------AVERAL---DL-------ELQPDITA-------------------------
SYDP_ERWT9/6-179PNL----D---------------------AVERAL---DI-------RLQPAVTA-------------------------
SYDP_VIBCH/6-179ADF----S---------------------NVERAI---EL-------TLHEDIKA-------------------------
SYDP_PHOLL/6-180EKL----N---------------------SVEVAL---DI-------QLQPAIHD-------------------------
W0HTY4_9ENTR/12-183QTL----A---------------------GVERAL---AL-------RLQPAAQA-------------------------
B4F2E3_PROMH/5-178DKL----E---------------------KVEKAM---GI-------IIRSELHD-------------------------
SYDP_VIBF1/6-179IRL----H---------------------NIEQGI---EL-------DLHDDFHA-------------------------
SYDP_VIBTL/6-179ADF----T---------------------NVETGI---EL-------TLHEDVKT-------------------------
A8GIF5_SERP5/18-190ATL----E---------------------KVETAL---EL-------RLQPDINL-------------------------
F7YLH7_VIBA7/10-183ADF----S---------------------NVEAAI---EL-------TLHSDIKA-------------------------
SYDP_ALTMD/6-178LSF----N---------------------NVEDAL---SL-------KLHADYCC-------------------------
SYDP_SHELP/5-184GPF----D---------------------NIEHAL---SI-------TLHPSIQA-------------------------
F0LVK8_VIBFN/6-179ADL----A---------------------NVEQGI---EL-------TLQQDIAP-------------------------
SYDP_HAHCH/7-185TLF----D---------------------GLEQGL---EV-------AIHPSITA-------------------------
SYDP_TOLAT/7-177SDL----Q---------------------NIASAL---EC-------VFHPAIHA-------------------------
SYDP_PECAS/6-179VAL----D---------------------GVERAL---EI-------SLHPDVHA-------------------------
SYDP_SHEON/4-180GSF----T---------------------NVEHAL---EL-------KLWPDIHS-------------------------
SYDP_PHOPR/6-179GDL----A---------------------GVEKGI---EI-------ELHKDIID-------------------------
SYDP_AERHH/6-178ADF----T---------------------AMNEAL---EL-------TLHPAAQA-------------------------
SYDP_SHEFN/4-180ADF----S---------------------NVEHAL---NI-------QLHQDIHA-------------------------
D3VCK7_XENNA/6-179GKL----N---------------------KVETAL---GL-------RLQDSIHD-------------------------
D3UWF0_XENBS/6-179EKL----S---------------------KVETAL---DI-------RLQDSIHD-------------------------
SYDP_PSEA6/6-182SEF----K---------------------DLSEAL---EL-------TLHPDVAQ-------------------------
SYDP_VIBPA/6-178ADF----T---------------------NVENAI---EL-------TLHEDIKA-------------------------
SYDP_ECOLI/6-179QNV----N---------------------AVERAF---DI-------VIQPTIHT-------------------------
SYDP_SHEDO/4-180GDF----D---------------------NVASAL---AI-------TLHQDINH-------------------------
SYDP_VIBVY/6-179VDF----A---------------------NVEQAI---EL-------TLHDDIKA-------------------------
H2FY10_OCESG/7-174GSF----D---------------------NLAHAL---DM-------PVHPSLTA-------------------------
SYDP_PSYIN/6-180LDM----S---------------------NIEQAL---DI-------KLHPSIVD-------------------------
SYDP_PSEHT/6-178GSL----N---------------------DLAKAL---DV-------TFPSGLNA-------------------------

PF02393

D2K3J3_HCMV/211-336----------------------------------------------R..........LCNL---RCFE..N--------S
B8YE72_HCMV/157-296----------------------------------------------THFAFWTHNTEVMKF---KETS..F--------S
A8T728_HCMV/200-332----------------------------------------------RLMKTVQQLHRIWPF---..CA..L--------T
D2K4S5_HCMV/202-333----------------------------------------------LMLGSIEGLRACRPF---DHMS..A--------A
D3YS52_HCMVO/180-322----------------------------------------------KLLTSFGCLTDCWPF---EVAP..A--------A
D2K3X0_HCMV/202-332----------------------------------------------LLCGQAENLKGVWPF---ICME..T--------E
D2K5D0_HCMV/151-256----------------------------------------------R..........LYDW---.......--------.
C8BKJ5_HCMV/34-153----------------------------------------------C..........ICD.---PSYE..F--------L
D2K5D0_HCMV/11-135----------------------------------------------I..........RRRW---RLVR..D--------E
B9VXJ9_HCMVT/546-653----------------------------------------------T..........FGSW---NVAE..A--------D
B9VXD4_HCMVT/116-247----------------------------------------------R....VTPRSQMNGV---GATD..L--------R
C3Y900_BRAFL/167-275----------------------------------------------...........FTPL---EEGS..S--------D
C3Z365_BRAFL/157-265----------------------------------------------...........FTPW---KGGS..S--------D
B9VXL1_HCMVT/265-382----------------------------------------------T..........TVVL---NGSQ..T--------Y
D3YRX5_HCMVO/17-135----------------------------------------------Q....LRSRSALGPF---VGKM..G--------T
Q14VM9_RAHV1/5-123----------------------------------------------E..........VCAL---ADTQ..Y--------V
D2K5D5_HCMV/214-331----------------------------------------------V..........LRTA---RDLG..L--------S
A8T728_HCMV/45-168----------------------------------------------M..........LRTE---DGII...--------.
D2K4G8_HCMV/126-245----------------------------------------------T..........YCDL---LRVG..Y--------F
D2K595_HCMV/6-123----------------------------------------------F..........VCDV---EETI...--------.
C3RWK6_FRG3V/35-153----------------------------------------------R..........ICDL---SGTI..Y--------S
C3RWV3_FRG3V/65-186----------------------------------------------R..........ICGL---DGTM..Y--------S
C1C3V1_LITCT/15-136----------------------------------------------R..........ICGL---DGTV..Y--------S
D2E8A7_ANHV1/5-121----------------------------------------------R..........IAPL---DGTI..H--------W
Q070N0_CPRVZ/47-172----------------------------------------------R..........VGDL---SSTF..Y--------G
B5XAY6_SALSA/21-139----------------------------------------------R..........IGGL---EDTV..H--------A
B4YEM5_9ALPH/49-167----------------------------------------------R..........IGGL---EASF..H--------K
B1NFI8_ADEGX/15-131----------------------------------------------V..........IGDL---EGTL..H--------A
F5HIG2_HCMV/399-518----------------------------------------------L..............---GDTQ..Y--------F
D3YRW4_HCMVO/69-190----------------------------------------------V..........LQEI---ETDE..D--------F
B9VXJ9_HCMVT/55-169----------------------------------------------V..........VGG.---EHSP..H--------S
C8CFJ9_HCMV/42-158----------------------------------------------Q..........VRPG---......S--------T
B9VXG6_HCMVT/274-510----------------------------------------------VLLGAWQELAQYEPF---ASAPHPA--------S
Q4KS78_ISKNV/1-104----------------------------------------------T..........FASA---ADTA..Y--------.
C8CFJ8_HCMV/54-179----------------------------------------------V.............M---REQA..A--------I
A8T729_HCMV/26-179----------------------------------------------D..........FVEF---EDIFGSA--------A

PF14433

A9B4M4_HERA2/8-176----------------------------------------------K--------Q.....---....ATY--------P
A9B983_HERA2/8-176----------------------------------------------T--------T.....---....IGW--------P
A9B4M5_HERA2/2-165----------------------------------------------R--------Q.....---....QQY--------P
A6LWQ5_CLOB8/2-136----------------------------------------------.--------......---....AGY--------E
Q97CY9_CLOAB/2-136----------------------------------------------.--------......---....EGY--------E
Q97CZ0_CLOAB/1-146----------------------------------------------.--------......---....RGF--------E
G8LY23_CLOCD/3-138----------------------------------------------.--------......---....RGF--------K
C0Z7L3_BREBN/1-129----------------------------------------------.--------......---....LGY--------I
D1ALL2_SEBTE/4-148----------------------------------------------.--------......---....IRY--------V
G8LVN3_CLOCD/3-139----------------------------------------------T--------E.....---....DGY--------V
R7KV91_9FIRM/6-151----------------------------------------------E--------E.....---....EGY--------T
B1HSL5_LYSSC/4-140----------------------------------------------.--------......---....KGY--------I
X2GUJ6_9BACI/4-141----------------------------------------------.--------......---....KGF--------R
K9X3G6_9NOST/4-142----------------------------------------------.--------......---....EGY--------S
A4X261_SALTO/96-238----------------------------------------------A--------DELAGL---E......--------.
F4F239_VERMA/96-237----------------------------------------------A--------DDLAGL---D......--------.
A4X254_SALTO/5-149----------------------------------------------A--------ADAAPD---G...RQH--------T
F4F315_VERMA/5-149----------------------------------------------A--------ADAALD---G...RQH--------V
B1VUI9_STRGG/11-155----------------------------------------------R--------SHASPA---G...HQH--------A
G2NEF9_STREK/19-163----------------------------------------------R--------SHTSPA---G...HRH--------A
B5GPR4_STRC2/10-154----------------------------------------------R--------AYESPA---G...HRH--------A
D6X5Y7_STRPR/10-154----------------------------------------------R--------AHVSPA---G...HQH--------T
F2R7E3_STRVP/10-154----------------------------------------------R--------AHVSPA---G...HRH--------S
V6JXA9_STRNV/9-153----------------------------------------------R--------AHTTPA---G...HVH--------A
F8JWB4_STREN/11-156----------------------------------------------R--------AHTSPG---G...HRH--------T
B5I7H7_9ACTN/11-155----------------------------------------------R--------EHISPA---G...HRH--------A
K4R8Z5_9ACTN/11-155----------------------------------------------R--------EHASPA---G...HRH--------T
H2JSV2_STRHJ/11-155----------------------------------------------R--------AHTSPA---G...HRH--------T
V6K5C4_STRRC/24-168----------------------------------------------R--------EHTSPA---G...HRH--------T
S5VNY2_STRCU/11-155----------------------------------------------R--------EHTSPA---G...HRH--------T
Q9F2N2_STRCO/11-155----------------------------------------------R--------EHSSPA---G...HRH--------T
C9YY15_STRSW/11-155----------------------------------------------R--------EHTSPA---G...HRH--------A
Q82HF0_STRAW/11-155----------------------------------------------R--------SHTSPA---G...HRH--------T
D7BTM5_STRBB/9-153----------------------------------------------R--------AHTSPA---G...HLH--------A
G2PAB9_STRVO/37-181----------------------------------------------R--------AHTSPA---G...HRH--------A
V4J1P0_9ACTN/10-159----------------------------------------------R--------AHTTPG---G...HQH--------T
F3ZHS7_9ACTN/28-172----------------------------------------------R--------AHTSPA---G...HQH--------H
D9TC01_MICAI/257-399----------------------------------------------M--------TETKAV---AGQHHRH--------E
F4F5L1_VERMA/256-398----------------------------------------------I--------RDVREV---RGKTHEH--------A
R4LXK7_9ACTN/252-397----------------------------------------------I--------NDVVTV---PGRRYRH--------Q
U5WFU2_9ACTN/252-397----------------------------------------------I--------EDVVNV---PGKRFQH--------R
B1VX82_STRGG/6-147----------------------------------------------T--------DRYRAY---G...VDI--------E
F2RCB0_STRVP/3-144----------------------------------------------I--------DRFAEE---G...HPV--------E
Q82G08_STRAW/6-147----------------------------------------------L--------QDSERQ---G...VPL--------T
D1A3E8_THECD/8-146----------------------------------------------S--------RT....---....SGF--------R
F4FAN2_VERMA/7-145----------------------------------------------E--------AD....---....GFL--------P
D0J054_COMT2/5-146----------------------------------------------D--------QQ....---....PGL--------T

PF14435

A7HBV7_ANADF/6-194......RGVPR.............................EVRLQGWTGPTFFSSELADGR---LRTLEQF--------A
B1VPR4_STRGG/19-175........EPV..................................................---.......--------.
B1VUJ2_STRGG/672-850......AGLPA.............................DFGPFFWAQ..PGQPVVPTLG---ELAAQRQ--------V
B1VYJ1_STRGG/2-183......VGIPV..........................................APRLVRRV---VVQSEAE--------P
B5H683_STRPR/212-402......VGLPR...................DAQMFCMDPEDLLVPLPDDRERSKQNPAHQH---LWNGSD.--------.
B5HAJ0_STRPR/5-188......IGLPD............................DEEFEITFRMPVTFDAAFIWDR---ASREARG--------W
B5HAW8_STRPR/38-231......YGLPH..............................................GDTM---CLPVPGS--------A
B5HNY7_9ACTN/216-393......TGLPE...................DGVLFHTDP.DAPLPTLAEHRADH.......---......L--------T
B5I6T5_9ACTN/5-183......VGIPA...........................RPNPWFDLVDGSPEQARTLGDAY---DDLRERW--------T
D1A3F0_THECD/2-169......AAIPA...................................EVPLLFTAYIDDEIK---LFNVLEI--------Q
D1A5L5_THECD/5-198......VGLPN........................STAGGLVDVDEAFAAGLPPMSEHEYF---GSGEHGG--------W
D7C074_STRBB/2-188......VGMPQ.............................SLLGHLYFGNVRTDPPQTISQ---AVDTGTP--------D
D9T329_MICAI/3-173......VSVPD................................................VE---LFSTLSI--------E
E2Q6I7_STRC2/663-841......AGLPA.............................DFNPFFWAQ..PAHPVVLTLA---ELAAQRQ--------V
E4N1Q1_KITSK/248-421......VGLPE................................DAAFLALEPEIRWGGSLI---GDEYWVS--------R
E4NG11_KITSK/606-780......VGLPR.............................EFAPFFWAQAQEGRP.IPTLA---ELAAERG--------L
F3ZHT0_9ACTN/605-784......AGLPF.............................DMGPFFWAQAQPGRP.VPTLA---ELAQERG--------V
F5XQA6_MICPN/2-160......VGLPV............................................AVDPLF---VFTPVES--------M
F9GD57_FUSOF/7-186......LGIPV...........................RDNPWFDMAEGLDQRLRPVGDWD---WDLSDRY--------E
G8WZI2_STREN/529-708......AGLPV.............................DFGPFFWAQAQPGRP.VPTLA---EVAAERG--------A
H2JJX8_STRHJ/242-430......VGLPA............................WWVCHSAQYETHPLDAMRPPAE---GALPDGS--------L
H2JNL8_STRHJ/197-379......TGLPE...................EAVFFHADT.DAPLPTLREYVTQE.......---.RPDYPL--------A
H2JQV0_STRHJ/213-403......AGLPR...................DGFMFYGPPGEPLVTLPEDWAESQSNPRHAH---LWHGGE.--------.
H2K7D5_STRHJ/5-186......VGVPT..............................GTLWLRVPDEDDGLLPLVQD---VVDVEDF--------E
I0H563_ACTM4/37-227......YGLPPQRTDGLMGVAGGFHDAAPAYH.............................---.......--------.
I0H8Z2_ACTM4/10-174......SGVPM.........................................IEGLVDVVS---FQAKPTM--------Y
I0HE25_ACTM4/11-180......VGLPRLDTRFIPDPQHGDEPALPTMY.............................---.......--------.
Q47PK6_THEFY/246-429......FGLPS.....................LIPHFFVADPPHQPPAGGLFCDAATHLHA---RGTPASD--------P
Q82D46_STRAW/202-388......VGLPE...................NGYWFEVDT.DVPLPTLAEHYADELSGAFTD---G......--------.
Q9K3X2_STRCO/5-185......VGAPT..............................GTLLLRAPDEESGRLPLVRD---VVHAEDF--------E
Q9L1R9_STRCO/109-254......TGLPE...................DARPFRLDADDLPLPTLAEYCEEHPDQ....---.......--------.
S5VHB8_STRCU/197-386......TGLPE...................AAVVFHADT.DGPLRTLTEFTTGEPCDDRSG---.RPAPSA--------D
S5YXS3_PARAH/2-168LTKFHFVRFPDEKVAITSETLSGE.....................................---.......--------.
V6JYL3_STRNV/5-177......VGLPD................................TEWFMSKASLVASDSISL---AEWYAAR--------G
V6K0N1_STRRC/197-380......TGLPE...................EAVLFHADA.DVPLPTLREYATEDH......---.TGDHPL--------D

PF09346

A0RE58_BACAH/19-133----------------------------------------------VI......Q....QC---TN...AE--------I
Q81B84_BACCR/8-142----------------------------------------------FL......S....EY---NG...GT--------S
A4YB72_SHEPC/14-135----------------------------------------------FL......L....ET---NG...AE--------T
A0A0B5R2A8_BACTU/32-156----------------------------------------------FL......Q....VC---NG...GE--------L
B1YF81_EXIS2/16-130----------------------------------------------LF......L....QT---NG.....--------.
A6FHD8_9GAMM/19-145----------------------------------------------LI...........ST---YG...LV--------H
A4EPD0_9RHOB/35-163----------------------------------------------QV...........LS---FGLPKPT--------L
A0RAV0_BACAH/42-162----------------------------------------------LL......S....LM---NG...SF--------L
B8I5J3_CLOCE/15-125----------------------------------------------LL...........YL---SN...GF--------V
C3G559_BACTU/15-125----------------------------------------------LL......R....CT---NG...FS--------I
Q1DBU4_MYXXD/34-167----------------------------------------------FI...........ST---YG.....--------.
A5UV09_ROSS1/24-144----------------------------------------------FL...........SY---TD...GL--------L
Q6HMR4_BACHK/23-143----------------------------------------------FL......K....TV---NG.....--------.
Q1CV91_HELPH/17-134----------------------------------------------FI......K....RS---NY...GF--------S
A5TTY9_FUSNP/35-181----------------------------------------------IL......L....NY---SSHFEYF--------W
Q47P53_THEFY/18-133----------------------------------------------LL......R....ET---NG.....--------.
A0JSM0_ARTS2/15-129----------------------------------------------LL......A....ET---NG.....--------.
Q82GY4_STRAW/63-178----------------------------------------------VL......R....ES---NG.....--------.
Q81BW2_BACCR/27-144----------------------------------------------LL......Q....ET---NG.IEGE--------Y
A5UTX3_ROSS1/55-202----------------------------------------------FL......Q....LT---NG...AQ--------L
A6C6S9_9PLAN/31-128----------------------------------------------FY......A....VT---NG.....--------.
A5FCA9_FLAJ1/44-161----------------------------------------------FY......E....TF---GI...AD--------I
B7X333_COMTE/152-284----------------------------------------------YL......L....QL---GV...LD--------W
Q4K6P0_PSEF5/56-173----------------------------------------------YH......R....QL---GVLSLAE--------V
Q63C14_BACCZ/25-143----------------------------------------------FY......K....EI---GY...GF--------L
Q81BA7_BACCR/48-167----------------------------------------------FY......Y....RF---AG...PF--------W
Q89MJ4_BRADU/28-170----------------------------------------------FL......L....AC---AG...GY--------F
A3ZX28_9PLAN/24-139----------------------------------------------FL......L....RY---GG.....--------.
A0AMA9_LISW6/21-137----------------------------------------------FI......K....RF---GG...AF--------A
A5FMA4_FLAJ1/23-172----------------------------------------------FY......K....TV---GGIESDE--------T
A0A0B8QYA4_LISMN/14-152----------------------------------------------FY......R....QL---NL...CS--------N
Q9F2V0_STRCO/29-155----------------------------------------------LY......L....RI---GD...GG--------F
Q3BQF4_XANC5/29-173----------------------------------------------LY......A....RY---DG...GA--------V
A5FJY1_FLAJ1/42-170----------------------------------------------FL......Q....EI---GT...GQ--------F
Q1ZQF0_PHOAS/14-166----------------------------------------------FV......S....DI---DA...GE--------D
Q5WBD2_BACSK/23-138----------------------------------------------FI...........EL---MS...EY--------S
A5FGR4_FLAJ1/41-198----------------------------------------------FL......L....HI---GN...GG--------I
Q0RKI3_FRAAA/56-185----------------------------------------------FL...........AT---SD...GW--------P
Q9F3Q3_STRCO/47-179----------------------------------------------FL......M....VS---DG.....--------.
A6CDZ7_9PLAN/19-143----------------------------------------------FL...........KQ---YG...AT--------M
B3ZML8_BACCE/18-127----------------------------------------------LL...........SE---LG.....--------.
A4Y3I6_SHEPC/21-128----------------------------------------------YL......L.....Y---AS...DV--------I
A4Y9N5_SHEPC/8-116----------------------------------------------FI............K---SGYDLGD--------A
A4SRI0_AERS4/8-116----------------------------------------------FL...........KT---GSDVANA--------I
Q5LEK2_BACFN/47-168----------------------------------------------FL......MT...DT---NG...LH--------L
Q82RV7_STRAW/96-236----------------------------------------------FY......R....LR---NG..TGH--------P
A4FNW2_SACEN/30-166----------------------------------------------WW...........TC---CG...GT--------A
A5FAZ7_FLAJ1/185-329----------------------------------------------FY......KVQNVDY---DPVTAAF--------Q
A3I618_9BACI/42-194----------------------------------------------LL......Q....DV---NGTYHCK--------H
B4SN74_STRM5/28-184----------------------------------------------LL......S....RV---NGTHFRE--------Y
Q39NE9_BURL3/28-182----------------------------------------------LL......G....KL---DGTYWRD--------Y
Q6HHY9_BACHK/33-185----------------------------------------------LL......E....NI---DGTYWRK--------Y
A5TXY3_FUSNP/37-189----------------------------------------------LL......K....IV---DGTYFRE--------Y
E6XGA7_SHEP2/26-168----------------------------------------------LW......G....YA---NG...GN--------E
Q73QC3_TREDE/40-189----------------------------------------------LY......R....YK---NGSKYLS--------I
H2K898_STRHJ/18-144----------------------------------------------LW...........RL---SA...GE--------D
A6G0Q7_9DELT/31-170----------------------------------------------WL...........KT---NRNALNF--------M
Q9RYT7_DEIRA/27-166----------------------------------------------SL......L....RH---DGSVDDS--------W
Q93JL3_STRCO/163-310----------------------------------------------LY...........RV---VRARWQD--------W
A1ZXR5_9BACT/30-166----------------------------------------------FL......T....RF---NEYQSVT--------F
SMI1_CANGA/103-288----------------------------------------------SY......R....IH---DGQEDLE--------S
Q59YV1_CANAL/104-343----------------------------------------------YF......K....LV---DG...QY--------S
A5DZP7_LODEL/117-382----------------------------------------------FF......K....LT---DG...QL--------N
SMI1_DEBHA/98-296----------------------------------------------FY......K....IT---DG...QS--------Y
Q55KB3_CRYNB/120-282----------------------------------------------SI......Q....VA---DG...QD--------L
SMI2_DEBHA/142-319----------------------------------------------FY......K....RH---DGQFRGG--------K
A1C9R6_ASPCL/143-317----------------------------------------------SL......M....SH---DGQERPG--------L
SMI1_YARLI/171-356----------------------------------------------SC......L....IH---DG...QE--------K
A6EFN0_9SPHI/29-161----------------------------------------------LY......L....FA---DGTNIDT--------V
O07689_LISSE/36-156----------------------------------------------IL...........KL---SK.....--------.
A3ZN04_9PLAN/36-149----------------------------------------------FLKIARYVK....ID---DG...CE--------I
A7VFJ3_9CLOT/24-132----------------------------------------------WM......L....FS---DG...GE--------L
A4X269_SALTO/103-245----------------------------------------------WL......E....QT---NG...AQ--------P
E6XKF4_SHEP2/4-129----------------------------------------------AM......K....ID---NG...GE--------A
A0PQE6_MYCUA/4-131----------------------------------------------KT......M....AD---NG...GA--------V
Q8NRK2_CORGL/4-116----------------------------------------------RL......L....QN---NG...GE--------V
Q0VKY9_ALCBS/4-130----------------------------------------------KM......M....KS---NG...GG--------V
Q9F2N4_STRCO/160-298----------------------------------------------FL......K....AA---GG...CA--------P
A3KB11_9RHOB/18-152----------------------------------------------FL......L....TY---GG...GA--------P
Q1DEQ7_MYXXD/33-153----------------------------------------------FY......L....HC---DG...AE--------L
Q1CY42_MYXXD/19-141----------------------------------------------FY......L....HC---DG...AD--------L
Q09D40_STIAD/24-149----------------------------------------------FY......L....HC---NG...AE--------L
B1YEY9_EXIS2/39-159----------------------------------------------FL......E....LH---DG...AK--------L
Q5WJU2_BACSK/38-153----------------------------------------------FL......S....LH---NG...AR--------I
A7Z7P3_BACA2/41-156----------------------------------------------FL......K....LH---NG...AR--------I
YOBM_BACSU/42-161----------------------------------------------FM......T....LH---NG...AK--------I
A7Z5R7_BACA2/23-158----------------------------------------------FL......N....LY---GE...CW--------I
A3ZX25_9PLAN/22-154----------------------------------------------FL......R....QF---GA...CD--------L
A7VE32_9CLOT/35-145----------------------------------------------LL......L....NF---GG...CY--------L
A7MRN6_CROS8/1-150----------------------------------------------FL......L....LN---NGFVVKS--------P
B3Z4D7_BACCE/12-154----------------------------------------------FI......K....VN---NG...GS--------P
A5Z4R3_9FIRM/12-152----------------------------------------------FL......L....KS---NG...GY--------P
A5Z4R9_9FIRM/9-151----------------------------------------------FL......L....ES---NG...GT--------P
A1ZMA9_9BACT/9-138----------------------------------------------FL......L....EY---NG...GV--------P
A0A0B5R450_BACTU/12-152----------------------------------------------FL......L....SK---NG...GK--------T
J7Z7X1_BACCE/12-138----------------------------------------------CI......K....KN---NG...GY--------P
Q6HGG3_BACHK/12-159----------------------------------------------CV......M....KN---NG...AH--------V
Q6HGE4_BACHK/13-160----------------------------------------------CV......K....IN---GG...AG--------V
A0RAF8_BACAH/19-149----------------------------------------------CV......A....NY---NA...GR--------P
A7FEI4_YERP3/10-144----------------------------------------------FL......K....KY---NG...GY--------P
Q21ED8_SACD2/11-151----------------------------------------------FM......L....KY---NG...GD--------P
A6CCT7_9PLAN/22-151----------------------------------------------LL......D....TV---NG...GS--------P
Q6CS49_KLULA/64-193----------------------------------------------FY......M....KG---NG...GK--------L
B1J8X4_PSEPW/139-260----------------------------------------------LY......L....SS---NG...GY--------I
A7ML24_CROS8/19-151----------------------------------------------HY......L....RI---NG...GY--------L
A5FLI6_FLAJ1/11-131----------------------------------------------FY......L....LN---NG...GF--------L
Q7CL34_YERPE/11-153----------------------------------------------HY......L....SF---NG...GV--------P
Q5LEK4_BACFN/167-306----------------------------------------------FY......L....KF---NG...GM--------P
Q65VI9_MANSM/10-134----------------------------------------------LY......L....KF---NG...GQ--------P
B8I222_CLOCE/15-149----------------------------------------------HY......L....LY---NG...GY--------P
Q92KA2_RHIME/32-167----------------------------------------------LY......A....AH---DGQPAGS--------P
Q28UU7_JANSC/42-166----------------------------------------------LY......L....WR---DG.HGAY--------L
Q5LEK4_BACFN/11-139----------------------------------------------FY......L....KW---NG...GK--------P
Q5LEK9_BACFN/11-148----------------------------------------------FY......L....QY---NG...GS--------T
A7RYE8_NEMVE/119-257----------------------------------------------SY......R....IH---NG...QR--------L
G1S8C1_NOMLE/121-251----------------------------------------------SY......R....IH---NG...QK--------L
Q52KV8_XENLA/36-166----------------------------------------------SL......R....IH---NG...QK--------L
A0RFK3_BACAH/36-159----------------------------------------------FL......K....HA---NG.....--------.
Q9CND2_PASMU/14-158----------------------------------------------LI......T....KH---NAPGIIQ--------S
A6DN67_9BACT/17-158----------------------------------------------IL......L....IQ---NG...GT--------V
A9B016_HERA2/24-146----------------------------------------------FL...........QT---FG.....--------.
Q5WC01_BACSK/21-135----------------------------------------------YY...........KA---LG...RS--------P
A1ZUI6_9BACT/29-147----------------------------------------------FL......TVVGKTI---RG...FT--------W
Q47R76_THEFY/31-145----------------------------------------------FL...........RC---AGRSAGS--------L
A8M704_SALAI/21-139----------------------------------------------FL...........TN---MGSRAGR--------V
Q6NG79_CORDI/14-156----------------------------------------------IL......E....CC---GG...GI--------L
Q7DD43_NEIMB/1-117----------------------------------------------LA......Q....ST---HA.....--------.
A3I6Z7_9BACI/22-146----------------------------------------------WL......M....NY---GK...AR--------L
Q38V57_LACSS/13-131----------------------------------------------LC......Q....ET---NG...GF--------L
A4BCB8_9GAMM/14-147----------------------------------------------LL......K....QQ---NG...GY--------T
A0R498_MYCS2/11-150----------------------------------------------LL......R....RQ---NG...GY--------L
A6VZI9_MARMS/37-168----------------------------------------------IS...........KS---KETKVIR--------L
Q2BBP3_9BACI/17-145----------------------------------------------LM......K....KR---NG...FY--------L
Q816C2_BACCR/16-147----------------------------------------------LL......K....EQ---NG...GT--------L
A5TTM3_FUSNP/176-315----------------------------------------------LM......K....IQ---NG...GE--------L
A4X5D2_SALTO/28-164----------------------------------------------LA......R....RH---NG...GS--------F
Q11VT9_CYTH3/29-168----------------------------------------------LM......K....QH---NG...GT--------P
A1INP6_NEIMA/28-167----------------------------------------------LM......A....VQ---NG...GI--------F
H1GFW8_LISIO/124-264----------------------------------------------LM......RH...TQ---NG...GI--------V
B1KH37_SHEWM/28-163----------------------------------------------FM...........KN---YG...MR--------I
B1KH38_SHEWM/29-165----------------------------------------------FM...........KN---VG...RR--------L
Q8GDM6_PHOLU/25-137----------------------------------------------FL......N....NF---GG...GD--------I
Q926X2_LISIN/25-149----------------------------------------------FL...........EK---YG.....--------.
Q5DWB0_CLOPF/25-151----------------------------------------------FL......L....SF---GA...LS--------F
B1KPX6_SHEWM/17-136----------------------------------------------FL......L....EL---GSLSIGD--------I
A7Z5G8_BACA2/23-137----------------------------------------------FL......R....KY---GS...GG--------V
A7GQ33_BACCN/21-130----------------------------------------------FV......K....KF---GS...GG--------I
A4IKF8_GEOTN/21-132----------------------------------------------FL......K....EY---GS...GG--------I
A3ZX34_9PLAN/23-143----------------------------------------------FL......A....EY---GG...GG--------V
B7KWA7_METC4/14-155----------------------------------------------FA......Q....SC---GA...GR--------I
Q4K9A1_PSEF5/28-140----------------------------------------------FL......K....EC---GG...GY--------F
Q633D5_BACCZ/17-131----------------------------------------------FM......L....ES---NG...AE--------G
A5Z4Q5_9FIRM/17-131----------------------------------------------LI......L....FS---NG.IEGP--------I
A1TSU7_ACIAC/17-133----------------------------------------------FL......L....WS---NG...GQ--------A
Q8F615_LEPIN/16-123----------------------------------------------IL......L....WS---NG...GE--------G
Q5LEL2_BACFN/13-124----------------------------------------------FL......L....WS---NG...GE--------G

PF14568

Q7N9I9_PHOLL/26-145----------------------------------------------FL------Q----KY...GT---LS........F
G2TJC9_BACCO/28-148----------------------------------------------FL------L----SF...GA---GN........F
V5XPU7_ENTMU/27-147----------------------------------------------FL------S----SF...GA---LT........F
D3FRA3_BACPE/26-146----------------------------------------------YL------K----TF...GA---GN........F
Q4KGS7_PSEF5/49-173----------------------------------------------WL------L----EH...NG---KA........L
H6NAP1_9BACL/27-148----------------------------------------------FL------K----EY...GI---VS........T
X2H814_9GAMM/28-135----------------------------------------------FL------N----NY...GG---GD........I
A6X425_OCHA4/23-138----------------------------------------------LL------Q----KY...GA---VL........A
H8H3I1_DEIGI/15-142----------------------------------------------VL------Q----TH...NA---AY........F
H1Y7D2_9SPHI/29-143----------------------------------------------WL------K----NY...NG---GE........I
Q8DV31_STRMU/18-125----------------------------------------------AL------A----KF...GN---FE........V
R5BF88_9FIRM/22-126----------------------------------------------YL------K----QF...GA---IS........F
R4TCF2_AMYOR/45-152----------------------------------------------FM------V----RH...GG---GA........F
B1HSL3_LYSSC/34-146----------------------------------------------FL------L----EVGHCAG---LL........F
B8I223_CLOCE/18-129----------------------------------------------FF------K----EV...GY---GF........I
B9T8U5_RICCO/20-128----------------------------------------------YL------A----QF...GV---IA........F
B1YF88_EXIS2/12-121----------------------------------------------YF------K----KE...NK---FE........A
D3EC76_GEOS4/35-147----------------------------------------------FI------R----KF...GG---AY........A
YOKK_BACSU/26-163----------------------------------------------FL------K----KY...GG---CY........L
D1AMU4_SEBTE/16-153----------------------------------------------FL------K----KY...NG---AT........L
D5DHK7_BACMD/19-130----------------------------------------------FL------L----EI...GY---GF........L
D3V9F7_XENNA/31-140----------------------------------------------FS------T----NY...NA---GY........F
F2F0G1_SOLSS/15-152----------------------------------------------FI------K----KY...NG---GT........P
A8FII6_BACP2/16-121----------------------------------------------LL------K----QT...NG---CS........V
F0RDN6_CELLC/80-198----------------------------------------------FL------K----YF.GDGG---TW........I
L0DJE0_SINAD/14-143----------------------------------------------FL------A----KE...NG---GR........P
D3FRA7_BACPE/19-130----------------------------------------------FL------N----EI...GY---GF........I
C2X0Q7_BACCE/18-123----------------------------------------------LL------R----CT...NG---FS........I
R5ZM16_9FIRM/11-125----------------------------------------------FL------L----KY...NG---GD........T
W6EF85_SULMU/15-166----------------------------------------------LL------S----QH...NA---LT........P
H8H3H9_DEIGI/15-154----------------------------------------------FL------L----EH...NG---GS........P
D1AK41_SEBTE/28-142----------------------------------------------LL------N----NF...GS---CN........F
B1HQ89_LYSSC/39-149----------------------------------------------FI------K----MF...GG---AY........A
D1BM01_VEIPT/30-141----------------------------------------------LL------K----EF...GG---CH........F
Q2SDZ5_HAHCH/31-138----------------------------------------------FL------L----QY...GG---GY........F
A9C331_DELAS/17-129----------------------------------------------FL------L----GIGRGAG---IL........F
D1BM10_VEIPT/30-159----------------------------------------------LL------K----NH...NG---GV........V
YNAB_BACSU/14-117----------------------------------------------FL------L----QH...NG---ME........M
Q65PK7_BACLD/21-130----------------------------------------------LL------K----MT...NG---IN........D
E3EFQ0_PAEPS/15-152----------------------------------------------FI------K----EN...NG---VV........P
E3E4D6_PAEPS/30-142----------------------------------------------LL------L----YY...GA---CH........F
C3AIQ8_BACMY/23-155----------------------------------------------LI------K----SQ...NG---GT........P
D1AI41_SEBTE/179-313----------------------------------------------LV------R----LH...NG---GL........L
D5DG34_BACMD/42-148----------------------------------------------FL------Q----LT...NG---CN........L
G8LVX3_CLOCD/46-166----------------------------------------------FL------M----CA...NG---WKGFLHTIDLF
D7C627_STRBB/27-150----------------------------------------------LV------E----TY...GR---GE........F
B1HSJ7_LYSSC/16-121----------------------------------------------VL------K----EA...NG---FA........L
E6UH30_RUMA7/13-149----------------------------------------------LL------M----EN...NG---GV........P
W0EAP9_9FIRM/31-139----------------------------------------------FI------K----EY...GG---GY........F
C7PR05_CHIPD/29-163----------------------------------------------LM------K----LH...NG---GI........P
F2IDG4_FLUTR/12-130----------------------------------------------IL------K----KY...AG---LN........V
Q8A449_BACTN/32-166----------------------------------------------LM------K----QH...NG---GI........P
X5DYB7_9CORY/26-162----------------------------------------------VI------M----TT...GG---GI........L
Q81H93_BACCR/16-140----------------------------------------------CV------K----KY...DG---GY........P
K9VSA2_9CYAN/26-156----------------------------------------------FC------Q----VF...GT---GL........F
A5FC92_FLAJ1/15-125----------------------------------------------FL------I----LY...GL---GS........I
M5E8L2_9GAMM/13-128----------------------------------------------FV------K----KY...NG---SR........P
R6VPC4_9FIRM/166-289----------------------------------------------FL------I----RY...NG---GA........A
X2GNV0_9BACI/171-305----------------------------------------------LM------K----QH...NG---GV........P
C5ANN1_BURGB/12-131----------------------------------------------HY------I----TY...NG---GY........P
C3AJS9_BACMY/32-166----------------------------------------------LM------K----KH...NG---GI........P
YXXD_BACSU/19-130----------------------------------------------FY------L----EV...GY---GF........I
R6UAS7_9CLOT/11-122----------------------------------------------II------L----NY...NG---GR........P
E6TT52_BACCJ/18-135----------------------------------------------LM------K----LY...NG---GR........P
Q81XQ3_BACAN/19-145----------------------------------------------LL------K----EQ...NG---GT........L
Q3IK24_PSEHT/11-122----------------------------------------------VL------P----VL...NR---GK........P
H6NG08_9BACL/105-217----------------------------------------------FL------L----TAGHGAG---RL........L
A8FAT3_BACP2/20-143----------------------------------------------LI------L----EQ...NG---GY........T
C3AMY1_BACMY/25-162----------------------------------------------FI------K----KN...NG---AI........P
C3AU00_BACMY/12-136----------------------------------------------FL------L----KY...NG---GY........P
D3FZU7_BACPE/33-153----------------------------------------------LM------N----EQ...NG---GE........L
E6UJV2_RUMA7/27-143----------------------------------------------LL------R----VQ...NG---GC........P
F4AXJ4_DOKS4/15-148----------------------------------------------FL------L----EN...NG---GI........S
B1YEX8_EXIS2/18-145----------------------------------------------KM------E----EQ...NG---GD........I
C3ATZ9_BACMY/28-146----------------------------------------------FL------K----YA...NG---WK........G
C3ATZ8_BACMY/15-152----------------------------------------------FI------K----LH...NG---GL........P
Q9X366_BACAN/16-140----------------------------------------------CV------K----KY...DS---GY........P
C2X3A0_BACCE/19-143----------------------------------------------CV------K----KY...DG---GY........P
K9ZKW6_ANACC/21-135----------------------------------------------FL------K----MMGHGAG---KF........L
F0SMF1_RUBBR/22-135----------------------------------------------LL------K----ET...NG---LQ........G
R5LQ27_9SPIR/14-127----------------------------------------------YI------T----EY...NA---GE........P
F3ZZP4_MAHA5/26-131----------------------------------------------LL------L----EM...NG---DN........W
U5L8D3_9BACI/50-163----------------------------------------------LY------K----ET...NG---VY........G

PF14567

Q81B94_BACCR/6-143----------------------------------------------FI------E----LM---SE---YV--------F
C7N7K9_SLAHD/5-132----------------------------------------------YL------N----IY---SY---GG--------I
K4KKC1_SIMAS/1-134----------------------------------------------FL------L----ET---GD---LL--------V
Q0VNR5_ALCBS/1-133----------------------------------------------FL------L----SA---SD---IV--------C
D4ZBL0_SHEVD/1-131----------------------------------------------YL------L----YA---SD---VI--------Y
Q21KG4_SACD2/2-132----------------------------------------------YL------L----HS---SN---CI--------Y
A6X428_OCHA4/5-137----------------------------------------------FL------K----NV---SN---AF--------V
Q81Q97_BACAN/1-122----------------------------------------------FL------K----QY---GS---GG--------L
S6B2A8_PSERE/1-133----------------------------------------------FL------L----KV---SD---VV--------Y
YOBK_BACSU/6-138----------------------------------------------FL------E----KY---GA---GG--------L
F2K758_PSEBN/1-133----------------------------------------------FL------L----TV---SD---VV--------Y
Q880E4_PSESM/5-136----------------------------------------------FA------K----EA---SD---SI--------F
X2GZW0_9GAMM/4-146----------------------------------------------FI------L----LV---GG---GG--------V
U5MVI7_CLOSA/6-138----------------------------------------------FL------G----KY---GF---GG--------I
Q5WIS2_BACSK/1-155----------------------------------------------YL------K----TF---GA---GN--------F
Q8EAQ0_SHEON/1-131----------------------------------------------YL------L----HA---SD---VI--------Y
B8CQS9_SHEPW/1-121----------------------------------------------YL------M----EA---SD---VI--------V
I0GP53_SELRL/13-146----------------------------------------------FL------K----EY---GA---SS--------V
B3PC71_CELJU/34-164----------------------------------------------FL------L----EV---SD---VV--------Y
D3FRA5_BACPE/5-133----------------------------------------------FV------K----HY---GS---GG--------I
M4X311_PSEDE/1-131----------------------------------------------FL------L----KV---SD---VI--------Y
Q12R95_SHEDO/1-131----------------------------------------------YL------M----EA---SD---VV--------Y
D5HHH7_9FIRM/5-133----------------------------------------------FL------K----NY---GH---GG--------L
D5SSH7_PLAL2/5-147----------------------------------------------FL------E----EY---GG---GG--------I
N0B2R8_9BACI/1-137----------------------------------------------LF------K----LT---NN---AQ--------I
G8M281_CLOCD/7-139----------------------------------------------FI------E----NY---GH---GG--------I
G2Z5P5_FLABF/2-145----------------------------------------------FI------K----KF---GG---AY--------A
A3QH89_SHELP/1-131----------------------------------------------YL------L----YA---SD---VI--------H
R6FTE9_9CLOT/5-133----------------------------------------------FI------L----NY---GS---GG--------I
R5TPA4_9FIRM/24-155----------------------------------------------FL------K----EY---GC---GG--------Y
Q086X2_SHEFN/1-131----------------------------------------------FL------L----YG---SD---VI--------Y
C1D4A4_DEIDV/3-141----------------------------------------------YL------L----TL---SD---VL--------A
D3FZM0_BACPE/6-143----------------------------------------------FI------E----LM---SK---YS--------F
A1S8W2_SHEAM/1-131----------------------------------------------YL------L----NA---SD---VI--------V
Q7M7B0_PHOLL/5-136----------------------------------------------VL------K----KI---SN---IF--------Y

PF07348

SYDP_KLEP7/6-179----------------------------------------------YY----------------TTQFAGD--------M
SYDP_COLP3/9-191----------------------------------------------YF----------------TTIFSGD--------I
I2B5Z7_SHIBC/5-178----------------------------------------------FW----------------CSQYAGD--------M
R5V7K9_9FIRM/4-185----------------------------------------------FL----------------STYWFLA--------L
SYDP_YERPE/6-179----------------------------------------------FY----------------TQQYAGD--------M
K7A551_9ALTE/8-182----------------------------------------------FY----------------SAYWSDN--------L
E0SCC1_DICD3/6-178----------------------------------------------FF----------------TSQFAGD--------M
X2H3P8_9GAMM/9-173----------------------------------------------FY----------------GTQYAGN--------M
D4ZHN4_SHEVD/5-186----------------------------------------------FF----------------GEYFSAP--------L
D8MW85_ERWBE/6-178----------------------------------------------WY----------------STQFAGD--------M
SYDP_CROS8/6-179----------------------------------------------FY----------------ASQYAGD--------M
F5Z4L7_ALTSS/6-183----------------------------------------------FF----------------TQFFSNN--------L
SYDP_SHEAM/4-180----------------------------------------------FY----------------GHLFGGP--------L
J7U684_MORMO/6-178----------------------------------------------FY----------------TQQFAGD--------M
E1STK9_FERBD/4-172----------------------------------------------LY----------------GHFYAGN--------L
I0DWV2_PROSM/6-180----------------------------------------------FY----------------TTQLAGD--------M
SYDP_IDILO/6-175----------------------------------------------LF----------------GRWYAGD--------L
C2X4F6_BACCE/19-188----------------------------------------------YF----------------NSYWFAD--------L
SYDP_EDWI9/6-178----------------------------------------------FF----------------TTQYAGD--------M
M4UN22_9GAMM/6-180----------------------------------------------FF----------------CSVYSAG--------I
H2IXL4_RAHAC/6-178----------------------------------------------FY----------------TTQYAGD--------M
G4QLZ8_GLANF/9-186----------------------------------------------LF----------------CRYYSHD--------L
E6WGC7_PANSA/6-178----------------------------------------------FY----------------TTQFAGD--------M
SYDP_ERWT9/6-179----------------------------------------------FY----------------TSQFAGD--------M
SYDP_VIBCH/6-179----------------------------------------------FY----------------ASQFSAD--------M
SYDP_PHOLL/6-180----------------------------------------------FY----------------TSQLAGD--------M
W0HTY4_9ENTR/12-183----------------------------------------------YY----------------CSQYAGD--------M
B4F2E3_PROMH/5-178----------------------------------------------YF----------------TTQYAGD--------M
SYDP_VIBF1/6-179----------------------------------------------FY----------------GTQYSAD--------M
SYDP_VIBTL/6-179----------------------------------------------FY----------------GAQFSAD--------M
A8GIF5_SERP5/18-190----------------------------------------------FY----------------TQQYAGD--------M
F7YLH7_VIBA7/10-183----------------------------------------------FY----------------GVQFCAD--------M
SYDP_ALTMD/6-178----------------------------------------------YF----------------TTYYSDN--------L
SYDP_SHELP/5-184----------------------------------------------FY----------------GRYFAAP--------L
F0LVK8_VIBFN/6-179----------------------------------------------FY----------------GAQFSAD--------M
SYDP_HAHCH/7-185----------------------------------------------FY----------------GSYWSDG--------L
SYDP_TOLAT/7-177----------------------------------------------YY----------------GHGYAGQ--------I
SYDP_PECAS/6-179----------------------------------------------FY----------------TAQYAGD--------M
SYDP_SHEON/4-180----------------------------------------------FY----------------GQYFAAP--------V
SYDP_PHOPR/6-179----------------------------------------------FY----------------STQFSGD--------M
SYDP_AERHH/6-178----------------------------------------------LF----------------GGWFSRP--------V
SYDP_SHEFN/4-180----------------------------------------------FY----------------GQYFSAP--------L
D3VCK7_XENNA/6-179----------------------------------------------YY----------------VTQFAGD--------M
D3UWF0_XENBS/6-179----------------------------------------------YY----------------VTQLAGD--------M
SYDP_PSEA6/6-182----------------------------------------------FY----------------SRYWSDN--------I
SYDP_VIBPA/6-178----------------------------------------------FY----------------GSQYSAD--------M
SYDP_ECOLI/6-179----------------------------------------------FY----------------TTQFAGD--------M
SYDP_SHEDO/4-180----------------------------------------------FY----------------ASFFSAP--------L
SYDP_VIBVY/6-179----------------------------------------------FY----------------GSQLSAD--------M
H2FY10_OCESG/7-174----------------------------------------------LF----------------GHYYAGH--------L
SYDP_PSYIN/6-180----------------------------------------------FF----------------CSAYSAG--------L
SYDP_PSEHT/6-178----------------------------------------------LY----------------GHMYGGN--------I

PF02393

D2K3J3_HCMV/211-336VEGG-------------------------HLLRNI--KTAFG--------------------------------------
B8YE72_HCMV/157-296VVRA-------------------------GGSIQT--MELMI--------------------------------------
A8T728_HCMV/200-332EVES-------------------------RRWWWA--VRANL--------------------------------------
D2K4S5_HCMV/202-333DFRD-------------------------LLNFIR--QRLCC--------------------------------------
D3YS52_HCMVO/180-322RLAE-------------------------CEMYVT--LQLRC--------------------------------------
D2K3X0_HCMV/202-332QFND-------------------------LLKFFV--DRLCC--------------------------------------
D2K5D0_HCMV/151-256...S-------------------------EINDWR--VMVGS--------------------------------------
C8BKJ5_HCMV/34-153QMNL-------------------------SKISWL--ERHCP--------------------------------------
D2K5D0_HCMV/11-135GRDA-------------------------QRLAS.--.YLCC--------------------------------------
B9VXJ9_HCMVT/546-653EANN-------------------------F.....--.VIGV--------------------------------------
B9VXD4_HCMVT/116-247QLSP-------------------------RDAWIV--LVATV--------------------------------------
C3Y900_BRAFL/167-275MERF-------------------------RVWKCS--.FAYV--------------------------------------
C3Z365_BRAFL/157-265MARF-------------------------RLLECS--.FGYV--------------------------------------
B9VXL1_HCMVT/265-382EDPA-------------------------HGNWLK--.ETCS--------------------------------------
D3YRX5_HCMVO/17-135VCSQ-------------------------GA....--.YVCC--------------------------------------
Q14VM9_RAHV1/5-123TRPQ-------------------------VVEDWN--.SCYL--------------------------------------
D2K5D5_HCMV/214-331AS..-------------------------MLRRFQ--RSLYT--------------------------------------
A8T728_HCMV/45-168..TA-------------------------AKQAAS--KLICC--------------------------------------
D2K4G8_HCMV/126-245GHLN-------------------------IKGLEK--TFLCC--------------------------------------
D2K595_HCMV/6-123LTPR-------------------------DVEYWK--LLVVT--------------------------------------
C3RWK6_FRG3V/35-153GETF-------------------------MLESWR--.VLYL--------------------------------------
C3RWV3_FRG3V/65-186GEQY-------------------------TLESWE--.ELYL--------------------------------------
C1C3V1_LITCT/15-136GENY-------------------------RLESWG--.QNFL--------------------------------------
D2E8A7_ANHV1/5-121GDDD-------------------------IVSAWE--.TLFL--------------------------------------
Q070N0_CPRVZ/47-172DLEH-------------------------QMEDWA--.YLYL--------------------------------------
B5XAY6_SALSA/21-139GDGE-------------------------QLEVWK--.DCYL--------------------------------------
B4YEM5_9ALPH/49-167GQEE-------------------------LLEYCE--.ALYL--------------------------------------
B1NFI8_ADEGX/15-131G.QH-------------------------LKEYCE--.VLYL--------------------------------------
F5HIG2_HCMV/399-518GVVR-------------------------DHKTYR--RFSCL--------------------------------------
D3YRW4_HCMVO/69-190.KPE-------------------------DVKAWS--HYLCC--------------------------------------
B9VXJ9_HCMVT/55-169LTEI-------------------------DLEHCQ--.NDFF--------------------------------------
C8CFJ9_HCMV/42-158MPEL-------------------------RDQLLD--DVICC--------------------------------------
B9VXG6_HCMVT/274-510LLTA-------------------------VRRHLN--QRLCC--------------------------------------
Q4KS78_ISKNV/1-104.DSN-------------------------TIRGWS--.KFYL--------------------------------------
C8CFJ8_HCMV/54-179PQIY-------------------------ARSLAA--DYLCC--------------------------------------
A8T729_HCMV/26-179VTDG-------------------------PETPWG--QLICC--------------------------------------

PF14433

A9B4M4_HERA2/8-176IFPL-------------------------AEAFLR--QFGEL...........................TTLGCYNRFIF
A9B983_HERA2/8-176IFPE-------------------------AQRIFT--ALGMLNLNLQHLPPIPPDPRTTTPDPIALRDHLWYADIRIDFD
A9B4M5_HERA2/2-165IFPQ-------------------------LIEILS--RYGGF.....RLNSLDIAQPWTLDASLEALFVWTDSPLEIQLL
A6LWQ5_CLOB8/2-136VFDA-------------------------ARKFLE--EFGEL..............................NIIPKYID
Q97CY9_CLOAB/2-136VFEA-------------------------ARKFME--EFGEV..............................HIIAKYID
Q97CZ0_CLOAB/1-146IFPE-------------------------AKKFLE--EFGMI......................DVYCPINPRIPEEDIK
G8LY23_CLOCD/3-138VFPK-------------------------VKEFLQ--EYGML................................EFRIHH
C0Z7L3_BREBN/1-129VFPE-------------------------VKNFLK--EFGNL......................VIEDSINDETHNTSIR
D1ALL2_SEBTE/4-148CNDM-------------------------QLKFLK--NFSYL.................................EITFE
G8LVN3_CLOCD/3-139VSNT-------------------------VRDFLE--EFGLL...................................KIS
R7KV91_9FIRM/6-151VSDE-------------------------AKEIID--NFYML..........SIGKHGTFKDGTFVITENDDIENKLVVY
B1HSL5_LYSSC/4-140VFDC-------------------------VKEALE--QFGEL......................KCIYEYNGKLDDFVID
X2GUJ6_9BACI/4-141VGSV-------------------------VKEALE--QFGGL......................EYKFSDGNDFENFIII
K9X3G6_9NOST/4-142IYPT-------------------------VMNFLS--SFGGL..........HVKYPHKRVPRLEDDFHFNVPEAVANIY
A4X261_SALTO/96-238CFPA-------------------------VRAALI--EFGGL..........IL..PQLGRSGEP......GAGFASGIQ
F4F239_VERMA/96-237CPPA-------------------------ARAALV--EFGGL..........TL..PQFGRTGRA......GAGFTSYLH
A4X254_SALTO/5-149IVRA-------------------------AVEAYG--EFGGL..........LV..RPQ.GDGEQ......IAPSTFHLD
F4F315_VERMA/5-149MTPA-------------------------AMQAYA--EFGGL..........RL..HPQ.GAGEQ......VAPSDVHLD
B1VUI9_STRGG/11-155VFPA-------------------------AVEAWA--EFGGL..........RI..TAS.APGRQ......IAPAAVRID
G2NEF9_STREK/19-163VFPA-------------------------AVEAWA--EFGGL..........RV..TAS.APGRQ......IAPAVLRID
B5GPR4_STRC2/10-154VSPA-------------------------AVEAWA--EFGGL..........RI..APP.GPGRQ......TAPPVVLME
D6X5Y7_STRPR/10-154VFPA-------------------------VVEAWA--EFGGL..........TV..VAP.GPGRQ......HAPAPLRFD
F2R7E3_STRVP/10-154VFPA-------------------------VVEAWA--EFGGL..........RV..TAP.GHGRQ......IAPAAVRFD
V6JXA9_STRNV/9-153VFAA-------------------------VVEIWA--EFGGL..........TV..TGP.APGRQ......IAPATVRFD
F8JWB4_STREN/11-156VFPA-------------------------AVEAWA--EFGGL..........TV..TAEDTEGQE......VAPSGLTVD
B5I7H7_9ACTN/11-155VFPA-------------------------AVEAWA--EFGGL..........HL..TPA.GPGRQ......VAPAHLHLD
K4R8Z5_9ACTN/11-155VFPA-------------------------AVEAWA--EFGGL..........HI..TPP.GPGRQ......VAPARVHVD
H2JSV2_STRHJ/11-155VFPA-------------------------AVEAWA--EFGGL..........SI..TPA.GPGRQ......IAPAGLHVD
V6K5C4_STRRC/24-168VFPA-------------------------AVEAWA--EFGGL..........RI..TPS.GPGRQ......IAPATLHLD
S5VNY2_STRCU/11-155VFPA-------------------------AVEAWA--EFGGL..........HI..TPG.GPGRQ......VAPATLHID
Q9F2N2_STRCO/11-155VFPA-------------------------AVEAWA--EFGGL..........HI..APT.GPGRQ......IAPATLHLD
C9YY15_STRSW/11-155VFPA-------------------------AVEAWA--EFGGL..........RL..TAQ.GPGRR......LAPADLHLD
Q82HF0_STRAW/11-155VFPA-------------------------AVEAWA--EFGGL..........HL..TAQ.GPGRQ......LAPATLHLD
D7BTM5_STRBB/9-153VFPA-------------------------AVEAWA--EFGGL..........HV..IPP.GAGRH......IAPASFHID
G2PAB9_STRVO/37-181VFPA-------------------------AVEAWA--EFGGL..........HI..QPP.GAGRE......IAPTPFRID
V4J1P0_9ACTN/10-159VSPA-------------------------AVESWA--EFGGL..........RI..APK.GPGRQ......LTPSTFRID
F3ZHS7_9ACTN/28-172VSPA-------------------------AVEAWA--EFGGL..........TP..HPT.AKGRH......LAPASLDLD
D9TC01_MICAI/257-399AFPA-------------------------AEAALT--AFPAV..........LS..RRR.GPGEQ......VWISRFTTN
F4F5L1_VERMA/256-398VPPA-------------------------ALRTLT--AFPSL..........VG..AKL.GPGEE......VWISRFDIR
R4LXK7_9ACTN/252-397MFPA-------------------------ARAAIM--DFPGV..........FC..GLR.APGVH......RQIRWLNLE
U5WFU2_9ACTN/252-397VFPA-------------------------AREAVM--AFPGI..........FC..GLR.GPGVR......RWVRWLNLE
B1VX82_STRGG/6-147PSAA-------------------------ALSFIR--EHVSL..........RAVIDTA.............PENFAIFT
F2RCB0_STRVP/3-144PFPA-------------------------ARDFVR--AFGGL..........RLVIPGS.............PPAAVGFT
Q82G08_STRAW/6-147PVSA-------------------------AVRFIH--TYGML..........RLDHPKA.............SGCAWVMK
D1A3E8_THECD/8-146MHTA-------------------------AARFLA--EFGGL..........KVPEGPN.EPGQQ......VASDEFDLD
F4FAN2_VERMA/7-145LHPV-------------------------ARRFLT--EFGGL..........TV..HNS.EPGVT......RAREPFTLV
D0J054_COMT2/5-146SHP.-------------------------AVAALQ--NLAGL...................HIGQVGKGRECASSDIEFD

PF14435

A7HBV7_ANADF/6-194GAGA-------------------------EAAGVAGWVLGSM....RDPLAWDDEPS-----------------------
B1VPR4_STRGG/19-175....-------------------------........TIGAH......GEFVKFGST-----------------------
B1VUJ2_STRGG/672-850QAAP-------------------------DAGSYL..VMGTD.............FG-----------------------
B1VYJ1_STRGG/2-183ALPT-------------------------SRGPLY..RLTEQ......ADPDDRAER-----------------------
B5H683_STRPR/212-402TLPP-------------------------DAEHLL..VLGGL............MHD-----------------------
B5HAJ0_STRPR/5-188HFPA-------------------------GVESVV..KIGAF.............PI-----------------------
B5HAW8_STRPR/38-231PFSR-------------------------VAGRFW..SLGLT..........DTWPA-----------------------
B5HNY7_9ACTN/216-393ALPP-------------------------RAGHLI..VLGHL............IED-----------------------
B5I6T5_9ACTN/5-183DLPE-------------------------GAEGWL..LLGMV.............PY-----------------------
D1A3F0_THECD/2-169VGDN-------------------------EPMGLL..ALGAV...........PDEK-----------------------
D1A5L5_THECD/5-198ELPA-------------------------MCADFL..LLGDW.............NS-----------------------
D7C074_STRBB/2-188KFPP-------------------------EVRDDI..VIAAG.............MG-----------------------
D9T329_MICAI/3-173LGDQ-------------------------GPRPYV..VLGAS..........PEDPA-----------------------
E2Q6I7_STRC2/663-841RSAS-------------------------DAASYL..VVGND.............FG-----------------------
E4N1Q1_KITSK/248-421AAPL-------------------------DATAWL..PLGRF.............GE-----------------------
E4NG11_KITSK/606-780PPGP-------------------------DFGGYL..VLGND.............YG-----------------------
F3ZHT0_9ACTN/605-784AAAP-------------------------DAGTYL..VVGSD.............FG-----------------------
F5XQA6_MICPN/2-160PSDR-------------------------RPGPPI..RFGTD.............GG-----------------------
F9GD57_FUSOF/7-186QVPP-------------------------GAERWI..SLALI.............PY-----------------------
G8WZI2_STREN/529-708QSAP-------------------------DASSYL..VIGND.............YG-----------------------
H2JJX8_STRHJ/242-430PDGV-------------------------ATADLI..AFGTT.............EY-----------------------
H2JNL8_STRHJ/197-379ELPA-------------------------HCDHLI..RLGHL............LED-----------------------
H2JQV0_STRHJ/213-403QLPP-------------------------DAEHLV..VLGGL............VHD-----------------------
H2K7D5_STRHJ/5-186DAGE-------------------------GAGGWP..VIGWL.............LN-----------------------
I0H563_ACTM4/37-227....-------------------------........VLGSY.............GS-----------------------
I0H8Z2_ACTM4/10-174QLAH-------------------------AHGLDR..IFGAA...............-----------------------
I0HE25_ACTM4/11-180....-------------------------........VIGREQITPNHVHEAGCTEC-----------------------
Q47PK6_THEFY/246-429TLAA-------------------------TLGEYV..RIGSD.............GG-----------------------
Q82D46_STRAW/202-388ELPA-------------------------GADHLI..RLGHL............LED-----------------------
Q9K3X2_STRCO/5-185AASR-------------------------DAGGWP..VIGWL.............LN-----------------------
Q9L1R9_STRCO/109-254PVPP-------------------------GADHLV..RLGRL............ADG-----------------------
S5VHB8_STRCU/197-386ALPA-------------------------HSDHLI..RLGHL............VED-----------------------
S5YXS3_PARAH/2-168....-------------------------........IFGTC.............DY-----------------------
V6JYL3_STRNV/5-177DVPD-------------------------ECRNWL..VLGLF.............AD-----------------------
V6K0N1_STRRC/197-380ELPA-------------------------HADHLI..RLGHL............VGG-----------------------

PF09346

A0RE58_BACAH/19-133NVKN..........................EIYIR--ILGPI--------------------------------------
Q81B84_BACCR/8-142KVRY................SKFFVKELNQEIPLD--VLYGI--------------------------------------
A4YB72_SHEPC/14-135PIGV........................QEPDDSV--VLWSA--------------------------------------
A0A0B5R2A8_BACTU/32-156FIPG..............................T--VLSEI--------------------------------------
B1YF81_EXIS2/16-130.............................AQFGEW--TLYPI--------------------------------------
A6FHD8_9GAMM/19-145TPNV.............................LT--KICDL--------------------------------------
A4EPD0_9RHOB/35-163ALLT........................AITDREI--DLHDL--------------------------------------
A0RAV0_BACAH/42-162ANLV.........................RIAGQP--KVGGL--------------------------------------
B8I5J3_CLOCE/15-125TDDG..............................I--AIFGT--------------------------------------
C3G559_BACTU/15-125GSGL...................LIYGTEHIAERN--EVWEV--------------------------------------
Q1DBU4_MYXXD/34-167..........................TFKVLHGGR--ELIGM--------------------------------------
A5UV09_ROSS1/24-144YNGL...............................--MIYAS--------------------------------------
Q6HMR4_BACHK/23-143.............................LDFDGL--VLYGV--------------------------------------
Q1CV91_HELPH/17-134QWRS..........................FMVGN--ESYTF--------------------------------------
A5TTY9_FUSNP/35-181STYK...........DEEEEQIEFPENFRAVFSGD--LHWGL--------------------------------------
Q47P53_THEFY/18-133...........................VWNEYGDA--VVWSA--------------------------------------
A0JSM0_ARTS2/15-129...........................IEGEYGLG--LLWST--------------------------------------
Q82GY4_STRAW/63-178...........................IVGEYGNH--LVSPI--------------------------------------
Q81BW2_BACCR/27-144GDFI.......................WSASKIKT--ENMSM--------------------------------------
A5UTX3_ROSS1/55-202YVAP..............LAWKPSWSTKGDYIHYH--IFSTL--------------------------------------
A6C6S9_9PLAN/31-128...................................--.MDLL--------------------------------------
A5FCA9_FLAJ1/44-161GEQL..............................Q--DFEEV--------------------------------------
B7X333_COMTE/152-284AERL...................LSPRFDLMAPDA--DMDAI--------------------------------------
Q4K6P0_PSEF5/56-173LCSV.............................GP--GHTPI--------------------------------------
Q63C14_BACCZ/25-143EASD..........................RFFFN--RFMDP--------------------------------------
Q81BA7_BACCR/48-167EVHV..........................PYELL--DIIDE--------------------------------------
Q89MJ4_BRADU/28-170QGSA.................EFNWPQGHWAGAVQ--EVLGL--------------------------------------
A3ZX28_9PLAN/24-139.............................AMVGPY--PVFGL--------------------------------------
A0AMA9_LISW6/21-137GISI.........................HAFSNE--SLIGK--------------------------------------
A5FMA4_FLAJ1/23-172FRIS.............SAENLIRYMKQRTAFSHN--SAGII--------------------------------------
A0A0B8QYA4_LISMN/14-152VGDT........................CWFLLEE--DFLEN--------------------------------------
Q9F2V0_STRCO/29-155GPEY...............................--GLLPL--------------------------------------
Q3BQF4_XANC5/29-173QMAR.................GQSLEEPDNWLKAE--WLFPR--------------------------------------
A5FJY1_FLAJ1/42-170FIGE..........................YFAKF--ELYNL--------------------------------------
Q1ZQF0_PHOAS/14-166YCFN..............EYPEEYPDFEGRYWAFF--DEELL--------------------------------------
Q5WBD2_BACSK/23-138FPGD...............................--.ILNV--------------------------------------
A5FGR4_FLAJ1/41-198SYQNSAAGPGYGIFPFGENVDEFVYSNPENCLSQD--CFIYP--------------------------------------
Q0RKI3_FRAAA/56-185NPAE..........WIDELHASAEVAWFRDTPDGT--GFIDL--------------------------------------
Q9F3Q3_STRCO/47-179..............WRHAGGFVWLLAGTADARWHD--DASGL--------------------------------------
A6CDZ7_9PLAN/19-143GVGF............................EIA--GLFDS--------------------------------------
B3ZML8_BACCE/18-127...................................--.IISL--------------------------------------
A4Y3I6_SHEPC/21-128YGAI...............................--EPVTV--------------------------------------
A4Y9N5_SHEPC/8-116PIEA..............................L--EISNP--------------------------------------
A4SRI0_AERS4/8-116FEAA...............................--VILPG--------------------------------------
Q5LEK2_BACFN/47-168FHHF...............................--...SL--------------------------------------
Q82RV7_STRAW/96-236GDFG.........................WTPEPD--TGLPL--------------------------------------
A4FNW2_SACEN/30-166TDVL.......................ADVLPPFY--TPYSP--------------------------------------
A5FAZ7_FLAJ1/185-329FGIN...........................NWSY--DLIPF--------------------------------------
A3I618_9BACI/42-194GQEN................ISVLVLGSDLGDYPY--YLKAV--------------------------------------
B4SN74_STRM5/28-184PGGE..............VCVLMLGSDVEGGGYPY--YLRSV--------------------------------------
Q39NE9_BURL3/28-182GGTT................VNVLVLGSDVYEYPY--YLLSA--------------------------------------
Q6HHY9_BACHK/33-185GENE................VTVCILGSDVEEYPY--YLLST--------------------------------------
A5TXY3_FUSNP/37-189KGKT................VASYFLGSDVEEYPY--YLLSS--------------------------------------
E6XGA7_SHEP2/26-168WSTV.....................FARKDYFCRY--DFLSL--------------------------------------
Q73QC3_TREDE/40-189LPCV....................IDEIEMPFNLM--SLQTV--------------------------------------
H2K898_STRHJ/18-144GVAG.......................SGLMLGNW--ALMPL--------------------------------------
A6G0Q7_9DELT/31-170GNYG......................ANDPKRIAE--GIRGT--------------------------------------
Q9RYT7_DEIRA/27-166PTGE...............................--.LLSL--------------------------------------
Q93JL3_STRCO/163-310RGDY...................AAQERVVDAVGC--ELLPL--------------------------------------
A1ZXR5_9BACT/30-166FEYK....................SLSISDIYDNW--RLLTN--------------------------------------
SMI1_CANGA/103-288MTGT........................SGLIYGL--QLMTL--------------------------------------
Q59YV1_CANAL/104-343DFES........................SGLIFGL--KLMSL--------------------------------------
A5DZP7_LODEL/117-382FGSS...................LNIETNGLIFGL--KLMSL--------------------------------------
SMI1_DEBHA/98-296FNDN......................GSGGLVFGL--KLMPI--------------------------------------
Q55KB3_CRYNB/120-282ETTG...................NISGSGGLFFGL--YFLPL--------------------------------------
SMI2_DEBHA/142-319PTGL...........................VMGL--TLLDL--------------------------------------
A1C9R6_ASPCL/143-317PTGV...........................IFGC--MLLDC--------------------------------------
SMI1_YARLI/171-356FGRP........................SGIIFGI--TLLDL--------------------------------------
A6EFN0_9SPHI/29-161TPSG.......................LTGLIPIH--NFLSL--------------------------------------
O07689_LISSE/36-156.............................KIYWYW--TLFGK--------------------------------------
A3ZN04_9PLAN/36-149GGLD..........ANGV.................--YVTER--------------------------------------
A7VFJ3_9CLOT/24-132FLPA.............................GV--QLYGI--------------------------------------
A4X269_SALTO/103-245EMEH.........................HVPGRP--FVL..--------------------------------------
E6XKF4_SHEP2/4-129STEE............................DDW--EFYPI--------------------------------------
A0PQE6_MYCUA/4-131.ETS...........................SDVW--DLHPF--------------------------------------
Q8NRK2_CORGL/4-116IDNE...........................NNDW--ILHPV--------------------------------------
Q0VKY9_ALCBS/4-130EVST.........................DYFEIH--PFYDT--------------------------------------
Q9F2N4_STRCO/160-298VGTA....................LDAELGLLVDQ--PFFTV--------------------------------------
A3KB11_9RHOB/18-152YPLI..............................F--DYAPD--------------------------------------
Q1DEQ7_MYXXD/33-153FRRL..........................PDANY--SILSL--------------------------------------
Q1CY42_MYXXD/19-141FGTV...........................DPAF--SFFPL--------------------------------------
Q09D40_STIAD/24-149IERL..........................PNSPY--LILPL--------------------------------------
B1YEY9_EXIS2/39-159FMLG...........................DEGL--VLYPL--------------------------------------
Q5WJU2_BACSK/38-153YESM.....................YSGEPAGGGL--ELFAL--------------------------------------
A7Z7P3_BACA2/41-156FDLL.....................FYGENVGGGL--HILNV--------------------------------------
YOBM_BACSU/42-161FEIL.....................SDGENIGGGL--QLFSL--------------------------------------
A7Z5R7_BACA2/23-158EEDN...........VFFPVLEDNPLADNGNLRLG--YFYGL--------------------------------------
A3ZX25_9PLAN/22-154EEYA...............................--VILTE--------------------------------------
A7VE32_9CLOT/35-145AEPW.............................IF--TLKEL--------------------------------------
A7MRN6_CROS8/1-150DYCN....................LAYGGVDEGAI--AFNAL--------------------------------------
B3Z4D7_BACCE/12-154EKKS....................FVCNNHSYAVI--RFLCI--------------------------------------
A5Z4R3_9FIRM/12-152REEL............................FTH--PFIEI--------------------------------------
A5Z4R9_9FIRM/9-151EEDL...................AFDFIDIASNKK--NSTDI--------------------------------------
A1ZMA9_9BACT/9-138THRQ..................THVGDLDETIIVN--SFFSL--------------------------------------
A0A0B5R450_BACTU/12-152EQRR..............FKTNDTTKKGVITSSVS--MFFPL--------------------------------------
J7Z7X1_BACCE/12-138EPNI..................YDINDDEGGAVFD--CLLSF--------------------------------------
Q6HGG3_BACHK/12-159SPEV..................FEVEGKRKVFGTL--LTYDM--------------------------------------
Q6HGE4_BACHK/13-160LPEE....................FNVGNVERCFG--SLFSF--------------------------------------
A0RAF8_BACAH/19-149RPNV...................FDTAQRKELVAK--ALLSF--------------------------------------
A7FEI4_YERP3/10-144EPD................................--GFYFI--------------------------------------
Q21ED8_SACD2/11-151LKCV...............FKFQNATGPYSDSIIR--YFFAF--------------------------------------
A6CCT7_9PLAN/22-151SHDI...........................FSYK--DPETY--------------------------------------
Q6CS49_KLULA/64-193PDER.................CMYVSSDGREFDIK--NFLPI--------------------------------------
B1J8X4_PSEPW/139-260GDAQ.......................GGNDLLLT--GFVPI--------------------------------------
A7ML24_CROS8/19-151AEED....................VEADRWGMPVG--GFNPI--------------------------------------
A5FLI6_FLAJ1/11-131PEEN........................YNRFILG--GFNSI--------------------------------------
Q7CL34_YERPE/11-153LRAW..................WACDDGCEPLEIA--AFKPF--------------------------------------
Q5LEK4_BACFN/167-306SPYC.................FQPQDEDLDWVEIN--AFFPI--------------------------------------
Q65VI9_MANSM/10-134TEYV.....................HDDNYLYPIW--AFSCL--------------------------------------
B8I222_CLOCE/15-149EKCI...................FVDADGRRYEVE--HFIPI--------------------------------------
Q92KA2_RHIME/32-167ALYL.............................NQ--RWLPL--------------------------------------
Q28UU7_JANSC/42-166APSL...........................IHNL--MFPPL--------------------------------------
Q5LEK4_BACFN/11-139KQQT...................ICINRYYEVEIM--RFMAL--------------------------------------
Q5LEK9_BACFN/11-148KQTA....................SINKYQEVEIE--DFFPF--------------------------------------
A7RYE8_NEMVE/119-257VSPG...............................--.LIGS--------------------------------------
G1S8C1_NOMLE/121-251VVPG...............................--.LLGS--------------------------------------
Q52KV8_XENLA/36-166VVP................................--GLMGS--------------------------------------
A0RFK3_BACAH/36-159...........................WKGFYQTV--DLFGI--------------------------------------
Q9CND2_PASMU/14-158YFDY..................YDSYRNEDEYSSF--GFEGF--------------------------------------
A6DN67_9BACT/17-158EIPI....................FKLKSKKHHID--SIYGI--------------------------------------
A9B016_HERA2/24-146.........................KTNTWRWFDG--DYASI--------------------------------------
Q5WC01_BACSK/21-135HITQ.........................GCNNQY--EPLPL--------------------------------------
A1ZUI6_9BACT/29-147APGF.............................FY--SFIMY--------------------------------------
Q47R76_THEFY/31-145FQGS..........................DIHYP--DCLGI--------------------------------------
A8M704_SALAI/21-139LLGT..........................DAFFP--TILEM--------------------------------------
Q6NG79_CORDI/14-156SLKN..................SFINLPLDDRSEY--YELSI--------------------------------------
Q7DD43_NEIMB/1-117...............................INYD--EQYSF--------------------------------------
A3I6Z7_9BACI/22-146NGGN........................ILTVSQP--EYRDI--------------------------------------
Q38V57_LACSS/13-131SRFS...............................--..LPT--------------------------------------
A4BCB8_9GAMM/14-147TNFV....................FPTDQENSWAE--DHVPL--------------------------------------
A0R498_MYCS2/11-150QVGF.....................PEDRDYNTTH--DIIRG--------------------------------------
A6VZI9_MARMS/37-168PPCD.....................NETLKYYFGE--GFYEI--------------------------------------
Q2BBP3_9BACI/17-145AKKY..............YPTTVPNSWANNSVYVN--ELYGI--------------------------------------
Q816C2_BACCR/16-147RLDV..............HPTSKPNSWADDHVNVS--GLYGI--------------------------------------
A5TTM3_FUSNP/176-315RKNT..............FQRPFRRSWSRGFFDVH--YIYGV--------------------------------------
A4X5D2_SALTO/28-164ARDA.................HPAPSPTSWAEEHI--GVDIL--------------------------------------
Q11VT9_CYTH3/29-168VNCC.................FPVTEETSGTEYHV--EISGI--------------------------------------
A1INP6_NEIMA/28-167VKNC.................FPTTQRNSWAKDHV--QICEV--------------------------------------
H1GFW8_LISIO/124-264STGS.................VPTTEPSSWSENCV--AITGI--------------------------------------
B1KH37_SHEWM/28-163IEDD....................RVNLNLNGVSM--SFLSM--------------------------------------
B1KH38_SHEWM/29-165IDDR......................RINIKLNGV--SLSFL--------------------------------------
Q8GDM6_PHOLU/25-137CGD................................--EIYSI--------------------------------------
Q926X2_LISIN/25-149............................TLTFNGV--SFYGI--------------------------------------
Q5DWB0_CLOPF/25-151NGEE.............................IF--GIVSS--------------------------------------
B1KPX6_SHEWM/17-136SISG...............................--..ITC--------------------------------------
A7Z5G8_BACA2/23-137YGID...............................--.LLGY--------------------------------------
A7GQ33_BACCN/21-130CGVE...............................--.VLGV--------------------------------------
A4IKF8_GEOTN/21-132CGVE...............................--.ILGI--------------------------------------
A3ZX34_9PLAN/23-143VEE................................--...EV--------------------------------------
B7KWA7_METC4/14-155GGHL........RIFTPVPVEAADLGSRAHLISHG--VALAL--------------------------------------
Q4K9A1_PSEF5/28-140ALAM...............................--.LYSL--------------------------------------
Q633D5_BACCZ/17-131AIGE...........................NGYL--QLWSI--------------------------------------
A5Z4Q5_9FIRM/17-131GKAN.......................YLSIWPIN--ELIEL--------------------------------------
A1TSU7_ACIAC/17-133QVGS.........................AYFSFW--RVWDI--------------------------------------
Q8F615_LEPIN/16-123KVGN............................RYL--SLWKI--------------------------------------
Q5LEL2_BACFN/13-124KLGD...............................--NYIYI--------------------------------------

PF14568

Q7N9I9_PHOLL/26-145GGDD-------------------------YYGITK--KGING--------------------------------------
G2TJC9_BACCO/28-148GSQE-------------------------IYGIIK--EDFEN--------------------------------------
V5XPU7_ENTMU/27-147GSIE-------------------------IYGVFK--EDFEN--------------------------------------
D3FRA3_BACPE/26-146GAQE-------------------------IYGILN--DEFEN--------------------------------------
Q4KGS7_PSEF5/49-173GALE-------------------------VFPVFD--ARDPR--------------------------------------
H6NAP1_9BACL/27-148YGHQ-------------------------VYGITS--DKFEN--------------------------------------
X2H814_9GAMM/28-135CGEE-------------------------IYSIYC--LPFNE--------------------------------------
A6X425_OCHA4/23-138GGLE-------------------------VYGLPK--MERND--------------------------------------
H8H3I1_DEIGI/15-142ERQE-------------------------FPVVTP--DGPED--------------------------------------
H1Y7D2_9SPHI/29-143LGEE-------------------------IFSIYE--MDFDN--------------------------------------
Q8DV31_STRMU/18-125NNHE-------------------------FTGVQF--ENYLN--------------------------------------
R5BF88_9FIRM/22-126WGTE-------------------------LTGLNI--SGPMN--------------------------------------
R4TCF2_AMYOR/45-152LFVD-------------------------LLPVVA--PGPRA--------------------------------------
B1HSL3_LYSSC/34-146QGTD-------------------------IFFGSL--KRLTE--------------------------------------
B8I223_CLOCE/18-129KGSD-------------------------STAINR--MIDPG--------------------------------------
B9T8U5_RICCO/20-128GAYE-------------------------TYGLGV--PDNSF--------------------------------------
B1YF88_EXIS2/12-121GEWQ-------------------------FHPIKD--EQYIK--------------------------------------
D3EC76_GEOS4/35-147GLAV-------------------------HAFSNG--SSIGN--------------------------------------
YOKK_BACSU/26-163ESKK-------------------------TTDEIE--YDVCY--------------------------------------
D1AMU4_SEBTE/16-153LTNI-------------------------LKIRDF--EYIVE--------------------------------------
D5DHK7_BACMD/19-130QRSE-------------------------YN.INR--IMGPS--------------------------------------
D3V9F7_XENNA/31-140AFVN-------------------------IYSLNP--NSEWY--------------------------------------
F2F0G1_SOLSS/15-152IKDS-------------------------FKCNSH--VYAID--------------------------------------
A8FII6_BACP2/16-121GGDV-------------------------LIYGTE--DIAER--------------------------------------
F0RDN6_CELLC/80-198YTNS-------------------------IDSIRN--RSWLS--------------------------------------
L0DJE0_SINAD/14-143RPTA-------------------------FEGPNG--DGSVV--------------------------------------
D3FRA7_BACPE/19-130KGSE-------------------------YN.INR--IMDPY--------------------------------------
C2X0Q7_BACCE/18-123GGGL-------------------------LIYGTE--HIAER--------------------------------------
R5ZM16_9FIRM/11-125PKTI-------------------------LIKGKR--KEIVR--------------------------------------
W6EF85_SULMU/15-166LNSY-------------------------ASFVDI--DGGEG--------------------------------------
H8H3H9_DEIGI/15-154SPEN-------------------------FKVEME--PRPHT--------------------------------------
D1AK41_SEBTE/28-142SDPY-------------------------IYGITD--LNRCY--------------------------------------
B1HQ89_LYSSC/39-149GLAI-------------------------HAFSNG--SSIGN--------------------------------------
D1BM01_VEIPT/30-141VDPW-------------------------IFTLEE--LGCVY--------------------------------------
Q2SDZ5_HAHCH/31-138AFGN-------------------------VFSLEA--GSEWN--------------------------------------
A9C331_DELAS/17-129QGTD-------------------------IFFPSI--IGLKT--------------------------------------
D1BM10_VEIPT/30-159KKNC-------------------------FIND..--...DD--------------------------------------
YNAB_BACSU/14-117FDGI-------------------------EILSLE--GIIEY--------------------------------------
Q65PK7_BACLD/21-130TFGD-------------------------HLIWPA--DRIIE--------------------------------------
E3EFQ0_PAEPS/15-152VTNV-------------------------FSFNHH--EYIIE--------------------------------------
E3E4D6_PAEPS/30-142GDPA-------------------------LYSVQE--LDWAY--------------------------------------
C3AIQ8_BACMY/23-155VQNC-------------------------FSTTVP--TSWAE--------------------------------------
D1AI41_SEBTE/179-313LDKY-------------------------FENPLQ--REWEP--------------------------------------
D5DG34_BACMD/42-148FIDA-------------------------DKKIAG--NLYSL--------------------------------------
G8LVX3_CLOCD/46-166GTGD-------------------------LIGSSL--MDYVL--------------------------------------
D7C627_STRBB/27-150CDHI-------------------------CLRTPF--GEDNP--------------------------------------
B1HSJ7_LYSSC/16-121TNGV-------------------------LIYGTE--EIMER--------------------------------------
E6UH30_RUMA7/13-149DKRN-------------------------FQCGTR--TRMIV--------------------------------------
W0EAP9_9FIRM/31-139AFTV-------------------------IFSGIK--ESEWF--------------------------------------
C7PR05_CHIPD/29-163KNTC-------------------------FPTSEN--TSWAD--------------------------------------
F2IDG4_FLUTR/12-130YENI-------------------------FIDKDE--NLWSL--------------------------------------
Q8A449_BACTN/32-166FNVC-------------------------FPCDEP--TSWAD--------------------------------------
X5DYB7_9CORY/26-162GINT-------------------------RVILDS--HSSSR--------------------------------------
Q81H93_BACCR/16-140TPDT-------------------------FNIPNQ--DEDSL--------------------------------------
K9VSA2_9CYAN/26-156GEYM-------------------------RIYCPN--LEMSN--------------------------------------
A5FC92_FLAJ1/15-125NELV-------------------------MMQQPD--KDFIK--------------------------------------
M5E8L2_9GAMM/13-128PVSV-------------------------FTTSSL--QEKTI--------------------------------------
R6VPC4_9FIRM/166-289TDTY-------------------------FYMENA--GETVY--------------------------------------
X2GNV0_9BACI/171-305RNTC-------------------------FPTDMA--TSWAE--------------------------------------
C5ANN1_BURGB/12-131VDAE-------------------------AVEGIE--HTFPL--------------------------------------
C3AJS9_BACMY/32-166INDC-------------------------FPTDIP--TSWAE--------------------------------------
YXXD_BACSU/19-130KGSE-------------------------FN.TNR--ILDPY--------------------------------------
R6UAS7_9CLOT/11-122DRRI-------------------------FDTTTS--KERVI--------------------------------------
E6TT52_BACCJ/18-135KPNK-------------------------YYIQQE--ERVVK--------------------------------------
Q81XQ3_BACAN/19-145RLDA-------------------------HPTSEP--NSWAD--------------------------------------
Q3IK24_PSEHT/11-122SKDQ-------------------------LDISNR--LECVV--------------------------------------
H6NG08_9BACL/105-217HGTD-------------------------ILWDQV--TSLRE--------------------------------------
A8FAT3_BACP2/20-143LHNA-------------------------FPTDQP--NGWAE--------------------------------------
C3AMY1_BACMY/25-162ITKY-------------------------FAHKNN--RYVVE--------------------------------------
C3AU00_BACMY/12-136KASM-------------------------YKISDD--AGASV--------------------------------------
D3FZU7_BACPE/33-153TYRY-------------------------LLFEDG--EAAII--------------------------------------
E6UJV2_RUMA7/27-143KNKR-------------------------V.....--...GN--------------------------------------
F4AXJ4_DOKS4/15-148YPNW-------------------------PTIPSE--NNSEL--------------------------------------
B1YEX8_EXIS2/18-145AFNS-------------------------VVVNFK--NSWSD--------------------------------------
C3ATZ9_BACMY/28-146FYQT-------------------------VDLFGT--EQLKE--------------------------------------
C3ATZ8_BACMY/15-152EKNS-------------------------FICNNH--SYAVI--------------------------------------
Q9X366_BACAN/16-140RPKI-------------------------FDVPGQ--DENVF--------------------------------------
C2X3A0_BACCE/19-143NPKV-------------------------FDVPGQ--DENVF--------------------------------------
K9ZKW6_ANACC/21-135RGSD-------------------------CFYQHL--PQIQE--------------------------------------
F0SMF1_RUBBR/22-135EYGI-------------------------SLIWSV--DRIVA--------------------------------------
R5LQ27_9SPIR/14-127TPNI-------------------------FDTDKF--KEKVF--------------------------------------
F3ZZP4_MAHA5/26-131LIFS-------------------------TEQIME--INLSV--------------------------------------
U5L8D3_9BACI/50-163NYGI-------------------------SFVWSI--EQMIK--------------------------------------

PF14567

Q81B94_BACCR/6-143.PGD-------------------------ILNVSS--GKTNG--------------------------------------
C7N7K9_SLAHD/5-132NGTE-------------------------ILGIGM--.....--------------------------------------
K4KKC1_SIMAS/1-134GSLE-------------------------PAVVAD--PSAHN--------------------------------------
Q0VNR5_ALCBS/1-133GSLE-------------------------PATVMD--DYAHN--------------------------------------
D4ZBL0_SHEVD/1-131GSLE-------------------------PVTASD--PYSHT--------------------------------------
Q21KG4_SACD2/2-132GRLE-------------------------PVTVAD--RNSHT--------------------------------------
A6X428_OCHA4/5-137GYLS-------------------------PLILNE--EMGGV--------------------------------------
Q81Q97_BACAN/1-122DGMD-------------------------IHGCET--.....--------------------------------------
S6B2A8_PSERE/1-133GRLE-------------------------PVTATD--PQSHT--------------------------------------
YOBK_BACSU/6-138FGVL-------------------------VLGY.N--.....--------------------------------------
F2K758_PSEBN/1-133GSLE-------------------------PVTVTD--PQSHT--------------------------------------
Q880E4_PSESM/5-136NGKD-------------------------ALRLTV--DRNSP--------------------------------------
X2GZW0_9GAMM/4-146VGEE-------------------------ISGIVD--.NDAL--------------------------------------
U5MVI7_CLOSA/6-138FGVE-------------------------ILGCGK--.....--------------------------------------
Q5WIS2_BACSK/1-155GAQE-------------------------IYGIID--.ADFE--------------------------------------
Q8EAQ0_SHEON/1-131GVIE-------------------------PVTAAD--PYSHT--------------------------------------
B8CQS9_SHEPW/1-121GSLE-------------------------PVTASD--PHSHT--------------------------------------
I0GP53_SELRL/13-146LGIT-------------------------IFGVAA--.....--------------------------------------
B3PC71_CELJU/34-164GSIE-------------------------PVTAAD--PHSHT--------------------------------------
D3FRA5_BACPE/5-133CGVD-------------------------ILGIKG--.....--------------------------------------
M4X311_PSEDE/1-131GRLE-------------------------PVTVTD--PHSHT--------------------------------------
Q12R95_SHEDO/1-131GHIE-------------------------PVTASD--PQSHT--------------------------------------
D5HHH7_9FIRM/5-133DGIE-------------------------TLGVGK--.....--------------------------------------
D5SSH7_PLAL2/5-147VGEE-------------------------ISGIED--.DNPS--------------------------------------
N0B2R8_9BACI/1-137GEWT-------------------------LFPIKD--PKNLK--------------------------------------
G8M281_CLOCD/7-139NGVE-------------------------VYGISK--.....--------------------------------------
G2Z5P5_FLABF/2-145.GIP-------------------------IYAFTN--NEMLS--------------------------------------
A3QH89_SHELP/1-131GTLE-------------------------PVTAAD--PYAHT--------------------------------------
R6FTE9_9CLOT/5-133CGVE-------------------------ILGIEN--.....--------------------------------------
R5TPA4_9FIRM/24-155.WFD-------------------------IMGYFK--.....--------------------------------------
Q086X2_SHEFN/1-131GTLE-------------------------PVTAAD--PSSHT--------------------------------------
C1D4A4_DEIDV/3-141GAYW-------------------------PLVIHH--ELTGG--------------------------------------
D3FZM0_BACPE/6-143.PGD-------------------------ILNVSN--GNTNG--------------------------------------
A1S8W2_SHEAM/1-131GSLE-------------------------PVTVAD--PHSHT--------------------------------------
Q7M7B0_PHOLL/5-136GTID-------------------------LLSVTR--DKKY.--------------------------------------

PF07348

SYDP_KLEP7/6-179SGRF-----------------------AGETLTLL--QTWSE--------------------------------------
SYDP_COLP3/9-191EAQS-----------------------DDGELSLL--FAWNK--------------------------------------
I2B5Z7_SHIBC/5-178DATL-----------------------EGKPLTLL--QAWSE--------------------------------------
R5V7K9_9FIRM/4-185DG..-----------------------......II--QTSRG--------------------------------------
SYDP_YERPE/6-179MADL-----------------------GNHRFTLL--QVWSE--------------------------------------
K7A551_9ALTE/8-182SAET-----------------------NKGYLQLL--QPWNQ--------------------------------------
E0SCC1_DICD3/6-178TARF-----------------------DDLECTLL--QAWSE--------------------------------------
X2H3P8_9GAMM/9-173TAKL-----------------------ADIKLTLI--QAWND--------------------------------------
D4ZHN4_SHEVD/5-186LFNC-----------------------EWGQGELL--QVWNQ--------------------------------------
D8MW85_ERWBE/6-178TATF-----------------------GGKACTLL--QTWSE--------------------------------------
SYDP_CROS8/6-179AARY-----------------------DDVALTLL--QAWSQ--------------------------------------
F5Z4L7_ALTSS/6-183PVAA-----------------------EHGACELL--QVWNE--------------------------------------
SYDP_SHEAM/4-180QFDS-----------------------PWGEGELI--QIWNE--------------------------------------
J7U684_MORMO/6-178QAVF-----------------------EDIQLSLV--QVWSE--------------------------------------
E1STK9_FERBD/4-172YFEA-----------------------PFGRGELL--QVWCD--------------------------------------
I0DWV2_PROSM/6-180KAQF-----------------------EGHLLNLV--QVWSE--------------------------------------
SYDP_IDILO/6-175ALDY-----------------------QGHTISLL--QTQSA--------------------------------------
C2X4F6_BACCE/19-188DGFI-----------------------GDHYISLE--AVLPN--------------------------------------
SYDP_EDWI9/6-178RARW-----------------------NEIEMDLV--QVWSV--------------------------------------
M4UN22_9GAMM/6-180PCLF-----------------------ESHPIELI--QVWNE--------------------------------------
H2IXL4_RAHAC/6-178TASW-----------------------QGNALTLL--QVWSE--------------------------------------
G4QLZ8_GLANF/9-186PAST-----------------------DRGDLDIL--QAWNQ--------------------------------------
E6WGC7_PANSA/6-178TARF-----------------------QQRDITLL--QVWSE--------------------------------------
SYDP_ERWT9/6-179TGTL-----------------------DGRPLSLV--QVWSE--------------------------------------
SYDP_VIBCH/6-179PAQW-----------------------RGRELTLL--QVWSE--------------------------------------
SYDP_PHOLL/6-180TVTF-----------------------EGQRLSLI--QVWSE--------------------------------------
W0HTY4_9ENTR/12-183PAAF-----------------------EGEPLELV--QVWSE--------------------------------------
B4F2E3_PROMH/5-178QVRF-----------------------DSLNFTLL--QIWSE--------------------------------------
SYDP_VIBF1/6-179TAKF-----------------------EDMNIELL--QVWSD--------------------------------------
SYDP_VIBTL/6-179NATF-----------------------DGNELTLL--QIWSD--------------------------------------
A8GIF5_SERP5/18-190SAQF-----------------------GEHHVTLL--QVWSE--------------------------------------
F7YLH7_VIBA7/10-183PAKW-----------------------QGNELALL--QVWSE--------------------------------------
SYDP_ALTMD/6-178KAKA-----------------------PQGDCELL--QVFNR--------------------------------------
SYDP_SHELP/5-184MFES-----------------------EFGEGELL--QPWNQ--------------------------------------
F0LVK8_VIBFN/6-179PARW-----------------------RGRELTLL--QVWSD--------------------------------------
SYDP_HAHCH/7-185WCSS-----------------------PFGEISLI--QLWNE--------------------------------------
SYDP_TOLAT/7-177TASF-----------------------KGLAVTLV--QPWNE--------------------------------------
SYDP_PECAS/6-179AAQF-----------------------DSLSCQLL--QVWSE--------------------------------------
SYDP_SHEON/4-180LFDS-----------------------TWGTGELL--QVWNE--------------------------------------
SYDP_PHOPR/6-179AAKF-----------------------GEIELDLL--QVFSE--------------------------------------
SYDP_AERHH/6-178PCLY-----------------------KGLRLEFV--LPWNE--------------------------------------
SYDP_SHEFN/4-180PFTA-----------------------SFGDGELL--QAWNQ--------------------------------------
D3VCK7_XENNA/6-179AASF-----------------------EGQNLSLI--QVWSE--------------------------------------
D3UWF0_XENBS/6-179TASF-----------------------EGQNLSLI--QVWSD--------------------------------------
SYDP_PSEA6/6-182VAQH-----------------------PSGKLQIL--QAWNE--------------------------------------
SYDP_VIBPA/6-178DATW-----------------------QTNPLTLL--QVWSD--------------------------------------
SYDP_ECOLI/6-179HAQF-----------------------GDIKLTLL--QTWSE--------------------------------------
SYDP_SHEDO/4-180QFNS-----------------------PWGEGELL--LAWSL--------------------------------------
SYDP_VIBVY/6-179TATW-----------------------EGNELTLL--QVWND--------------------------------------
H2FY10_OCESG/7-174PLCY-----------------------KGLFITLL--QPWHR--------------------------------------
SYDP_PSYIN/6-180PAVY-----------------------QDHPIELI--QAWND--------------------------------------
SYDP_PSEHT/6-178QASI-----------------------DGHQVELL--QVWNS--------------------------------------

PF02393

D2K3J3_HCMV/211-336------------------------------------MR..........................................
B8YE72_HCMV/157-296------------------------------------RT..........................................
A8T728_HCMV/200-332------------------------------------AT..........................................
D2K4S5_HCMV/202-333------------------------------------EW..........................................
D3YS52_HCMVO/180-322------------------------------------RW..........................................
D2K3X0_HCMV/202-332------------------------------------ET..........................................
D2K5D0_HCMV/151-256------------------------------------NH..........................................
C8BKJ5_HCMV/34-153------------------------------------PL..........................................
D2K5D0_HCMV/11-135------------------------------------PE..........................................
B9VXJ9_HCMVT/546-653------------------------------------LE..........................................
B9VXD4_HCMVT/116-247------------------------------------VH..........................................
C3Y900_BRAFL/167-275------------------------------------NP..........................................
C3Z365_BRAFL/157-265------------------------------------NP..........................................
B9VXL1_HCMVT/265-382------------------------------------LN..........................................
D3YRX5_HCMVO/17-135------------------------------------QE..........................................
Q14VM9_RAHV1/5-123------------------------------------ET..........................................
D2K5D5_HCMV/214-331------------------------------------RE..........................................
A8T728_HCMV/45-168------------------------------------RE..........................................
D2K4G8_HCMV/126-245------------------------------------DK..........................................
D2K595_HCMV/6-123------------------------------------QG..........................................
C3RWK6_FRG3V/35-153------------------------------------PK..........................................
C3RWV3_FRG3V/65-186------------------------------------PE..........................................
C1C3V1_LITCT/15-136------------------------------------PK..........................................
D2E8A7_ANHV1/5-121------------------------------------PT..........................................
Q070N0_CPRVZ/47-172------------------------------------PR..........................................
B5XAY6_SALSA/21-139------------------------------------PE..........................................
B4YEM5_9ALPH/49-167------------------------------------PQ..........................................
B1NFI8_ADEGX/15-131------------------------------------PS..........................................
F5HIG2_HCMV/399-518------------------------------------RQ..........................................
D3YRW4_HCMVO/69-190------------------------------------QT..........................................
B9VXJ9_HCMVT/55-169------------------------------------GE..........................................
C8CFJ9_HCMV/42-158------------------------------------PE..........................................
B9VXG6_HCMVT/274-510------------------------------------GWLALGAVLPARWLGCAAGPATMTAGTTAMATGTTLPAGASGTE
Q4KS78_ISKNV/1-104------------------------------------PD..........................................
C8CFJ8_HCMV/54-179------------------------------------DD..........................................
A8T729_HCMV/26-179------------------------------------EE..........................................

PF14433

A9B4M4_HERA2/8-176DNQVFEHQGTPYRLWRMFENFIPAYSQHADYEAAPYWL------------------------------------------
A9B983_HERA2/8-176PAEAFAIDDEDFIVY.....................WS------------------------------------------
A9B4M5_HERA2/2-165PQLAPAFSEATF........................WR------------------------------------------
A6LWQ5_CLOB8/2-136SFGEEDYEEHST..............CLEAINYLC.KY------------------------------------------
Q97CY9_CLOAB/2-136SFGDEDYDEHST..............CYEDMKYYY.EH------------------------------------------
Q97CZ0_CLOAB/1-146KYHFNRYDLYTTNMIKSLNGMLSR............DC------------------------------------------
G8LY23_CLOCD/3-138PDIKSEVIVHNTNPIQALGDAGDR............RI------------------------------------------
C0Z7L3_BREBN/1-129FTNYDNCGSFKS..........................------------------------------------------
D1ALL2_SEBTE/4-148NPHVKKFPRLKNIPVRFMLYPLDAAESVFR......MR------------------------------------------
G8LVN3_CLOCD/3-139FNNPKNNKFINTIYVDPRKTGVFK............SV------------------------------------------
R7KV91_9FIRM/6-151PENIYDAA............................HL------------------------------------------
B1HSL5_LYSSC/4-140PEEGLGDLDR..........................RH------------------------------------------
X2GUJ6_9BACI/4-141PEEQIGDGVQK.........................IH------------------------------------------
K9X3G6_9NOST/4-142P...................................ER------------------------------------------
A4X261_SALTO/96-238PT...RTGGVLA........................DC------------------------------------------
F4F239_VERMA/96-237PT...R.GGVVT........................EG------------------------------------------
A4X254_SALTO/5-149PF...L.VGRSV........................GT------------------------------------------
F4F315_VERMA/5-149PF...R.VRHCV........................AT------------------------------------------
B1VUI9_STRGG/11-155PL...S.GLHLA........................RT------------------------------------------
G2NEF9_STREK/19-163PL...R.GLHLA........................RT------------------------------------------
B5GPR4_STRC2/10-154PL...A.GLHLA........................RT------------------------------------------
D6X5Y7_STRPR/10-154PL...E.GLHLA........................RT------------------------------------------
F2R7E3_STRVP/10-154PL...A.GLHLS........................RT------------------------------------------
V6JXA9_STRNV/9-153PL...A.GIHLA........................RT------------------------------------------
F8JWB4_STREN/11-156PL...L.GLHLA........................RT------------------------------------------
B5I7H7_9ACTN/11-155PL...H.GLHMA........................RT------------------------------------------
K4R8Z5_9ACTN/11-155PL...H.GLHMA........................RT------------------------------------------
H2JSV2_STRHJ/11-155PL...H.GLHHA........................RT------------------------------------------
V6K5C4_STRRC/24-168PL...H.GLHHA........................RT------------------------------------------
S5VNY2_STRCU/11-155PL...H.GLHLA........................RT------------------------------------------
Q9F2N2_STRCO/11-155PL...H.GLHMA........................RT------------------------------------------
C9YY15_STRSW/11-155PL...H.GLHMA........................RT------------------------------------------
Q82HF0_STRAW/11-155PL...H.GLHLA........................RT------------------------------------------
D7BTM5_STRBB/9-153PL...H.GLHLA........................RT------------------------------------------
G2PAB9_STRVO/37-181PL...H.GLHLA........................RT------------------------------------------
V4J1P0_9ACTN/10-159PL...A.GLHMA........................RT------------------------------------------
F3ZHS7_9ACTN/28-172PL...H.GLHLA........................RT------------------------------------------
D9TC01_MICAI/257-399PL...R.AAHTA........................DS------------------------------------------
F4F5L1_VERMA/256-398PR...Q.VAHTA........................DT------------------------------------------
R4LXK7_9ACTN/252-397PS...I.AAHTA........................DA------------------------------------------
U5WFU2_9ACTN/252-397PA...A.AAHSA........................DA------------------------------------------
B1VX82_STRGG/6-147PH...LVFKGDA........................EE------------------------------------------
F2RCB0_STRVP/3-144PH...WIYEESG........................ED------------------------------------------
Q82G08_STRAW/6-147PT...IGYDGDA........................GN------------------------------------------
D1A3E8_THECD/8-146PLEGEKMR............................PY------------------------------------------
F4FAN2_VERMA/7-145PT...E.CSGEA........................DR------------------------------------------
D0J054_COMT2/5-146WLEAYFTGEDAD........................DA------------------------------------------

PF14435

A7HBV7_ANADF/6-194------------------------------------AV------------------------------------------
B1VPR4_STRGG/19-175------------------------------------GL------------------------------------------
B1VUJ2_STRGG/672-850------------------------------------RA------------------------------------------
B1VYJ1_STRGG/2-183------------------------------------SS------------------------------------------
B5H683_STRPR/212-402------------------------------------FT------------------------------------------
B5HAJ0_STRPR/5-188------------------------------------NA------------------------------------------
B5HAW8_STRPR/38-231------------------------------------PE------------------------------------------
B5HNY7_9ACTN/216-393------------------------------------NT------------------------------------------
B5I6T5_9ACTN/5-183------------------------------------DD------------------------------------------
D1A3F0_THECD/2-169------------------------------------MY------------------------------------------
D1A5L5_THECD/5-198------------------------------------AV------------------------------------------
D7C074_STRBB/2-188------------------------------------GF------------------------------------------
D9T329_MICAI/3-173------------------------------------LL------------------------------------------
E2Q6I7_STRC2/663-841------------------------------------RQ------------------------------------------
E4N1Q1_KITSK/248-421------------------------------------DS------------------------------------------
E4NG11_KITSK/606-780------------------------------------RQ------------------------------------------
F3ZHT0_9ACTN/605-784------------------------------------KA------------------------------------------
F5XQA6_MICPN/2-160------------------------------------SS------------------------------------------
F9GD57_FUSOF/7-186------------------------------------DD------------------------------------------
G8WZI2_STREN/529-708------------------------------------RQ------------------------------------------
H2JJX8_STRHJ/242-430------------------------------------GE------------------------------------------
H2JNL8_STRHJ/197-379------------------------------------NS------------------------------------------
H2JQV0_STRHJ/213-403------------------------------------FD------------------------------------------
H2K7D5_STRHJ/5-186------------------------------------AH------------------------------------------
I0H563_ACTM4/37-227------------------------------------AI------------------------------------------
I0H8Z2_ACTM4/10-174------------------------------------..------------------------------------------
I0HE25_ACTM4/11-180------------------------------------GY------------------------------------------
Q47PK6_THEFY/246-429------------------------------------SV------------------------------------------
Q82D46_STRAW/202-388------------------------------------TS------------------------------------------
Q9K3X2_STRCO/5-185------------------------------------AH------------------------------------------
Q9L1R9_STRCO/109-254------------------------------------AH------------------------------------------
S5VHB8_STRCU/197-386------------------------------------NS------------------------------------------
S5YXS3_PARAH/2-168------------------------------------GP------------------------------------------
V6JYL3_STRNV/5-177------------------------------------TT------------------------------------------
V6K0N1_STRRC/197-380------------------------------------NS------------------------------------------

PF09346

A0RE58_BACAH/19-133------------------------------------DC------------------------------------------
Q81B84_BACCR/8-142------------------------------------G.------------------------------------------
A4YB72_SHEPC/14-135------------------------------------KE------------------------------------------
A0A0B5R2A8_BACTU/32-156------------------------------------HT------------------------------------------
B1YF81_EXIS2/16-130------------------------------------PT------------------------------------------
A6FHD8_9GAMM/19-145------------------------------------NS------------------------------------------
A4EPD0_9RHOB/35-163------------------------------------SE------------------------------------------
A0RAV0_BACAH/42-162------------------------------------SD------------------------------------------
B8I5J3_CLOCE/15-125------------------------------------DI------------------------------------------
C3G559_BACTU/15-125------------------------------------DE------------------------------------------
Q1DBU4_MYXXD/34-167------------------------------------EE------------------------------------------
A5UV09_ROSS1/24-144------------------------------------NE------------------------------------------
Q6HMR4_BACHK/23-143------------------------------------DS------------------------------------------
Q1CV91_HELPH/17-134------------------------------------KH------------------------------------------
A5TTY9_FUSNP/35-181------------------------------------DF------------------------------------------
Q47P53_THEFY/18-133------------------------------------ER------------------------------------------
A0JSM0_ARTS2/15-129------------------------------------QR------------------------------------------
Q82GY4_STRAW/63-178------------------------------------ET------------------------------------------
Q81BW2_BACCR/27-144------------------------------------RN------------------------------------------
A5UTX3_ROSS1/55-202------------------------------------EL------------------------------------------
A6C6S9_9PLAN/31-128------------------------------------SA------------------------------------------
A5FCA9_FLAJ1/44-161------------------------------------DW------------------------------------------
B7X333_COMTE/152-284------------------------------------GP------------------------------------------
Q4K6P0_PSEF5/56-173------------------------------------QP------------------------------------------
Q63C14_BACCZ/25-143------------------------------------FS------------------------------------------
Q81BA7_BACCR/48-167------------------------------------EN------------------------------------------
Q89MJ4_BRADU/28-170------------------------------------RR------------------------------------------
A3ZX28_9PLAN/24-139------------------------------------RG------------------------------------------
A0AMA9_LISW6/21-137------------------------------------AT------------------------------------------
A5FMA4_FLAJ1/23-172------------------------------------DM------------------------------------------
A0A0B8QYA4_LISMN/14-152------------------------------------ED------------------------------------------
Q9F2V0_STRCO/29-155------------------------------------LD------------------------------------------
Q3BQF4_XANC5/29-173------------------------------------AR------------------------------------------
A5FJY1_FLAJ1/42-170------------------------------------EQ------------------------------------------
Q1ZQF0_PHOAS/14-166------------------------------------CE------------------------------------------
Q5WBD2_BACSK/23-138------------------------------------SS------------------------------------------
A5FGR4_FLAJ1/41-198------------------------------------KM------------------------------------------
Q0RKI3_FRAAA/56-185------------------------------------YG------------------------------------------
Q9F3Q3_STRCO/47-179------------------------------------AD------------------------------------------
A6CDZ7_9PLAN/19-143------------------------------------SD------------------------------------------
B3ZML8_BACCE/18-127------------------------------------NG------------------------------------------
A4Y3I6_SHEPC/21-128------------------------------------AD------------------------------------------
A4Y9N5_SHEPC/8-116------------------------------------PS------------------------------------------
A4SRI0_AERS4/8-116------------------------------------AG------------------------------------------
Q5LEK2_BACFN/47-168------------------------------------YG------------------------------------------
Q82RV7_STRAW/96-236------------------------------------QG------------------------------------------
A4FNW2_SACEN/30-166------------------------------------SA------------------------------------------
A5FAZ7_FLAJ1/185-329------------------------------------QD------------------------------------------
A3I618_9BACI/42-194------------------------------------EQ------------------------------------------
B4SN74_STRM5/28-184------------------------------------AQ------------------------------------------
Q39NE9_BURL3/28-182------------------------------------GQ------------------------------------------
Q6HHY9_BACHK/33-185------------------------------------QE------------------------------------------
A5TXY3_FUSNP/37-189------------------------------------SQ------------------------------------------
E6XGA7_SHEP2/26-168------------------------------------AS------------------------------------------
Q73QC3_TREDE/40-189------------------------------------TN------------------------------------------
H2K898_STRHJ/18-144------------------------------------DA------------------------------------------
A6G0Q7_9DELT/31-170------------------------------------RE------------------------------------------
Q9RYT7_DEIRA/27-166------------------------------------ER------------------------------------------
Q93JL3_STRCO/163-310------------------------------------DQ------------------------------------------
A1ZXR5_9BACT/30-166------------------------------------LK------------------------------------------
SMI1_CANGA/103-288------------------------------------DE------------------------------------------
Q59YV1_CANAL/104-343------------------------------------DE------------------------------------------
A5DZP7_LODEL/117-382------------------------------------DE------------------------------------------
SMI1_DEBHA/98-296------------------------------------DE------------------------------------------
Q55KB3_CRYNB/120-282------------------------------------EE------------------------------------------
SMI2_DEBHA/142-319------------------------------------EG------------------------------------------
A1C9R6_ASPCL/143-317------------------------------------EE------------------------------------------
SMI1_YARLI/171-356------------------------------------ET------------------------------------------
A6EFN0_9SPHI/29-161------------------------------------QD------------------------------------------
O07689_LISSE/36-156------------------------------------TI------------------------------------------
A3ZN04_9PLAN/36-149------------------------------------LW------------------------------------------
A7VFJ3_9CLOT/24-132------------------------------------EH------------------------------------------
A4X269_SALTO/103-245------------------------------------..------------------------------------------
E6XKF4_SHEP2/4-129------------------------------------KD------------------------------------------
A0PQE6_MYCUA/4-131------------------------------------FD------------------------------------------
Q8NRK2_CORGL/4-116------------------------------------RD------------------------------------------
Q0VKY9_ALCBS/4-130------------------------------------SD------------------------------------------
Q9F2N4_STRCO/160-298------------------------------------RE------------------------------------------
A3KB11_9RHOB/18-152------------------------------------ED------------------------------------------
Q1DEQ7_MYXXD/33-153------------------------------------EG------------------------------------------
Q1CY42_MYXXD/19-141------------------------------------AE------------------------------------------
Q09D40_STIAD/24-149------------------------------------GE------------------------------------------
B1YEY9_EXIS2/39-159------------------------------------EE------------------------------------------
Q5WJU2_BACSK/38-153------------------------------------DQ------------------------------------------
A7Z7P3_BACA2/41-156------------------------------------EE------------------------------------------
YOBM_BACSU/42-161------------------------------------EE------------------------------------------
A7Z5R7_BACA2/23-158------------------------------------NN------------------------------------------
A3ZX25_9PLAN/22-154------------------------------------DG------------------------------------------
A7VE32_9CLOT/35-145------------------------------------EK------------------------------------------
A7MRN6_CROS8/1-150------------------------------------FG------------------------------------------
B3Z4D7_BACCE/12-154------------------------------------LE------------------------------------------
A5Z4R3_9FIRM/12-152------------------------------------NP------------------------------------------
A5Z4R9_9FIRM/9-151------------------------------------RE------------------------------------------
A1ZMA9_9BACT/9-138------------------------------------EQ------------------------------------------
A0A0B5R450_BACTU/12-152------------------------------------SI------------------------------------------
J7Z7X1_BACCE/12-138------------------------------------TS------------------------------------------
Q6HGG3_BACHK/12-159------------------------------------DD------------------------------------------
Q6HGE4_BACHK/13-160------------------------------------DE------------------------------------------
A0RAF8_BACAH/19-149------------------------------------DQ------------------------------------------
A7FEI4_YERP3/10-144------------------------------------DS------------------------------------------
Q21ED8_SACD2/11-151------------------------------------SD------------------------------------------
A6CCT7_9PLAN/22-151------------------------------------QE------------------------------------------
Q6CS49_KLULA/64-193------------------------------------SY------------------------------------------
B1J8X4_PSEPW/139-260------------------------------------KY------------------------------------------
A7ML24_CROS8/19-151------------------------------------KY------------------------------------------
A5FLI6_FLAJ1/11-131------------------------------------KY------------------------------------------
Q7CL34_YERPE/11-153------------------------------------KY------------------------------------------
Q5LEK4_BACFN/167-306------------------------------------KE------------------------------------------
Q65VI9_MANSM/10-134------------------------------------SE------------------------------------------
B8I222_CLOCE/15-149------------------------------------KN------------------------------------------
Q92KA2_RHIME/32-167------------------------------------DL------------------------------------------
Q28UU7_JANSC/42-166------------------------------------AS------------------------------------------
Q5LEK4_BACFN/11-139------------------------------------NT------------------------------------------
Q5LEK9_BACFN/11-148------------------------------------KY------------------------------------------
A7RYE8_NEMVE/119-257------------------------------------MS------------------------------------------
G1S8C1_NOMLE/121-251------------------------------------MA------------------------------------------
Q52KV8_XENLA/36-166------------------------------------MA------------------------------------------
A0RFK3_BACAH/36-159------------------------------------EQ------------------------------------------
Q9CND2_PASMU/14-158------------------------------------ET------------------------------------------
A6DN67_9BACT/17-158------------------------------------NE------------------------------------------
A9B016_HERA2/24-146------------------------------------DR------------------------------------------
Q5WC01_BACSK/21-135------------------------------------EK------------------------------------------
A1ZUI6_9BACT/29-147------------------------------------ET------------------------------------------
Q47R76_THEFY/31-145------------------------------------NA------------------------------------------
A8M704_SALAI/21-139------------------------------------SE------------------------------------------
Q6NG79_CORDI/14-156------------------------------------DQ------------------------------------------
Q7DD43_NEIMB/1-117------------------------------------PW------------------------------------------
A3I6Z7_9BACI/22-146------------------------------------DD------------------------------------------
Q38V57_LACSS/13-131------------------------------------SE------------------------------------------
A4BCB8_9GAMM/14-147------------------------------------NE------------------------------------------
A0R498_MYCS2/11-150------------------------------------IG------------------------------------------
A6VZI9_MARMS/37-168------------------------------------GT------------------------------------------
Q2BBP3_9BACI/17-145------------------------------------GE------------------------------------------
Q816C2_BACCR/16-147------------------------------------SF------------------------------------------
A5TTM3_FUSNP/176-315------------------------------------DS------------------------------------------
A4X5D2_SALTO/28-164------------------------------------AA------------------------------------------
Q11VT9_CYTH3/29-168------------------------------------MG------------------------------------------
A1INP6_NEIMA/28-167------------------------------------SG------------------------------------------
H1GFW8_LISIO/124-264------------------------------------MG------------------------------------------
B1KH37_SHEWM/28-163------------------------------------FS------------------------------------------
B1KH38_SHEWM/29-165------------------------------------DW------------------------------------------
Q8GDM6_PHOLU/25-137------------------------------------YC------------------------------------------
Q926X2_LISIN/25-149------------------------------------SK------------------------------------------
Q5DWB0_CLOPF/25-151------------------------------------ED------------------------------------------
B1KPX6_SHEWM/17-136------------------------------------EN------------------------------------------
A7Z5G8_BACA2/23-137------------------------------------DF------------------------------------------
A7GQ33_BACCN/21-130------------------------------------EG------------------------------------------
A4IKF8_GEOTN/21-132------------------------------------EG------------------------------------------
A3ZX34_9PLAN/23-143------------------------------------SG------------------------------------------
B7KWA7_METC4/14-155------------------------------------DG------------------------------------------
Q4K9A1_PSEF5/28-140------------------------------------DS------------------------------------------
Q633D5_BACCZ/17-131------------------------------------DV------------------------------------------
A5Z4Q5_9FIRM/17-131------------------------------------NQ------------------------------------------
A1TSU7_ACIAC/17-133------------------------------------VD------------------------------------------
Q8F615_LEPIN/16-123------------------------------------EE------------------------------------------
Q5LEL2_BACFN/13-124------------------------------------WA------------------------------------------

PF14568

Q7N9I9_PHOLL/26-145------------------------------------NQ------------------------------------------
G2TJC9_BACCO/28-148------------------------------------SS------------------------------------------
V5XPU7_ENTMU/27-147------------------------------------SG------------------------------------------
D3FRA3_BACPE/26-146------------------------------------SS------------------------------------------
Q4KGS7_PSEF5/49-173------------------------------------KT------------------------------------------
H6NAP1_9BACL/27-148------------------------------------DA------------------------------------------
X2H814_9GAMM/28-135------------------------------------AV------------------------------------------
A6X425_OCHA4/23-138------------------------------------PP------------------------------------------
H8H3I1_DEIGI/15-142------------------------------------KS------------------------------------------
H1Y7D2_9SPHI/29-143------------------------------------VK------------------------------------------
Q8DV31_STRMU/18-125------------------------------------IV------------------------------------------
R5BF88_9FIRM/22-126------------------------------------VV------------------------------------------
R4TCF2_AMYOR/45-152------------------------------------ED------------------------------------------
B1HSL3_LYSSC/34-146------------------------------------EA------------------------------------------
B8I223_CLOCE/18-129------------------------------------TI------------------------------------------
B9T8U5_RICCO/20-128------------------------------------LN------------------------------------------
B1YF88_EXIS2/12-121------------------------------------RT------------------------------------------
D3EC76_GEOS4/35-147------------------------------------ET------------------------------------------
YOKK_BACSU/26-163------------------------------------KP------------------------------------------
D1AMU4_SEBTE/16-153------------------------------------RF------------------------------------------
D5DHK7_BACMD/19-130------------------------------------SI------------------------------------------
D3V9F7_XENNA/31-140------------------------------------LP------------------------------------------
F2F0G1_SOLSS/15-152------------------------------------RF------------------------------------------
A8FII6_BACP2/16-121------------------------------------NA------------------------------------------
F0RDN6_CELLC/80-198------------------------------------DY------------------------------------------
L0DJE0_SINAD/14-143------------------------------------HF------------------------------------------
D3FRA7_BACPE/19-130------------------------------------SI------------------------------------------
C2X0Q7_BACCE/18-123------------------------------------NE------------------------------------------
R5ZM16_9FIRM/11-125------------------------------------CL------------------------------------------
W6EF85_SULMU/15-166------------------------------------LC------------------------------------------
H8H3H9_DEIGI/15-154------------------------------------RR------------------------------------------
D1AK41_SEBTE/28-142------------------------------------SH------------------------------------------
B1HQ89_LYSSC/39-149------------------------------------ET------------------------------------------
D1BM01_VEIPT/30-141------------------------------------PA------------------------------------------
Q2SDZ5_HAHCH/31-138------------------------------------LI------------------------------------------
A9C331_DELAS/17-129------------------------------------DA------------------------------------------
D1BM10_VEIPT/30-159------------------------------------DC------------------------------------------
YNAB_BACSU/14-117------------------------------------..------------------------------------------
Q65PK7_BACLD/21-130------------------------------------EN------------------------------------------
E3EFQ0_PAEPS/15-152------------------------------------KF------------------------------------------
E3E4D6_PAEPS/30-142------------------------------------PA------------------------------------------
C3AIQ8_BACMY/23-155------------------------------------DH------------------------------------------
D1AI41_SEBTE/179-313------------------------------------QI------------------------------------------
D5DG34_BACMD/42-148------------------------------------ED------------------------------------------
G8LVX3_CLOCD/46-166------------------------------------RN------------------------------------------
D7C627_STRBB/27-150------------------------------------VR------------------------------------------
B1HSJ7_LYSSC/16-121------------------------------------NE------------------------------------------
E6UH30_RUMA7/13-149------------------------------------RF------------------------------------------
W0EAP9_9FIRM/31-139------------------------------------IV------------------------------------------
C7PR05_CHIPD/29-163------------------------------------DH------------------------------------------
F2IDG4_FLUTR/12-130------------------------------------GA------------------------------------------
Q8A449_BACTN/32-166------------------------------------DH------------------------------------------
X5DYB7_9CORY/26-162------------------------------------DD------------------------------------------
Q81H93_BACCR/16-140------------------------------------NN------------------------------------------
K9VSA2_9CYAN/26-156------------------------------------LL------------------------------------------
A5FC92_FLAJ1/15-125------------------------------------SN------------------------------------------
M5E8L2_9GAMM/13-128------------------------------------KS------------------------------------------
R6VPC4_9FIRM/166-289------------------------------------CL------------------------------------------
X2GNV0_9BACI/171-305------------------------------------DH------------------------------------------
C5ANN1_BURGB/12-131------------------------------------HG------------------------------------------
C3AJS9_BACMY/32-166------------------------------------DH------------------------------------------
YXXD_BACSU/19-130------------------------------------SV------------------------------------------
R6UAS7_9CLOT/11-122------------------------------------KS------------------------------------------
E6TT52_BACCJ/18-135------------------------------------SF------------------------------------------
Q81XQ3_BACAN/19-145------------------------------------DH------------------------------------------
Q3IK24_PSEHT/11-122------------------------------------DY------------------------------------------
H6NG08_9BACL/105-217------------------------------------AA------------------------------------------
A8FAT3_BACP2/20-143------------------------------------DH------------------------------------------
C3AMY1_BACMY/25-162------------------------------------RF------------------------------------------
C3AU00_BACMY/12-136------------------------------------LN------------------------------------------
D3FZU7_BACPE/33-153------------------------------------PY------------------------------------------
E6UJV2_RUMA7/27-143------------------------------------TS------------------------------------------
F4AXJ4_DOKS4/15-148------------------------------------WG------------------------------------------
B1YEX8_EXIS2/18-145------------------------------------EE------------------------------------------
C3ATZ9_BACMY/28-146------------------------------------SN------------------------------------------
C3ATZ8_BACMY/15-152------------------------------------RF------------------------------------------
Q9X366_BACAN/16-140------------------------------------SK------------------------------------------
C2X3A0_BACCE/19-143------------------------------------SD------------------------------------------
K9ZKW6_ANACC/21-135------------------------------------WA------------------------------------------
F0SMF1_RUBBR/22-135------------------------------------DN------------------------------------------
R5LQ27_9SPIR/14-127------------------------------------NA------------------------------------------
F3ZZP4_MAHA5/26-131------------------------------------RK------------------------------------------
U5L8D3_9BACI/50-163------------------------------------EN------------------------------------------

PF14567

Q81B94_BACCR/6-143------------------------------------N.------------------------------------------
C7N7K9_SLAHD/5-132------------------------------------.T------------------------------------------
K4KKC1_SIMAS/1-134------------------------------------Y.------------------------------------------
Q0VNR5_ALCBS/1-133------------------------------------F.------------------------------------------
D4ZBL0_SHEVD/1-131------------------------------------Y.------------------------------------------
Q21KG4_SACD2/2-132------------------------------------Y.------------------------------------------
A6X428_OCHA4/5-137------------------------------------YG------------------------------------------
Q81Q97_BACAN/1-122------------------------------------TA------------------------------------------
S6B2A8_PSERE/1-133------------------------------------Y.------------------------------------------
YOBK_BACSU/6-138------------------------------------.F------------------------------------------
F2K758_PSEBN/1-133------------------------------------Y.------------------------------------------
Q880E4_PSESM/5-136------------------------------------R.------------------------------------------
X2GZW0_9GAMM/4-146------------------------------------AE------------------------------------------
U5MVI7_CLOSA/6-138------------------------------------.G------------------------------------------
Q5WIS2_BACSK/1-155------------------------------------NS------------------------------------------
Q8EAQ0_SHEON/1-131------------------------------------Y.------------------------------------------
B8CQS9_SHEPW/1-121------------------------------------F.------------------------------------------
I0GP53_SELRL/13-146------------------------------------.P------------------------------------------
B3PC71_CELJU/34-164------------------------------------Y.------------------------------------------
D3FRA5_BACPE/5-133------------------------------------.V------------------------------------------
M4X311_PSEDE/1-131------------------------------------Y.------------------------------------------
Q12R95_SHEDO/1-131------------------------------------Y.------------------------------------------
D5HHH7_9FIRM/5-133------------------------------------.N------------------------------------------
D5SSH7_PLAL2/5-147------------------------------------LD------------------------------------------
N0B2R8_9BACI/1-137------------------------------------R.------------------------------------------
G8M281_CLOCD/7-139------------------------------------.A------------------------------------------
G2Z5P5_FLABF/2-145------------------------------------TD------------------------------------------
A3QH89_SHELP/1-131------------------------------------Y.------------------------------------------
R6FTE9_9CLOT/5-133------------------------------------.K------------------------------------------
R5TPA4_9FIRM/24-155------------------------------------.N------------------------------------------
Q086X2_SHEFN/1-131------------------------------------Y.------------------------------------------
C1D4A4_DEIDV/3-141------------------------------------R.------------------------------------------
D3FZM0_BACPE/6-143------------------------------------N.------------------------------------------
A1S8W2_SHEAM/1-131------------------------------------Y.------------------------------------------
Q7M7B0_PHOLL/5-136------------------------------------YG------------------------------------------

PF07348

SYDP_KLEP7/6-179------------------------------------ED------------------------------------------
SYDP_COLP3/9-191------------------------------------DD------------------------------------------
I2B5Z7_SHIBC/5-178------------------------------------ED------------------------------------------
R5V7K9_9FIRM/4-185------------------------------------EA------------------------------------------
SYDP_YERPE/6-179------------------------------------DD------------------------------------------
K7A551_9ALTE/8-182------------------------------------HD------------------------------------------
E0SCC1_DICD3/6-178------------------------------------DD------------------------------------------
X2H3P8_9GAMM/9-173------------------------------------DD------------------------------------------
D4ZHN4_SHEVD/5-186------------------------------------TD------------------------------------------
D8MW85_ERWBE/6-178------------------------------------ED------------------------------------------
SYDP_CROS8/6-179------------------------------------DD------------------------------------------
F5Z4L7_ALTSS/6-183------------------------------------ED------------------------------------------
SYDP_SHEAM/4-180------------------------------------DD------------------------------------------
J7U684_MORMO/6-178------------------------------------DD------------------------------------------
E1STK9_FERBD/4-172------------------------------------ED------------------------------------------
I0DWV2_PROSM/6-180------------------------------------ED------------------------------------------
SYDP_IDILO/6-175------------------------------------ED------------------------------------------
C2X4F6_BACCE/19-188------------------------------------KE------------------------------------------
SYDP_EDWI9/6-178------------------------------------ED------------------------------------------
M4UN22_9GAMM/6-180------------------------------------ED------------------------------------------
H2IXL4_RAHAC/6-178------------------------------------DD------------------------------------------
G4QLZ8_GLANF/9-186------------------------------------DD------------------------------------------
E6WGC7_PANSA/6-178------------------------------------DD------------------------------------------
SYDP_ERWT9/6-179------------------------------------DD------------------------------------------
SYDP_VIBCH/6-179------------------------------------DD------------------------------------------
SYDP_PHOLL/6-180------------------------------------DD------------------------------------------
W0HTY4_9ENTR/12-183------------------------------------SD------------------------------------------
B4F2E3_PROMH/5-178------------------------------------ED------------------------------------------
SYDP_VIBF1/6-179------------------------------------ED------------------------------------------
SYDP_VIBTL/6-179------------------------------------DD------------------------------------------
A8GIF5_SERP5/18-190------------------------------------DD------------------------------------------
F7YLH7_VIBA7/10-183------------------------------------DD------------------------------------------
SYDP_ALTMD/6-178------------------------------------ED------------------------------------------
SYDP_SHELP/5-184------------------------------------QD------------------------------------------
F0LVK8_VIBFN/6-179------------------------------------AD------------------------------------------
SYDP_HAHCH/7-185------------------------------------DD------------------------------------------
SYDP_TOLAT/7-177------------------------------------ED------------------------------------------
SYDP_PECAS/6-179------------------------------------ED------------------------------------------
SYDP_SHEON/4-180------------------------------------AD------------------------------------------
SYDP_PHOPR/6-179------------------------------------QD------------------------------------------
SYDP_AERHH/6-178------------------------------------AD------------------------------------------
SYDP_SHEFN/4-180------------------------------------DD------------------------------------------
D3VCK7_XENNA/6-179------------------------------------DD------------------------------------------
D3UWF0_XENBS/6-179------------------------------------DD------------------------------------------
SYDP_PSEA6/6-182------------------------------------ED------------------------------------------
SYDP_VIBPA/6-178------------------------------------DD------------------------------------------
SYDP_ECOLI/6-179------------------------------------DD------------------------------------------
SYDP_SHEDO/4-180------------------------------------ED------------------------------------------
SYDP_VIBVY/6-179------------------------------------DD------------------------------------------
H2FY10_OCESG/7-174------------------------------------DD------------------------------------------
SYDP_PSYIN/6-180------------------------------------ED------------------------------------------
SYDP_PSEHT/6-178------------------------------------DD------------------------------------------

PF02393

D2K3J3_HCMV/211-336..........................................VL....GL-GT-----VS...........LK-------
B8YE72_HCMV/157-296...................................VPR....ITCYHQLL-GA-----LG..........HEV-------
A8T728_HCMV/200-332.....................................P....WY....VL-GV-----TG..........RPR-------
D2K4S5_HCMV/202-333...........................................Y....VV-GL-----VG...........YY-------
D3YS52_HCMVO/180-322...........................................Y....LL-GA-----VG...........SY-------
D2K3X0_HCMV/202-332...........................................M....IM-GV-----VG...........ES-------
D2K5D0_HCMV/151-256..........................................VE....PL-GW-----LV.............-------
C8BKJ5_HCMV/34-153...................................DQE....LI....MF-GV-----IE...........AW-------
D2K5D0_HCMV/11-135.....................................P....LR....FV-GS-----IC......TYNFLKH-------
B9VXJ9_HCMVT/546-653...................................QAH....FV....VI-GW-----ME...........PV-------
B9VXD4_HCMVT/116-247...................................EVD....PA....AD-PT-----VG...........DK-------
C3Y900_BRAFL/167-275...................................PEK....LT....VI-GY-----LE...........DD-------
C3Z365_BRAFL/157-265...................................PEK....LI....VI-GY-----LQ...........DD-------
B9VXL1_HCMVT/265-382...................................VLQ....VF....VV-RA-----VP............V-------
D3YRX5_HCMVO/17-135.....................................Y....LH....PF-GF-----VE............G-------
Q14VM9_RAHV1/5-123...................................SVN....FM....VV-GR-----CA............H-------
D2K5D5_HCMV/214-331.....................................P....VM....PL-GE-----IE...........GA-------
A8T728_HCMV/45-168.....................................P....LT....PL-GY-----AV..ILLPEPRRDHH-------
D2K4G8_HCMV/126-245.....................................F....LL....PV-GT-----VS...........RC-------
D2K595_HCMV/6-123.....................................Q....LR....VI-GT-----IG............L-------
C3RWK6_FRG3V/35-153...................................PTQ....ME....VL-GT-----LE...........NC-------
C3RWV3_FRG3V/65-186...................................PTK....ME....VF-GV-----LE...........SS-------
C1C3V1_LITCT/15-136...................................PTK....MK....VL-GI-----IE...........SS-------
D2E8A7_ANHV1/5-121...................................PEK....MV....VL-GA-----ID...........HI-------
Q070N0_CPRVZ/47-172...................................PQR....LA....VL-GS-----IN....NILGTVNSI-------
B5XAY6_SALSA/21-139...................................RME....MV....VI-GA-----LD...........DF-------
B4YEM5_9ALPH/49-167...................................HVK....ME....IV-GI-----VD...........DV-------
B1NFI8_ADEGX/15-131...................................PKR....MT....VI-GI-----VD...........NV-------
F5HIG2_HCMV/399-518...................................AGR....LY....FI-GL-----VS...........VY-------
D3YRW4_HCMVO/69-190.....................................R....LA....FV-GR-----FV............N-------
B9VXJ9_HCMVT/55-169...................................FRA....LH....LI-GT-----VS...........HA-------
C8CFJ9_HCMV/42-158.....................................R....LI....VL-GK-----CV..........IMV-------
B9VXG6_HCMVT/274-510TEAAGGDAPCAIAGAVGSAVTLPPQPYGAAGGSAVCVPNADTHA....VV-GT-----DAAAAAAAAPTVMVG-------
Q4KS78_ISKNV/1-104...................................VVQ....ME....VV-GI-----VE...........GL-------
C8CFJ8_HCMV/54-179.....................................T....LE....AV-GV-----LA...........VR-------
A8T729_HCMV/26-179...................................SLESLGVLQFSTTVL-PR-----VHGPRSSSEDEDSDD-------

PF14433

A9B4M4_HERA2/8-176------------------------------------------NH----PL.IA-----NY-----------GR-------
A9B983_HERA2/8-176------------------------------------------SH----PL.VQ-----LH-----------GG-------
A9B4M5_HERA2/2-165------------------------------------------SH----AY.VQ-----LR-----------NL-------
A6LWQ5_CLOB8/2-136------------------------------------------NT----NY.DE-----EV-----------GE-------
Q97CY9_CLOAB/2-136------------------------------------------NA----NY.DE-----KV-----------GE-------
Q97CZ0_CLOAB/1-146------------------------------------------IS----EYEEE-----YV-----------EE-------
G8LY23_CLOCD/3-138------------------------------------------VA----QF.EE-----LA-----------KE-------
C0Z7L3_BREBN/1-129------------------------------------------..----.E.EK-----YA-----------GE-------
D1ALL2_SEBTE/4-148------------------------------------------VR----DY.EI-----HF-----------NK-------
G8LVN3_CLOCD/3-139------------------------------------------ID----AY.GR-----HC-----------NT-------
R7KV91_9FIRM/6-151------------------------------------------FK----QL.SD-----AV-----------GD-------
B1HSL5_LYSSC/4-140------------------------------------------YK----RY.EV-----II-----------GE-------
X2GUJ6_9BACI/4-141------------------------------------------FK----RY.DT-----LI-----------GE-------
K9X3G6_9NOST/4-142------------------------------------------VK----DY.SD-----RV-----------GV-------
A4X261_SALTO/96-238------------------------------------------SE----IF.AE-----EF-----------NN-------
F4F239_VERMA/96-237------------------------------------------AR----GF.AE-----EY-----------GI-------
A4X254_SALTO/5-149------------------------------------------LA----EL.AA-----AI-----------GA-------
F4F315_VERMA/5-149------------------------------------------LA----EL.AS-----VT-----------GA-------
B1VUI9_STRGG/11-155------------------------------------------LG----DL.GR-----AL-----------ET-------
G2NEF9_STREK/19-163------------------------------------------LG----DL.GR-----AL-----------ET-------
B5GPR4_STRC2/10-154------------------------------------------LA----DL.GR-----AL-----------DT-------
D6X5Y7_STRPR/10-154------------------------------------------LA----DL.GR-----AL-----------DT-------
F2R7E3_STRVP/10-154------------------------------------------LA----DL.GR-----AL-----------DT-------
V6JXA9_STRNV/9-153------------------------------------------LG----DL.GR-----SL-----------DT-------
F8JWB4_STREN/11-156------------------------------------------LA----DL.GR-----AL-----------DT-------
B5I7H7_9ACTN/11-155------------------------------------------LA----DL.GR-----AL-----------DT-------
K4R8Z5_9ACTN/11-155------------------------------------------LG----DL.GR-----AL-----------DT-------
H2JSV2_STRHJ/11-155------------------------------------------LG----DL.GR-----AL-----------GT-------
V6K5C4_STRRC/24-168------------------------------------------LG----DL.GR-----AL-----------GT-------
S5VNY2_STRCU/11-155------------------------------------------LG----DL.GR-----AL-----------GT-------
Q9F2N2_STRCO/11-155------------------------------------------LG----DL.GR-----AL-----------GT-------
C9YY15_STRSW/11-155------------------------------------------LG----DL.GR-----AL-----------DT-------
Q82HF0_STRAW/11-155------------------------------------------LG----DL.GR-----AL-----------DT-------
D7BTM5_STRBB/9-153------------------------------------------LG----DL.GR-----AL-----------DT-------
G2PAB9_STRVO/37-181------------------------------------------LG----DL.GH-----AL-----------ET-------
V4J1P0_9ACTN/10-159------------------------------------------LA----DL.GR-----AL-----------ET-------
F3ZHS7_9ACTN/28-172------------------------------------------LG----DL.GH-----AL-----------GT-------
D9TC01_MICAI/257-399------------------------------------------LA----DF.AA-----VL-----------GA-------
F4F5L1_VERMA/256-398------------------------------------------LA----DF.AA-----VI-----------GA-------
R4LXK7_9ACTN/252-397------------------------------------------LG----EF.GE-----VI-----------GA-------
U5WFU2_9ACTN/252-397------------------------------------------LG----EL.AA-----VI-----------GA-------
B1VX82_STRGG/6-147------------------------------------------ID----EL.AG-----DL-----------GV-------
F2RCB0_STRVP/3-144------------------------------------------VA----EL.AR-----NL-----------GR-------
Q82G08_STRAW/6-147------------------------------------------IK----EL.GA-----GL-----------GV-------
D1A3E8_THECD/8-146------------------------------------------FQ----RV.GR-----AA-----------VG-------
F4FAN2_VERMA/7-145------------------------------------------FI----GW.GE-----RI-----------SR-------
D0J054_COMT2/5-146------------------------------------------LL----SW.EQ-----RL-----------HT-------

PF14435

A7HBV7_ANADF/6-194------------------------------------------FV----L...E-----RA-----------SG-------
B1VPR4_STRGG/19-175------------------------------------------FG----SILWD-----PR-----------TG-------
B1VUJ2_STRGG/672-850------------------------------------------IC----V...Q-----YG-----------TA-------
B1VYJ1_STRGG/2-183------------------------------------------FG----V...E-----PE-----------TG-------
B5H683_STRPR/212-402------------------------------------------VL----L...D-----GR-----------TG-------
B5HAJ0_STRPR/5-188------------------------------------------VV----I...D-----PN-----------TG-------
B5HAW8_STRPR/38-231------------------------------------------YV----L....-----DE-----------TG-------
B5HNY7_9ACTN/216-393------------------------------------------LV----V...D-----GE-----------TG-------
B5I6T5_9ACTN/5-183------------------------------------------IA----L...D-----GV-----------SG-------
D1A3F0_THECD/2-169------------------------------------------YC----L...D-----GD-----------TG-------
D1A5L5_THECD/5-198------------------------------------------LG----VVGLN-----PR-----------TG-------
D7C074_STRBB/2-188------------------------------------------AC----M...S-----RA-----------DY-------
D9T329_MICAI/3-173------------------------------------------FC----L...D-----AG-----------TG-------
E2Q6I7_STRC2/663-841------------------------------------------IC----V...Q-----YG-----------TA-------
E4N1Q1_KITSK/248-421------------------------------------------FH----L...D-----TV-----------TG-------
E4NG11_KITSK/606-780------------------------------------------LC----V...Q-----YG-----------TA-------
F3ZHT0_9ACTN/605-784------------------------------------------LC----V...Q-----YG-----------TG-------
F5XQA6_MICPN/2-160------------------------------------------LC----L...V-----PP-----------DG-------
F9GD57_FUSOF/7-186------------------------------------------IA----F...D-----PS-----------TG-------
G8WZI2_STREN/529-708------------------------------------------LC----V...Q-----YG-----------TA-------
H2JJX8_STRHJ/242-430------------------------------------------LY----L...H-----RH-----------DG-------
H2JNL8_STRHJ/197-379------------------------------------------LV----I...D-----GR-----------TG-------
H2JQV0_STRHJ/213-403------------------------------------------LL----I...D-----GR-----------TG-------
H2K7D5_STRHJ/5-186------------------------------------------LA----L...D-----PA-----------SG-------
I0H563_ACTM4/37-227------------------------------------------IA----A...V-----PG-----------SD-------
I0H8Z2_ACTM4/10-174------------------------------------------..----.....-----TA-----------TG-------
I0HE25_ACTM4/11-180------------------------------------------FG----L...R-----EG-----------SG-------
Q47PK6_THEFY/246-429------------------------------------------VA----VRRAE-----PD-----------AG-------
Q82D46_STRAW/202-388------------------------------------------LV----V...D-----GA-----------TG-------
Q9K3X2_STRCO/5-185------------------------------------------LA----L...D-----PG-----------SG-------
Q9L1R9_STRCO/109-254------------------------------------------VA----V...D-----GT-----------TG-------
S5VHB8_STRCU/197-386------------------------------------------LV----V...D-----GR-----------TG-------
S5YXS3_PARAH/2-168------------------------------------------LV----....E-----AK-----------DG-------
V6JYL3_STRNV/5-177------------------------------------------LA----L...A-----PE-----------SG-------
V6K0N1_STRRC/197-380------------------------------------------LV----V...D-----GR-----------TG-------

PF09346

A0RE58_BACAH/19-133------------------------------------------------....I-----EM-----------NE.......
Q81B84_BACCR/8-142------------------------------------------------....V-----KK-----------TF.......
A4YB72_SHEPC/14-135------------------------------------------------....I-----SE-----------L........
A0A0B5R2A8_BACTU/32-156------------------------------------------------....A-----AQ-----------GP.......
B1YF81_EXIS2/16-130------------------------------------------------.....-----..-----------.........
A6FHD8_9GAMM/19-145------------------------------------------------....D-----IS-----------EV.......
A4EPD0_9RHOB/35-163------------------------------------------------....L-----YQ-----------P........
A0RAV0_BACAH/42-162------------------------------------------------....E-----EE-----------YF.......
B8I5J3_CLOCE/15-125------------------------------------------------....I-----AE-----------.........
C3G559_BACTU/15-125------------------------------------------------.....-----..-----------.........
Q1DBU4_MYXXD/34-167------------------------------------------------....P-----GF-----------LR.......
A5UV09_ROSS1/24-144------------------------------------------------....S-----FL-----------QG.......
Q6HMR4_BACHK/23-143------------------------------------------------..SLL-----ET-----------KK.......
Q1CV91_HELPH/17-134------------------------------------------------....V-----LH-----------F........
A5TTY9_FUSNP/35-181------------------------------------------------....L-----LN-----------FE.......
Q47P53_THEFY/18-133------------------------------------------------....I-----IE-----------DN.......
A0JSM0_ARTS2/15-129------------------------------------------------....I-----AS-----------DN.......
Q82GY4_STRAW/63-178------------------------------------------------....I-----VQ-----------RN.......
Q81BW2_BACCR/27-144------------------------------------------------....I-----VD-----------FK.......
A5UTX3_ROSS1/55-202------------------------------------------------....V-----TI-----------NQ.......
A6C6S9_9PLAN/31-128------------------------------------------------.....-----..-----------.........
A5FCA9_FLAJ1/44-161------------------------------------------------....I-----KD-----------IW.......
B7X333_COMTE/152-284------------------------------------------------....V-----QV-----------VF.......
Q4K6P0_PSEF5/56-173------------------------------------------------....L-----LE-----------AY.......
Q63C14_BACCZ/25-143------------------------------------------------....V-----SD-----------FR.......
Q81BA7_BACCR/48-167------------------------------------------------....N-----IE-----------YY.......
Q89MJ4_BRADU/28-170------------------------------------------------.....-----..-----------.........
A3ZX28_9PLAN/24-139------------------------------------------------SDVME-----DD-----------RW.......
A0AMA9_LISW6/21-137------------------------------------------------VVDFT-----LK-----------FR.......
A5FMA4_FLAJ1/23-172------------------------------------------------....I-----IA-----------FW.......
A0A0B8QYA4_LISMN/14-152------------------------------------------------....D-----AF-----------SW.......
Q9F2V0_STRCO/29-155------------------------------------------------....H-----DP-----------SG.......
Q3BQF4_XANC5/29-173------------------------------------------------LLGSA-----EL-----------FS.......
A5FJY1_FLAJ1/42-170------------------------------------------------....L-----KN-----------YN.......
Q1ZQF0_PHOAS/14-166------------------------------------------------NIEMS-----RV-----------GR.......
Q5WBD2_BACSK/23-138------------------------------------------------....G-----KT-----------NG.......
A5FGR4_FLAJ1/41-198------------------------------------------------....S-----DE-----------FW.......
Q0RKI3_FRAAA/56-185------------------------------------------------....E-----PR-----------ND.......
Q9F3Q3_STRCO/47-179------------------------------------------------....T-----FE-----------E........
A6CDZ7_9PLAN/19-143------------------------------------------------..DSA-----PP-----------MW.......
B3ZML8_BACCE/18-127------------------------------------------------....H-----EV-----------FG.......
A4Y3I6_SHEPC/21-128------------------------------------------------.....-----..-----------.........
A4Y9N5_SHEPC/8-116------------------------------------------------....H-----AD-----------IF.......
A4SRI0_AERS4/8-116------------------------------------------------RLDIF-----..-----------.........
Q5LEK2_BACFN/47-168------------------------------------------------....M-----RK-----------SY.......
Q82RV7_STRAW/96-236------------------------------------------------....Q-----ET-----------AW.......
A4FNW2_SACEN/30-166------------------------------------------------....A-----LR-----------AW.......
A5FAZ7_FLAJ1/185-329------------------------------------------------....I-----AE-----------EW.......
A3I618_9BACI/42-194------------------------------------------------ILADA-----QN-----------QR.......
B4SN74_STRM5/28-184------------------------------------------------VFEDQ-----RQ-----------WD.......
Q39NE9_BURL3/28-182------------------------------------------------....M-----LE-----------EG.......
Q6HHY9_BACHK/33-185------------------------------------------------....M-----IE-----------SS.......
A5TXY3_FUSNP/37-189------------------------------------------------ILETK-----NE-----------AY.......
E6XGA7_SHEP2/26-168------------------------------------------------SLKFR-----DR-----------MK.......
Q73QC3_TREDE/40-189------------------------------------------------....T-----KE-----------HF.......
H2K898_STRHJ/18-144------------------------------------------------....V-----IE-----------VY.......
A6G0Q7_9DELT/31-170------------------------------------------------....I-----DF-----------SR.......
Q9RYT7_DEIRA/27-166------------------------------------------------....M-----AD-----------ER.......
Q93JL3_STRCO/163-310------------------------------------------------LYVAD-----AR-----------SR.......
A1ZXR5_9BACT/30-166------------------------------------------------....T-----QG-----------EF.......
SMI1_CANGA/103-288------------------------------------------------IVAMT-----QR-----------WR.......
Q59YV1_CANAL/104-343------------------------------------------------ITTAT-----EN-----------WR.......
A5DZP7_LODEL/117-382------------------------------------------------IMVQT-----EN-----------WRKVSDYIN
SMI1_DEBHA/98-296------------------------------------------------VMVMT-----EH-----------WR.......
Q55KB3_CRYNB/120-282------------------------------------------------....V-----MR-----------EW.......
SMI2_DEBHA/142-319------------------------------------------------....I-----IE-----------EY.......
A1C9R6_ASPCL/143-317------------------------------------------------....I-----VQ-----------EW.......
SMI1_YARLI/171-356------------------------------------------------....I-----AE-----------EW.......
A6EFN0_9SPHI/29-161------------------------------------------------....A-----IS-----------YY.......
O07689_LISSE/36-156------------------------------------------------....I-----PS-----------DF.......
A3ZN04_9PLAN/36-149------------------------------------------------....V-----SD-----------QH.......
A7VFJ3_9CLOT/24-132------------------------------------------------.....-----..-----------.........
A4X269_SALTO/103-245------------------------------------------------....I-----PE-----------RP.......
E6XKF4_SHEP2/4-129------------------------------------------------....I-----SN-----------RK.......
A0PQE6_MYCUA/4-131------------------------------------------------....T-----SD-----------KQ.......
Q8NRK2_CORGL/4-116------------------------------------------------....D-----SD-----------RK.......
Q0VKY9_ALCBS/4-130------------------------------------------------....K-----KR-----------IK.......
Q9F2N4_STRCO/160-298------------------------------------------------.....-----..-----------.........
A3KB11_9RHOB/18-152------------------------------------------------....D-----PE-----------RF.......
Q1DEQ7_MYXXD/33-153------------------------------------------------....I-----AA-----------AT.......
Q1CY42_MYXXD/19-141------------------------------------------------....I-----RR-----------AR.......
Q09D40_STIAD/24-149------------------------------------------------.....-----..-----------.........
B1YEY9_EXIS2/39-159------------------------------------------------....V-----IE-----------KT.......
Q5WJU2_BACSK/38-153------------------------------------------------.....-----..-----------.........
A7Z7P3_BACA2/41-156------------------------------------------------....I-----EK-----------YM.......
YOBM_BACSU/42-161------------------------------------------------....I-----EE-----------EL.......
A7Z5R7_BACA2/23-158------------------------------------------------NDANI-----IK-----------LK.......
A3ZX25_9PLAN/22-154------------------------------------------------....S-----IA-----------PG.......
A7VE32_9CLOT/35-145------------------------------------------------AYPIF-----QE-----------AY.......
A7MRN6_CROS8/1-150------------------------------------------------....L-----GT-----------EN.......
B3Z4D7_BACCE/12-154------------------------------------------------APENI-----EI-----------GM.......
A5Z4R3_9FIRM/12-152------------------------------------------------NTNIE-----FV-----------QE.......
A5Z4R9_9FIRM/9-151------------------------------------------------....F-----YI-----------FY.......
A1ZMA9_9BACT/9-138------------------------------------------------....I-----QE-----------EC.......
A0A0B5R450_BACTU/12-152------------------------------------------------.....-----..-----------.........
J7Z7X1_BACCE/12-138------------------------------------------------.....-----..-----------.........
Q6HGG3_BACHK/12-159------------------------------------------------....D-----EN-----------II.......
Q6HGE4_BACHK/13-160------------------------------------------------.....-----..-----------.........
A0RAF8_BACAH/19-149------------------------------------------------..TNV-----EN-----------IW.......
A7FEI4_YERP3/10-144------------------------------------------------KDGSC-----VD-----------KF.......
Q21ED8_SACD2/11-151------------------------------------------------....D-----YD-----------ES.......
A6CCT7_9PLAN/22-151------------------------------------------------....I-----RS-----------CL.......
Q6CS49_KLULA/64-193------------------------------------------------....P-----RF-----------DG.......
B1J8X4_PSEPW/139-260------------------------------------------------GRIPM-----DI-----------AY.......
A7ML24_CROS8/19-151------------------------------------------------....G-----PL-----------PI.......
A5FLI6_FLAJ1/11-131------------------------------------------------GKLPI-----ER-----------IY.......
Q7CL34_YERPE/11-153------------------------------------------------....H-----KM-----------TN.......
Q5LEK4_BACFN/167-306------------------------------------------------....R-----TN-----------AF.......
Q65VI9_MANSM/10-134------------------------------------------------....I-----ED-----------DL.......
B8I222_CLOCE/15-149------------------------------------------------....S-----NN-----------KR.......
Q92KA2_RHIME/32-167------------------------------------------------....V-----LI-----------AW.......
Q28UU7_JANSC/42-166------------------------------------------------....V-----AD-----------TK.......
Q5LEK4_BACFN/11-139------------------------------------------------....V-----EE-----------K........
Q5LEK9_BACFN/11-148------------------------------------------------....N-----KD-----------FK.......
A7RYE8_NEMVE/119-257------------------------------------------------....I-----SS-----------HY.......
G1S8C1_NOMLE/121-251------------------------------------------------....L-----SN-----------HY.......
Q52KV8_XENLA/36-166------------------------------------------------....L-----SN-----------HY.......
A0RFK3_BACAH/36-159------------------------------------------------....L-----KK-----------ST.......
Q9CND2_PASMU/14-158------------------------------------------------....E-----SN-----------KY.......
A6DN67_9BACT/17-158------------------------------------------------....S-----KS-----------EY.......
A9B016_HERA2/24-146------------------------------------------------....F-----DE-----------TL.......
Q5WC01_BACSK/21-135------------------------------------------------.....-----..-----------.........
A1ZUI6_9BACT/29-147------------------------------------------------.....-----..-----------.........
Q47R76_THEFY/31-145------------------------------------------------....Y-----AE-----------EF.......
A8M704_SALAI/21-139------------------------------------------------....W-----AD-----------EF.......
Q6NG79_CORDI/14-156------------------------------------------------....I-----LG-----------NG.......
Q7DD43_NEIMB/1-117------------------------------------------------....W-----FE-----------NA.......
A3I6Z7_9BACI/22-146------------------------------------------------.....-----..-----------.........
Q38V57_LACSS/13-131------------------------------------------------....P-----TS-----------DG.......
A4BCB8_9GAMM/14-147------------------------------------------------LFGIV-----TD-----------EA.......
A0R498_MYCS2/11-150------------------------------------------------....T-----RF-----------PR.......
A6VZI9_MARMS/37-168------------------------------------------------....F-----SN-----------ID.......
Q2BBP3_9BACI/17-145------------------------------------------------.....-----..-----------.........
Q816C2_BACCR/16-147------------------------------------------------.....-----..-----------.........
A5TTM3_FUSNP/176-315------------------------------------------------....S-----SD-----------YS.......
A4X5D2_SALTO/28-164------------------------------------------------....I-----GH-----------TA.......
Q11VT9_CYTH3/29-168------------------------------------------------....I-----GR-----------SK.......
A1INP6_NEIMA/28-167------------------------------------------------....I-----GF-----------EK.......
H1GFW8_LISIO/124-264------------------------------------------------....I-----GD-----------CG.......
B1KH37_SHEWM/28-163------------------------------------------------....A-----AD-----------DA.......
B1KH38_SHEWM/29-165------------------------------------------------....F-----RD-----------AI.......
Q8GDM6_PHOLU/25-137------------------------------------------------....I-----PF-----------E........
Q926X2_LISIN/25-149------------------------------------------------..RGL-----SA-----------AS.......
Q5DWB0_CLOPF/25-151------------------------------------------------....L-----TI-----------KG.......
B1KPX6_SHEWM/17-136------------------------------------------------....L-----DD-----------GG.......
A7Z5G8_BACA2/23-137------------------------------------------------....G-----GA-----------SV.......
A7GQ33_BACCN/21-130------------------------------------------------....M-----EY-----------A........
A4IKF8_GEOTN/21-132------------------------------------------------....N-----LG-----------A........
A3ZX34_9PLAN/23-143------------------------------------------------....I-----ED-----------DD.......
B7KWA7_METC4/14-155------------------------------------------------....L-----RD-----------ED.......
Q4K9A1_PSEF5/28-140------------------------------------------------....S-----SD-----------FH.......
Q633D5_BACCZ/17-131------------------------------------------------....L-----IQ-----------HN.......
A5Z4Q5_9FIRM/17-131------------------------------------------------.....-----..-----------.........
A1TSU7_ACIAC/17-133------------------------------------------------.....-----..-----------.........
Q8F615_LEPIN/16-123------------------------------------------------....L-----VQ-----------FN.......
Q5LEL2_BACFN/13-124------------------------------------------------....I-----ED-----------V........

PF14568

Q7N9I9_PHOLL/26-145----------------------------------------------------A-----PC-----------IL-------
G2TJC9_BACCO/28-148----------------------------------------------------V-----PD-----------AI-------
V5XPU7_ENTMU/27-147----------------------------------------------------V-----PD-----------AV-------
D3FRA3_BACPE/26-146----------------------------------------------------V-----PD-----------AI-------
Q4KGS7_PSEF5/49-173----------------------------------------------------W-----ES-----------IV-------
H6NAP1_9BACL/27-148----------------------------------------------------V-----PN-----------AV-------
X2H814_9GAMM/28-135----------------------------------------------------G-----GD-----------IV-------
A6X425_OCHA4/23-138----------------------------------------------------L-----WQ-----------DV-------
H8H3I1_DEIGI/15-142----------------------------------------------------V-----AV-----------LL-------
H1Y7D2_9SPHI/29-143----------------------------------------------------G-----GD-----------IV-------
Q8DV31_STRMU/18-125----------------------------------------------------V-----AT-----------VD-------
R5BF88_9FIRM/22-126----------------------------------------------------E-----AT-----------KE-------
R4TCF2_AMYOR/45-152----------------------------------------------------L-----VS-----------VN-------
B1HSL3_LYSSC/34-146----------------------------------------------------N-----EL-----------LE-------
B8I223_CLOCE/18-129----------------------------------------------------A-----DI-----------RL-------
B9T8U5_RICCO/20-128----------------------------------------------------V-----AN-----------AY-------
B1YF88_EXIS2/12-121----------------------------------------------------W-----ED-----------VV-------
D3EC76_GEOS4/35-147----------------------------------------------------V-----AD-----------LT-------
YOKK_BACSU/26-163----------------------------------------------------L-----EK-----------DP-------
D1AMU4_SEBTE/16-153----------------------------------------------------L-----CL-----------LD-------
D5DHK7_BACMD/19-130----------------------------------------------------R-----DA-----------RL-------
D3V9F7_XENNA/31-140----------------------------------------------------V-----KN-----------KE-------
F2F0G1_SOLSS/15-152----------------------------------------------------L-----CI-----------LK-------
A8FII6_BACP2/16-121----------------------------------------------------T-----..-----------..-------
F0RDN6_CELLC/80-198----------------------------------------------------R-----.N-----------EL-------
L0DJE0_SINAD/14-143----------------------------------------------------F-----FT-----------LD-------
D3FRA7_BACPE/19-130----------------------------------------------------R-----DF-----------RL-------
C2X0Q7_BACCE/18-123----------------------------------------------------V-----..-----------..-------
R5ZM16_9FIRM/11-125----------------------------------------------------Y-----GI-----------NT-------
W6EF85_SULMU/15-166----------------------------------------------------G-----VS-----------FF-------
H8H3H9_DEIGI/15-154----------------------------------------------------S-----QT-----------KL-------
D1AK41_SEBTE/28-142----------------------------------------------------F-----MK-----------KW-------
B1HQ89_LYSSC/39-149----------------------------------------------------V-----ID-----------LT-------
D1BM01_VEIPT/30-141----------------------------------------------------F-----IA-----------NY-------
Q2SDZ5_HAHCH/31-138----------------------------------------------------D-----IN-----------AE-------
A9C331_DELAS/17-129----------------------------------------------------V-----NL-----------LK-------
D1BM10_VEIPT/30-159----------------------------------------------------V-----YI-----------TG-------
YNAB_BACSU/14-117----------------------------------------------------.-----..-----------..-------
Q65PK7_BACLD/21-130----------------------------------------------------L-----DM-----------RC-------
E3EFQ0_PAEPS/15-152----------------------------------------------------L-----CI-----------LN-------
E3E4D6_PAEPS/30-142----------------------------------------------------F-----LE-----------AY-------
C3AIQ8_BACMY/23-155----------------------------------------------------I-----YV-----------AG-------
D1AI41_SEBTE/179-313----------------------------------------------------F-----GI-----------SS-------
D5DG34_BACMD/42-148----------------------------------------------------V-----..-----------..-------
G8LVX3_CLOCD/46-166----------------------------------------------------L-----DV-----------MD-------
D7C627_STRBB/27-150----------------------------------------------------L-----AA-----------DL-------
B1HSJ7_LYSSC/16-121----------------------------------------------------T-----..-----------..-------
E6UH30_RUMA7/13-149----------------------------------------------------L-----CI-----------KE-------
W0EAP9_9FIRM/31-139----------------------------------------------------S-----KN-----------KE-------
C7PR05_CHIPD/29-163----------------------------------------------------I-----AI-----------TA-------
F2IDG4_FLUTR/12-130----------------------------------------------------F-----DN-----------FT-------
Q8A449_BACTN/32-166----------------------------------------------------V-----AI-----------TG-------
X5DYB7_9CORY/26-162----------------------------------------------------E-----VF-----------HI-------
Q81H93_BACCR/16-140----------------------------------------------------L-----LT-----------LD-------
K9VSA2_9CYAN/26-156----------------------------------------------------L-----NS-----------IK-------
A5FC92_FLAJ1/15-125----------------------------------------------------F-----SD-----------YM-------
M5E8L2_9GAMM/13-128----------------------------------------------------F-----LS-----------FN-------
R6VPC4_9FIRM/166-289----------------------------------------------------D-----RF-----------YG-------
X2GNV0_9BACI/171-305----------------------------------------------------I-----AI-----------TG-------
C5ANN1_BURGB/12-131----------------------------------------------------F-----FP-----------LT-------
C3AJS9_BACMY/32-166----------------------------------------------------V-----AI-----------TG-------
YXXD_BACSU/19-130----------------------------------------------------R-----DF-----------RL-------
R6UAS7_9CLOT/11-122----------------------------------------------------L-----IS-----------YS-------
E6TT52_BACCJ/18-135----------------------------------------------------L-----NV-----------YP-------
Q81XQ3_BACAN/19-145----------------------------------------------------V-----NI-----------SG-------
Q3IK24_PSEHT/11-122----------------------------------------------------F-----IN-----------LS-------
H6NG08_9BACL/105-217----------------------------------------------------E-----EL-----------LA-------
A8FAT3_BACP2/20-143----------------------------------------------------V-----SF-----------DH-------
C3AMY1_BACMY/25-162----------------------------------------------------L-----CL-----------LD-------
C3AU00_BACMY/12-136----------------------------------------------------I-----FY-----------GI-------
D3FZU7_BACPE/33-153----------------------------------------------------F-----QE-----------LD-------
E6UJV2_RUMA7/27-143----------------------------------------------------W-----LL-----------EG-------
F4AXJ4_DOKS4/15-148----------------------------------------------------I-----ER-----------FL-------
B1YEX8_EXIS2/18-145----------------------------------------------------T-----GL-----------YL-------
C3ATZ9_BACMY/28-146----------------------------------------------------V-----MN-----------YA-------
C3ATZ8_BACMY/15-152----------------------------------------------------L-----CI-----------LE-------
Q9X366_BACAN/16-140----------------------------------------------------L-----LT-----------FD-------
C2X3A0_BACCE/19-143----------------------------------------------------L-----LT-----------LH-------
K9ZKW6_ANACC/21-135----------------------------------------------------K-----QL-----------LL-------
F0SMF1_RUBBR/22-135----------------------------------------------------L-----LF-----------RS-------
R5LQ27_9SPIR/14-127----------------------------------------------------L-----FS-----------YN-------
F3ZZP4_MAHA5/26-131----------------------------------------------------.-----..-----------..-------
U5L8D3_9BACI/50-163----------------------------------------------------L-----FF-----------WT-------

PF14567

Q81B94_BACCR/6-143------------------------------------------------...DT-----IE-----------FI-------
C7N7K9_SLAHD/5-132------------------------------------------------GKIMF-----LE-----------ET-------
K4KKC1_SIMAS/1-134------------------------------------------------.LPEM-----AA-----------NA-------
Q0VNR5_ALCBS/1-133------------------------------------------------.LPEM-----AA-----------NS-------
D4ZBL0_SHEVD/1-131------------------------------------------------.LAEV-----TA-----------YA-------
Q21KG4_SACD2/2-132------------------------------------------------.LPEV-----AA-----------EA-------
A6X428_OCHA4/5-137------------------------------------------------ELLTT-----IQ-----------QA-------
Q81Q97_BACAN/1-122------------------------------------------------ADSSV-----VY-----------HT-------
S6B2A8_PSERE/1-133------------------------------------------------.LPEV-----AA-----------VA-------
YOBK_BACSU/6-138------------------------------------------------DHASV-----VN-----------RT-------
F2K758_PSEBN/1-133------------------------------------------------.LPDV-----AA-----------NA-------
Q880E4_PSESM/5-136------------------------------------------------ELLNV-----VA-----------EA-------
X2GZW0_9GAMM/4-146------------------------------------------------SGGAI-----YY-----------DT-------
U5MVI7_CLOSA/6-138------------------------------------------------GVPSV-----IR-----------ET-------
Q5WIS2_BACSK/1-155------------------------------------------------SVPDA-----IW-----------YT-------
Q8EAQ0_SHEON/1-131------------------------------------------------.LPEV-----TC-----------YA-------
B8CQS9_SHEPW/1-121------------------------------------------------.LPEV-----AA-----------YA-------
I0GP53_SELRL/13-146------------------------------------------------PYPSV-----VE-----------IT-------
B3PC71_CELJU/34-164------------------------------------------------.LPEV-----TA-----------TA-------
D3FRA5_BACPE/5-133------------------------------------------------DYASV-----VE-----------KT-------
M4X311_PSEDE/1-131------------------------------------------------.LPEV-----AA-----------VA-------
Q12R95_SHEDO/1-131------------------------------------------------.LPEV-----TC-----------YA-------
D5HHH7_9FIRM/5-133------------------------------------------------GKMIF-----VE-----------KT-------
D5SSH7_PLAL2/5-147------------------------------------------------YRGTI-----YG-----------DT-------
N0B2R8_9BACI/1-137------------------------------------------------TWDDI-----VR-----------QN-------
G8M281_CLOCD/7-139------------------------------------------------DIPSC-----VR-----------HT-------
G2Z5P5_FLABF/2-145------------------------------------------------SIVDL-----TN-----------SF-------
A3QH89_SHELP/1-131------------------------------------------------.LPEV-----TS-----------YA-------
R6FTE9_9CLOT/5-133------------------------------------------------EDSSV-----IH-----------VT-------
R5TPA4_9FIRM/24-155------------------------------------------------GKPKF-----VE-----------IT-------
Q086X2_SHEFN/1-131------------------------------------------------.LPEV-----AC-----------YA-------
C1D4A4_DEIDV/3-141------------------------------------------------....L-----LD-----------QT-------
D3FZM0_BACPE/6-143------------------------------------------------...DT-----IE-----------FT-------
A1S8W2_SHEAM/1-131------------------------------------------------.LSEV-----AA-----------YA-------
Q7M7B0_PHOLL/5-136------------------------------------------------ELSQA-----LS-----------DA-------

PF07348

SYDP_KLEP7/6-179------------------------------------------------FQRVQ.....EN-----------LI-------
SYDP_COLP3/9-191------------------------------------------------FERLQ.....EN-----------II-------
I2B5Z7_SHIBC/5-178------------------------------------------------FLRAE.....EN-----------LI-------
R5V7K9_9FIRM/4-185------------------------------------------------ELRLNGLTPYSN-----------LG-------
SYDP_YERPE/6-179------------------------------------------------FIRLQ.....EN-----------LI-------
K7A551_9ALTE/8-182------------------------------------------------FERLQ.....QN-----------LV-------
E0SCC1_DICD3/6-178------------------------------------------------FIRLQ.....EN-----------LI-------
X2H3P8_9GAMM/9-173------------------------------------------------FSNLE.....QN-----------LI-------
D4ZHN4_SHEVD/5-186------------------------------------------------FEYLQ.....QN-----------II-------
D8MW85_ERWBE/6-178------------------------------------------------YLRVQ.....EN-----------LI-------
SYDP_CROS8/6-179------------------------------------------------FRRVQ.....EN-----------LI-------
F5Z4L7_ALTSS/6-183------------------------------------------------FERLQ.....QN-----------LI-------
SYDP_SHEAM/4-180------------------------------------------------FVLLQ.....QN-----------IL-------
J7U684_MORMO/6-178------------------------------------------------FIRLQ.....EN-----------LI-------
E1STK9_FERBD/4-172------------------------------------------------FQFLQ.....EN-----------LI-------
I0DWV2_PROSM/6-180------------------------------------------------FIRLQ.....EN-----------LI-------
SYDP_IDILO/6-175------------------------------------------------GERLL.....EN-----------IT-------
C2X4F6_BACCE/19-188------------------------------------------------LDSFK.....EK-----------LE-------
SYDP_EDWI9/6-178------------------------------------------------LHRLQ.....EN-----------QI-------
M4UN22_9GAMM/6-180------------------------------------------------FQLLQ.....EN-----------MI-------
H2IXL4_RAHAC/6-178------------------------------------------------FTRLQ.....EN-----------LI-------
G4QLZ8_GLANF/9-186------------------------------------------------FERLQ.....KN-----------LI-------
E6WGC7_PANSA/6-178------------------------------------------------FTRLQ.....EN-----------LI-------
SYDP_ERWT9/6-179------------------------------------------------FIRVQ.....EN-----------LI-------
SYDP_VIBCH/6-179------------------------------------------------FTRLQ.....EN-----------IL-------
SYDP_PHOLL/6-180------------------------------------------------FIRLQ.....EN-----------LI-------
W0HTY4_9ENTR/12-183------------------------------------------------FVRVQ.....EN-----------LI-------
B4F2E3_PROMH/5-178------------------------------------------------FIRLQ.....EN-----------MI-------
SYDP_VIBF1/6-179------------------------------------------------LERLQ.....GN-----------ML-------
SYDP_VIBTL/6-179------------------------------------------------FECLQ.....EN-----------IL-------
A8GIF5_SERP5/18-190------------------------------------------------FIRLQ.....EN-----------LI-------
F7YLH7_VIBA7/10-183------------------------------------------------FVRLQ.....EN-----------IL-------
SYDP_ALTMD/6-178------------------------------------------------FERLQ.....QN-----------LI-------
SYDP_SHELP/5-184------------------------------------------------FEYLQ.....QN-----------LI-------
F0LVK8_VIBFN/6-179------------------------------------------------FQRLQ.....EN-----------IL-------
SYDP_HAHCH/7-185------------------------------------------------METLR.....EN-----------LL-------
SYDP_TOLAT/7-177------------------------------------------------FERLQ.....QN-----------LV-------
SYDP_PECAS/6-179------------------------------------------------FTRMQ.....EN-----------LI-------
SYDP_SHEON/4-180------------------------------------------------FDALQ.....QN-----------II-------
SYDP_PHOPR/6-179------------------------------------------------GVRLQ.....EN-----------IL-------
SYDP_AERHH/6-178------------------------------------------------LDLLK.....EN-----------LI-------
SYDP_SHEFN/4-180------------------------------------------------FENLQ.....QN-----------VI-------
D3VCK7_XENNA/6-179------------------------------------------------FIRLQ.....EN-----------II-------
D3UWF0_XENBS/6-179------------------------------------------------FIRLQ.....EN-----------LI-------
SYDP_PSEA6/6-182------------------------------------------------FERLQ.....QN-----------IV-------
SYDP_VIBPA/6-178------------------------------------------------FVRLQ.....EN-----------IL-------
SYDP_ECOLI/6-179------------------------------------------------FRRVQ.....EN-----------LI-------
SYDP_SHEDO/4-180------------------------------------------------FEYLQ.....QN-----------II-------
SYDP_VIBVY/6-179------------------------------------------------FTRLQ.....EN-----------IL-------
H2FY10_OCESG/7-174------------------------------------------------FERLQ.....QN-----------QI-------
SYDP_PSYIN/6-180------------------------------------------------FNLLQ.....EN-----------ML-------
SYDP_PSEHT/6-178------------------------------------------------FDLLQ.....QN-----------IT-------

PF02393

D2K3J3_HCMV/211-336--------------------------------------------------------------------------------
B8YE72_HCMV/157-296--------------------------------------------------------------------------------
A8T728_HCMV/200-332--------------------------------------------------------------------------------
D2K4S5_HCMV/202-333--------------------------------------------------------------------------------
D3YS52_HCMVO/180-322--------------------------------------------------------------------------------
D2K3X0_HCMV/202-332--------------------------------------------------------------------------------
D2K5D0_HCMV/151-256--------------------------------------------------------------------------------
C8BKJ5_HCMV/34-153--------------------------------------------------------------------------------
D2K5D0_HCMV/11-135--------------------------------------------------------------------------------
B9VXJ9_HCMVT/546-653--------------------------------------------------------------------------------
B9VXD4_HCMVT/116-247--------------------------------------------------------------------------------
C3Y900_BRAFL/167-275--------------------------------------------------------------------------------
C3Z365_BRAFL/157-265--------------------------------------------------------------------------------
B9VXL1_HCMVT/265-382--------------------------------------------------------------------------------
D3YRX5_HCMVO/17-135--------------------------------------------------------------------------------
Q14VM9_RAHV1/5-123--------------------------------------------------------------------------------
D2K5D5_HCMV/214-331--------------------------------------------------------------------------------
A8T728_HCMV/45-168--------------------------------------------------------------------------------
D2K4G8_HCMV/126-245--------------------------------------------------------------------------------
D2K595_HCMV/6-123--------------------------------------------------------------------------------
C3RWK6_FRG3V/35-153--------------------------------------------------------------------------------
C3RWV3_FRG3V/65-186--------------------------------------------------------------------------------
C1C3V1_LITCT/15-136--------------------------------------------------------------------------------
D2E8A7_ANHV1/5-121--------------------------------------------------------------------------------
Q070N0_CPRVZ/47-172--------------------------------------------------------------------------------
B5XAY6_SALSA/21-139--------------------------------------------------------------------------------
B4YEM5_9ALPH/49-167--------------------------------------------------------------------------------
B1NFI8_ADEGX/15-131--------------------------------------------------------------------------------
F5HIG2_HCMV/399-518--------------------------------------------------------------------------------
D3YRW4_HCMVO/69-190--------------------------------------------------------------------------------
B9VXJ9_HCMVT/55-169--------------------------------------------------------------------------------
C8CFJ9_HCMV/42-158--------------------------------------------------------------------------------
B9VXG6_HCMVT/274-510--------------------------------------------------------------------------------
Q4KS78_ISKNV/1-104--------------------------------------------------------------------------------
C8CFJ8_HCMV/54-179--------------------------------------------------------------------------------
A8T729_HCMV/26-179--------------------------------------------------------------------------------

PF14433

A9B4M4_HERA2/8-176--------------------------------------------------------------------------------
A9B983_HERA2/8-176--------------------------------------------------------------------------------
A9B4M5_HERA2/2-165--------------------------------------------------------------------------------
A6LWQ5_CLOB8/2-136--------------------------------------------------------------------------------
Q97CY9_CLOAB/2-136--------------------------------------------------------------------------------
Q97CZ0_CLOAB/1-146--------------------------------------------------------------------------------
G8LY23_CLOCD/3-138--------------------------------------------------------------------------------
C0Z7L3_BREBN/1-129--------------------------------------------------------------------------------
D1ALL2_SEBTE/4-148--------------------------------------------------------------------------------
G8LVN3_CLOCD/3-139--------------------------------------------------------------------------------
R7KV91_9FIRM/6-151--------------------------------------------------------------------------------
B1HSL5_LYSSC/4-140--------------------------------------------------------------------------------
X2GUJ6_9BACI/4-141--------------------------------------------------------------------------------
K9X3G6_9NOST/4-142--------------------------------------------------------------------------------
A4X261_SALTO/96-238--------------------------------------------------------------------------------
F4F239_VERMA/96-237--------------------------------------------------------------------------------
A4X254_SALTO/5-149--------------------------------------------------------------------------------
F4F315_VERMA/5-149--------------------------------------------------------------------------------
B1VUI9_STRGG/11-155--------------------------------------------------------------------------------
G2NEF9_STREK/19-163--------------------------------------------------------------------------------
B5GPR4_STRC2/10-154--------------------------------------------------------------------------------
D6X5Y7_STRPR/10-154--------------------------------------------------------------------------------
F2R7E3_STRVP/10-154--------------------------------------------------------------------------------
V6JXA9_STRNV/9-153--------------------------------------------------------------------------------
F8JWB4_STREN/11-156--------------------------------------------------------------------------------
B5I7H7_9ACTN/11-155--------------------------------------------------------------------------------
K4R8Z5_9ACTN/11-155--------------------------------------------------------------------------------
H2JSV2_STRHJ/11-155--------------------------------------------------------------------------------
V6K5C4_STRRC/24-168--------------------------------------------------------------------------------
S5VNY2_STRCU/11-155--------------------------------------------------------------------------------
Q9F2N2_STRCO/11-155--------------------------------------------------------------------------------
C9YY15_STRSW/11-155--------------------------------------------------------------------------------
Q82HF0_STRAW/11-155--------------------------------------------------------------------------------
D7BTM5_STRBB/9-153--------------------------------------------------------------------------------
G2PAB9_STRVO/37-181--------------------------------------------------------------------------------
V4J1P0_9ACTN/10-159--------------------------------------------------------------------------------
F3ZHS7_9ACTN/28-172--------------------------------------------------------------------------------
D9TC01_MICAI/257-399--------------------------------------------------------------------------------
F4F5L1_VERMA/256-398--------------------------------------------------------------------------------
R4LXK7_9ACTN/252-397--------------------------------------------------------------------------------
U5WFU2_9ACTN/252-397--------------------------------------------------------------------------------
B1VX82_STRGG/6-147--------------------------------------------------------------------------------
F2RCB0_STRVP/3-144--------------------------------------------------------------------------------
Q82G08_STRAW/6-147--------------------------------------------------------------------------------
D1A3E8_THECD/8-146--------------------------------------------------------------------------------
F4FAN2_VERMA/7-145--------------------------------------------------------------------------------
D0J054_COMT2/5-146--------------------------------------------------------------------------------

PF14435

A7HBV7_ANADF/6-194--------------------------------------------------------------------------------
B1VPR4_STRGG/19-175--------------------------------------------------------------------------------
B1VUJ2_STRGG/672-850--------------------------------------------------------------------------------
B1VYJ1_STRGG/2-183--------------------------------------------------------------------------------
B5H683_STRPR/212-402--------------------------------------------------------------------------------
B5HAJ0_STRPR/5-188--------------------------------------------------------------------------------
B5HAW8_STRPR/38-231--------------------------------------------------------------------------------
B5HNY7_9ACTN/216-393--------------------------------------------------------------------------------
B5I6T5_9ACTN/5-183--------------------------------------------------------------------------------
D1A3F0_THECD/2-169--------------------------------------------------------------------------------
D1A5L5_THECD/5-198--------------------------------------------------------------------------------
D7C074_STRBB/2-188--------------------------------------------------------------------------------
D9T329_MICAI/3-173--------------------------------------------------------------------------------
E2Q6I7_STRC2/663-841--------------------------------------------------------------------------------
E4N1Q1_KITSK/248-421--------------------------------------------------------------------------------
E4NG11_KITSK/606-780--------------------------------------------------------------------------------
F3ZHT0_9ACTN/605-784--------------------------------------------------------------------------------
F5XQA6_MICPN/2-160--------------------------------------------------------------------------------
F9GD57_FUSOF/7-186--------------------------------------------------------------------------------
G8WZI2_STREN/529-708--------------------------------------------------------------------------------
H2JJX8_STRHJ/242-430--------------------------------------------------------------------------------
H2JNL8_STRHJ/197-379--------------------------------------------------------------------------------
H2JQV0_STRHJ/213-403--------------------------------------------------------------------------------
H2K7D5_STRHJ/5-186--------------------------------------------------------------------------------
I0H563_ACTM4/37-227--------------------------------------------------------------------------------
I0H8Z2_ACTM4/10-174--------------------------------------------------------------------------------
I0HE25_ACTM4/11-180--------------------------------------------------------------------------------
Q47PK6_THEFY/246-429--------------------------------------------------------------------------------
Q82D46_STRAW/202-388--------------------------------------------------------------------------------
Q9K3X2_STRCO/5-185--------------------------------------------------------------------------------
Q9L1R9_STRCO/109-254--------------------------------------------------------------------------------
S5VHB8_STRCU/197-386--------------------------------------------------------------------------------
S5YXS3_PARAH/2-168--------------------------------------------------------------------------------
V6JYL3_STRNV/5-177--------------------------------------------------------------------------------
V6K0N1_STRRC/197-380--------------------------------------------------------------------------------

PF09346

A0RE58_BACAH/19-133................................................................................
Q81B84_BACCR/8-142................................................................................
A4YB72_SHEPC/14-135................................................................................
A0A0B5R2A8_BACTU/32-156................................................................................
B1YF81_EXIS2/16-130................................................................................
A6FHD8_9GAMM/19-145................................................................................
A4EPD0_9RHOB/35-163................................................................................
A0RAV0_BACAH/42-162................................................................................
B8I5J3_CLOCE/15-125................................................................................
C3G559_BACTU/15-125................................................................................
Q1DBU4_MYXXD/34-167................................................................................
A5UV09_ROSS1/24-144................................................................................
Q6HMR4_BACHK/23-143................................................................................
Q1CV91_HELPH/17-134................................................................................
A5TTY9_FUSNP/35-181................................................................................
Q47P53_THEFY/18-133................................................................................
A0JSM0_ARTS2/15-129................................................................................
Q82GY4_STRAW/63-178................................................................................
Q81BW2_BACCR/27-144................................................................................
A5UTX3_ROSS1/55-202................................................................................
A6C6S9_9PLAN/31-128................................................................................
A5FCA9_FLAJ1/44-161................................................................................
B7X333_COMTE/152-284................................................................................
Q4K6P0_PSEF5/56-173................................................................................
Q63C14_BACCZ/25-143................................................................................
Q81BA7_BACCR/48-167................................................................................
Q89MJ4_BRADU/28-170................................................................................
A3ZX28_9PLAN/24-139................................................................................
A0AMA9_LISW6/21-137................................................................................
A5FMA4_FLAJ1/23-172................................................................................
A0A0B8QYA4_LISMN/14-152................................................................................
Q9F2V0_STRCO/29-155................................................................................
Q3BQF4_XANC5/29-173................................................................................
A5FJY1_FLAJ1/42-170................................................................................
Q1ZQF0_PHOAS/14-166................................................................................
Q5WBD2_BACSK/23-138................................................................................
A5FGR4_FLAJ1/41-198................................................................................
Q0RKI3_FRAAA/56-185................................................................................
Q9F3Q3_STRCO/47-179................................................................................
A6CDZ7_9PLAN/19-143................................................................................
B3ZML8_BACCE/18-127................................................................................
A4Y3I6_SHEPC/21-128................................................................................
A4Y9N5_SHEPC/8-116................................................................................
A4SRI0_AERS4/8-116................................................................................
Q5LEK2_BACFN/47-168................................................................................
Q82RV7_STRAW/96-236................................................................................
A4FNW2_SACEN/30-166................................................................................
A5FAZ7_FLAJ1/185-329................................................................................
A3I618_9BACI/42-194................................................................................
B4SN74_STRM5/28-184................................................................................
Q39NE9_BURL3/28-182................................................................................
Q6HHY9_BACHK/33-185................................................................................
A5TXY3_FUSNP/37-189................................................................................
E6XGA7_SHEP2/26-168................................................................................
Q73QC3_TREDE/40-189................................................................................
H2K898_STRHJ/18-144................................................................................
A6G0Q7_9DELT/31-170................................................................................
Q9RYT7_DEIRA/27-166................................................................................
Q93JL3_STRCO/163-310................................................................................
A1ZXR5_9BACT/30-166................................................................................
SMI1_CANGA/103-288.......................................................................SVADKLNKQ
Q59YV1_CANAL/104-343................RVAGHLNEELKQNFKSGLTKLPSSHSNSNQLTRKFTSTSNNADTSLNSIGAINDIDMANIGQDP
A5DZP7_LODEL/117-382NEARLENYKLNNLSKLPTSHANNGQYQKKIGLGVGVNTSSTTNLININNNNNNSSNNNNNNNNSNNNINNNNSNNNNINT
SMI1_DEBHA/98-296...........................................................KVADYLNSKLLHANQTNKLQE
Q55KB3_CRYNB/120-282................................................................................
SMI2_DEBHA/142-319......................................................AIWAKVNQRLEKQQYMFQHQQQQQQ.
A1C9R6_ASPCL/143-317......................................................KNWRT....VNEEF..LSGSNVMNPP
SMI1_YARLI/171-356......................................................YSWKKAAIRINREIARATGQTPTKQG
A6EFN0_9SPHI/29-161................................................................................
O07689_LISSE/36-156................................................................................
A3ZN04_9PLAN/36-149................................................................................
A7VFJ3_9CLOT/24-132................................................................................
A4X269_SALTO/103-245................................................................................
E6XKF4_SHEP2/4-129................................................................................
A0PQE6_MYCUA/4-131................................................................................
Q8NRK2_CORGL/4-116................................................................................
Q0VKY9_ALCBS/4-130................................................................................
Q9F2N4_STRCO/160-298................................................................................
A3KB11_9RHOB/18-152................................................................................
Q1DEQ7_MYXXD/33-153................................................................................
Q1CY42_MYXXD/19-141................................................................................
Q09D40_STIAD/24-149................................................................................
B1YEY9_EXIS2/39-159................................................................................
Q5WJU2_BACSK/38-153................................................................................
A7Z7P3_BACA2/41-156................................................................................
YOBM_BACSU/42-161................................................................................
A7Z5R7_BACA2/23-158................................................................................
A3ZX25_9PLAN/22-154................................................................................
A7VE32_9CLOT/35-145................................................................................
A7MRN6_CROS8/1-150................................................................................
B3Z4D7_BACCE/12-154................................................................................
A5Z4R3_9FIRM/12-152................................................................................
A5Z4R9_9FIRM/9-151................................................................................
A1ZMA9_9BACT/9-138................................................................................
A0A0B5R450_BACTU/12-152................................................................................
J7Z7X1_BACCE/12-138................................................................................
Q6HGG3_BACHK/12-159................................................................................
Q6HGE4_BACHK/13-160................................................................................
A0RAF8_BACAH/19-149................................................................................
A7FEI4_YERP3/10-144................................................................................
Q21ED8_SACD2/11-151................................................................................
A6CCT7_9PLAN/22-151................................................................................
Q6CS49_KLULA/64-193................................................................................
B1J8X4_PSEPW/139-260................................................................................
A7ML24_CROS8/19-151................................................................................
A5FLI6_FLAJ1/11-131................................................................................
Q7CL34_YERPE/11-153................................................................................
Q5LEK4_BACFN/167-306................................................................................
Q65VI9_MANSM/10-134................................................................................
B8I222_CLOCE/15-149................................................................................
Q92KA2_RHIME/32-167................................................................................
Q28UU7_JANSC/42-166................................................................................
Q5LEK4_BACFN/11-139................................................................................
Q5LEK9_BACFN/11-148................................................................................
A7RYE8_NEMVE/119-257................................................................................
G1S8C1_NOMLE/121-251................................................................................
Q52KV8_XENLA/36-166................................................................................
A0RFK3_BACAH/36-159................................................................................
Q9CND2_PASMU/14-158................................................................................
A6DN67_9BACT/17-158................................................................................
A9B016_HERA2/24-146................................................................................
Q5WC01_BACSK/21-135................................................................................
A1ZUI6_9BACT/29-147................................................................................
Q47R76_THEFY/31-145................................................................................
A8M704_SALAI/21-139................................................................................
Q6NG79_CORDI/14-156................................................................................
Q7DD43_NEIMB/1-117................................................................................
A3I6Z7_9BACI/22-146................................................................................
Q38V57_LACSS/13-131................................................................................
A4BCB8_9GAMM/14-147................................................................................
A0R498_MYCS2/11-150................................................................................
A6VZI9_MARMS/37-168................................................................................
Q2BBP3_9BACI/17-145................................................................................
Q816C2_BACCR/16-147................................................................................
A5TTM3_FUSNP/176-315................................................................................
A4X5D2_SALTO/28-164................................................................................
Q11VT9_CYTH3/29-168................................................................................
A1INP6_NEIMA/28-167................................................................................
H1GFW8_LISIO/124-264................................................................................
B1KH37_SHEWM/28-163................................................................................
B1KH38_SHEWM/29-165................................................................................
Q8GDM6_PHOLU/25-137................................................................................
Q926X2_LISIN/25-149................................................................................
Q5DWB0_CLOPF/25-151................................................................................
B1KPX6_SHEWM/17-136................................................................................
A7Z5G8_BACA2/23-137................................................................................
A7GQ33_BACCN/21-130................................................................................
A4IKF8_GEOTN/21-132................................................................................
A3ZX34_9PLAN/23-143................................................................................
B7KWA7_METC4/14-155................................................................................
Q4K9A1_PSEF5/28-140................................................................................
Q633D5_BACCZ/17-131................................................................................
A5Z4Q5_9FIRM/17-131................................................................................
A1TSU7_ACIAC/17-133................................................................................
Q8F615_LEPIN/16-123................................................................................
Q5LEL2_BACFN/13-124................................................................................

PF14568

Q7N9I9_PHOLL/26-145--------------------------------------------------------------------------------
G2TJC9_BACCO/28-148--------------------------------------------------------------------------------
V5XPU7_ENTMU/27-147--------------------------------------------------------------------------------
D3FRA3_BACPE/26-146--------------------------------------------------------------------------------
Q4KGS7_PSEF5/49-173--------------------------------------------------------------------------------
H6NAP1_9BACL/27-148--------------------------------------------------------------------------------
X2H814_9GAMM/28-135--------------------------------------------------------------------------------
A6X425_OCHA4/23-138--------------------------------------------------------------------------------
H8H3I1_DEIGI/15-142--------------------------------------------------------------------------------
H1Y7D2_9SPHI/29-143--------------------------------------------------------------------------------
Q8DV31_STRMU/18-125--------------------------------------------------------------------------------
R5BF88_9FIRM/22-126--------------------------------------------------------------------------------
R4TCF2_AMYOR/45-152--------------------------------------------------------------------------------
B1HSL3_LYSSC/34-146--------------------------------------------------------------------------------
B8I223_CLOCE/18-129--------------------------------------------------------------------------------
B9T8U5_RICCO/20-128--------------------------------------------------------------------------------
B1YF88_EXIS2/12-121--------------------------------------------------------------------------------
D3EC76_GEOS4/35-147--------------------------------------------------------------------------------
YOKK_BACSU/26-163--------------------------------------------------------------------------------
D1AMU4_SEBTE/16-153--------------------------------------------------------------------------------
D5DHK7_BACMD/19-130--------------------------------------------------------------------------------
D3V9F7_XENNA/31-140--------------------------------------------------------------------------------
F2F0G1_SOLSS/15-152--------------------------------------------------------------------------------
A8FII6_BACP2/16-121--------------------------------------------------------------------------------
F0RDN6_CELLC/80-198--------------------------------------------------------------------------------
L0DJE0_SINAD/14-143--------------------------------------------------------------------------------
D3FRA7_BACPE/19-130--------------------------------------------------------------------------------
C2X0Q7_BACCE/18-123--------------------------------------------------------------------------------
R5ZM16_9FIRM/11-125--------------------------------------------------------------------------------
W6EF85_SULMU/15-166--------------------------------------------------------------------------------
H8H3H9_DEIGI/15-154--------------------------------------------------------------------------------
D1AK41_SEBTE/28-142--------------------------------------------------------------------------------
B1HQ89_LYSSC/39-149--------------------------------------------------------------------------------
D1BM01_VEIPT/30-141--------------------------------------------------------------------------------
Q2SDZ5_HAHCH/31-138--------------------------------------------------------------------------------
A9C331_DELAS/17-129--------------------------------------------------------------------------------
D1BM10_VEIPT/30-159--------------------------------------------------------------------------------
YNAB_BACSU/14-117--------------------------------------------------------------------------------
Q65PK7_BACLD/21-130--------------------------------------------------------------------------------
E3EFQ0_PAEPS/15-152--------------------------------------------------------------------------------
E3E4D6_PAEPS/30-142--------------------------------------------------------------------------------
C3AIQ8_BACMY/23-155--------------------------------------------------------------------------------
D1AI41_SEBTE/179-313--------------------------------------------------------------------------------
D5DG34_BACMD/42-148--------------------------------------------------------------------------------
G8LVX3_CLOCD/46-166--------------------------------------------------------------------------------
D7C627_STRBB/27-150--------------------------------------------------------------------------------
B1HSJ7_LYSSC/16-121--------------------------------------------------------------------------------
E6UH30_RUMA7/13-149--------------------------------------------------------------------------------
W0EAP9_9FIRM/31-139--------------------------------------------------------------------------------
C7PR05_CHIPD/29-163--------------------------------------------------------------------------------
F2IDG4_FLUTR/12-130--------------------------------------------------------------------------------
Q8A449_BACTN/32-166--------------------------------------------------------------------------------
X5DYB7_9CORY/26-162--------------------------------------------------------------------------------
Q81H93_BACCR/16-140--------------------------------------------------------------------------------
K9VSA2_9CYAN/26-156--------------------------------------------------------------------------------
A5FC92_FLAJ1/15-125--------------------------------------------------------------------------------
M5E8L2_9GAMM/13-128--------------------------------------------------------------------------------
R6VPC4_9FIRM/166-289--------------------------------------------------------------------------------
X2GNV0_9BACI/171-305--------------------------------------------------------------------------------
C5ANN1_BURGB/12-131--------------------------------------------------------------------------------
C3AJS9_BACMY/32-166--------------------------------------------------------------------------------
YXXD_BACSU/19-130--------------------------------------------------------------------------------
R6UAS7_9CLOT/11-122--------------------------------------------------------------------------------
E6TT52_BACCJ/18-135--------------------------------------------------------------------------------
Q81XQ3_BACAN/19-145--------------------------------------------------------------------------------
Q3IK24_PSEHT/11-122--------------------------------------------------------------------------------
H6NG08_9BACL/105-217--------------------------------------------------------------------------------
A8FAT3_BACP2/20-143--------------------------------------------------------------------------------
C3AMY1_BACMY/25-162--------------------------------------------------------------------------------
C3AU00_BACMY/12-136--------------------------------------------------------------------------------
D3FZU7_BACPE/33-153--------------------------------------------------------------------------------
E6UJV2_RUMA7/27-143--------------------------------------------------------------------------------
F4AXJ4_DOKS4/15-148--------------------------------------------------------------------------------
B1YEX8_EXIS2/18-145--------------------------------------------------------------------------------
C3ATZ9_BACMY/28-146--------------------------------------------------------------------------------
C3ATZ8_BACMY/15-152--------------------------------------------------------------------------------
Q9X366_BACAN/16-140--------------------------------------------------------------------------------
C2X3A0_BACCE/19-143--------------------------------------------------------------------------------
K9ZKW6_ANACC/21-135--------------------------------------------------------------------------------
F0SMF1_RUBBR/22-135--------------------------------------------------------------------------------
R5LQ27_9SPIR/14-127--------------------------------------------------------------------------------
F3ZZP4_MAHA5/26-131--------------------------------------------------------------------------------
U5L8D3_9BACI/50-163--------------------------------------------------------------------------------

PF14567

Q81B94_BACCR/6-143--------------------------------------------------------------------------------
C7N7K9_SLAHD/5-132--------------------------------------------------------------------------------
K4KKC1_SIMAS/1-134--------------------------------------------------------------------------------
Q0VNR5_ALCBS/1-133--------------------------------------------------------------------------------
D4ZBL0_SHEVD/1-131--------------------------------------------------------------------------------
Q21KG4_SACD2/2-132--------------------------------------------------------------------------------
A6X428_OCHA4/5-137--------------------------------------------------------------------------------
Q81Q97_BACAN/1-122--------------------------------------------------------------------------------
S6B2A8_PSERE/1-133--------------------------------------------------------------------------------
YOBK_BACSU/6-138--------------------------------------------------------------------------------
F2K758_PSEBN/1-133--------------------------------------------------------------------------------
Q880E4_PSESM/5-136--------------------------------------------------------------------------------
X2GZW0_9GAMM/4-146--------------------------------------------------------------------------------
U5MVI7_CLOSA/6-138--------------------------------------------------------------------------------
Q5WIS2_BACSK/1-155--------------------------------------------------------------------------------
Q8EAQ0_SHEON/1-131--------------------------------------------------------------------------------
B8CQS9_SHEPW/1-121--------------------------------------------------------------------------------
I0GP53_SELRL/13-146--------------------------------------------------------------------------------
B3PC71_CELJU/34-164--------------------------------------------------------------------------------
D3FRA5_BACPE/5-133--------------------------------------------------------------------------------
M4X311_PSEDE/1-131--------------------------------------------------------------------------------
Q12R95_SHEDO/1-131--------------------------------------------------------------------------------
D5HHH7_9FIRM/5-133--------------------------------------------------------------------------------
D5SSH7_PLAL2/5-147--------------------------------------------------------------------------------
N0B2R8_9BACI/1-137--------------------------------------------------------------------------------
G8M281_CLOCD/7-139--------------------------------------------------------------------------------
G2Z5P5_FLABF/2-145--------------------------------------------------------------------------------
A3QH89_SHELP/1-131--------------------------------------------------------------------------------
R6FTE9_9CLOT/5-133--------------------------------------------------------------------------------
R5TPA4_9FIRM/24-155--------------------------------------------------------------------------------
Q086X2_SHEFN/1-131--------------------------------------------------------------------------------
C1D4A4_DEIDV/3-141--------------------------------------------------------------------------------
D3FZM0_BACPE/6-143--------------------------------------------------------------------------------
A1S8W2_SHEAM/1-131--------------------------------------------------------------------------------
Q7M7B0_PHOLL/5-136--------------------------------------------------------------------------------

PF07348

SYDP_KLEP7/6-179--------------------------------------------------------------------------------
SYDP_COLP3/9-191--------------------------------------------------------------------------------
I2B5Z7_SHIBC/5-178--------------------------------------------------------------------------------
R5V7K9_9FIRM/4-185--------------------------------------------------------------------------------
SYDP_YERPE/6-179--------------------------------------------------------------------------------
K7A551_9ALTE/8-182--------------------------------------------------------------------------------
E0SCC1_DICD3/6-178--------------------------------------------------------------------------------
X2H3P8_9GAMM/9-173--------------------------------------------------------------------------------
D4ZHN4_SHEVD/5-186--------------------------------------------------------------------------------
D8MW85_ERWBE/6-178--------------------------------------------------------------------------------
SYDP_CROS8/6-179--------------------------------------------------------------------------------
F5Z4L7_ALTSS/6-183--------------------------------------------------------------------------------
SYDP_SHEAM/4-180--------------------------------------------------------------------------------
J7U684_MORMO/6-178--------------------------------------------------------------------------------
E1STK9_FERBD/4-172--------------------------------------------------------------------------------
I0DWV2_PROSM/6-180--------------------------------------------------------------------------------
SYDP_IDILO/6-175--------------------------------------------------------------------------------
C2X4F6_BACCE/19-188--------------------------------------------------------------------------------
SYDP_EDWI9/6-178--------------------------------------------------------------------------------
M4UN22_9GAMM/6-180--------------------------------------------------------------------------------
H2IXL4_RAHAC/6-178--------------------------------------------------------------------------------
G4QLZ8_GLANF/9-186--------------------------------------------------------------------------------
E6WGC7_PANSA/6-178--------------------------------------------------------------------------------
SYDP_ERWT9/6-179--------------------------------------------------------------------------------
SYDP_VIBCH/6-179--------------------------------------------------------------------------------
SYDP_PHOLL/6-180--------------------------------------------------------------------------------
W0HTY4_9ENTR/12-183--------------------------------------------------------------------------------
B4F2E3_PROMH/5-178--------------------------------------------------------------------------------
SYDP_VIBF1/6-179--------------------------------------------------------------------------------
SYDP_VIBTL/6-179--------------------------------------------------------------------------------
A8GIF5_SERP5/18-190--------------------------------------------------------------------------------
F7YLH7_VIBA7/10-183--------------------------------------------------------------------------------
SYDP_ALTMD/6-178--------------------------------------------------------------------------------
SYDP_SHELP/5-184--------------------------------------------------------------------------------
F0LVK8_VIBFN/6-179--------------------------------------------------------------------------------
SYDP_HAHCH/7-185--------------------------------------------------------------------------------
SYDP_TOLAT/7-177--------------------------------------------------------------------------------
SYDP_PECAS/6-179--------------------------------------------------------------------------------
SYDP_SHEON/4-180--------------------------------------------------------------------------------
SYDP_PHOPR/6-179--------------------------------------------------------------------------------
SYDP_AERHH/6-178--------------------------------------------------------------------------------
SYDP_SHEFN/4-180--------------------------------------------------------------------------------
D3VCK7_XENNA/6-179--------------------------------------------------------------------------------
D3UWF0_XENBS/6-179--------------------------------------------------------------------------------
SYDP_PSEA6/6-182--------------------------------------------------------------------------------
SYDP_VIBPA/6-178--------------------------------------------------------------------------------
SYDP_ECOLI/6-179--------------------------------------------------------------------------------
SYDP_SHEDO/4-180--------------------------------------------------------------------------------
SYDP_VIBVY/6-179--------------------------------------------------------------------------------
H2FY10_OCESG/7-174--------------------------------------------------------------------------------
SYDP_PSYIN/6-180--------------------------------------------------------------------------------
SYDP_PSEHT/6-178--------------------------------------------------------------------------------

PF02393

D2K3J3_HCMV/211-336------------------------------GENAPFPH----------------------------------LR-----W
B8YE72_HCMV/157-296------------------------------PERKEFLV----------------------------------..-----.
A8T728_HCMV/200-332------------------------------PGRSFVAE----------------------------------..-----.
D2K4S5_HCMV/202-333------------------------------LAYGPFVP----------------------------------S.-----.
D3YS52_HCMVO/180-322------------------------------RAGGFFDT----------------------------------S.-----.
D2K3X0_HCMV/202-332------------------------------LPSGVFHA----------------------------------D.-----.
D2K5D0_HCMV/151-256------------------------------...SPYD.----------------------------------..-----.
C8BKJ5_HCMV/34-153------------------------------EEASVRPT----------------------------------RQ-----.
D2K5D0_HCMV/11-135------------------------------KGDHNVP.----------------------------------..-----.
B9VXJ9_HCMVT/546-653------------------------------N.......----------------------------------..-----.
B9VXD4_HCMVT/116-247------------------------------AGHPEGLC----------------------------------AQ-----D
C3Y900_BRAFL/167-275------------------------------A.......----------------------------------..-----.
C3Z365_BRAFL/157-265------------------------------A.......----------------------------------..-----.
B9VXL1_HCMVT/265-382------------------------------ESQQRLD.----------------------------------..-----.
D3YRX5_HCMVO/17-135------------------------------PGFMRYQ.----------------------------------..-----.
Q14VM9_RAHV1/5-123------------------------------RSVQNTRR----------------------------------..-----.
D2K5D5_HCMV/214-331------------------------------EDKTFFHR----------------------------------..-----.
A8T728_HCMV/45-168------------------------------DGMVATP.----------------------------------..-----.
D2K4G8_HCMV/126-245------------------------------EAIGRPP.----------------------------------..-----.
D2K595_HCMV/6-123------------------------------ANLFSWDR----------------------------------..-----.
C3RWK6_FRG3V/35-153------------------------------CGIPPFPE----------------------------------..-----.
C3RWV3_FRG3V/65-186------------------------------KGMAPFPQ----------------------------------..-----.
C1C3V1_LITCT/15-136------------------------------SGMLLFPQ----------------------------------..-----.
D2E8A7_ANHV1/5-121------------------------------DGEWICQ.----------------------------------..-----.
Q070N0_CPRVZ/47-172------------------------------RQMENWQQ----------------------------------..-----.
B5XAY6_SALSA/21-139------------------------------RCSAAGWQ----------------------------------..-----.
B4YEM5_9ALPH/49-167------------------------------PCLATGMQ----------------------------------..-----.
B1NFI8_ADEGX/15-131------------------------------ISFADGLQ----------------------------------..-----.
F5HIG2_HCMV/399-518------------------------------ECVPDANT----------------------------------..-----.
D3YRW4_HCMVO/69-190------------------------------EGVLSPDQ----------------------------------QK-----K
B9VXJ9_HCMVT/55-169------------------------------TCRYQ...----------------------------------..-----.
C8CFJ9_HCMV/42-158------------------------------EDHYEETE----------------------------------..-----.
B9VXG6_HCMVT/274-510------------------------------PTAMAGPA----------------------------------AS-----G
Q4KS78_ISKNV/1-104------------------------------PCSDQMV.----------------------------------..-----.
C8CFJ8_HCMV/54-179------------------------------PPDSDLTR----------------------------------NT-----K
A8T729_HCMV/26-179------------------------------DDFFVYVE----------------------------------EI-----E

PF14433

A9B4M4_HERA2/8-176------------------------------LLCPIGSY----------------------------------..-----.
A9B983_HERA2/8-176------------------------------GICPIGSY----------------------------------HP-----.
A9B4M5_HERA2/2-165------------------------------QIAPIGRL----------------------------------..-----S
A6LWQ5_CLOB8/2-136------------------------------RTIPVFRL----------------------------------YR-----G
Q97CY9_CLOAB/2-136------------------------------RTIPVCKL----------------------------------YQ-----G
Q97CZ0_CLOAB/1-146------------------------------KLVVVGSL----------------------------------.N-----G
G8LY23_CLOCD/3-138------------------------------ELVIVGEL----------------------------------HN-----R
C0Z7L3_BREBN/1-129------------------------------SLVPVGMI----------------------------------DS-----G
D1ALL2_SEBTE/4-148------------------------------NMIPIAEV----------------------------------PT-----E
G8LVN3_CLOCD/3-139------------------------------TMVPVADL----------------------------------PK-----H
R7KV91_9FIRM/6-151------------------------------YIIPLGLI----------------------------------NN-----D
B1HSL5_LYSSC/4-140------------------------------DLVVIGTA----------------------------------FR-----D
X2GUJ6_9BACI/4-141------------------------------YLIVIGSV----------------------------------FR-----N
K9X3G6_9NOST/4-142------------------------------PLCIIGES----------------------------------NR-----V
A4X261_SALTO/96-238------------------------------PVFPLGNN----------------------------------AD-----G
F4F239_VERMA/96-237------------------------------PVYPIGNN----------------------------------ED-----G
A4X254_SALTO/5-149------------------------------PLTPIGEE----------------------------------GD-----G
F4F315_VERMA/5-149------------------------------PLSPLGEE----------------------------------GD-----G
B1VUI9_STRGG/11-155------------------------------EVSPLGAE----------------------------------GE-----E
G2NEF9_STREK/19-163------------------------------EVAPLGEE----------------------------------GD-----G
B5GPR4_STRC2/10-154------------------------------EISPLGVE----------------------------------GN-----D
D6X5Y7_STRPR/10-154------------------------------EISPLGME----------------------------------GD-----Q
F2R7E3_STRVP/10-154------------------------------ELAPLGEE----------------------------------GD-----H
V6JXA9_STRNV/9-153------------------------------EISPIGEE----------------------------------GD-----G
F8JWB4_STREN/11-156------------------------------QVCPLGAQ----------------------------------TD-----G
B5I7H7_9ACTN/11-155------------------------------EVCPVGAE----------------------------------TD-----T
K4R8Z5_9ACTN/11-155------------------------------EVCPLGAE----------------------------------TD-----T
H2JSV2_STRHJ/11-155------------------------------ELSPLGEE----------------------------------TD-----N
V6K5C4_STRRC/24-168------------------------------EICPLGQE----------------------------------TD-----T
S5VNY2_STRCU/11-155------------------------------EVSPLGEE----------------------------------TD-----T
Q9F2N2_STRCO/11-155------------------------------QTCPLGTE----------------------------------TD-----S
C9YY15_STRSW/11-155------------------------------EVCPLGHE----------------------------------TA-----T
Q82HF0_STRAW/11-155------------------------------EVCPLGEE----------------------------------SD-----S
D7BTM5_STRBB/9-153------------------------------ALSPLGEE----------------------------------AG-----G
G2PAB9_STRVO/37-181------------------------------EICPLGEE----------------------------------SD-----G
V4J1P0_9ACTN/10-159------------------------------ELCPLGEE----------------------------------TT-----A
F3ZHS7_9ACTN/28-172------------------------------HLCPLGLD----------------------------------TT-----T
D9TC01_MICAI/257-399------------------------------RLFPLGSE----------------------------------RQ-----.
F4F5L1_VERMA/256-398------------------------------RLFPIGTE----------------------------------NQ-----.
R4LXK7_9ACTN/252-397------------------------------RLFPLGVE----------------------------------AK-----G
U5WFU2_9ACTN/252-397------------------------------PLFPIGVE----------------------------------AK-----G
B1VX82_STRGG/6-147------------------------------KLFPVGYD----------------------------------TY-----D
F2RCB0_STRVP/3-144------------------------------RLFPVGYE----------------------------------TF-----D
Q82G08_STRAW/6-147------------------------------ELFPVGYE----------------------------------AS-----E
D1A3E8_THECD/8-146------------------------------ELYPIGSV----------------------------------AG-----G
F4FAN2_VERMA/7-145------------------------------DIAPIGEL----------------------------------AG-----G
D0J054_COMT2/5-146------------------------------RLIAVADV----------------------------------HH-----A

PF14435

A7HBV7_ANADF/6-194------------------------------RVLLVDLE----------------------------------QG.....Q
B1VPR4_STRGG/19-175------------------------------HVVQSGKS----------------------------------LE.....H
B1VUJ2_STRGG/672-850------------------------------NIVAVPVE----------------------------------AG.....P
B1VYJ1_STRGG/2-183------------------------------AVYFVMPD----------------------------------GE.....A
B5H683_STRPR/212-402------------------------------EVHYAEYD----------------------------------AD.....R
B5HAJ0_STRPR/5-188------------------------------VVYQFTDA----------------------------------IK.....E
B5HAW8_STRPR/38-231------------------------------RVWVLAEG----------------------------------VD.....P
B5HNY7_9ACTN/216-393------------------------------EVLNWSER----------------------------------EG.....T
B5I6T5_9ACTN/5-183------------------------------VVYCLPGD----------------------------------ES.....E
D1A3F0_THECD/2-169------------------------------RVLLLDLG----------------------------------DQ.....V
D1A5L5_THECD/5-198------------------------------AVYVVSEM----------------------------------EY.....E
D7C074_STRBB/2-188------------------------------RIYWYEPG----------------------------------SS.....N
D9T329_MICAI/3-173------------------------------AVILLDLE----------------------------------TP.....N
E2Q6I7_STRC2/663-841------------------------------HIVAVPLE----------------------------------AG.....P
E4N1Q1_KITSK/248-421------------------------------RVHNVPDG----------------------------------EA.....P
E4NG11_KITSK/606-780------------------------------AVVAVDLE----------------------------------NP.....A
F3ZHT0_9ACTN/605-784------------------------------HIVAVPVE----------------------------------AG.....P
F5XQA6_MICPN/2-160------------------------------AVISVTAT----------------------------------SD.....L
F9GD57_FUSOF/7-186------------------------------TVWCLPQD----------------------------------AD.....I
G8WZI2_STREN/529-708------------------------------HIMAVPLE----------------------------------AV.....P
H2JJX8_STRHJ/242-430------------------------------TVHIRSRL----------------------------------TR.....R
H2JNL8_STRHJ/197-379------------------------------AVLTFNEP----------------------------------EA.....T
H2JQV0_STRHJ/213-403------------------------------ALFRTELG----------------------------------AD.....H
H2K7D5_STRHJ/5-186------------------------------KVHAFDAD----------------------------------EE.....T
I0H563_ACTM4/37-227------------------------------AVLAVPRS----------------------------------SAVHPDLA
I0H8Z2_ACTM4/10-174------------------------------AVMEHSPE----------------------------------AG.....M
I0HE25_ACTM4/11-180------------------------------EVVYRWLR----------------------------------HD.....G
Q47PK6_THEFY/246-429------------------------------TVWAIDMR----------------------------------SG.....A
Q82D46_STRAW/202-388------------------------------AVLCWSEP----------------------------------DG.....M
Q9K3X2_STRCO/5-185------------------------------TVYAFDPD----------------------------------EE.....T
Q9L1R9_STRCO/109-254------------------------------AVLTWRTP----------------------------------DG.....T
S5VHB8_STRCU/197-386------------------------------AVLTYSAP----------------------------------DA.....T
S5YXS3_PARAH/2-168------------------------------SIRVIAAE----------------------------------DE.....E
V6JYL3_STRNV/5-177------------------------------TVYSLGDG----------------------------------ET......
V6K0N1_STRRC/197-380------------------------------AVLTFSEP----------------------------------EA.....T

PF09346

A0RE58_BACAH/19-133...................................AHD..IQK....-------------------------........
Q81B84_BACCR/8-142..............................DLS..ECY..EEF....-------------------------.EEDM...
A4YB72_SHEPC/14-135..............................TEA..YCY..EQY....-------------------------........
A0A0B5R2A8_BACTU/32-156..............................KQRGGSYL..NDSFKKE-------------------------RRPTK...
B1YF81_EXIS2/16-130..............................RRT..VSI..DLVRHNE-------------------------KRPAG...
A6FHD8_9GAMM/19-145..............QDFLSLE.........DVA..SLS..QLY....-------------------------.EMSG...
A4EPD0_9RHOB/35-163..............................EMI..VTQ..TLD...W-------------------------CKIG....
A0RAV0_BACAH/42-162..............QPFDLYN.........FQQ..LYA..SKK....-------------------------........
B8I5J3_CLOCE/15-125..............................RNL..TYE..VPE....-------------------------........
C3G559_BACTU/15-125...............................................-------------------------........
Q1DBU4_MYXXD/34-167..............AAAPDPS.........DAV..NGD..DPE.VEE-------------------------AINQA...
A5UV09_ROSS1/24-144..............RQDLSVW.........GII..EAN..ILH....-------------------------.RSDP...
Q6HMR4_BACHK/23-143..............................DEH..ICG..FIDTNEI-------------------------WYENE...
Q1CV91_HELPH/17-134..............................NLE..SLF..VDF.MQS-------------------------LKEWL...
A5TTY9_FUSNP/35-181..............ESRQGWV.........DIC..YPD..YND..EY-------------------------DKVWH...
Q47P53_THEFY/18-133..............................LAM..RSE..PDY....-------------------------.RELY...
A0JSM0_ARTS2/15-129..............................AYF..RND..ADVSDSF-------------------------........
Q82GY4_STRAW/63-178..............................VEL..RSS........F-------------------------SELYM...
Q81BW2_BACCR/27-144..............................DLY..............-------------------------........
A5UTX3_ROSS1/55-202..............NLLKDFR.........AML..GND..PDF.RDL-------------------------HTLNY...
A6C6S9_9PLAN/31-128..............................ELF..DAD..SLQ....-------------------------........
A5FCA9_FLAJ1/44-161..................SDA.........PQY..GPD..FTE....-------------------------.EDKL...
B7X333_COMTE/152-284..............PGIADIV.........EMS..APQ..QAQ....-------------------------.ALKA...
Q4K6P0_PSEF5/56-173..............................PGIVEIGD..VDL....-------------------------........
Q63C14_BACCZ/25-143...................................LRE..DIYEYTP-------------------------NIDGV...
Q81BA7_BACCR/48-167..............................TII..ARK..EHG....-------------------------........
Q89MJ4_BRADU/28-170..............................DEC..SLV..QTR...Q-------------------------TPQWP...
A3ZX28_9PLAN/24-139..............................SVI..DVT..NEVRQSV-------------------------TDGVS...
A0AMA9_LISW6/21-137...................................DTY..GES....-------------------------........
A5FMA4_FLAJ1/23-172..............ANDRPEL.........QEY..KLL..TEE.QTQ-------------------------KINEA...
A0A0B8QYA4_LISMN/14-152..............NSFEQMS.........LEA..AEG..DTN.LEN-------------------------EVKLF...
Q9F2V0_STRCO/29-155..............EPAAVAQ.........YLA..NRD..SGA...K-------------------------DPDWP...
Q3BQF4_XANC5/29-173..............FAQVRAR.........EEY..RDD..AFA...G-------------------------LAAGG...
A5FJY1_FLAJ1/42-170..............ALVQQEI.........EGE..DEA..SED.NYF-------------------------MIGSHL..
Q1ZQF0_PHOAS/14-166..............APAHRQL.........ELY..LKY..YQE.FSN-------------------------SDFVY...
Q5WBD2_BACSK/23-138..............................NDT..IEF..TYD..YE-------------------------IKQGG...
A5FGR4_FLAJ1/41-198..............EESIKNI.........EEN..DDI..SEE.DFE-------------------------AELGR...
Q0RKI3_FRAAA/56-185..............................DED..DSD..MLS....-------------------------........
Q9F3Q3_STRCO/47-179..................DLD.........EEA..GPQ..ERR....-------------------------.EAGI...
A6CDZ7_9PLAN/19-143..............................RHV..VKT..SVQ.LGR-------------------------VNQGH...
B3ZML8_BACCE/18-127..............LGTSGYL.........NVV..EST..LEE...R-------------------------QFEKA...
A4Y3I6_SHEPC/21-128..................PYS.........HTY..LPE..VTC...Y-------------------------AWSIG...
A4Y9N5_SHEPC/8-116..............................ETLANARK..YFQ....-------------------------........
A4SRI0_AERS4/8-116...................................EMARIAWEIIG.-------------------------........
Q5LEK2_BACFN/47-168..............NRDLNAT.........PAP..FGL..LEP.NIY-------------------------EKPKN...
Q82RV7_STRAW/96-236..............LLPRKHGIPPVQ....HLP..YWD..EGP.HTI-------------------------GRPDD...
A4FNW2_SACEN/30-166..............RGHRELWTA.......RWE..RPS..CDY.YAG-------------------------SAGSS...
A5FAZ7_FLAJ1/185-329..............NSIQDLQ.....FDEDDLP..EQE..LDF.EKI-------------------------NTNNY...
A3I618_9BACI/42-194..............................ETI..FER..YQDFLEY-------------------------VDIDKRIN
B4SN74_STRM5/28-184..............DSIRSIY.........EEW..LDD..EPEILGE-------------------------GIDAD...
Q39NE9_BURL3/28-182..............................AKYRDSIA..EIYGDDA-------------------------NDDGELVD
Q6HHY9_BACHK/33-185..............KEGEDVS.........YLLEYQDD..EDVVDSK-------------------------INPEG...
A5TXY3_FUSNP/37-189..............................DFYADYVD..REYEEVE-------------------------IDEEIISD
E6XGA7_SHEP2/26-168..............KQAQYYA.........DYQ..EPE..VRD.PKI-------------------------QSGW....
Q73QC3_TREDE/40-189..............QNRDALL.........TEF..TDY..FTN...E-------------------------DIENMKDS
H2K898_STRHJ/18-144..............RMQMRFQ.........EEN..GED..EDA.LVL-------------------------........
A6G0Q7_9DELT/31-170..............................HFANVTSWGDGRFDDGR-------------------------LARTY...
Q9RYT7_DEIRA/27-166..................KVWMDLLQDGTFDGN..ASH..NESSEAL-------------------------QPGW....
Q93JL3_STRCO/163-310.................PCLW.........QFAATDAA..VTAPDAA-------------------------VQGLV...
A1ZXR5_9BACT/30-166..............................EHL..TPW..YIKEKGA-------------------------VKFKW...
SMI1_CANGA/103-288ATMSKHSSVGVSNGSSMGSTASIGSSSQQQREK..PRN..KFKLPYI-------------------------PEQKSIPP
Q59YV1_CANAL/104-343ISTRSSIDISTTTSRTSSTHSTNTATSMCYNSNILPST..KKRGMNI-------------------------PKQRSIPP
A5DZP7_LODEL/117-382SEMSSRRTSFDLSQVESRSSTSTTSHDALNIET..ATK..KHKTKKM-------------------------PRQRAIPP
SMI1_DEBHA/98-296LSKLETSHANSSQLKFSSSNLDLIEPVKIAKQQ..RHE..SAGSPNI-------------------------PRQKSIPP
Q55KB3_CRYNB/120-282..............AFWRYAEDDPTVGGNPAIL..ATM..ASVPPQW-------------------------IKTVY...
SMI2_DEBHA/142-319......HQKATSSADASETHGHENKINN..SFI..ANQ..KSIPPNA-------------------------IQPYY...
A1C9R6_ASPCL/143-317PL...PKATASSSSTVPPPQATNPLWRN..ELL..ERQ..DSQPPGA-------------------------VQKAY...
SMI1_YARLI/171-356GIFINPNAGSPNSSTPGSPVASVARQKNISSWL..ASQ..DSVPEGA-------------------------VQLVY...
A6EFN0_9SPHI/29-161..............H...............ESM..EFE..QSF.HNW-------------------------TRGFS...
O07689_LISSE/36-156..............EQIKGTF.........SIN..LEE..IEF.FTA-------------------------PLVKI...
A3ZN04_9PLAN/36-149..................K...........RGH..KHI....V...F-------------------------.A......
A7VFJ3_9CLOT/24-132..............................KPL..IDV..NDN.SR.-------------------------........
A4X269_SALTO/103-245..............LCGVHPQ.........HPS..RDL..VHA.QRV-------------------------HRDPW...
E6XKF4_SHEP2/4-129..............RLSRTCN.........HII..NET..ESC.QGF-------------------------...GY...
A0PQE6_MYCUA/4-131..............RLKRTCN.........DIV..RET...AS...S-------------------------.KEWF...
Q8NRK2_CORGL/4-116..............................RLVRTAND..IIRETES-------------------------AREWDN..
Q0VKY9_ALCBS/4-130..............................RTC..NSI..LHETKIA-------------------------REHYR...
Q9F2N4_STRCO/160-298..............................EAA..VND..LVY.VNK-------------------------CLRDH...
A3KB11_9RHOB/18-152..............LDRLNRP.........ARV..QEL..ANG...K-------------------------TFGDG...
Q1DEQ7_MYXXD/33-153..............PRLRQRA.........QGA..SET..ASL....-------------------------........
Q1CY42_MYXXD/19-141..............................VTMRKKDT..DKA....-------------------------........
Q09D40_STIAD/24-149..............................IVR..ARV..AIFGKRK-------------------------DDDQH...
B1YEY9_EXIS2/39-159..............IEAKED..........GLI..DED.........-------------------------........
Q5WJU2_BACSK/38-153...................................MKE..AQK....-------------------------........
A7Z7P3_BACA2/41-156..............................QNG..............-------------------------........
YOBM_BACSU/42-161..............................KYEDLFED..ING....-------------------------........
A7Z5R7_BACA2/23-158..............................EDL..SEQ.........-------------------------........
A3ZX25_9PLAN/22-154..............................SFF..GDD..LAG.ALN-------------------------DFSER...
A7VE32_9CLOT/35-145..............................EDY..MSE..YDH....-------------------------........
A7MRN6_CROS8/1-150..............................EYC..DIE..YNNEELF-------------------------SELDF...
B3Z4D7_BACCE/12-154..............FDIDVTW.........TQL..DER..LTD....-------------------------.DGDL...
A5Z4R3_9FIRM/12-152..............TDVEKFF.........SLN..EME..FEY.GDI-------------------------VDEDY...
A5Z4R9_9FIRM/9-151..............PEGESSY.........DDI..IKV..NYI...M-------------------------KSEGL...
A1ZMA9_9BACT/9-138..............................KKY..KNI.........-------------------------........
A0A0B5R450_BACTU/12-152..............................ENE..INL..EEKLRSY-------------------------NLMQV...
J7Z7X1_BACCE/12-138..............................KDA..NIE..VVY....-------------------------.ELTS...
Q6HGG3_BACHK/12-159..............................EVF..NDY..NGT....-------------------------........
Q6HGE4_BACHK/13-160..................ESS.........EYI..VKK...YE...I-------------------------.YKPT...
A0RAF8_BACAH/19-149..............................TTY..ENL..KNQ....-------------------------........
A7FEI4_YERP3/10-144..............LSTNGDK.........SDS..IAA..CYD...L-------------------------.YKKR...
Q21ED8_SACD2/11-151..............................IKH..NHE...AY...T-------------------------.LADR...
A6CCT7_9PLAN/22-151..............GALISFN.........SED..ENN..ILD.YLS-------------------------RPSEG...
Q6CS49_KLULA/64-193..............................DMT..VEQ..AYE.ILV-------------------------ENKYL...
B1J8X4_PSEPW/139-260..............................REL..VED..FPQ....-------------------------........
A7ML24_CROS8/19-151..............................ETL..IND..IFSISPA-------------------------DSEYGP..
A5FLI6_FLAJ1/11-131..............................KDL..IED..FNN....-------------------------........
Q7CL34_YERPE/11-153..............DNPNSLI.........DGC..YNE........M-------------------------IRKNV...
Q5LEK4_BACFN/167-306..................ETI.........EVI..AKD........I-------------------------WSKNL...
Q65VI9_MANSM/10-134..............................QLI..DEN........W-------------------------CPNGF...
B8I222_CLOCE/15-149..............SLDKVLS.........LHY..DDK.........-------------------------........
Q92KA2_RHIME/32-167..............................EDL..CLR..YGG.EVY-------------------------