Sequence alignment for CL0526

PF02393

C8CFJ8_HCMV/54-179-------------------------------------------------------------------------RQYDPPA
C8CFJ9_HCMV/42-158-------------------------------------------------------------------------CQYSADV
A8T729_HCMV/26-179-------------------------------------------------------------------------CQDSRQD
A8T728_HCMV/45-168-------------------------------------------------------------------------FCLEPME
D3YRX5_HCMVO/17-135-------------------------------------------------------------------------RAGDFNG
D2K4G8_HCMV/126-245-------------------------------------------------------------------------TADARKD
UL298_HCMVM/399-518-------------------------------------------------------------------------ERASGVH
B9VXJ9_HCMVT/55-169-------------------------------------------------------------------------VRRDYEG
D2K5D0_HCMV/11-135-------------------------------------------------------------------------LLDRWRP
B9VXD4_HCMVT/116-247-------------------------------------------------------------------------ANSTGRA
D3YRW4_HCMVO/11-132-------------------------------------------------------------------------AEFGLGC
D2K4S5_HCMV/202-333-------------------------------------------------------------------------DPTDAAA
D3YS52_HCMVO/180-322-------------------------------------------------------------------------HGHDADA
D2K3X0_HCMV/202-332-------------------------------------------------------------------------HDNSISE
A8T728_HCMV/200-332-------------------------------------------------------------------------NDTTPEG
B8YE72_HCMV/157-296-------------------------------------------------------------------------YRGDVES
B9VXG6_HCMVT/274-510-------------------------------------------------------------------------AEEATAL
B9VXL1_HCMVT/265-382-------------------------------------------------------------------------LARDLLA
B9VXJ9_HCMVT/546-653-------------------------------------------------------------------------ILHDRTN
D2K5D5_HCMV/214-331-------------------------------------------------------------------------ACEDTAA
D2K5D0_HCMV/151-256-------------------------------------------------------------------------GCMHIHA
B8YE60_HCMV/153-278-------------------------------------------------------------------------WSLGLDT
C8BKJ5_HCMV/34-153-------------------------------------------------------------------------SALGKVA
D2K595_HCMV/6-123-------------------------------------------------------------------------APDGGLN
B4YEM5_9ALPH/49-167-------------------------------------------------------------------------TIADLEG
D2E8A7_9VIRU/5-121-------------------------------------------------------------------------VQATFEE
C3RWK6_9VIRU/35-153-------------------------------------------------------------------------KPGDLAV
C3RWV3_9VIRU/65-186-------------------------------------------------------------------------DPANLVL
Q070N0_CPRV/47-172-------------------------------------------------------------------------PLAGPDL
B1NFI8_ADEGX/15-131-------------------------------------------------------------------------YWGTLEE
Q4KS78_ISKNV/1-104-------------------------------------------------------------------------.......
B5XAY6_SALSA/21-139-------------------------------------------------------------------------AVEFLGQ
C3Y900_BRAFL/167-275-------------------------------------------------------------------------AYKSPTK
C3Z365_BRAFL/157-265-------------------------------------------------------------------------AYKSPKK
C1C3V1_LITCT/15-136-------------------------------------------------------------------------ADSHDLL
Q14VM9_9VIRU/5-123-------------------------------------------------------------------------SAKWRAE

PF14433

C3WDW2_FUSMR/11-172--------------------------------------------------------------------------KSLAHQ
F0KCA1_CLOAE/2-150--------------------------------------------------------------------------KEKTIE
C3BLQ7_9BACI/6-145--------------------------------------------------------------------------SNKTIE
F0KCA3_CLOAE/3-152--------------------------------------------------------------------------EERVKK
B1HSL5_LYSSC/5-144--------------------------------------------------------------------------SIKTKK
C0Z7L3_BREBN/2-133--------------------------------------------------------------------------SKETLK
B7N9G4_ECOLU/6-148--------------------------------------------------------------------------NKQVMS
A8RVU3_9CLOT/13-150--------------------------------------------------------------------------KSKVKQ
A9B4M5_HERA2/3-169--------------------------------------------------------------------------ESIIHS
C2M481_CAPGI/2-151--------------------------------------------------------------------------KKSLEN
A9B4M4_HERA2/9-180--------------------------------------------------------------------------SQLAET
A9B983_HERA2/9-180--------------------------------------------------------------------------TDQTIF
D1ALL2_SEBTE/5-152--------------------------------------------------------------------------DKDILE
C2G2C6_9SPHI/5-144--------------------------------------------------------------------------DKRIIT
A9DRL2_9FLAO/4-142--------------------------------------------------------------------------KKEVQE
D7VVD7_9FLAO/4-136--------------------------------------------------------------------------KSNVQT
D6B4A2_9ACTO/10-151--------------------------------------------------------------------------SEDLLG
C5UVJ4_CLOBO/2-147--------------------------------------------------------------------------ENITLN
A4A0B2_9PLAN/1-122--------------------------------------------------------------------------......
A2W0F4_9BURK/45-178--------------------------------------------------------------------------PLTVRP
B7WUX3_COMTE/6-150--------------------------------------------------------------------------SPVVIE
C6DGM5_PECCP/1-142--------------------------------------------------------------------------MNKLIE
B7M4P5_ECO8A/11-152--------------------------------------------------------------------------MCELIN
C4GHT1_9NEIS/5-139--------------------------------------------------------------------------NAKTLQ
D1A3E8_THECD/9-150--------------------------------------------------------------------------PPEVTA
D9X9L6_STRVR/182-321--------------------------------------------------------------------------SEETDR
Q82G08_STRAW/7-151--------------------------------------------------------------------------TQEVLG
B1VX82_STRGG/7-150--------------------------------------------------------------------------VEEVDA
D6K3Y2_9ACTO/7-151--------------------------------------------------------------------------PEEVDA
A4X261_SALTO/97-242--------------------------------------------------------------------------PPDVRE
D6K3Y4_9ACTO/15-161--------------------------------------------------------------------------RVTQRH
B1VX84_STRGG/1-149--------------------------------------------------------------------------MTSNHD
D9UTG4_9ACTO/29-176--------------------------------------------------------------------------PDAADS
C4RQ15_9ACTO/292-437--------------------------------------------------------------------------PDEVAH
A4X254_SALTO/6-153--------------------------------------------------------------------------PPLVTE

PF09346

SMI1_DEBHA/98-296--------------------------------------------------------------PC---------TDADLS.
SMI2_DEBHA/142-319--------------------------------------------------------------GV---------TTADLN.
YOBM_BACSU/42-161--------------------------------------------------------------KA---------TLNDIQ.
A7VFJ3_9CLOT/24-132--------------------------------------------------------------ET---------TEEKIL.
A1ZXR5_9BACT/30-166--------------------------------------------------------------GA---------AKEDIA.
A3KB11_9RHOB/18-152--------------------------------------------------------------AA---------LADAVA.
A5UTX3_ROSS1/55-202--------------------------------------------------------------PA---------LPEDIR.
A1C9R6_ASPCL/143-317--------------------------------------------------------------GC---------TQNDIN.
A0JSM0_ARTS2/15-129--------------------------------------------------------------PA---------SADAIQ.
SMI1_CANGA/103-288--------------------------------------------------------------PC---------TANDIK.
Q89MJ4_BRAJA/28-170--------------------------------------------------------------QP---------TLAALE.
Q22E93_TETTS/424-535--------------------------------------------------------------PA---------TDKQID.
A7MRN6_CROS8/1-150--------------------------------------------------------------MI---------TEADIQ.
E6XKE0_SHEP2/21-128--------------------------------------------------------------LP---------TFEQLV.
Q63C14_BACCZ/25-143--------------------------------------------------------------PL---------KSEEIE.
Q0VKY9_ALCBS/4-130--------------------------------------------------------------PV---------DEKYIE.
A5TTM3_FUSNP/176-315--------------------------------------------------------------TA---------TDEDFK.
Q5LEL2_BACFN/13-124--------------------------------------------------------------GA---------SSASID.
Q2BBP1_9BACI/47-165--------------------------------------------------------------PA---------TEAETA.
Q4K9A1_PSEF5/28-140--------------------------------------------------------------LA---------SQTQIL.
A7Z5R7_BACA2/23-158--------------------------------------------------------------IN---------SHQVLK.
FBX3_HUMAN/121-251--------------------------------------------------------------GA---------REEDLD.
Q81H93_BACCR/13-142--------------------------------------------------------------KV---------TDEQIE.
A6G0Q7_9DELT/31-170--------------------------------------------------------------PA---------TDDELA.
Q3EQ17_BACTI/32-156--------------------------------------------------------------GI---------NLEDIT.
A1INP6_NEIMA/28-167--------------------------------------------------------------PF---------TPEILA.
A6FHD8_9GAMM/19-145--------------------------------------------------------------PI---------NGDDIT.
Q6CS49_KLULA/64-193--------------------------------------------------------------PL---------NDEDVK.
Q1L2J9_STRHY/18-144--------------------------------------------------------------GA---------SDDEIA.
A3I618_9BACI/42-194--------------------------------------------------------------GA---------TDAQIE.
Q47R76_THEFY/31-145--------------------------------------------------------------GC---------TPEEVA.
A3ZN04_9PLAN/36-149--------------------------------------------------------------GA---------TADELV.
A0PQE6_MYCUA/4-131--------------------------------------------------------------PV---------AEKYIL.
Q7M7B0_PHOLL/25-133--------------------------------------------------------------LP---------DDELIS.
Q3IK24_PSEHT/8-124--------------------------------------------------------------RV---------NIEDVH.
A5FAZ7_FLAJ1/185-329--------------------------------------------------------------GI---------STEDIQ.
Q92KA2_RHIME/32-167--------------------------------------------------------------GA---------DCGTIQ.
Q4K6P0_PSEF5/56-173--------------------------------------------------------------PV---------SEDALQ.
Q6HGF3_BACHK/15-125--------------------------------------------------------------AA---------SDIEIQ.
B4SN74_STRM5/28-184--------------------------------------------------------------GA---------SAEDLQ.
Q82RV7_STRAW/96-236--------------------------------------------------------------PA---------PEADIR.
A1ZUI6_9BACT/29-147--------------------------------------------------------------GC---------TEAEIQ.
A9B016_HERA2/24-146--------------------------------------------------------------GV---------DEAVIA.
A1RPC3_SHESW/26-168--------------------------------------------------------------GL---------SNSALD.
A0RE58_BACAH/19-133--------------------------------------------------------------PT---------SKEAIQ.
A4X5D2_SALTO/28-164--------------------------------------------------------------PL---------TDEVLQ.
Q1CV91_HELPH/17-134--------------------------------------------------------------PL---------NEKALN.
O64025_BPSPB/23-165--------------------------------------------------------------IN---------TNEQLK.
A7GQ33_BACCN/21-130--------------------------------------------------------------EI---------SDENIV.
Q816C2_BACCR/16-147--------------------------------------------------------------PI---------KDELIK.
Q633D5_BACCZ/17-131--------------------------------------------------------------PT---------SLENIT.
Q81BA7_BACCR/48-167--------------------------------------------------------------RE---------DKGQVN.
B1YF88_EXIS2/9-123--------------------------------------------------------------GI---------TEERLQ.
Q9F2N4_STRCO/160-298--------------------------------------------------------------AV---------TEQQVQ.
A8FAT3_BACP2/17-145--------------------------------------------------------------KI---------NEKGIA.
A0R498_MYCS2/11-150--------------------------------------------------------------PL---------TDELLD.
A4YB72_SHEPC/14-135--------------------------------------------------------------PA---------STEEIQ.
Q927J5_LISIN/124-264--------------------------------------------------------------YP---------TPQRVA.
Q6HHY9_BACHK/33-185--------------------------------------------------------------GA---------TKEDID.
Q7DD43_NEIMB/1-117--------------------------------------------------------------MI---------KQNSFV.
Q82GY4_STRAW/63-178--------------------------------------------------------------PV---------SDDALT.
Q55KB3_CRYNB/120-282--------------------------------------------------------------PV---------NPTLLA.
B8I5J3_CLOCE/15-125--------------------------------------------------------------AV---------NSVEID.
Q6HGD1_BACHK/12-154--------------------------------------------------------------LP---------SDSLIL.
A5Z4Q5_9FIRM/17-131--------------------------------------------------------------PA---------TKIMIE.
Q4EKD7_LISMN/14-152--------------------------------------------------------------NN---------WQVDLSA
A7FEI4_YERP3/10-144--------------------------------------------------------------PA---------DELSIV.
B1KPX6_SHEWM/17-136--------------------------------------------------------------GA---------SLGLVS.
O07689_LISSE/36-156--------------------------------------------------------------GA---------TDAQLA.
Q81B84_BACCR/8-142--------------------------------------------------------------KA---------TEESIE.
Q5LEK4_BACFN/11-139--------------------------------------------------------------SL---------TLKDFE.
A7VE32_9CLOT/35-145--------------------------------------------------------------PE---------PEDAVK.
A0RAF8_BACAH/19-149--------------------------------------------------------------LG---------NEEAVV.
Q3BQF4_XANC5/29-173--------------------------------------------------------------PA---------TEAAIA.
Q81Q97_BACAN/4-119--------------------------------------------------------------AV---------DQANKG.
Q3EVG8_BACTI/12-138--------------------------------------------------------------AI---------DEQVII.
Q1DBU4_MYXXD/34-167--------------------------------------------------------------PV---------TADEVA.
A3ZX25_9PLAN/22-154--------------------------------------------------------------PL---------SEDELE.
A1TSU7_ACIAC/17-133--------------------------------------------------------------PA---------DERAIA.
Q9F2V0_STRCO/29-155--------------------------------------------------------------PV---------DGEAPA.
B1YEY9_EXIS2/39-159--------------------------------------------------------------PV---------RSETLD.
Q28UU7_JANSC/42-166--------------------------------------------------------------GV---------DEAALD.
Q9CND2_PASMU/14-158--------------------------------------------------------------MV---------SQEIIS.
Q65VI9_MANSM/10-134--------------------------------------------------------------PI---------TANELL.
B7KWA7_METC4/14-155--------------------------------------------------------------TS---------SEADLA.
Q5DWB0_CLOPF/25-151--------------------------------------------------------------GA---------SIEAIN.
Q63F89_BACCZ/18-127--------------------------------------------------------------GV---------SSAEIK.
A1RND9_SHESW/4-129--------------------------------------------------------------DL---------SEEQLK.
Q3EVG9_BACTI/12-152--------------------------------------------------------------PI---------GIEDIE.
Q8F615_LEPIN/16-123--------------------------------------------------------------GT---------NLNTIQ.
Q5WBD2_BACSK/23-138--------------------------------------------------------------IP---------SVRDWE.
A5FGR4_FLAJ1/41-198--------------------------------------------------------------TA---------AVDDIF.
A6X425_OCHA4/20-140--------------------------------------------------------------PV---------GDLAIA.
Q9RYT7_DEIRA/27-166--------------------------------------------------------------GA---------TAEALA.
Q5WJU2_BACSK/38-153--------------------------------------------------------------PV---------TENHLS.
Q880E4_PSESM/25-133--------------------------------------------------------------LP---------DDALII.
A5DZP7_LODEL/117-382--------------------------------------------------------------KC---------TSDDLR.
Q6HMR4_BACHK/23-143--------------------------------------------------------------PA---------TDTEVQS
Q8GDM6_PHOLU/25-137--------------------------------------------------------------AP---------SPEWIN.
A4X269_SALTO/103-245--------------------------------------------------------------HL---------DEVQLQ.
Q4KGS7_PSEF5/46-175--------------------------------------------------------------GT---------TIEAIR.
A4IKF8_GEOTN/21-132--------------------------------------------------------------GA---------SEQEIR.
A7RYE8_NEMVE/119-257--------------------------------------------------------------GL---------TETEIS.
A4VZJ4_STRS2/19-128--------------------------------------------------------------PA---------SEQEVA.
Q1CY42_MYXXD/19-141--------------------------------------------------------------PA---------TPAQIA.
Q1ZQF0_PHOAS/14-166--------------------------------------------------------------KG---------KIVNIS.
SMI1_YARLI/171-356--------------------------------------------------------------PA---------TASDLN.
A3ZX28_9PLAN/24-139--------------------------------------------------------------VP---------TSDEVD.
A6C6S9_9PLAN/31-128--------------------------------------------------------------PL---------SADELK.
Q65PK7_BACLD/18-132--------------------------------------------------------------PI---------ETGKLQ.
Q81BW2_BACCR/27-144--------------------------------------------------------------PA---------TKDELT.
A4Y9N5_SHEPC/8-116--------------------------------------------------------------PP---------TDKEIE.
Q5LEK4_BACFN/167-306--------------------------------------------------------------PL---------TKEDIK.
A4SRI0_AERS4/8-116--------------------------------------------------------------IP---------TDDEIA.
A3I6Z7_9BACI/22-146--------------------------------------------------------------NV---------KDSWIT.
Q2SDZ5_HAHCH/28-140--------------------------------------------------------------AP---------DQDSLA.
Q0RKI3_FRAAA/56-185--------------------------------------------------------------PA---------AEQTVV.
A3ZX34_9PLAN/23-143--------------------------------------------------------------KA---------SQESIE.
A8M704_SALAI/21-139--------------------------------------------------------------GL---------EPSEVQ.
B8I223_CLOCE/15-131--------------------------------------------------------------KL---------SEDDII.
Q4PAY0_USTMA/184-339--------------------------------------------------------------PC---------SEDALD.
Q21ED8_SACD2/11-151--------------------------------------------------------------AI---------SESAIR.
A0RAV0_BACAH/42-162--------------------------------------------------------------PL---------SKEEIQ.
A8FII6_BACP2/13-123--------------------------------------------------------------PA---------SDKQIK.
Q09D40_STIAD/24-149--------------------------------------------------------------PA---------HPDELA.
B7X333_COMTE/152-284--------------------------------------------------------------PF---------SLAELR.
Q38V57_LACSS/13-131--------------------------------------------------------------LI---------DPRFIK.
Q8NRK2_CORGL/4-116--------------------------------------------------------------PV---------TEDKIL.
A5TXY3_FUSNP/37-189--------------------------------------------------------------GA---------SEENIK.
Q5LEK9_BACFN/11-148--------------------------------------------------------------SL---------TLKDFE.
Q7N9I9_PHOLL/23-147--------------------------------------------------------------GV---------DIDTIR.
Q52KV8_XENLA/36-166--------------------------------------------------------------GV---------LERDLN.
Q6HGG3_BACHK/12-159--------------------------------------------------------------PL---------LRENVK.
A5TTY9_FUSNP/35-181--------------------------------------------------------------PV---------KEEEIL.
A5Z4R9_9FIRM/9-151--------------------------------------------------------------KI---------TKEDIL.
A6CCT7_9PLAN/22-151--------------------------------------------------------------KP---------TVDAIK.
Q0VNR5_ALCBS/21-130--------------------------------------------------------------LP---------DEDRLV.
B8I222_CLOCE/15-149--------------------------------------------------------------KL---------SEWDLQ.
Q59YV1_CANAL/104-343--------------------------------------------------------------KC---------TDSDLQ.
Q93JL3_STRCO/163-310--------------------------------------------------------------GA---------TEAEIA.
A0RFK3_BACAH/36-159--------------------------------------------------------------GT---------SEEYVH.
Q73QC3_TREDE/40-189--------------------------------------------------------------GA---------SEEEIS.
Q4UXL8_XANC8/219-365--------------------------------------------------------------VA---------DTEALA.
Q5LEK2_BACFN/47-168--------------------------------------------------------------TL---------NEDDIV.
B1J8X4_PSEPW/139-260--------------------------------------------------------------AI---------SCADLD.
A5FCA9_FLAJ1/44-161--------------------------------------------------------------PV---------SKEEIL.
A5Z4R3_9FIRM/12-152--------------------------------------------------------------KL---------TVDEIQ.
A5FLI6_FLAJ1/11-131--------------------------------------------------------------KL---------TIKEII.
Q1C2E7_YERPA/11-153--------------------------------------------------------------NI---------DLSDIK.
A6VZI9_MARMS/37-168--------------------------------------------------------------YS---------AEEALS.
A5FMA4_FLAJ1/23-172--------------------------------------------------------------LA---------SDEEIQ.
A7Z7P3_BACA2/41-156--------------------------------------------------------------GA---------TDLEIE.
Q39NE9_BURS3/28-182--------------------------------------------------------------GA---------TPAQLD.
A0AMA9_LISW6/21-137--------------------------------------------------------------PA---------TSDQIN.
Q2BBP3_9BACI/17-145--------------------------------------------------------------EL---------HEETLQ.
B1KH37_SHEWM/28-163--------------------------------------------------------------CA---------SDKQLF.
A4EPD0_9RHOB/35-163--------------------------------------------------------------RV---------DPGQLD.
A6CDZ7_9PLAN/19-143--------------------------------------------------------------PA---------TDEMIT.
Q9F3Q3_STRCO/47-179--------------------------------------------------------------PA---------DEERVA.
A6DN67_9BACT/17-158--------------------------------------------------------------IV---------TQKDIS.
A7ML24_CROS8/19-151--------------------------------------------------------------KI---------SNIEWT.
A1ZMA9_9BACT/9-138--------------------------------------------------------------TI---------TQQDID.
Q1DEQ7_MYXXD/33-153--------------------------------------------------------------PV---------TAARIA.
B1YF81_EXIS2/16-130--------------------------------------------------------------GV---------SAVDLK.
Q5WC01_BACSK/21-135--------------------------------------------------------------GI---------PESEIE.
A5FJY1_FLAJ1/42-170--------------------------------------------------------------NI---------STEELQ.
B1YEX8_EXIS2/15-147--------------------------------------------------------------PL---------KKEEIK.
A6EFN0_9SPHI/29-161--------------------------------------------------------------PA---------TLQDIE.
Q6HGE4_BACHK/13-160--------------------------------------------------------------EV---------SETKIK.
A5UV09_ROSS1/24-144--------------------------------------------------------------GC---------TRDQLDQ
A4BCB8_9GAMM/14-147--------------------------------------------------------------EL---------TDEMLE.
Q11VT9_CYTH3/29-168--------------------------------------------------------------TP---------TDALID.
A4FNW2_SACEN/30-166--------------------------------------------------------------PP---------DPAELV.
A7Z5G8_BACA2/23-137--------------------------------------------------------------GI---------GEDKIL.
Q6NG79_CORDI/14-156--------------------------------------------------------------KC---------TALDTA.
B1KH38_SHEWM/29-165--------------------------------------------------------------LS---------SNEELI.
Q47P53_THEFY/18-133--------------------------------------------------------------PA---------KEALFW.
Q926X2_LISIN/25-149--------------------------------------------------------------TG---------TPELIK.

PF14568

A0AMA9_LISW6/24-135--------------------------------------------------------------------------SDQIN-
A3I6Z7_9BACI/25-144--------------------------------------------------------------------------DSWIT-
A3ZX34_9PLAN/26-141--------------------------------------------------------------------------QESIE-
A4IKF8_GEOTN/24-130--------------------------------------------------------------------------EQEIR-
A4VZJ4_STRS2/22-126--------------------------------------------------------------------------EQEVA-
A6CDZ7_9PLAN/22-141--------------------------------------------------------------------------DEMIT-
A6X425_OCHA4/23-138--------------------------------------------------------------------------DLAIA-
A7FEI4_YERP3/13-142--------------------------------------------------------------------------ELSIV-
A7GQ33_BACCN/24-128--------------------------------------------------------------------------DENIV-
A7Z5G8_BACA2/26-135--------------------------------------------------------------------------EDKIL-
A7ZAC8_BACA2/3-116--------------------------------------------------------------------------EEEFR-
A8UFY5_9FLAO/12-126--------------------------------------------------------------------------EDDLN-
A9DRK0_9FLAO/13-128--------------------------------------------------------------------------EEDLQ-
A9INX3_BART1/38-152--------------------------------------------------------------------------DLQIE-
A9INY0_BART1/31-145--------------------------------------------------------------------------DVLIE-
A9INY3_BART1/35-149--------------------------------------------------------------------------DILIE-
A9INY6_BART1/35-148--------------------------------------------------------------------------DLVIE-
A9INZ4_BART1/35-149--------------------------------------------------------------------------DLRIE-
B0ALZ7_BACAN/9-120--------------------------------------------------------------------------DQANK-
B1BP25_CLOPF/31-145--------------------------------------------------------------------------LEEIN-
B1KH37_SHEWM/31-161--------------------------------------------------------------------------DKQLF-
B1KPX6_SHEWM/20-134--------------------------------------------------------------------------LGLVS-
B3ZML8_BACCE/21-125--------------------------------------------------------------------------SAEIK-
B4AJF6_BACPU/18-123--------------------------------------------------------------------------DINIK-
B5ULT3_BACCE/26-136--------------------------------------------------------------------------DNDWR-
B5UUA7_BACCE/17-130--------------------------------------------------------------------------ELQIK-
B7INQ5_BACC2/11-140--------------------------------------------------------------------------EESIE-
B7JLP8_BACC0/25-134--------------------------------------------------------------------------KKQVD-
B8DA94_LISMH/28-135--------------------------------------------------------------------------TEWVN-
B8DD33_LISMH/29-148--------------------------------------------------------------------------AEVIT-
B8DD37_LISMH/24-135--------------------------------------------------------------------------EEQIH-
C2KY92_9FIRM/22-126--------------------------------------------------------------------------TAQIR-
C2M8M5_CAPGI/23-138--------------------------------------------------------------------------ITWIE-
C2PY06_BACCE/26-128--------------------------------------------------------------------------EEAIQ-
C2TZ07_BACCE/17-130--------------------------------------------------------------------------ELYIK-
C2ZR32_BACCE/17-130--------------------------------------------------------------------------EIDIK-
C3BVU2_9BACI/35-154--------------------------------------------------------------------------LEDIT-
C3WVX7_9FUSO/23-127--------------------------------------------------------------------------EEQII-
C4L6I6_EXISA/20-124--------------------------------------------------------------------------EKEVQ-
C6ABU4_BARGA/31-145--------------------------------------------------------------------------DVLIE-
C6ABU7_BARGA/31-144--------------------------------------------------------------------------DVRIK-
C6AD58_BARGA/31-144--------------------------------------------------------------------------DIWVK-
C6AD60_BARGA/31-146--------------------------------------------------------------------------DVWIK-
C6AEU7_BARGA/31-145--------------------------------------------------------------------------NERIE-
C6CF14_DICZE/28-135--------------------------------------------------------------------------SEWIQ-
C7GI90_9FIRM/31-150--------------------------------------------------------------------------EEEID-
C7N7K9_SLAHD/25-127--------------------------------------------------------------------------PEMVK-
C8K547_LISMN/28-148--------------------------------------------------------------------------DTIIE-
D0KCB2_PECWW/28-147--------------------------------------------------------------------------EEDII-
D0KCZ5_PECWW/26-145--------------------------------------------------------------------------EAEIK-
D1W447_9BACT/21-143--------------------------------------------------------------------------NEQIL-
D3EC77_GEOS4/25-144--------------------------------------------------------------------------EEWIA-
D3FRA3_BACPE/26-146--------------------------------------------------------------------------LELIR-
D3FRA5_BACPE/24-128--------------------------------------------------------------------------DEAIE-
D3I7I1_9BACT/41-148--------------------------------------------------------------------------DKDIK-
D3I8Y5_9BACT/21-120--------------------------------------------------------------------------EDKIV-
D4FV91_BACNA/25-133--------------------------------------------------------------------------EDKIK-
D4FXH9_BACNA/26-163--------------------------------------------------------------------------NEQLK-
D4FXI0_BACNA/26-142--------------------------------------------------------------------------DQEIR-
D4FXI1_BACNA/25-133--------------------------------------------------------------------------HENIG-
D5HHH7_9FIRM/25-128--------------------------------------------------------------------------DKDLY-
D5SSH7_PLAL2/27-142--------------------------------------------------------------------------RGSIE-
D6CWW7_9BACE/84-197--------------------------------------------------------------------------DEDIS-
D7JDE8_9BACT/35-142--------------------------------------------------------------------------REEII-
D7VC45_LACPN/26-146--------------------------------------------------------------------------SELIA-
E1UUR3_BACAS/39-142--------------------------------------------------------------------------PQEIS-
E1UUR6_BACAS/25-133--------------------------------------------------------------------------GDQIR-
E2MKG2_PSEUB/45-159--------------------------------------------------------------------------DEWII-
E3YTZ2_9LIST/29-148--------------------------------------------------------------------------PELIE-
E3ZJV4_LISIV/35-139--------------------------------------------------------------------------MEQIK-
E4LF31_9FIRM/27-134--------------------------------------------------------------------------DDEIL-
E5W3S4_9BACI/29-137--------------------------------------------------------------------------EEKIK-
E5W3S5_9BACI/24-128--------------------------------------------------------------------------NEDIT-
E6UJN0_RUMA7/22-127--------------------------------------------------------------------------MEKIK-
E8K361_9STRE/11-132--------------------------------------------------------------------------INIIE-
E9SF19_RUMAL/19-157--------------------------------------------------------------------------KDIIK-
F0RDN6_CELLC/80-198--------------------------------------------------------------------------ETEII-
Q0VKY9_ALCBS/7-128--------------------------------------------------------------------------EKYIE-
Q2SDZ5_HAHCH/31-138--------------------------------------------------------------------------QDSLA-
Q4K9A1_PSEF5/31-138--------------------------------------------------------------------------QTQIL-
Q4KGS7_PSEF5/49-173--------------------------------------------------------------------------IEAIR-
Q5DWB0_CLOPF/28-149--------------------------------------------------------------------------IEAIN-
Q5WIS2_BACSK/30-150--------------------------------------------------------------------------EELIN-
Q7M7B0_PHOLL/28-131--------------------------------------------------------------------------DELIS-
Q7N9I9_PHOLL/26-145--------------------------------------------------------------------------IDTIR-
Q8GDM6_PHOLU/28-135--------------------------------------------------------------------------PEWIN-

PF14567

A0KT76_SHESA/1-131MHDIIEQLQE------------------------------------------RSETVPVPLELP---------TFEQLV-
Q0VNR5_ALCBS/1-133MDDIVDMLRE------------------------------------------RHDGGLIALELP---------DEDRLV-
D4ZBL0_SHEVD/1-131MHEIIEQLQE------------------------------------------LSETVPIPLELP---------TFEQIV-
A4SRI0_AERS4/1-119MQND......------------------------------------------.......PFRIP---------TDDEIA-
Q21KG4_SACD2/2-132INEIAEMLAA------------------------------------------RSLKTAYPLELP---------TMDDIV-
A6X428_OCHA4/5-137IASIIEEINR------------------------------------------IDDPTGRKLTLP---------DDALIH-
A8H7F8_SHEPA/1-132MNDIIEQLQE------------------------------------------MSETVPVPLELA---------TFEQIV-
A0Y938_9GAMM/1-109MDDIID....------------------------------------------...........A---------......-
C1DFY0_AZOVD/1-133MEDVIEQLRE------------------------------------------LNEPVPVPLELP---------DEDLLV-
C4S745_YERBE/5-136IDKVINELKI------------------------------------------LSGGEILNIELP---------DDALIA-
B0KR80_PSEPG/1-133MEEVIEQLRE------------------------------------------ANEPVPVPLELP---------DEDQLV-
Q2BMU0_9GAMM/1-131MEDIIELLRE------------------------------------------KNAEVPVPLDLP---------DEDDLV-
B2C6T5_ACIBA/7-138LDNIIQELKE------------------------------------------LSGNSRLNIELP---------DDIFIS-
B8CKE3_SHEPW/1-119MEEF......------------------------------------------.......EIKIP---------SDIQIA-
E3A4U8_PSEAI/1-131MEDVIEKLRE------------------------------------------LNEPVPVPLELP---------EEELLV-
Q086X2_SHEFN/1-131MNDIIEQLQE------------------------------------------LSETVPVPLELP---------TFEQLV-
Q880E4_PSESM/5-136IRDVVAELKS------------------------------------------VRMSLPNAQRLP---------DDALII-
B3PC71_CELJU/34-164MEDVIELLRE------------------------------------------YNEPVPVPLDLP---------DEDQLV-
D4RXT0_9FIRM/2-135MFEDLDKFIA------------------------------------------ENQEEVLVTGGW---------TDDKIS-
A4Y9N5_SHEPC/1-119MKIF......------------------------------------------.......EFVPP---------TDKEIE-
Q12R95_SHEDO/1-131MHELIEQLQA------------------------------------------LNEPVPVPLELA---------SFEQLV-
D0WEZ4_9ACTN/5-134INDLMTRLGD------------------------------------------KGSFTKVA...P---------TQEMLA-
A3QH89_SHELP/1-131MHDLIEQLRE------------------------------------------LSETVPVPLELP---------SFDQLV-
C1D4A4_DEIDV/3-141QEELFKRLRA------------------------------------------GGVPAPLIPKLP---------DDREID-
A1S8W2_SHEAM/1-131MHELIEQLQE------------------------------------------MSEQVPVPLELP---------SFDQLL-
Q7M7B0_PHOLL/5-136LNDVIEEIER------------------------------------------LSDGQRNDVDLP---------DDELIS-
D1W447_9BACT/1-147M.DYITRLKQ------------------------------------------.NEEFEYWLE.A---------DNEQIL-

PF07348

C6RW74_VIBCL/5-179VVQALSAFSQRFLQHCAQQTGQLPENDELLG....LASPCVV..........EELTDVVRWRPV.........NREVWAD
B8K7V3_VIBPA/10-184AQQALLTFTENYHQAYLDAHGHLPRSEELYD....LVSPCVE..........SKSDGAVDWKAF.........VREQQAE
SYDP_SHEON/3-180CLPALDKFLQNYHQSYLSTLGELPRY.YPRG....ESSLCIQGE......FVEASTEAVGWLPV.........KREQPGS
C3BLV0_9BACI/6-177MKREMEQYFHKLFKEWKNYNHSLPKSVWIEE....ADSFIYVGE........PDAEEYIFWKPI.........EKDLFHD
C2X4F6_BACCE/18-189VKNAMSTYFKLRKEYFDRGLNFLFKTPYNEK....VDFVIYQG.........EIEEDEISWKPV.........EKYIETD
SYDP_ERWCT/5-179VVSALAAFTQRYVACWQQEKGHLPASEALYG....IPSPCIV..........ENHEDTVYWSPQ.........PFAPSVA
Q6HGE7_BACHK/3-177IKKALEHYFKELINVWDTKYGTYPKAPWDEE....IDPRLYLSN........PDEEEYVYWKPI.........EKVDLDD
D4I9V3_ERWAE/5-179TTGALRDFSQHYCDIWQQQSGHAPASKELYG....IPSTCVI..........ASHEEEVWWLPQ.........PFTLEPN
C2QKP9_BACCE/1-174MKEVMKDYFEKFIDKWMEYNNSLPQIAWNED....VDEFIYSGE........EDEYGYISWKPI.........EKGVEFS
SYDP_SHEPW/3-180SLPALDIFLSDYQQAYLDTLGEHPRY.YAQQ....QASECIVGD......VDVETEEALQWKSV.........VRVDTGR
SYDP_PHOPR/5-179VAVALSDFSSLFLQAWRDTGHGFPRSEDLVG....LESPCVE..........HDSGDEVTWKPI.........TRQPQGD
B4F2E3_PROMH/4-178ISTELKQLTQNYVDLWQQESGFPPASHELYG....VPSPCIS..........RTGDNVVYWLPQ.........PFTGRDK
SYDP_PHOLL/5-180VTEALSNFTRCYVDLWQKETGAPPASRELYG....VPSPCIT..........QTGDNIVYWLPQ.........PFPLEEK
SYDP_EDWI9/5-178VSAALREFTQRYVAQWQQQHGDWPSSHALYG....IPSPCVV..........YSRDDCVFWRPE.........PGR.GED
SYDP_VIBF1/5-179VEQALANFSQRYVEAWKAQHDCLPINEELVG....LASPCIE..........ETRDLEISWQPI.........VRDEAIR
SYDP_ALTMD/5-178ISAQLDKFVSSYVEHAK...GEGLKIAFDSE....WPSPCYEET........AKDGELVEWAPK.........RQSPPLS
A7GQ41_BACCN/1-173MKDAMSKYFNLRKEYFDKGLDFLFKTPYNEE....VDSFIYQGE........MDDEEEISWKPI.........EKNNKND
A9DDC7_9GAMM/3-186SLPALDDFLKLYQLTYLEKLGESPRY.YPRG....EGSLCIEGEFDASNYHESNEEVSVCWKPV.........KREEPGS
A0Y507_9GAMM/15-191VALLLEQLHHQFSENTLKNTAKYPLIAHDEQ....WPSPCELGE........VDEQGNIQWQGV.........RQQPAGS
SYDP_AERHH/5-179VLSALEHFFLRWQRDGEARRG.LPLCEWEAD....WRSPCELD.........EPKEGRVAWRPH.........RRAEPAD
C6CEU0_DICZE/5-179VSQALSAFTRRYVELWQRETGHPPASEALYG....VASPCIV..........ATQESQVHWLPQ.........TSTAAVR
C3BLV7_9BACI/3-176IKNAMQQYFRLRIKLAYEGLDFLLKTPVLEE....VNPILYDGE........IDEEGYILWKPV.........EKNIVHD
SYDP_SHELP/3-184SLPALDQFFTLYHQAYSDKLGESPRY.FPLG....EASPCVLEC..DQEKVDASPERSVQWQAV.........KRDSQGP
SYDP_SHEDO/3-180CSSALEKFINSYLNSYQNALSELPRY.YPMG....VASPCIAQT......FDEQSEDAVFWQPV.........KREPAGD
SYDP_SHEFN/3-180CSSALDCFIKNYLKSYQDTLSEFPRY.YPLG....EDSICIQGT......FNADTDDTVFWQPV.........KRDNVAD
SYDP_SHEAM/3-180CLAALTKFHEIYKAAFVERLGELPRC.FTHG....RPSPCLADD......ALAGSEEPQPWQMV.........PRREVAV
SYDP_COLP3/8-192LTQAILNFSKSYSQQHVEQFGHLPTVEHDEQ....WPSPCDLG.........SHDTSHHYWQAVAMESVQLADNKEEALS
SYDP_TOLAT/5-177VICALSDVFARWF.AYQQQRGIQVCCPEDEL....RPSPCR...........YDAQHPERWKPW.........SRPEMSD
SYDP_HAHCH/6-185VTARLSELTNTFIERHHSSSRQRPCIPLNEDTRYMLDSPCVEHV........DEEAGVFYWTPR.........PHMDFTL
A3WM07_9GAMM/6-183TEHAVSVLLERYLEVIPE.....PKTEWVEE....WDAKIYQQ.........RIGEEQVIWRPV.........KRDEVQD
A6F6I4_9GAMM/5-184VTDALIAFYARCEQLWQAQ.DYLPQQEFDPE....WDSPCFIEA....SNSAQLRADHKAWLPV.........KRDEITS
SYDP_PSEA6/5-182VNQSLDDFMGRFA.AFVKEHAEAGAIEYDED....WPSPCYATD......VTPESGTSIPWKPV.........LREQTSE
D2U272_9ENTR/7-182ISQALKELTQRYIAYWQQQTGGLPASDSFYS....IPSPCIE..........YSKDEVIYWLPK........PFPMLNEK
Q1ZGY9_9GAMM/5-180IQTELLSVFSRYASLFQTEKESYPLQPVDKD....WLSPCLFG.........DEVQGEKQWKSV.........VRTAPVD
SYDP_PSYIN/5-180TQTQLFDFFERFKAHWQTQKKSLPQAIFEPQ....WISPCQIG.........EVENQLIFWSPI.........KREPALD
SYDP_IDILO/4-175LEESIDALMTRYKENVP.....VRYTEYVEE....WNSPIYGT.........VIDENTVEWTPC.........RQPEALN
A4C5J8_9GAMM/3-179VQQVLKQLLNQWHEKAVNHTGSEPLIEHDEQ....WPSPCENMS........SLNEGLVQWQHV.........ERTEQGD
C6CC04_DICDC/5-179VSQTLQAFTQRYVELWRRETDHPPASAALYG....IPSPCIT..........DNGDECVFWLPQ.........LPVAASR
E6WGC7_PANSA/4-178TVDALRDFTARYCDEWQQRTGHLPASSDLHG....VPSPCIQ..........TTLDDRVLWQPQ.........PFTLPAT
D4GLK5_PANAM/5-179TAEALTDFTTRYCLHWQHNNGHAPASRDLYG....VPSPCLI..........ENRGERALWQPQ.........PFSLPPS
A6D8T1_9VIBR/5-179VQQALEAFSKRYQQAWQEKHQTLPASEELHG....LISPCID..........SKDEQQVYWTHC.........LRDAPEM
C9P9P0_VIBFU/5-179VVEALFSFSQRYLDAVQHAHQQLPYNDELID....WPSPCVV..........EALEDRVFWQPV.........PRTPAAD
D0ICP4_VIBHO/5-179VIHALWSFSARFVDAWDQKHGSKPQSEGYLG....LASPCVV..........QETDDVVIWQPV.........KRETLAD

PF14435

Q11UH8_CYTH3/2-179-------------------------------------------------------------------------IIQDYI-
C3G535_BACTU/11-190-------------------------------------------------------------------------SPQDFL-
C3BLX0_9BACI/3-181-------------------------------------------------------------------------APKEFC-
C3G534_BACTU/3-181-------------------------------------------------------------------------LPEDFR-
D7C074_STRBB/3-186-------------------------------------------------------------------------THAELV-
E0QLS9_9FIRM/4-167-------------------------------------------------------------------------NLDYLL-
A3IE36_9BACI/4-165-------------------------------------------------------------------------DIREIR-
D3GZ30_ECO44/1-160-------------------------------------------------------------------------MLIKLI-
B7LQU5_ESCF3/2-167-------------------------------------------------------------------------SLNPFD-
B1VPR4_STRGG/6-176-------------------------------------------------------------------------LRAPHA-
C6PRK9_9CLOT/16-217-------------------------------------------------------------------------VRNKLK-
B8CKE1_SHEPW/1-161-------------------------------------------------------------------------MDAAIF-
A3ZNI5_9PLAN/58-240-------------------------------------------------------------------------QVESWI-
D3E916_GEOS4/1-200-------------------------------------------------------------------------MEPQYH-
E2N2L1_CAPSP/5-173-------------------------------------------------------------------------TKDDIE-
C0DUS3_EIKCO/1-171-------------------------------------------------------------------------..MNLA-
B5HAW8_STRPR/39-232-------------------------------------------------------------------------GAHQVA-
E8RXJ9_MICSL/4-174-------------------------------------------------------------------------TREQLT-
D1A3F0_THECD/3-170-------------------------------------------------------------------------SHQEMS-
Q47PK6_THEFY/247-430-------------------------------------------------------------------------LDQLLA-
E4NDB7_KITSK/233-420-------------------------------------------------------------------------LGKRLA-
C9YY18_STRSW/732-910-------------------------------------------------------------------------IGQELA-
B5HAJ0_STRPR/6-189-------------------------------------------------------------------------DLKSLE-
D6K842_9ACTO/6-208-------------------------------------------------------------------------RRGRLV-
B5I6T5_9ACTO/6-184-------------------------------------------------------------------------DRETLE-
E4N1Q1_KITSK/249-422-------------------------------------------------------------------------DRATAE-
D1A5L5_THECD/6-199-------------------------------------------------------------------------TREQLA-
D6K293_9ACTO/144-316-------------------------------------------------------------------------PHRLLA-
D6KEF7_9ACTO/214-404-------------------------------------------------------------------------PDGLLD-
Q82D46_STRAW/203-389-------------------------------------------------------------------------PPRLLD-
D9WNF8_9ACTO/13-197-------------------------------------------------------------------------DAAWLE-
Q2U157_ASPOR/71-266-------------------------------------------------------------------------NQAWLE-

PF02393

C8CFJ8_HCMV/54-179LRTYVQRH-------QGT-----------------------------TV-----ALRNP-A.....N-------------
C8CFJ9_HCMV/42-158LRDWVRNH-------VDQ-----------------------------VL-----SLGIP-H.....N-------------
A8T729_HCMV/26-179IRHLVRSY-------ADM-----------------------------NI-----SLPVS-APP...G-------------
A8T728_HCMV/45-168ITRYVHRN-------EGR-----------------------------CL-----SLGPP-K.....G-------------
D3YRX5_HCMVO/17-135LNDFLEQE-------CGT-----------------------------RL-----HVAWP-E.....R-------------
D2K4G8_HCMV/126-245LQKLVRRV-------SGT-----------------------------VL-----RLSWP-N.....G-------------
UL298_HCMVM/399-518LQRYVRAT-------AGR-----------------------------WL-----PLCWP-P.....L-------------
B9VXJ9_HCMVT/55-169LRRYLRRF-------EGS-----------------------------CV-----SLGWP-S.....Q-------------
D2K5D0_HCMV/11-135PKTSRPWK-------PGQ-----------------------------RV-----ALVWP-K.....D-------------
B9VXD4_HCMVT/116-247MRKWSQRD-------AGT-----------------------------LL-----PLGRP-Y.....G-------------
D3YRW4_HCMVO/11-132LEAYVRIN-------AGQ-----------------------------VL-----PVVWP-P.....G-------------
D2K4S5_HCMV/202-333VAKTAREM-------SGL-----------------------------NL-----VIRTP-GRTEV.E-------------
D3YS52_HCMVO/180-322LAACVGEH-------HGR-----------------------------DV-----NFHTP-GRHA..K-------------
D2K3X0_HCMV/202-332LQRVTCRY-------RGE-----------------------------CV-----PLRTP-GEMT..R-------------
A8T728_HCMV/200-332SYATAERI-------LGC-----------------------------DV-----KLHTP-GYGT..V-------------
B8YE72_HCMV/157-296LSAEVTKR-------GYA-----------------------------SY-----TIDDP-FDECPDT-------------
B9VXG6_HCMVT/274-510GRELRRRW-------AGT-----------------------------TV-----ALQTP-GRR...L-------------
B9VXL1_HCMVT/265-382LWRLCMKR-------EGS-----------------------------IF-----SWRDG-N.....E-------------
B9VXJ9_HCMVT/546-653LLRVCQLH-------AGS-----------------------------KI-----RLGGS-P.....A-------------
D2K5D5_HCMV/214-331RCAYVEAH-------REA-----------------------------QL-----TLIWP-E.....K-------------
D2K5D0_HCMV/151-256FAQWRATY-------RGR-----------------------------LM-----VMGD.-......Y-------------
B8YE60_HCMV/153-278MARFIIRH-------HGQ-----------------------------FM-----PLTYP-PGTE..L-------------
C8BKJ5_HCMV/34-153LRYAVRKL-------MKR-----------------------------GA-----RLRHD-S.....G-------------
D2K595_HCMV/6-123LDDFMRRQ-------RGR-----------------------------HL-----DLPYP-R.....G-------------
B4YEM5_9ALPH/49-167IRELVRKF-------RGR-----------------------------LL-----PFEKC-P.....D-------------
D2E8A7_9VIRU/5-121LPQLVDDR-------RGD-----------------------------RI-----LLKRG-.......-------------
C3RWK6_9VIRU/35-153VSDFVKSN-------TGK-----------------------------RL-----PIGKR-S.....D-------------
C3RWV3_9VIRU/65-186VADFVKKN-------RDA-----------------------------KL-----HPPAS-EAAK..D-------------
Q070N0_CPRV/47-172IACYADRH-------RGR-----------------------------HL-----YFAKQ-Q.....R-------------
B1NFI8_ADEGX/15-131IDRYAKAN-------RGT-----------------------------VA-----PIGSG-......K-------------
Q4KS78_ISKNV/1-104....MEST-------HGT-----------------------------TI-----ALPHP-P.....G-------------
B5XAY6_SALSA/21-139IKEIVSKH-------RNN-----------------------------KI-----LLAKP-K.....S-------------
C3Y900_BRAFL/167-275LQAFFQEN-------YSI-----------------------------SV-----PLGSN-G.....D-------------
C3Z365_BRAFL/157-265LKAFFQEY-------RKT-----------------------------TL-----AVGSN-G.....E-------------
C1C3V1_LITCT/15-136VDNFVENF-------SDD-----------------------------LI-----RPPDN-EVTN..N-------------
Q14VM9_9VIRU/5-123GDRFLEKF-------RGC-----------------------------KL-----RIKGL-RT....N-------------

PF14433

C3WDW2_FUSMR/11-172VLEYAGWY.......EGR-----------------------------KV-----DVEKI-IEYYQKN.....NYILNDFA
F0KCA1_CLOAE/2-150ILKKSGWH.......PNR-----------------------------KI-----DITDL-VVYYEKR.....GFEIFPEA
C3BLQ7_9BACI/6-145ELKKAGWY.......EDR-----------------------------KI-----DILEN-VKFLEER.....DFEVFESA
F0KCA3_CLOAE/3-152ILKRSGWI.......ENQ-----------------------------KI-----DITNQ-VKMLESE.....GYEVFEAA
B1HSL5_LYSSC/5-144ILKQSGWT.......PER-----------------------------KK-----DISSQ-VKYLEDK.....GYIVFDCV
C0Z7L3_BREBN/2-133ILRDSGWY.......EGR-----------------------------SI-----DIKEI-EENLERL.....GYIVFPEV
B7N9G4_ECOLU/6-148VLLQNGWH.......YGR-----------------------------KE-----NIDKY-IKCLSIK.....KYFVNEII
A8RVU3_9CLOT/13-150LMEYAGWY.......EGR-----------------------------SV-----DISIA-EQYYANH.....GVPMMKTT
A9B4M5_HERA2/3-169LLMTAGWQ.......PDT-----------------------------TI-----DPEPW-LYELRQQ.....QYPIFPQL
C2M481_CAPGI/2-151LLAQQGITLLNSLSKEER-----------------------------RA-----RTETI-KARYREA.....GYDDLPHE
A9B4M4_HERA2/9-180VYRQLGWT.......PDR-----------------------------DI-----DPTPH-LEHIKQA.....TYPIFPLA
A9B983_HERA2/9-180LLTAAGWS.......PER-----------------------------TY-----DPTTT-IIQPLTT....IGWPIFPEA
D1ALL2_SEBTE/5-152TLKKSGWQ.......ENR-----------------------------EI-----PIHNI-LEYYEKI.....RYVCNDMQ
C2G2C6_9SPHI/5-144RLLESGWF.......DGR-----------------------------NI-----LKNLE-FPIE........GYPL..DA
A9DRL2_9FLAO/4-142QFRKAGWY.......EGR-----------------------------NL-----KKKYD-KIN.........GFHELPDF
D7VVD7_9FLAO/4-136QFEKAGWF.......ENR-----------------------------NI-----ETALN-QKIN........NFGELPNH
D6B4A2_9ACTO/10-151ALVASGWS.......ADR-----------------------------KV-----DPGQW-VLPLEGE.....GYRSHPLA
C5UVJ4_CLOBO/2-147RLKKAGWT.......NER-----------------------------NI-----NIDLI-EKTFKEK.....SINMPEKI
A4A0B2_9PLAN/1-122.MLAAGWR.......ADR-----------------------------NV-----LNQLD-MPK.........SYLMFPAI
A2W0F4_9BURK/45-178LFVAAGWC.......GPA-----------------------------DG-----RLSAR-DGE.............HPGD
B7WUX3_COMTE/6-150LLQARGWT.......PQR-----------------------------EV-----AIPVP-VQSALGRQ...PSLATHPAV
C6DGM5_PECCP/1-142LASKYGEI.......KRQ-----------------------------EI-----KLSEC-LSAITNF.....GYLVSDGL
B7M4P5_ECO8A/11-152EASKYGKV.......NER-----------------------------KM-----DIDLC-CKKIEEE.....GYSVFVAF
C4GHT1_9NEIS/5-139VLRQAGWH.......PNR-----------------------------RT-----DIAAI-AARAAAC.....GYEIGENV
D1A3E8_THECD/9-150HMTAAGWS.......PER-----------------------------RV-----DVSAW-EEELSRT....SGFRMHTAA
D9X9L6_STRVR/182-321VLRAGGWF.......PGR-----------------------------SV-----PTETW-ETILLQT....GGFEIHDAA
Q82G08_STRAW/7-151WLTERGWFPGR.DIGEQA-----------------------------EE-----LVRVR-LQDSERQ.....GVPLTPVS
B1VX82_STRGG/7-150WLTEAGWYPGR.DAAQEA-----------------------------AE-----AVATV-TDRYRAY.....GVDIEPSA
D6K3Y2_9ACTO/7-151WLANAGWHP....GRRCD-----------------------------DL-----AATEI-EDARASFRNDGGSLDVIQPA
A4X261_SALTO/97-242VLDQAGWFPG...RDMTA-----------------------------AV-----DLWLA-RFADELA.....GLECFPAV
D6K3Y4_9ACTO/15-161RAERIGWTAG..RNVERE-----------------------------GM-----QAALR-IAAMAQSH..GTSLSIFPAA
B1VX84_STRGG/1-149ALTAAGWHDG..RDVRDD-----------------------------AM-----SAVLK-TIAFVEPVAGGATWVLFPAA
D9UTG4_9ACTO/29-176ALRTAAGPPAAGTSLQAE-----------------------------IW-----ADTLR-AHTSPAG....HEHHVSPAA
C4RQ15_9ACTO/292-437ALVAAGWAP....HIGDE-----------------------------IM-----AAAAV-RDVTAVVGA.SHSHVAFPAA
A4X254_SALTO/6-153ALQAAGWVPGRRDDDRAQ-----------------------------QW-----ALRLA-ADAAPDG....RQHTIVRAA

PF09346

SMI1_DEBHA/98-296..D.FQKD-------..L-----------------------------NI----.KLPNC.LIE-----------------
SMI2_DEBHA/142-319..E.FEND-------..L-----------------------------GC----GSLPVE.IRQ-----------------
YOBM_BACSU/42-161..S.FEAK-------..H-----------------------------QL----.TLPQD.YQK-----------------
A7VFJ3_9CLOT/24-132..E.FEKE-------..K-----------------------------EI----.TLPSK.YKE-----------------
A1ZXR5_9BACT/30-166..K.LSAK-------..I-----------------------------GY----.ELPED.FQD-----------------
A3KB11_9RHOB/18-152..E.LETA-------..L-----------------------------GT----.ALPEP.YRS-----------------
A5UTX3_ROSS1/55-202..A.IEQS-------..L-----------------------------GF----.ALPES.LHH-----------------
A1C9R6_ASPCL/143-317..E.LEHE-------..L-----------------------------DC----.SLPLE.VRE-----------------
A0JSM0_ARTS2/15-129..A.CEAQ-------..L-----------------------------GH----.RLPDY.LRQ-----------------
SMI1_CANGA/103-288..H.AEED-------..L-----------------------------EV----.VLPKA.LKA-----------------
Q89MJ4_BRAJA/28-170..A.FEKS-------..I-----------------------------GC----.RLPDE.YRQ-----------------
Q22E93_TETTS/424-535..D.LQDN-------..V-----------------------------KL----.TIPKD.LIA-----------------
A7MRN6_CROS8/1-150..R.LEKT-------..Y-----------------------------CI----.SLPED.YKT-----------------
E6XKE0_SHEP2/21-128..E.VEEQ-------..I-----------------------------LI----.SLPRE.LKE-----------------
Q63C14_BACCZ/25-143..E.AEEL-------..L-----------------------------KM----.KFPKE.LKD-----------------
Q0VKY9_ALCBS/4-130..N.TKNE-------..L-----------------------------GV----.KFPDS.FRK-----------------
A5TTM3_FUSNP/176-315..K.VEKE-------..L-----------------------------GY----.RLPEA.YKV-----------------
Q5LEL2_BACFN/13-124..D.VEKL-------..L-----------------------------NT----.TLPKQ.YKS-----------------
Q2BBP1_9BACI/47-165..L.IKKE-------..L-----------------------------KV----.ELPDK.LAE-----------------
Q4K9A1_PSEF5/28-140..E.AQQA-------..L-----------------------------GL----.QLPAD.YTW-----------------
A7Z5R7_BACA2/23-158..K.FEDE-------..N-----------------------------SF----.DISDD.YKE-----------------
FBX3_HUMAN/121-251..A.VEAQ-------..I-----------------------------GC----.KLPDD.YRC-----------------
Q81H93_BACCR/13-142..Q.LEEY-------..F-----------------------------GI----.KFPND.FIE-----------------
A6G0Q7_9DELT/31-170..A.IAEA-------..A-----------------------------GA----.ELPGE.LKT-----------------
Q3EQ17_BACTI/32-156..S.LQNE-------..L-----------------------------NI----.QIPDI.YKD-----------------
A1INP6_NEIMA/28-167..A.VESE-------..L-----------------------------GY----.KLPQS.FIE-----------------
A6FHD8_9GAMM/19-145..E.LESK-------..L-----------------------------NC----.FLPES.YKY-----------------
Q6CS49_KLULA/64-193..K.FEKF-------..V-----------------------------GT----.VLSSG.VRA-----------------
Q1L2J9_STRHY/18-144..A.LEEA-------..L-----------------------------GV----.GAPEE.LKA-----------------
A3I618_9BACI/42-194..S.LLEI-------...-----------------------------.F----PQSPQS.FIE-----------------
Q47R76_THEFY/31-145..EVLAEK-------..K-----------------------------DV----.SVPQA.YVD-----------------
A3ZN04_9PLAN/36-149..A.LEGE-------..L-----------------------------GI----.SLPTE.YRQ-----------------
A0PQE6_MYCUA/4-131..D.TEEK-------..L-----------------------------GV----.TFPAA.FRA-----------------
Q7M7B0_PHOLL/25-133..Q.YEKE-------..I-----------------------------GF----.EFSND.YKE-----------------
Q3IK24_PSEHT/8-124..G.IEKH-------..F-----------------------------NV----.ILPDD.YKT-----------------
A5FAZ7_FLAJ1/185-329..EHIELE-------..D-----------------------------DI----.KIPPA.LIN-----------------
Q92KA2_RHIME/32-167..R.VEAK-------..F-----------------------------GR----.RLPPD.IRR-----------------
Q4K6P0_PSEF5/56-173..A.LEQR-------..L-----------------------------GC----.PLPRS.LRD-----------------
Q6HGF3_BACHK/15-125..A.VENR-------..M-----------------------------NV----.TLPNV.YKE-----------------
B4SN74_STRM5/28-184..R.LRAQ-------...-----------------------------.W----PQVPDS.LVA-----------------
Q82RV7_STRAW/96-236..E.VEQE-------..L-----------------------------DL----.TVPPG.LKA-----------------
A1ZUI6_9BACT/29-147..E.LEAL-------HPS-----------------------------GL----.SIPQI.FKD-----------------
A9B016_HERA2/24-146..E.LEQA-------..R-----------------------------GY----.RLPAC.YRA-----------------
A1RPC3_SHESW/26-168..E.AEKQ-------..L-----------------------------GF----.TLISP.LRE-----------------
A0RE58_BACAH/19-133..K.LQKF-------..S-----------------------------SI----.DVPLD.YLE-----------------
A4X5D2_SALTO/28-164..V.VEAQ-------..L-----------------------------GH----.KLPTA.YVD-----------------
Q1CV91_HELPH/17-134..G.LEDQ-------..L-----------------------------KT----.GLSDA.FKD-----------------
O64025_BPSPB/23-165..E.LEMN-------..I-----------------------------GN----.QLPSD.YKD-----------------
A7GQ33_BACCN/21-130..M.IEKK-------..L-----------------------------GC----.TFPPQ.YRE-----------------
Q816C2_BACCR/16-147..K.AEEV-------..L-----------------------------NV----.KLPES.YIT-----------------
Q633D5_BACCZ/17-131..V.IESQ-------..L-----------------------------NI----.SFPTD.YIS-----------------
Q81BA7_BACCR/48-167..E.VINR-------..L-----------------------------GV----.EVSNT.FRE-----------------
B1YF88_EXIS2/9-123..E.VETE-------..L-----------------------------GF----.SLPSE.LRT-----------------
Q9F2N4_STRCO/160-298..G.VEED-------..L-----------------------------GY----.RLPGA.YRS-----------------
A8FAT3_BACP2/17-145..K.AEKK-------..L-----------------------------GV----.ILPDT.YKK-----------------
A0R498_MYCS2/11-150..A.TEQR-------..L-----------------------------GV----.RLPES.LVA-----------------
A4YB72_SHEPC/14-135..A.LEKW-------..L-----------------------------GT----.DLPSE.HKK-----------------
Q927J5_LISIN/124-264..A.IEAE-------..L-----------------------------GY----.KLPKS.YIY-----------------
Q6HHY9_BACHK/33-185..I.LRLK-------...-----------------------------.Y----PNCPES.LIS-----------------
Q7DD43_NEIMB/1-117..PYPEAM-------LPK-----------------------------GF----.KYPQS.YLK-----------------
Q82GY4_STRAW/63-178..W.AAGV-------..L-----------------------------GS----.PLPDE.LIS-----------------
Q55KB3_CRYNB/120-282..T.FEAE-------..I-----------------------------GC----.PLPRS.VRE-----------------
B8I5J3_CLOCE/15-125..R.IESE-------..M-----------------------------GL----.KLPKV.FKE-----------------
Q6HGD1_BACHK/12-154..K.KEEF-------..W-----------------------------RV----.QLPVD.YKN-----------------
A5Z4Q5_9FIRM/17-131..K.VEKE-------..W-----------------------------NI----.SLPCE.YKQ-----------------
Q4EKD7_LISMN/14-152VEKNLPEQ-------ILK-----------------------------RY----GKLPDA.YKA-----------------
A7FEI4_YERP3/10-144..N.IEKK-------..L-----------------------------GI----.TFPND.YRE-----------------
B1KPX6_SHEWM/17-136..N.LEEA-------..L-----------------------------GV----.ILPET.YKE-----------------
O07689_LISSE/36-156..E.VEKM-------..L-----------------------------DI----.SLPDD.LKE-----------------
Q81B84_BACCR/8-142..E.LEEF-------..L-----------------------------GF----.LLPED.YKK-----------------
Q5LEK4_BACFN/11-139..E.IESN-------..L-----------------------------GY----.VLPKR.LKE-----------------
A7VE32_9CLOT/35-145..R.FESR-------..Y-----------------------------T.----.PIPAE.YRW-----------------
A0RAF8_BACAH/19-149..R.FENM-------..L-----------------------------EI----.VLPND.YKL-----------------
Q3BQF4_XANC5/29-173..A.AQAR-------..L-----------------------------GV----.RLPAW.LRE-----------------
Q81Q97_BACAN/4-119....IQQM-------..L-----------------------------NI----.KFPNS.YHW-----------------
Q3EVG8_BACTI/12-138..A.VENS-------..F-----------------------------GV----.RFPDD.YRE-----------------
Q1DBU4_MYXXD/34-167..Q.LEKK-------..F-----------------------------KL----.KLPPS.YVH-----------------
A3ZX25_9PLAN/22-154..R.LENS-------..V-----------------------------GV----.AFPDD.YRT-----------------
A1TSU7_ACIAC/17-133..R.VESE-------..L-----------------------------DV----.VFPVD.YRE-----------------
Q9F2V0_STRCO/29-155..R.AEAA-------..L-----------------------------GF----.PLPAL.LTE-----------------
B1YEY9_EXIS2/39-159..A.FEAE-------..F-----------------------------KQ----.PLPSE.YQT-----------------
Q28UU7_JANSC/42-166..A.FEAR-------..F-----------------------------DI----.VLPEA.FRR-----------------
Q9CND2_PASMU/14-158..D.FEGT-------..F-----------------------------GI----.KLLKL.YIE-----------------
Q65VI9_MANSM/10-134..A.IEKR-------..L-----------------------------NI----.VLPQE.MKN-----------------
B7KWA7_METC4/14-155..R.AEAE-------..L-----------------------------GF----.PLPQS.YRN-----------------
Q5DWB0_CLOPF/25-151..L.AEEM-------..L-----------------------------DL----.KFSKL.YRE-----------------
Q63F89_BACCZ/18-127..Q.AEEE-------..L-----------------------------QF----.NFPEQ.YKK-----------------
A1RND9_SHESW/4-129..R.TEEE-------..L-----------------------------GA----.KLPHE.YRE-----------------
Q3EVG9_BACTI/12-152..D.FENK-------..Y-----------------------------GI----.LLPDD.YKQ-----------------
Q8F615_LEPIN/16-123..K.IESI-------..F-----------------------------KV----.TFPED.YKQ-----------------
Q5WBD2_BACSK/23-138..K.IEKK-------..F-----------------------------GC----.EFPEE.FKD-----------------
A5FGR4_FLAJ1/41-198..E.FEKK-------..Y-----------------------------NV----.SLPDC.YRA-----------------
A6X425_OCHA4/20-140..Q.AEAD-------..L-----------------------------GV----.QFPLE.YRE-----------------
Q9RYT7_DEIRA/27-166..Q.AEKD-------..M-----------------------------GL----.TFPPE.MRE-----------------
Q5WJU2_BACSK/38-153..Q.FEKD-------..Q-----------------------------GI----.NIPSD.FKE-----------------
Q880E4_PSESM/25-133..A.YERE-------..L-----------------------------GI----.SFLDE.YKF-----------------
A5DZP7_LODEL/117-382..D.FQKD-------..L-----------------------------NI----.TLPNC.VVA-----------------
Q6HMR4_BACHK/23-143LRERVKEK-------..F-----------------------------NV----.DLPRE.YEE-----------------
Q8GDM6_PHOLU/25-137..K.TEKA-------..L-----------------------------SL----.TLPDD.YKW-----------------
A4X269_SALTO/103-245..A.VEAE-------..L-----------------------------GT----.RLPPS.YRR-----------------
Q4KGS7_PSEF5/46-175..A.AEMA-------..L-----------------------------GR----.TLPCS.FAR-----------------
A4IKF8_GEOTN/21-132..K.AEEI-------..L-----------------------------GL----.QFPES.YRA-----------------
A7RYE8_NEMVE/119-257..R.IEER-------HLK-----------------------------GL----.SLPLD.VKC-----------------
A4VZJ4_STRS2/19-128..V.AESK-------..L-----------------------------QL----.IFPAE.YKD-----------------
Q1CY42_MYXXD/19-141..A.FEQS-------..V-----------------------------GW----.RLDPD.LRA-----------------
Q1ZQF0_PHOAS/14-166..E.IQKE-------..R-----------------------------GM----.DLPSD.YLE-----------------
SMI1_YARLI/171-356..E.LEAD-------..L-----------------------------DC----.SLPLD.VRD-----------------
A3ZX28_9PLAN/24-139..S.ASQQ-------..V-----------------------------CI----.PFSED.YRQ-----------------
A6C6S9_9PLAN/31-128..SLIDNI-------...-----------------------------..----.PLPQE.LCD-----------------
Q65PK7_BACLD/18-132..K.AEEL-------..L-----------------------------GV----.SFPDE.LVS-----------------
Q81BW2_BACCR/27-144..D.IQKC-------..L-----------------------------HV----.ELPND.LYQ-----------------
A4Y9N5_SHEPC/8-116..E.AQLK-------..L-----------------------------GF----.KFSPE.YIE-----------------
Q5LEK4_BACFN/167-306..D.FEME-------..L-----------------------------NI----.KIPAA.MKN-----------------
A4SRI0_AERS4/8-116..I.AERK-------..L-----------------------------GI----.TFHND.YRC-----------------
A3I6Z7_9BACI/22-146..D.AEIE-------..L-----------------------------GF----.QLPPS.YCW-----------------
Q2SDZ5_HAHCH/28-140..R.AERL-------..L-----------------------------EV----.RLPQE.YKN-----------------
Q0RKI3_FRAAA/56-185..A.AEQR-------..L-----------------------------AV----.RLPPT.FRS-----------------
A3ZX34_9PLAN/23-143..K.LESL-------..L-----------------------------GS----.RLPVS.FKT-----------------
A8M704_SALAI/21-139..Q.VQAA-------..W-----------------------------DM----IRLPSA.YEE-----------------
B8I223_CLOCE/15-131..N.AERK-------..M-----------------------------GL----.ELPRE.LKE-----------------
Q4PAY0_USTMA/184-339..E.LEMT-------..I-----------------------------GY----.ALPSC.VRE-----------------
Q21ED8_SACD2/11-151..D.FEEN-------..I-----------------------------GM----.PFPPD.YRE-----------------
A0RAV0_BACAH/42-162..V.FEDE-------..M-----------------------------GT----.RFPEP.YKY-----------------
A8FII6_BACP2/13-123..K.AESQ-------..L-----------------------------NM----.VLPHA.HKT-----------------
Q09D40_STIAD/24-149..D.FERR-------..M-----------------------------GW----.KLDPD.LRA-----------------
B7X333_COMTE/152-284..L.CEWR-------..L-----------------------------GC----.NLSQS.LRD-----------------
Q38V57_LACSS/13-131........-------..P-----------------------------NA----.ALPAD.YLA-----------------
Q8NRK2_CORGL/4-116..A.AEET-------..L-----------------------------GR----.RLPET.LRE-----------------
A5TXY3_FUSNP/37-189..K.LKEE-------...-----------------------------.Y----PEVPDS.LIE-----------------
Q5LEK9_BACFN/11-148..E.IESK-------..L-----------------------------GY----.ALPER.LKE-----------------
Q7N9I9_PHOLL/23-147..E.FESL-------..L-----------------------------GV----.TFPES.YKF-----------------
Q52KV8_XENLA/36-166..G.VEEK-------..I-----------------------------GC----.KLPDD.YRC-----------------
Q6HGG3_BACHK/12-159..N.VERE-------..L-----------------------------GI----.HFPLD.YIE-----------------
A5TTY9_FUSNP/35-181..D.VEQK-------..L-----------------------------GY----.RIPED.FRD-----------------
A5Z4R9_9FIRM/9-151..E.FEEK-------..L-----------------------------NT----.KFPEA.YVD-----------------
A6CCT7_9PLAN/22-151..Q.FEVV-------..I-----------------------------GR----.ELPET.LKV-----------------
Q0VNR5_ALCBS/21-130..E.IEEQ-------..L-----------------------------LI----.SLPAD.YKA-----------------
B8I222_CLOCE/15-149..E.IEKK-------..F-----------------------------SF----.KIPSDIYKH-----------------
Q59YV1_CANAL/104-343..D.FQKD-------..L-----------------------------SI----.KLPNC.VIQ-----------------
Q93JL3_STRCO/163-310..E.AQTR-------..L-----------------------------GV----.TLPDE.LKA-----------------
A0RFK3_BACAH/36-159..A.FEQE-------..W-----------------------------GY----.KLDLK.YRD-----------------
Q73QC3_TREDE/40-189..A.FEEK-------..L-----------------------------GI----.TLPED.FKE-----------------
Q4UXL8_XANC8/219-365..A.AEAR-------..L-----------------------------GV----.RLPAL.FKR-----------------
Q5LEK2_BACFN/47-168..E.LERD-------..L-----------------------------KR----.EIPSQ.FRS-----------------
B1J8X4_PSEPW/139-260..F.LEEV-------..L-----------------------------GG----.RLPPE.FRR-----------------
A5FCA9_FLAJ1/44-161..A.LETK-------..L-----------------------------GT----.ALPEN.LKL-----------------
A5Z4R3_9FIRM/12-152..S.FEKK-------..I-----------------------------GK----.IFPND.FKK-----------------
A5FLI6_FLAJ1/11-131..E.FEKL-------..F-----------------------------NC----.LLPDS.FKD-----------------
Q1C2E7_YERPA/11-153..S.VEKT-------..L-----------------------------GY----.SFPEAFVSH-----------------
A6VZI9_MARMS/37-168..C.FEEK-------..Y-----------------------------GF----.LLPKE.YVN-----------------
A5FMA4_FLAJ1/23-172..E.LTSY-------..F-----------------------------SL----.PLPQE.LIT-----------------
A7Z7P3_BACA2/41-156..S.FEKK-------..I-----------------------------KV----.SLPED.YKT-----------------
Q39NE9_BURS3/28-182..A.LRDA-------...-----------------------------.Y----PQCPAS.LLE-----------------
A0AMA9_LISW6/21-137..E.AQKL-------..L-----------------------------NV----.QFNEQ.YIN-----------------
Q2BBP3_9BACI/17-145..K.VQRE-------..L-----------------------------QV----.DLPES.YIN-----------------
B1KH37_SHEWM/28-163..D.IEAF-------..L-----------------------------GT----.SLPSD.YKW-----------------
A4EPD0_9RHOB/35-163..Q.AEQL-------..L-----------------------------GI----.KLPMD.YRF-----------------
A6CDZ7_9PLAN/19-143..E.AEEQ-------..L-----------------------------SV----.RFPAS.YRH-----------------
Q9F3Q3_STRCO/47-179..A.AEAR-------..L-----------------------------GR----.RLPPS.YRE-----------------
A6DN67_9BACT/17-158..V.FEKK-------..Y-----------------------------NI----.KLPKK.YKE-----------------
A7ML24_CROS8/19-151..E.FAKC-------..F-----------------------------PA----.RLPES.FKA-----------------
A1ZMA9_9BACT/9-138..N.WEQK-------..E-----------------------------GI----.VLDKT.FQR-----------------
Q1DEQ7_MYXXD/33-153..A.FEAQ-------..M-----------------------------GW----.RLDDD.LRA-----------------
B1YF81_EXIS2/16-130..K.AEHA-------..L-----------------------------GV----.LFPDE.YKD-----------------
Q5WC01_BACSK/21-135..A.KERE-------..L-----------------------------GF----.SLPLV.LRN-----------------
A5FJY1_FLAJ1/42-170..D.IKSL-------..T-----------------------------NN----.NLEDS.YYY-----------------
B1YEX8_EXIS2/15-147..H.IEKQ-------..L-----------------------------GS----.RLPKS.YLK-----------------
A6EFN0_9SPHI/29-161..H.TEKS-------..I-----------------------------GV----.AFNNE.LKE-----------------
Q6HGE4_BACHK/13-160..E.IGLQ-------..L-----------------------------GF----.QLPQD.YID-----------------
A5UV09_ROSS1/24-144LIQKVQNE-------..L-----------------------------GA----.KLPEG.YIE-----------------
A4BCB8_9GAMM/14-147..V.AEKK-------..L-----------------------------GV----.KLPAE.YVE-----------------
Q11VT9_CYTH3/29-168..S.IEQE-------..L-----------------------------GY----.KLPAS.YIE-----------------
A4FNW2_SACEN/30-166..A.LEAE-------..F-----------------------------HV----.QLPAD.LRA-----------------
A7Z5G8_BACA2/23-137..K.IEQD-------..L-----------------------------QV----.TLPDS.YKW-----------------
Q6NG79_CORDI/14-156..R.IENE-------..L-----------------------------GK----.KLPQS.YRD-----------------
B1KH38_SHEWM/29-165..A.IERF-------..L-----------------------------QA----.KLPDD.YLW-----------------
Q47P53_THEFY/18-133..R.IEEA-------..L-----------------------------GM----.PVPWE.LVE-----------------
Q926X2_LISIN/25-149..I.YQDA-------..L-----------------------------GN----.EFPET.YKL-----------------

PF14568

A0AMA9_LISW6/24-135--E-AQKL---------L-----------------------------NV.....QFNEQ-YIN-----------------
A3I6Z7_9BACI/25-144--D-AEIE---------L-----------------------------GF.....QLPPS-YCW-----------------
A3ZX34_9PLAN/26-141--K-LESL---------L-----------------------------GS.....RLPVS-FKT-----------------
A4IKF8_GEOTN/24-130--K-AEEI---------L-----------------------------GL.....QFPES-YRA-----------------
A4VZJ4_STRS2/22-126--V-AESK---------L-----------------------------QL.....IFPAE-YKD-----------------
A6CDZ7_9PLAN/22-141--E-AEEQ---------L-----------------------------SV.....RFPAS-YRH-----------------
A6X425_OCHA4/23-138--Q-AEAD---------L-----------------------------GV.....QFPLE-YRE-----------------
A7FEI4_YERP3/13-142--N-IEKK---------L-----------------------------GI.....TFPND-YRE-----------------
A7GQ33_BACCN/24-128--M-IEKK---------L-----------------------------GC.....TFPPQ-YRE-----------------
A7Z5G8_BACA2/26-135--K-IEQD---------L-----------------------------QV.....TLPDS-YKW-----------------
A7ZAC8_BACA2/3-116--A-AEKS---------L-----------------------------RA.....SFPKA-YKR-----------------
A8UFY5_9FLAO/12-126--E-LELV---------L-----------------------------EK.....ELPED-YKA-----------------
A9DRK0_9FLAO/13-128--E-FENT---------L-----------------------------GK.....RLPED-YRQ-----------------
A9INX3_BART1/38-152--K-AEKT---------L-----------------------------GL.....QFTSS-YKV-----------------
A9INY0_BART1/31-145--K-AEKT---------L-----------------------------GL.....QFTTS-YKS-----------------
A9INY3_BART1/35-149--K-AERT---------L-----------------------------GL.....QFTSS-YKS-----------------
A9INY6_BART1/35-148--K-AEKA---------L-----------------------------GL.....QFTSS-YKS-----------------
A9INZ4_BART1/35-149--K-AEKA---------L-----------------------------GL.....QFTSS-YKV-----------------
B0ALZ7_BACAN/9-120--G-IQQM---------L-----------------------------NI.....KFPNS-YHW-----------------
B1BP25_CLOPF/31-145--K-YEEK---------L-----------------------------GV.....EFPNI-YKR-----------------
B1KH37_SHEWM/31-161--D-IEAF---------L-----------------------------GT.....SLPSD-YKW-----------------
B1KPX6_SHEWM/20-134--N-LEEA---------L-----------------------------GV.....ILPET-YKE-----------------
B3ZML8_BACCE/21-125--Q-AEEE---------L-----------------------------QF.....NFPEQ-YKK-----------------
B4AJF6_BACPU/18-123--K-AESQ---------L-----------------------------NM.....VLPDA-YKN-----------------
B5ULT3_BACCE/26-136--E-LEKK---------F-----------------------------GC.....QFPKE-FKC-----------------
B5UUA7_BACCE/17-130--E-TEEK---------L-----------------------------GA.....AFPNQ-YRD-----------------
B7INQ5_BACC2/11-140--E-LEEF---------L-----------------------------GF.....LLPED-YKK-----------------
B7JLP8_BACC0/25-134--Y-VQDT---------L-----------------------------QL.....KLPES-YKW-----------------
B8DA94_LISMH/28-135--N-AEKA---------L-----------------------------SI.....KLPSD-YKW-----------------
B8DD33_LISMH/29-148--I-YQNV---------L-----------------------------EN.....VFPDS-YKL-----------------
B8DD37_LISMH/24-135--E-AEKI---------L-----------------------------DA.....QFNKQ-YIH-----------------
C2KY92_9FIRM/22-126--E-AQES---------L-----------------------------DL.....VFPDE-YIE-----------------
C2M8M5_CAPGI/23-138--Q-TEKK---------L-----------------------------GF.....SLPDS-YKE-----------------
C2PY06_BACCE/26-128--E-VEER---------L-----------------------------NV.....KLPDS-YRW-----------------
C2TZ07_BACCE/17-130--E-TEEK---------L-----------------------------GV.....VFPAQ-YRD-----------------
C2ZR32_BACCE/17-130--E-TEEK---------L-----------------------------GV.....IFPEQ-YRD-----------------
C3BVU2_9BACI/35-154--I-LQNE---------L-----------------------------NI.....QIPDI-YKD-----------------
C3WVX7_9FUSO/23-127--R-AEKR---------L-----------------------------EL.....KFPEE-YKD-----------------
C4L6I6_EXISA/20-124--Q-AEEK---------L-----------------------------GM.....MFPKT-YRD-----------------
C6ABU4_BARGA/31-145--K-AEKT---------L-----------------------------GL.....QFTTS-YKS-----------------
C6ABU7_BARGA/31-144--T-AENT---------L-----------------------------DL.....QFTSS-YKS-----------------
C6AD58_BARGA/31-144--K-AEET---------L-----------------------------GL.....QFTSS-YKS-----------------
C6AD60_BARGA/31-146--R-AEET---------L-----------------------------GL.....QFTSS-YKA-----------------
C6AEU7_BARGA/31-145--E-AEKI---------L-----------------------------GV.....KFTTS-YKD-----------------
C6CF14_DICZE/28-135--K-AEQA---------L-----------------------------GV.....TLPED-YKW-----------------
C7GI90_9FIRM/31-150--M-SEKK---------L-----------------------------GI.....SFSPQ-CKE-----------------
C7N7K9_SLAHD/25-127--E-AQEK---------L-----------------------------GV.....EIPEQ-FLE-----------------
C8K547_LISMN/28-148--K-AQVV---------L-----------------------------NV.....NFPED-YKT-----------------
D0KCB2_PECWW/28-147--K-YESE---------L-----------------------------GV.....LFPES-YKF-----------------
D0KCZ5_PECWW/26-145--E-FEAL---------L-----------------------------GV.....FFPES-YKL-----------------
D1W447_9BACT/21-143--Y-IENE---------L-----------------------------NI.....KLPKQ-YKK-----------------
D3EC77_GEOS4/25-144--E-AEAE---------L-----------------------------GF.....SLPPS-YRW-----------------
D3FRA3_BACPE/26-146--A-AEDK---------I-----------------------------GL.....KFTGA-YLD-----------------
D3FRA5_BACPE/24-128--K-AEEV---------L-----------------------------KV.....KFPRD-YRK-----------------
D3I7I1_9BACT/41-148--Q-AEVM---------L-----------------------------NV.....VFDSD-YKQ-----------------
D3I8Y5_9BACT/21-120--S-AENV---------L-----------------------------GL.....HFAQE-YRE-----------------
D4FV91_BACNA/25-133--E-IQNS---------L-----------------------------NV.....KLPES-YKW-----------------
D4FXH9_BACNA/26-163--E-IEMN---------I-----------------------------GK.....QLPSD-YKD-----------------
D4FXI0_BACNA/26-142--N-FEEA---------V-----------------------------LGKFPVNEIPSG-YKK-----------------
D4FXI1_BACNA/25-133--R-IEEN---------L-----------------------------QC.....DLPNS-YKW-----------------
D5HHH7_9FIRM/25-128--D-AEKI---------L-----------------------------NL.....KIPEQ-YVW-----------------
D5SSH7_PLAL2/27-142--R-LQEL---------L-----------------------------HT.....RLPLS-LQK-----------------
D6CWW7_9BACE/84-197--K-LESK---------L-----------------------------NV.....ILPLS-YKI-----------------
D7JDE8_9BACT/35-142--N-AENE---------L-----------------------------GI.....KFDKD-YVF-----------------
D7VC45_LACPN/26-146--M-GETK---------L-----------------------------GV.....QFPSD-YRK-----------------
E1UUR3_BACAS/39-142--D-IEQK---------L-----------------------------GV.....TFPND-YKE-----------------
E1UUR6_BACAS/25-133--E-IEEY---------L-----------------------------NV.....TLPDS-YKW-----------------
E2MKG2_PSEUB/45-159--K-AEQR---------L-----------------------------GH.....PLPDS-YKW-----------------
E3YTZ2_9LIST/29-148--V-YQDS---------L-----------------------------GN.....EFPES-YKV-----------------
E3ZJV4_LISIV/35-139--L-VENN---------L-----------------------------GI.....SFSSD-YVW-----------------
E4LF31_9FIRM/27-134--N-IEKA---------L-----------------------------NI.....KLDDD-FKE-----------------
E5W3S4_9BACI/29-137--K-IEND---------L-----------------------------QT.....TLPES-YKW-----------------
E5W3S5_9BACI/24-128--N-AENQ---------L-----------------------------RC.....KFPQE-YKE-----------------
E6UJN0_RUMA7/22-127--N-AEDK---------L-----------------------------GL.....QFADD-YKE-----------------
E8K361_9STRE/11-132--S-VEHR---------L-----------------------------QI.....TLPED-YKQ-----------------
E9SF19_RUMAL/19-157--R-FENI---------L-----------------------------GL.....SFPDD-YKE-----------------
F0RDN6_CELLC/80-198--E-IEKQ---------I-----------------------------NL.....TLPLS-YKL-----------------
Q0VKY9_ALCBS/7-128--N-TKNE---------L-----------------------------GV.....KFPDS-FRK-----------------
Q2SDZ5_HAHCH/31-138--R-AERL---------L-----------------------------EV.....RLPQE-YKN-----------------
Q4K9A1_PSEF5/31-138--E-AQQA---------L-----------------------------GL.....QLPAD-YTW-----------------
Q4KGS7_PSEF5/49-173--A-AEMA---------L-----------------------------GR.....TLPCS-FAR-----------------
Q5DWB0_CLOPF/28-149--L-AEEM---------L-----------------------------DL.....KFSKL-YRE-----------------
Q5WIS2_BACSK/30-150--L-AEEK---------L-----------------------------GL.....KFTGL-YLD-----------------
Q7M7B0_PHOLL/28-131--Q-YEKE---------I-----------------------------GF.....EFSND-YKE-----------------
Q7N9I9_PHOLL/26-145--E-FESL---------L-----------------------------GV.....TFPES-YKF-----------------
Q8GDM6_PHOLU/28-135--K-TEKA---------L-----------------------------SL.....TLPDD-YKW-----------------

PF14567

A0KT76_SHESA/1-131--E-VEEQ---------I-----------------------------LI-----PLPRE-LKE-----------------
Q0VNR5_ALCBS/1-133--E-IEEQ---------L-----------------------------LI-----SLPAD-YKA-----------------
D4ZBL0_SHEVD/1-131--V-VEEE---------I-----------------------------LM-----PLPPE-LKE-----------------
A4SRI0_AERS4/1-119--I-AERK---------L-----------------------------GI-----TFHND-YRC-----------------
Q21KG4_SACD2/2-132--E-AHEA---------M-----------------------------LI-----SVPAD-FRD-----------------
A6X428_OCHA4/5-137--K-YESA---------T-----------------------------GF-----QFSED-YKE-----------------
A8H7F8_SHEPA/1-132--E-VEEE---------I-----------------------------LI-----PLPME-LKE-----------------
A0Y938_9GAMM/1-109--.-.EEQ---------I-----------------------------LL-----SLDPE-FRQ-----------------
C1DFY0_AZOVD/1-133--E-IEEQ---------L-----------------------------LI-----NLPFE-LRE-----------------
C4S745_YERBE/5-136--S-YEKN---------I-----------------------------GF-----TFPED-YKK-----------------
B0KR80_PSEPG/1-133--E-IEEQ---------L-----------------------------FI-----NIPFV-FKE-----------------
Q2BMU0_9GAMM/1-131--E-IEEQ---------I-----------------------------LI-----SLPDE-YKF-----------------
B2C6T5_ACIBA/7-138--A-YERK---------I-----------------------------GF-----IFPKD-YKK-----------------
B8CKE3_SHEPW/1-119--D-AQKK---------L-----------------------------GF-----RFPKE-YVA-----------------
E3A4U8_PSEAI/1-131--E-IEEE---------L-----------------------------LI-----GIPAE-FRE-----------------
Q086X2_SHEFN/1-131--E-VEEQ---------I-----------------------------LI-----GLPND-LKE-----------------
Q880E4_PSESM/5-136--A-YERE---------L-----------------------------GI-----SFLDE-YKF-----------------
B3PC71_CELJU/34-164--E-IEEE---------I-----------------------------LL-----PIPRD-MRR-----------------
D4RXT0_9FIRM/2-135--E-LEKQ---------L-----------------------------SI-----AFREE-VKI-----------------
A4Y9N5_SHEPC/1-119--E-AQLK---------L-----------------------------GF-----KFSPE-YIE-----------------
Q12R95_SHEDO/1-131--E-VEEQ---------I-----------------------------LI-----SLPRE-LKV-----------------
D0WEZ4_9ACTN/5-134--E-VEEK---------L-----------------------------GF-----IVPEQ-FLE-----------------
A3QH89_SHELP/1-131--E-VEEQ---------I-----------------------------LI-----PLPAE-LKE-----------------
C1D4A4_DEIDV/3-141--A-LEVL---------L-----------------------------ET-----RLPPS-YRA-----------------
A1S8W2_SHEAM/1-131--D-VEEA---------I-----------------------------LI-----PLPAD-LKE-----------------
Q7M7B0_PHOLL/5-136--Q-YEKE---------I-----------------------------GF-----EFSND-YKE-----------------
D1W447_9BACT/1-147--Y-IENE---------L-----------------------------NI-----KLPKQ-YKK-----------------

PF07348

C6RW74_VIBCL/5-179FSN-VERA---------I-----------------------------EL-----TLHED-IKA-----------------
B8K7V3_VIBPA/10-184FSN-VEAG---------I-----------------------------EL-----TLHED-IKL-----------------
SYDP_SHEON/3-180FTN-VEHA---------L-----------------------------EL-----KLWPD-IHS-----------------
C3BLV0_9BACI/6-177FSD-IEKK---------L-----------------------------AV-----QLHHS-IKE-----------------
C2X4F6_BACCE/18-189LTI-LEEQ---------F-----------------------------AI-----KFHDS-VYH-----------------
SYDP_ERWCT/5-179LDG-VERA---------L-----------------------------EI-----SLHPD-VHA-----------------
Q6HGE7_BACHK/3-177FTE-IEKK---------L-----------------------------GM-----NIHHA-MKE-----------------
D4I9V3_ERWAE/5-179LNA-VERA---------L-----------------------------DI-----RLQPA-VTA-----------------
C2QKP9_BACCE/1-174FDE-IESQ---------Y-----------------------------NV-----QLHDS-VKQ-----------------
SYDP_SHEPW/3-180FDN-VEHA---------L-----------------------------EL-----SLHGD-INA-----------------
SYDP_PHOPR/5-179LAG-VEKG---------I-----------------------------EI-----ELHKD-IID-----------------
B4F2E3_PROMH/4-178LEK-VEKA---------M-----------------------------GI-----IIRSE-LHD-----------------
SYDP_PHOLL/5-180LNS-VEVA---------L-----------------------------DI-----QLQPA-IHD-----------------
SYDP_EDWI9/5-178LEG-IGRA---------L-----------------------------DI-----RLHPA-LAP-----------------
SYDP_VIBF1/5-179LHN-IEQG---------I-----------------------------EL-----DLHDD-FHA-----------------
SYDP_ALTMD/5-178FNN-VEDA---------L-----------------------------SL-----KLHAD-YCC-----------------
A7GQ41_BACCN/1-173LTK-IEER---------F-----------------------------EI-----KLHTS-IDD-----------------
A9DDC7_9GAMM/3-186FAN-VETA---------L-----------------------------GI-----ELGSD-IDA-----------------
A0Y507_9GAMM/15-191LNN-LAKA---------L-----------------------------EL-----EFPTA-LSE-----------------
SYDP_AERHH/5-179FTA-MNEA---------L-----------------------------EL-----TLHPA-AQA-----------------
C6CEU0_DICZE/5-179LDG-VERA---------L-----------------------------EI-----QLHPD-IHS-----------------
C3BLV7_9BACI/3-176FIH-LEQE---------M-----------------------------DI-----HFHQT-VIT-----------------
SYDP_SHELP/3-184FDN-IEHA---------L-----------------------------SI-----TLHPS-IQA-----------------
SYDP_SHEDO/3-180FDN-VASA---------L-----------------------------AI-----TLHQD-INH-----------------
SYDP_SHEFN/3-180FSN-VEHA---------L-----------------------------NI-----QLHQD-IHA-----------------
SYDP_SHEAM/3-180FNN-VSHA---------M-----------------------------DI-----ELHHD-IDD-----------------
SYDP_COLP3/8-192FEN-VESA---------L-----------------------------NI-----ELHPD-IKI-----------------
SYDP_TOLAT/5-177LQN-IASA---------L-----------------------------EC-----VFHPA-IHA-----------------
SYDP_HAHCH/6-185FDG-LEQG---------L-----------------------------EV-----AIHPS-ITA-----------------
A3WM07_9GAMM/6-183FSK-LESA---------L-----------------------------DM-----RFHDS-VKR-----------------
A6F6I4_9GAMM/5-184FSN-IESA---------L-----------------------------NI-----ELDPQ-IAD-----------------
SYDP_PSEA6/5-182FKD-LSEA---------L-----------------------------EL-----TLHPD-VAQ-----------------
D2U272_9ENTR/7-182LHS-VEKA---------L-----------------------------EI-----HFYPN-IHQ-----------------
Q1ZGY9_9GAMM/5-180LSN-IESA---------L-----------------------------EI-----TLHPS-IHA-----------------
SYDP_PSYIN/5-180MSN-IEQA---------L-----------------------------DI-----KLHPS-IVD-----------------
SYDP_IDILO/4-175FDD-LESA---------L-----------------------------EM-----SFHQS-IKT-----------------
A4C5J8_9GAMM/3-179LTQ-LADA---------L-----------------------------EL-----TFHPS-INA-----------------
C6CC04_DICDC/5-179LDG-VERA---------L-----------------------------DI-----SVHPD-AHA-----------------
E6WGC7_PANSA/4-178LAA-VERA---------L-----------------------------DL-----ELQPD-ITA-----------------
D4GLK5_PANAM/5-179LDA-VERA---------L-----------------------------DI-----QLQPQ-ITA-----------------
A6D8T1_9VIBR/5-179LEN-IEQG---------I-----------------------------EL-----SLHDD-IKG-----------------
C9P9P0_VIBFU/5-179LAN-VEQG---------I-----------------------------EL-----TLQQD-IAP-----------------
D0ICP4_VIBHO/5-179FSN-VEEG---------I-----------------------------GI-----RLHDD-IKA-----------------

PF14435

Q11UH8_CYTH3/2-179--DYWNEQ---------DI.............ELDKIKLESVH....AI-----PLPVD-ILE-----------------
C3G535_BACTU/11-190--VNWNEE---------IY.............GLIHYNEKIIH....SF-----SFSKE-TKD-----------------
C3BLX0_9BACI/3-181--DRWNEK---------RD............GTLNKLDREIMQ....HA-----NLSSD-KRR-----------------
C3G534_BACTU/3-181--EKWDVN---------KD............GPLITFPEKELI....NK-----NFSAE-VKR-----------------
D7C074_STRBB/3-186--SAFGSL---------W...............VETMPPEVAE....RH-----FANPD-DRR-----------------
E0QLS9_9FIRM/4-167--NNLAF.---------.................NIKDTPYKK....LS-----LEELS-HNL-----------------
A3IE36_9BACI/4-165--EYYDSE---------T................REYDFNELV....NF-----GVSVE-NAD-----------------
D3GZ30_ECO44/1-160--DLQTI.---------.................KIFEKINS.....SS-----SDLSK-EIK-----------------
B7LQU5_ESCF3/2-167--VKINE.---------.................KFCEINKSD....SK-----SNLLK-EIR-----------------
B1VPR4_STRGG/6-176--YPTTER---------MI...............MSNESIDEE....SP-----QFSMT-QLH-----------------
C6PRK9_9CLOT/16-217--IRESEE---------R................KEIMRDIIM....NL-----KLPQE-TKD-----------------
B8CKE1_SHEPW/1-161--DNYSKY---------P...............ITRLSELG........-----.LHLS-TIR-----------------
A3ZNI5_9PLAN/58-240--SFFGAD---------Q...............LTYLHPSD.......D-----QLRGD-VQG-----------------
D3E916_GEOS4/1-200--TLYDHG---------................VLPYTRESLD....GQ-----GMHDK-TVE-----------------
E2N2L1_CAPSP/5-173--ALHQAG---------................ITAELHSPQP..QLMS-----LDEVL-QNK-----------------
C0DUS3_EIKCO/1-171--QALTAD---------H...............IPILRPAAYSAGEPAG-----LNTVF-KDG-----------------
B5HAW8_STRPR/39-232--EENGSG---------RYTPHWVRPGHWAQNGTLDLPTADAREVADWP-----APVRE-ALE-----------------
E8RXJ9_MICSL/4-174--ALWGER---------G...............VIYFPDQRFD....AV-----LGPLG-PEV-----------------
D1A3F0_THECD/3-170--DLWGED---------G...............LLYIPPEHV......E-----RFRFD-LRM-----------------
Q47PK6_THEFY/247-430--DTRLP.---------................VQRYDADAVA....ES-----GLPEA-THD-----------------
E4NDB7_KITSK/233-420--ALFGED---------G...............THRFEQAQTL....AA-----DLPEE-FSR-----------------
C9YY18_STRSW/732-910--AAFGPG---------................VFRFDQQAVS....RQ-----GVPPI-VAH-----------------
B5HAJ0_STRPR/6-189--RTVGEE---------N...............VHRLQPQVAE....AY-----GFNGE-ALR-----------------
D6K842_9ACTO/6-208--RVFGEG---------R...............VPTVPAAAFP....PA-----AADTE-GAR-----------------
B5I6T5_9ACTO/6-184--SEFDPE---------E...............LTTFSAAAVA....TI-----RHE.P-SAD-----------------
E4N1Q1_KITSK/249-422--AVFGAD---------G...............TVTLDERTA.....AA-----VAHRP-SRV-----------------
D1A5L5_THECD/6-199--EAYGEE---------N...............LLTIPADRLP....DL-----LIHQP-TRD-----------------
D6K293_9ACTO/144-316--QEFGAA---------A...............VVRFEEIDFP....PA-----LTHEP-TRR-----------------
D6KEF7_9ACTO/214-404--EVFGGG---------G...............MVRLADDHLP....PA-----LVHAP-TRR-----------------
Q82D46_STRAW/203-389--EEFGAF---------G...............IVRFEDVDFP....AA-----LTHEP-TRR-----------------
D9WNF8_9ACTO/13-197--ARFGAG---------S...............LWRPAEADLP....AE-----LTDQE-SRD-----------------
Q2U157_ASPOR/71-266--KQFGPG---------S...............LWRPKEADLP....VD-----LTNKP-ARE-----------------

PF02393

C8CFJ8_HCMV/54-179----WFLVMRE---------------------------QAAIP........------------------------....-
C8CFJ9_HCMV/42-158----WFLQVRP---------------------------GSTMP........------------------------....-
A8T729_HCMV/26-179----WRLDFVE---------------------------FEDIF........------------------------..GS-
A8T728_HCMV/45-168----WHVMLRT---------------------------EDGII........------------------------....-
D3YRX5_HCMVO/17-135----CFIQLRS---------------------------RSALG........------------------------...P-
D2K4G8_HCMV/126-245----WFFTYCD---------------------------LLRVG........------------------------....-
UL298_HCMVM/399-518----HGIMLGD---------------------------TQYFG........------------------------....-
B9VXJ9_HCMVT/55-169----CIYVVGG---------------------------EHSPH........------------------------....-
D2K5D0_HCMV/11-135----RCLVIRR---------------------------RWRLV........------------------------....-
B9VXD4_HCMVT/116-247----FYARVTP---------------------------RSQMN........------------------------....-
D3YRW4_HCMVO/11-132----WNLVLQE---------------------------IETDE........------------------------....-
D2K4S5_HCMV/202-333----PLLMLGS---------------------------IEGLRACR.....------------------------PFDH-
D3YS52_HCMVO/180-322----TLKLLTS---------------------------FGCLTDCW.....------------------------PFEV-
D2K3X0_HCMV/202-332----PLLLCGQ---------------------------AENLKGVW.....------------------------PFIC-
A8T728_HCMV/200-332----IMRLMKT---------------------------VQQLHRIW.....------------------------PFCA-
B8YE72_HCMV/157-296----HFAFWTH---------------------------NTEVMKFKETSFS------------------------VVRA-
B9VXG6_HCMVT/274-510----QPMVLLG---------------------------AWQELAQYE...P------------------------FASA-
B9VXL1_HCMVT/265-382----ALTTVVL---------------------------NGSQT........------------------------...Y-
B9VXJ9_HCMVT/546-653----CTFTFGS---------------------------WNVAE........------------------------....-
D2K5D5_HCMV/214-331----HSLVLRT---------------------------ARDLG........------------------------....-
D2K5D0_HCMV/151-256----SVIRVST---------------------------IRLYD........------------------------....-
B8YE60_HCMV/153-278----RLCNLRC---------------------------FENSV........------------------------....-
C8BKJ5_HCMV/34-153----LYVCICD---------------------------PSYEF........------------------------...L-
D2K595_HCMV/6-123----YTLFVCD---------------------------VEETI........------------------------....-
B4YEM5_9ALPH/49-167----FCLRIGG---------------------------LEASF........------------------------...H-
D2E8A7_9VIRU/5-121----IVLRIAP---------------------------LDGTI........------------------------...H-
C3RWK6_9VIRU/35-153----LYVRICD---------------------------LSGTI........------------------------...Y-
C3RWV3_9VIRU/65-186----MYIRICG---------------------------LDGTM........------------------------...Y-
Q070N0_CPRV/47-172----CCLRVGD---------------------------LSSTF........------------------------...Y-
B1NFI8_ADEGX/15-131----HFLVIGD---------------------------LEGTL........------------------------....-
Q4KS78_ISKNV/1-104----ATLTFAS---------------------------AADTA........------------------------....-
B5XAY6_SALSA/21-139----YELRIGG---------------------------LEDTV........------------------------...H-
C3Y900_BRAFL/167-275----IFTPLEE---------------------------GSSDM........------------------------....-
C3Z365_BRAFL/157-265----RFTPWKG---------------------------GSSDM........------------------------....-
C1C3V1_LITCT/15-136----LHIRICG---------------------------LDGTV........------------------------...Y-
Q14VM9_9VIRU/5-123----AYMEVCA---------------------------LADTQ........------------------------...Y-

PF14433

C3WDW2_FUSMR/11-172KK..FLQEFSGIKENWFFKYIG.............KNGEVRIDGNDFSFSI------------------------PYDL-
F0KCA1_CLOAE/2-150KK..FLEEFGMIDVYCPINPRIPE..........EDIKKYHFNRYDLYTTN------------------------MIKS-
C3BLQ7_9BACI/6-145KK..FMEEFGELQFNVERIWPD..............GVTKDISEHTTCIKE------------------------VIG.-
F0KCA3_CLOAE/3-152RK..FMEEFGEVHIIA......................KYIDSFGDEDYDE------------------------HSTC-
B1HSL5_LYSSC/5-144KE..ALEQFGELKCIY......................EYNGKLDDFVIDP------------------------EEGL-
C0Z7L3_BREBN/2-133KN..FLKEFGNLVIEDSIND..................ETHNTSIRFTNY.------------------------....-
B7N9G4_ECOLU/6-148CD..FLSEFGGLIVRHESY...................SDPNEYDKSDFDP------------------------IKAA-
A8RVU3_9CLOT/13-150QR..FYRKYFGLCCEWYLEQK................KMNWAADFQFALFP------------------------Y...-
A9B4M5_HERA2/3-169IE..ILSRYGGFRLNSLDIAQPWTLD.....ASLEALFVWTDSPLEIQLLP------------------------QLAP-
C2M481_CAPGI/2-151LV.TFLTIFDGKDI........................KRRDGYMVFIYSQ------------------------NL..-
A9B4M4_HERA2/9-180EA..FLRQFGEL.TTLGCYNRFIFDN.....QVFEHQGTPYRLWRMFENFI------------------------PAYS-
A9B983_HERA2/9-180QR..IFTALGMLNLNLQHLPPIPPDPRTTTPDPIALRDHLWYADIRIDFDP------------------------AEAF-
D1ALL2_SEBTE/5-152LK..FLKNFSYLEITFENPHVK.............KFPRLKNIPVRFMLYP------------------------LDAA-
C2G2C6_9SPHI/5-144KK..FLQEYGLLKVQDVEYDN................EYQRYIASYFEINP------------------------MIGK-
A9DRL2_9FLAO/4-142LK.EFLYEYGDLLV........................ETNDPNNTFTGTL------------------------NLKA-
D7VVD7_9FLAO/4-136LK.EFLIFYGDLVIEDCKPY.................KSDVVNTLNTKID.------------------------....-
D6B4A2_9ACTO/10-151EG..ILAAMGGLSIEPVNRV.................GPNFSNDEPYNFDP------------------------IAAG-
C5UVJ4_CLOBO/2-147RV..FLQKYGMLEIKFKRKM..................QAIAIDEVIEFNP------------------------IKAI-
A4A0B2_9PLAN/1-122TQ..IFAEFGNLKLAT......................ARETIWIGVEADP------------------------....-
A2W0F4_9BURK/45-178A...ILREFGTLIVGAEPARR................SGETCAPMGIAFRA------------------------LE..-
B7WUX3_COMTE/6-150A...ALQNLAGLHIGQVGK...................GRECASSDIEFDW------------------------LEAC-
C6DGM5_PECCP/1-142IS..FLQEYNGLQGNHSAYK..................NNDAPSKYFYINP------------------------EKAI-
B7M4P5_ECO8A/11-152YD..FIKKYGGLYGFHSAY...................KDTTINEAFFIDP------------------------ERAS-
C4GHT1_9NEIS/5-139RA..FVREFDGLSV........................GYPNGNFLFEFRA------------------------RSEY-
D1A3E8_THECD/9-150AR..FLAEFGGLKVPEGPNE.................PGQQVASDEFDLDP------------------------LEGE-
D9X9L6_STRVR/182-321RR..FLAEFGAVGVPYREP...................WDSMPWMEFSLDP------------------------LLAL-
Q82G08_STRAW/7-151AAVRFIHTYGMLRLD.......................HPKASGCAWVMKP------------------------TIGY-
B1VX82_STRGG/7-150AALSFIREHVSLRA........................VIDTAPENFAIFT------------------------PHLV-
D6K3Y2_9ACTO/7-151VE..FLREHIGLVAP.......................LHDSPEDVVMFFP------------------------RLMY-
A4X261_SALTO/97-242RA..ALIEFGGLILPQLGRS..................GEPGAGFASGIQP------------------------TRTG-
D6K3Y4_9ACTO/15-161KA..FLSEFYGLDHRPMES...................GREVASVGFSLDP------------------------EKAR-
B1VX84_STRGG/1-149EQ..ALRAFHGLRVSPVGP...................GRSVAATGCVVDP------------------------TEAR-
D9UTG4_9ACTO/29-176VE..AWAEFGGLTPHPTAK...................GRHLAPASLDLDP------------------------LHGL-
C4RQ15_9ACTO/292-437VE..AITRFPGLIGARRGP...................GEQVWISRFDITP------------------------HLVA-
A4X254_SALTO/6-153VE..AYGEFGGLLVRPQGD...................GEQIAPSTFHLDP------------------------FLVG-

PF09346

SMI1_DEBHA/98-296----FYKITDG............................QSYFNDNGSGGL------------------------V-FG-
SMI2_DEBHA/142-319----FYKRHD..............................GQFRGGKPTGL------------------------V-MG-
YOBM_BACSU/42-161----FMT............................................------------------------.-.L-
A7VFJ3_9CLOT/24-132----WML............................................------------------------.-.F-
A1ZXR5_9BACT/30-166----FLT...................................RFNEYQSVT------------------------F-FE-
A3KB11_9RHOB/18-152----FLLTY................................GGGAPYPLIF------------------------D-YA-
A5UTX3_ROSS1/55-202----FLQLTNGAQLY...................VAPLAWKPSWSTKGDYI------------------------H-YH-
A1C9R6_ASPCL/143-317----SLMSHD..............................GQERPGLPTGV------------------------I-FG-
A0JSM0_ARTS2/15-129----LLA.......................................ETNGI------------------------E-GE-
SMI1_CANGA/103-288----SYRIHDG...........................QEDLESMTGTSGL------------------------I-YG-
Q89MJ4_BRAJA/28-170----FLLA.................................CAGGYFQGSA------------------------E-FN-
Q22E93_TETTS/424-535----LLK............................................------------------------.-..-
A7MRN6_CROS8/1-150----FLLLNNGF..........................VVKSPDYCNLAYG------------------------G-VD-
E6XKE0_SHEP2/21-128----YLL............................................------------------------.-..-
Q63C14_BACCZ/25-143----FYK.......................................EIGYG------------------------F-LE-
Q0VKY9_ALCBS/4-130----KMMK..................................SNGGGVEVS------------------------T-DY-
A5TTM3_FUSNP/176-315----LMKIQNGGE........................LRKNTFQRPFRRSW------------------------S-RG-
Q5LEL2_BACFN/13-124----FLL.........................................WSN------------------------G-GE-
Q2BBP1_9BACI/47-165----LYK.......................................ETNGV------------------------Y-GN-
Q4K9A1_PSEF5/28-140----FLK............................................------------------------.-.E-
A7Z5R7_BACA2/23-158----FLNLYGEC..........................WIEEDNVFFPVLE------------------------D-NP-
FBX3_HUMAN/121-251----SYR......................................IHNGQK------------------------L-VV-
Q81H93_BACCR/13-142----CVKK.................................YDGGYPTPDT------------------------F-NI-
A6G0Q7_9DELT/31-170----WLKT.................................NRNALNFMGN------------------------Y-GA-
Q3EQ17_BACTI/32-156----FLQ.....................................VCNGGEL------------------------F-IP-
A1INP6_NEIMA/28-167----LMAVQNGGI........................FVKNCFPTTQRNSW------------------------A-KD-
A6FHD8_9GAMM/19-145----LIS....................................TYGLVHTP------------------------N-VL-
Q6CS49_KLULA/64-193----FYMKGNGG..........................KLPDERCMYVSSD------------------------G-RE-
Q1L2J9_STRHY/18-144----LWRLS...............................AGEDGVAGSGL------------------------M-LG-
A3I618_9BACI/42-194----LLQ......................................DVNGTY------------------------H-CK-
Q47R76_THEFY/31-145----FLR.......................................CAGRS------------------------A-GS-
A3ZN04_9PLAN/36-149----FLK........................................IARY------------------------V-KI-
A0PQE6_MYCUA/4-131----KTMA..................................DNGGAVETS------------------------S-DV-
Q7M7B0_PHOLL/25-133----VLK............................................------------------------K-IS-
Q3IK24_PSEHT/8-124----VLP.......................................VLNRG------------------------K-PS-
A5FAZ7_FLAJ1/185-329----FYKVQN.............................VDYDPVTAAFQF------------------------G-IN-
Q92KA2_RHIME/32-167----LYAA.................................HDGQPAGSPA------------------------L-YL-
Q4K6P0_PSEF5/56-173----YHR...................................QLGVLSLAE------------------------V-LC-
Q6HGF3_BACHK/15-125----LLR............................................------------------------C-TN-
B4SN74_STRM5/28-184----LLS......................................RVNGTH------------------------F-RE-
Q82RV7_STRAW/96-236----FYRLRNGT.........................GHPGDFGWTPEPDT------------------------G-LP-
A1ZUI6_9BACT/29-147----FLT..........................................VV------------------------G-KT-
A9B016_HERA2/24-146----FLQT.................................FGKTNTWRWF------------------------D-GD-
A1RPC3_SHESW/26-168----LWGYANG...........................GNEWSTVFARKDY------------------------F-CR-
A0RE58_BACAH/19-133----VIQ............................................------------------------.-.Q-
A4X5D2_SALTO/28-164----LARRHNGGS........................FARDAHPAPSPTSW------------------------A-EE-
Q1CV91_HELPH/17-134----FIK....................................RSNYGFSQ------------------------W-RS-
O64025_BPSPB/23-165----FLKKYGGC..........................YLESKKTTDEIEY------------------------D-VC-
A7GQ33_BACCN/21-130----FVK............................................------------------------.-.K-
Q816C2_BACCR/16-147----LLKEQNGGT........................LRLDVHPTSKPNSW------------------------A-DD-
Q633D5_BACCZ/17-131----FML............................................------------------------.-.E-
Q81BA7_BACCR/48-167----FYY..........................................RF------------------------A-GP-
B1YF88_EXIS2/9-123----YFK.........................................KEN------------------------K-FE-
Q9F2N4_STRCO/160-298----FLKA.................................AGGCAPVGTA------------------------L-DA-
A8FAT3_BACP2/17-145----LILEQNGGY........................TLHNAFPTDQPNGW------------------------A-ED-
A0R498_MYCS2/11-150----LLRRQNGGY........................LQVGFPEDRDYNTT------------------------H-DI-
A4YB72_SHEPC/14-135----FLL.....................................ETNGAET------------------------P-IG-
Q927J5_LISIN/124-264----LMRHTQNGG.......................IVSTGSVPTTEPSSW------------------------S-EN-
Q6HHY9_BACHK/33-185----LLE......................................NIDGTY------------------------W-RK-
Q7DD43_NEIMB/1-117----LAQ.........................................STH------------------------A-IN-
Q82GY4_STRAW/63-178----VLR.......................................ESNGI------------------------V-GE-
Q55KB3_CRYNB/120-282----SIQVADGQ.........................DLETTGNISGSGGL------------------------F-FG-
B8I5J3_CLOCE/15-125----LLY............................................------------------------L-SN-
Q6HGD1_BACHK/12-154----FIKV.................................NNGGSPEKKS------------------------F-VC-
A5Z4Q5_9FIRM/17-131----LIL........................................FSNG------------------------I-EG-
Q4EKD7_LISMN/14-152----FYRQ.................................LNLCSNVGDT------------------------C-WF-
A7FEI4_YERP3/10-144----FLKK.................................YNGGYPEPDG------------------------F-YF-
B1KPX6_SHEWM/17-136----FLL.........................................ELG------------------------S-LS-
O07689_LISSE/36-156----ILK.....................................LSKKIYW------------------------Y-WT-
Q81B84_BACCR/8-142----FLSEYN..............................GGTSKVRYSKF------------------------F-VK-
Q5LEK4_BACFN/11-139----FYLKW...............................NGGKPKQQTIC------------------------I-NR-
A7VE32_9CLOT/35-145----LLL...........................................N------------------------F-GG-
A0RAF8_BACAH/19-149----CVAN.................................YNAGRPRPNV------------------------F-DT-
Q3BQF4_XANC5/29-173----LYARYDGGA........................VQMARGQSLEEPDN------------------------W-LK-
Q81Q97_BACAN/4-119----FLK............................................------------------------Q-YG-
Q3EVG8_BACTI/12-138----CIKK.................................NNGGYPEPNI------------------------Y-DI-
Q1DBU4_MYXXD/34-167----FISTY...............................GTFKVLHGGRE------------------------L-IG-
A3ZX25_9PLAN/22-154----FLR.......................................QFGAC------------------------D-LE-
A1TSU7_ACIAC/17-133----FLL.........................................WSN------------------------G-GQ-
Q9F2V0_STRCO/29-155----LYL.....................................RIGDGGF------------------------G-PE-
B1YEY9_EXIS2/39-159----FLE............................................------------------------.-.L-
Q28UU7_JANSC/42-166----LYL............................................------------------------W-RD-
Q9CND2_PASMU/14-158----LITKHNAPG........................IIQSYFDYYDSYRN------------------------E-DE-
Q65VI9_MANSM/10-134----LYLK..................................FNGGQPTEY------------------------V-HD-
B7KWA7_METC4/14-155----FAQSCGAGRIGGH...............LRIFTPVPVEAADLGSRAH------------------------L-IS-
Q5DWB0_CLOPF/25-151----FLL......................................SFGALS------------------------F-NG-
Q63F89_BACCZ/18-127----LLS.........................................ELG------------------------I-IS-
A1RND9_SHESW/4-129----AMKI..................................DNGGEASTE------------------------E-DD-
Q3EVG9_BACTI/12-152----FLLS..................................KNGGKTEQR------------------------R-FK-
Q8F615_LEPIN/16-123----ILL.........................................WSN------------------------G-GE-
Q5WBD2_BACSK/23-138----FIE..........................................LM------------------------S-EY-
A5FGR4_FLAJ1/41-198----FLLHIGNGGISYQNSAAGPGYGIFPFGENVDEFVYSNPENCLSQDCF------------------------I-YP-
A6X425_OCHA4/20-140----LLQK.................................YGAVLAGGLE------------------------V-YG-
Q9RYT7_DEIRA/27-166----SLL...................................RHDGSVDDS------------------------W-PT-
Q5WJU2_BACSK/38-153----FLS............................................------------------------.-.L-
Q880E4_PSESM/25-133----FAK............................................------------------------E-AS-
A5DZP7_LODEL/117-382----FFKLTDGQ.........................LNFGSSLNIETNGL------------------------I-FG-
Q6HMR4_BACHK/23-143----FLK......................................TVNGLD------------------------F-DG-
Q8GDM6_PHOLU/25-137----FLN.........................................NFG------------------------G-GD-
A4X269_SALTO/103-245----WLE.....................................QTNGAQP------------------------E-ME-
Q4KGS7_PSEF5/46-175----WLL.........................................EHN------------------------G-KA-
A4IKF8_GEOTN/21-132----FLK............................................------------------------.-.E-
A7RYE8_NEMVE/119-257----SYR......................................IHNGQR------------------------L-VS-
A4VZJ4_STRS2/19-128----YLK............................................------------------------.-.E-
Q1CY42_MYXXD/19-141----FYL........................................HCDG------------------------A-DL-
Q1ZQF0_PHOAS/14-166----FVSDIDAGEDYCFNEYPEEY.PDFEGRYWAFFDEELLCENIEMSRVG------------------------R-AP-
SMI1_YARLI/171-356----SCLIHD..............................GQEKFGRPSGI------------------------I-FG-
A3ZX28_9PLAN/24-139----FLL......................................RYGGAM------------------------V-GP-
A6C6S9_9PLAN/31-128----FYA............................................------------------------.-..-
Q65PK7_BACLD/18-132----LLK.......................................MTNGI------------------------N-DT-
Q81BW2_BACCR/27-144----LLQ.......................................ETNGI------------------------E-GE-
A4Y9N5_SHEPC/8-116----FIK............................................------------------------.-..-
Q5LEK4_BACFN/167-306----FYLKFNG...........................GMPSPYCFQPQDE------------------------D-LD-
A4SRI0_AERS4/8-116----FLK............................................------------------------.-..-
A3I6Z7_9BACI/22-146----WLMN..................................YGKARLNGG------------------------N-IL-
Q2SDZ5_HAHCH/28-140----FLL............................................------------------------.-.Q-
Q0RKI3_FRAAA/56-185----FLAT.................................SDGWPNPAEW------------------------I-DE-
A3ZX34_9PLAN/23-143----FLA.........................................EYG------------------------G-GG-
A8M704_SALAI/21-139----FLT.....................................NMGSRAG------------------------R-VL-
B8I223_CLOCE/15-131----FFK.......................................EVGYG------------------------F-IK-
Q4PAY0_USTMA/184-339----SYLIYDG...........................QELESNQSCQDGL------------------------F-FG-
Q21ED8_SACD2/11-151----FMLK.................................YNGGDPLKCV------------------------F-KF-
A0RAV0_BACAH/42-162----LLS...................................LMNGSFLAN------------------------L-VR-
A8FII6_BACP2/13-123----LLK............................................------------------------Q-TN-
Q09D40_STIAD/24-149----FYL.....................................HCNGAEL------------------------I-ER-
B7X333_COMTE/152-284----YLLQLGV............................LDWAERLLSPRF------------------------D-LM-
Q38V57_LACSS/13-131----LCQ.......................................ETNGG------------------------F-LS-
Q8NRK2_CORGL/4-116----RLLQ.................................NNGGEVIDNE------------------------N-ND-
A5TXY3_FUSNP/37-189----LLK......................................IVDGTY------------------------F-RE-
Q5LEK9_BACFN/11-148----FYLQY................................NGGSTKQTAS------------------------I-NK-
Q7N9I9_PHOLL/23-147----FLQ.........................................KYG------------------------T-LS-
Q52KV8_XENLA/36-166----SLR......................................IHNGQK------------------------L-VV-
Q6HGG3_BACHK/12-159----CVMK..................................NNGAHVSPE------------------------V-FE-
A5TTY9_FUSNP/35-181----ILLNYSSHFEYFWST............YKDEEEEQIEFPENFRAVFS------------------------G-DL-
A5Z4R9_9FIRM/9-151----FLL......................................ESNGGT------------------------P-EE-
A6CCT7_9PLAN/22-151----LLD.......................................TVNGG------------------------S-PS-
Q0VNR5_ALCBS/21-130----FLL............................................------------------------.-..-
B8I222_CLOCE/15-149----YLLY..................................NGGYPEKCI------------------------F-VD-
Q59YV1_CANAL/104-343----YFKLVD..............................GQYSDFESSGL------------------------I-FG-
Q93JL3_STRCO/163-310----LYRVVRAR..........................WQDWRGDYAAQER------------------------V-VD-
A0RFK3_BACAH/36-159----FLKH..................................ANGWKGFYQ------------------------T-VD-
Q73QC3_TREDE/40-189----LYRYKNGSK........................YLSILPCVIDEIEM------------------------P-FN-
Q4UXL8_XANC8/219-365----LYGVQDGGD.......................TGWCWAPRTRFPSDR------------------------Y-VD-
Q5LEK2_BACFN/47-168----FLMT.................................DTNGLHLFHH------------------------F-SL-
B1J8X4_PSEPW/139-260----LYLSS................................NGGYIGDAQG------------------------G-ND-
A5FCA9_FLAJ1/44-161----FYE............................................------------------------.-..-
A5Z4R3_9FIRM/12-152----FLLK.................................SNGGYPREEL------------------------F-TH-
A5FLI6_FLAJ1/11-131----FYLL.................................NNGGFLPEEN------------------------Y-NR-
Q1C2E7_YERPA/11-153----YLSFNGGV..........................PLRAWWACDDGCE------------------------P-LE-
A6VZI9_MARMS/37-168----ISKSKET...........................KVIRLPPCDNETL------------------------K-YY-
A5FMA4_FLAJ1/23-172----FYKTVGGIESDE.................TFRISSAENLIRYMKQRT------------------------A-FS-
A7Z7P3_BACA2/41-156----FLK............................................------------------------.-.L-
Q39NE9_BURS3/28-182----LLG......................................KLDGTY------------------------W-RD-
A0AMA9_LISW6/21-137----FIK.....................................RFGGAFA------------------------G-IS-
Q2BBP3_9BACI/17-145----LMKKRNGFY........................LAKKYYPTTVPNSW------------------------A-NN-
B1KH37_SHEWM/28-163----FMKN.................................YGMRIIEDDR------------------------V-NL-
A4EPD0_9RHOB/35-163----QVL.........................................SFG------------------------L-PK-
A6CDZ7_9PLAN/19-143----FLK......................................QYGATM------------------------G-VG-
Q9F3Q3_STRCO/47-179----FLMVS................................DGWRHAGGFV------------------------W-LL-
A6DN67_9BACT/17-158----ILLIQNGGTVE...................IPIFKLKSKKHHIDSIY------------------------G-IN-
A7ML24_CROS8/19-151----HYLRI................................NGGYLAEEDV------------------------E-AD-
A1ZMA9_9BACT/9-138----FLL........................................EYNG------------------------G-VP-
Q1DEQ7_MYXXD/33-153----FYL.....................................HCDGAEL------------------------F-RR-
B1YF81_EXIS2/16-130----LFL............................................------------------------.-.Q-
Q5WC01_BACSK/21-135----YYK............................................------------------------A-LG-
A5FJY1_FLAJ1/42-170----FLQ.....................................EIGTGQF------------------------F-IG-
B1YEX8_EXIS2/15-147----KMEEQ................................NGGDIAFNSV------------------------V-VN-
A6EFN0_9SPHI/29-161----LYLFA................................DGTNIDTVTP------------------------S-GL-
Q6HGE4_BACHK/13-160----CVKI..................................NGGAGVLPE------------------------E-FN-
A5UV09_ROSS1/24-144----FLS......................................YTDGLL------------------------Y-NG-
A4BCB8_9GAMM/14-147----LLKQQNGGY........................TTNFVFPTDQENSW------------------------A-ED-
Q11VT9_CYTH3/29-168----LMKQHNGGT........................PVNCCFPVTEETSG------------------------T-EY-
A4FNW2_SACEN/30-166----WWT.......................................CCGGT------------------------A-TD-
A7Z5G8_BACA2/23-137----FLR............................................------------------------.-.K-
Q6NG79_CORDI/14-156----ILECC................................GGGILSLKNS------------------------F-IN-
B1KH38_SHEWM/29-165----FMKN.................................VGRRLIDDRR------------------------I-NI-
Q47P53_THEFY/18-133----LLR.......................................ETNGV------------------------W-NE-
Q926X2_LISIN/25-149----FLE.........................................KYG------------------------T-LT-

PF14568

A0AMA9_LISW6/24-135----FIK-----------------------------------------RFG------------------------G.A..
A3I6Z7_9BACI/25-144----WLM-----------------------------------------NYG------------------------K.AR.
A3ZX34_9PLAN/26-141----FLA-----------------------------------------EYG------------------------G.GG.
A4IKF8_GEOTN/24-130----FLK-----------------------------------------EYG------------------------S.GG.
A4VZJ4_STRS2/22-126----YLK-----------------------------------------EYG------------------------V.IS.
A6CDZ7_9PLAN/22-141----FLK-----------------------------------------QYG------------------------A.TM.
A6X425_OCHA4/23-138----LLQ-----------------------------------------KYG------------------------A.VL.
A7FEI4_YERP3/13-142----FLK-----------------------------------------KYN------------------------G.GY.
A7GQ33_BACCN/24-128----FVK-----------------------------------------KFG------------------------S.GG.
A7Z5G8_BACA2/26-135----FLR-----------------------------------------KYG------------------------S.GG.
A7ZAC8_BACA2/3-116----LLH-----------------------------------------KKN------------------------P.AE.
A8UFY5_9FLAO/12-126----HMK-----------------------------------------KYN------------------------G.GS.
A9DRK0_9FLAO/13-128----FMK-----------------------------------------DYN------------------------G.GIQ
A9INX3_BART1/38-152----FLK-----------------------------------------KYG------------------------G.GE.
A9INY0_BART1/31-145----FLK-----------------------------------------NYG------------------------R.AE.
A9INY3_BART1/35-149----FLK-----------------------------------------NYG------------------------G.GE.
A9INY6_BART1/35-148----FFK-----------------------------------------HYK------------------------G.GD.
A9INZ4_BART1/35-149----FLK-----------------------------------------KYV------------------------G.GE.
B0ALZ7_BACAN/9-120----FLK-----------------------------------------QYG------------------------S.GG.
B1BP25_CLOPF/31-145----FLI-----------------------------------------NFN------------------------G.GYL
B1KH37_SHEWM/31-161----FMK-----------------------------------------NYG------------------------M.RI.
B1KPX6_SHEWM/20-134----FLL-----------------------------------------ELG------------------------S.LS.
B3ZML8_BACCE/21-125----LLS-----------------------------------------ELG------------------------I.IS.
B4AJF6_BACPU/18-123----LLK-----------------------------------------QTN------------------------G.CS.
B5ULT3_BACCE/26-136----FIE-----------------------------------------...------------------------.....
B5UUA7_BACCE/17-130----LIK-----------------------------------------LVN------------------------N.AE.
B7INQ5_BACC2/11-140----FLS-----------------------------------------EYN------------------------G.GTS
B7JLP8_BACC0/25-134----FLT-----------------------------------------NYG------------------------S.GG.
B8DA94_LISMH/28-135----FLE-----------------------------------------TYG------------------------G.GD.
B8DD33_LISMH/29-148----FLE-----------------------------------------KYG------------------------T.LT.
B8DD37_LISMH/24-135----FIK-----------------------------------------QFG------------------------G.A..
C2KY92_9FIRM/22-126----YVK-----------------------------------------AFG------------------------C.ID.
C2M8M5_CAPGI/23-138----MLL-----------------------------------------NYE------------------------F.IS.
C2PY06_BACCE/26-128----FIK-----------------------------------------EYG------------------------G.GG.
C2TZ07_BACCE/17-130----LFK-----------------------------------------LVN------------------------N.AE.
C2ZR32_BACCE/17-130----LFK-----------------------------------------LVN------------------------N.AE.
C3BVU2_9BACI/35-154----FLQ-----------------------------------------VYN------------------------G.GEL
C3WVX7_9FUSO/23-127----YVK-----------------------------------------EFG------------------------A.IS.
C4L6I6_EXISA/20-124----IVK-----------------------------------------EFG------------------------S.VE.
C6ABU4_BARGA/31-145----FLK-----------------------------------------NYG------------------------G.GE.
C6ABU7_BARGA/31-144----FLK-----------------------------------------NYG------------------------G.GE.
C6AD58_BARGA/31-144----FLK-----------------------------------------NYK------------------------G.GE.
C6AD60_BARGA/31-146----FLK-----------------------------------------HYK------------------------G.GD.
C6AEU7_BARGA/31-145----FLK-----------------------------------------NYK------------------------G.GE.
C6CF14_DICZE/28-135----FLS-----------------------------------------EFG------------------------G.GD.
C7GI90_9FIRM/31-150----FYK-----------------------------------------KYG------------------------Y.LS.
C7N7K9_SLAHD/25-127----YLN-----------------------------------------IYS------------------------Y.GG.
C8K547_LISMN/28-148----FLA-----------------------------------------DYG------------------------A.LT.
D0KCB2_PECWW/28-147----FLR-----------------------------------------KYG------------------------T.LT.
D0KCZ5_PECWW/26-145----FLK-----------------------------------------KYG------------------------A.LS.
D1W447_9BACT/21-143----FLS-----------------------------------------QCG------------------------M.CN.
D3EC77_GEOS4/25-144----WLK-----------------------------------------NYG------------------------S.AT.
D3FRA3_BACPE/26-146----YLK-----------------------------------------TFG------------------------A.GN.
D3FRA5_BACPE/24-128----FVK-----------------------------------------HYG------------------------S.GG.
D3I7I1_9BACT/41-148----FIK-----------------------------------------TFG------------------------G....
D3I8Y5_9BACT/21-120----VLA-----------------------------------------NYG------------------------S.LF.
D4FV91_BACNA/25-133----FLN-----------------------------------------KYG------------------------S.GG.
D4FXH9_BACNA/26-163----FLK-----------------------------------------EYG------------------------G.CY.
D4FXI0_BACNA/26-142----FLQ-----------------------------------------TVN------------------------G.LD.
D4FXI1_BACNA/25-133----FLE-----------------------------------------KYG------------------------A.GG.
D5HHH7_9FIRM/25-128----FLK-----------------------------------------NYG------------------------H.GG.
D5SSH7_PLAL2/27-142----FLE-----------------------------------------EYG------------------------G.GG.
D6CWW7_9BACE/84-197----YLK-----------------------------------------.YK------------------------H.FYE
D7JDE8_9BACT/35-142----FLL-----------------------------------------NYG------------------------G.SL.
D7VC45_LACPN/26-146----FLL-----------------------------------------EYG------------------------A.LT.
E1UUR3_BACAS/39-142----FLL-----------------------------------------QHN------------------------GMEM.
E1UUR6_BACAS/25-133----FLT-----------------------------------------EYG------------------------S.GG.
E2MKG2_PSEUB/45-159----FLR-----------------------------------------NYA------------------------G.GE.
E3YTZ2_9LIST/29-148----FLE-----------------------------------------KYG------------------------T.LT.
E3ZJV4_LISIV/35-139----FLE-----------------------------------------NYG------------------------S.GG.
E4LF31_9FIRM/27-134----FTM-----------------------------------------RFG------------------------G.CV.
E5W3S4_9BACI/29-137----FLR-----------------------------------------NYG------------------------S.GG.
E5W3S5_9BACI/24-128----FIK-----------------------------------------SYG------------------------S.GG.
E6UJN0_RUMA7/22-127----YVA-----------------------------------------HYG------------------------T.IS.
E8K361_9STRE/11-132----FVL-----------------------------------------KYD------------------------G.GYP
E9SF19_RUMAL/19-157----FMM-----------------------------------------KNN------------------------G.GT.
F0RDN6_CELLC/80-198----FLK-----------------------------------------YFG------------------------D....
Q0VKY9_ALCBS/7-128----KMM-----------------------------------------KSN------------------------G....
Q2SDZ5_HAHCH/31-138----FLL-----------------------------------------QYG------------------------G.GY.
Q4K9A1_PSEF5/31-138----FLK-----------------------------------------ECG------------------------G.GY.
Q4KGS7_PSEF5/49-173----WLL-----------------------------------------EHN------------------------G.KA.
Q5DWB0_CLOPF/28-149----FLL-----------------------------------------SFG------------------------A.LS.
Q5WIS2_BACSK/30-150----YLK-----------------------------------------TFG------------------------A.GN.
Q7M7B0_PHOLL/28-131----VLK-----------------------------------------KIS------------------------N.IF.
Q7N9I9_PHOLL/26-145----FLQ-----------------------------------------KYG------------------------T.LS.
Q8GDM6_PHOLU/28-135----FLN-----------------------------------------NFG------------------------G.GD.

PF14567

A0KT76_SHESA/1-131----YLL-----------------------------------------HAS------------------------D-VI-
Q0VNR5_ALCBS/1-133----FLL-----------------------------------------SAS------------------------D-IV-
D4ZBL0_SHEVD/1-131----YLL-----------------------------------------YAS------------------------D-VI-
A4SRI0_AERS4/1-119----FLK-----------------------------------------TGS------------------------D-VA-
Q21KG4_SACD2/2-132----YLL-----------------------------------------HSS------------------------N-CI-
A6X428_OCHA4/5-137----FLK-----------------------------------------NVS------------------------N-AF-
A8H7F8_SHEPA/1-132----YLL-----------------------------------------YAS------------------------D-VI-
A0Y938_9GAMM/1-109----FLL-----------------------------------------RVS------------------------D-VV-
C1DFY0_AZOVD/1-133----FLL-----------------------------------------KVS------------------------D-VI-
C4S745_YERBE/5-136----ALK-----------------------------------------EVS------------------------N-VF-
B0KR80_PSEPG/1-133----FLL-----------------------------------------TVS------------------------D-VV-
Q2BMU0_9GAMM/1-131----FLL-----------------------------------------EVS------------------------D-VV-
B2C6T5_ACIBA/7-138----VLK-----------------------------------------EIS------------------------N-IF-
B8CKE3_SHEPW/1-119----FIK-----------------------------------------SGY------------------------D-LG-
E3A4U8_PSEAI/1-131----FLL-----------------------------------------LVS------------------------D-VV-
Q086X2_SHEFN/1-131----FLL-----------------------------------------YGS------------------------D-VI-
Q880E4_PSESM/5-136----FAK-----------------------------------------EAS------------------------D-SI-
B3PC71_CELJU/34-164----FLL-----------------------------------------EVS------------------------D-VV-
D4RXT0_9FIRM/2-135----FIR-----------------------------------------KYG------------------------V-LI-
A4Y9N5_SHEPC/1-119----FIK-----------------------------------------SGY------------------------D-LG-
Q12R95_SHEDO/1-131----YLM-----------------------------------------EAS------------------------D-VV-
D0WEZ4_9ACTN/5-134----YLN-----------------------------------------IYS------------------------H-GG-
A3QH89_SHELP/1-131----YLL-----------------------------------------YAS------------------------D-VI-
C1D4A4_DEIDV/3-141----YLL-----------------------------------------TLS------------------------D-VL-
A1S8W2_SHEAM/1-131----YLL-----------------------------------------NAS------------------------D-VI-
Q7M7B0_PHOLL/5-136----VLK-----------------------------------------KIS------------------------N-IF-
D1W447_9BACT/1-147----FLS-----------------------------------------QCG------------------------M-CN-

PF07348

C6RW74_VIBCL/5-179----FYA--------------------------------SQFSADMPAQWR------------------......G-RE-
B8K7V3_VIBPA/10-184----FYG--------------------------------VQYCGDMEATWN------------------......G-NE-
SYDP_SHEON/3-180----FYG--------------------------------QYFAAPVLFDST------------------......W-GT-
C3BLV0_9BACI/6-177----YYN--------------------------------SYWFLDLAGSYL------------------......E-YN-
C2X4F6_BACCE/18-189----YFN--------------------------------SYWFADLDGFIG------------------......D-HY-
SYDP_ERWCT/5-179----FYT--------------------------------AQYAGDMAAQFD------------------......S-LS-
Q6HGE7_BACHK/3-177----YFN--------------------------------SYWFLSLQGFYG------------------......S-RL-
D4I9V3_ERWAE/5-179----FYT--------------------------------SQFAGDMTASLH------------------......G-QQ-
C2QKP9_BACCE/1-174----YFN--------------------------------SYWFLELTGWVS------------------......S-YN-
SYDP_SHEPW/3-180----FYG--------------------------------SHFAASLMFDSQ------------------......W-GT-
SYDP_PHOPR/5-179----FYS--------------------------------TQFSGDMAAKFG------------------......E-IE-
B4F2E3_PROMH/4-178----YFT--------------------------------TQYAGDMQVRFD------------------......S-LN-
SYDP_PHOLL/5-180----FYT--------------------------------SQLAGDMTVTFE------------------......G-QR-
SYDP_EDWI9/5-178----FFT--------------------------------TQYAGDMRARWN------------------......E-IE-
SYDP_VIBF1/5-179----FYG--------------------------------TQYSADMTAKFE------------------......D-MN-
SYDP_ALTMD/5-178----YFT--------------------------------TYYSDNLKAKAP------------------......Q-GD-
A7GQ41_BACCN/1-173----YFN--------------------------------SYWFADLDGFIG------------------......N-HY-
A9DDC7_9GAMM/3-186----FFG--------------------------------EYFSAPLLFNCE------------------......W-GQ-
A0Y507_9GAMM/15-191----LYG--------------------------------HMYGGSVLAIID------------------......G-HQ-
SYDP_AERHH/5-179----LFG--------------------------------GWFSRPVPCLYK------------------......G-LR-
C6CEU0_DICZE/5-179----FFT--------------------------------SQFAGDMTARFE------------------......D-LE-
C3BLV7_9BACI/3-176----YFN--------------------------------SYWFAELNGFYK------------------......N-YY-
SYDP_SHELP/3-184----FYG--------------------------------RYFAAPLMFESE------------------......F-GE-
SYDP_SHEDO/3-180----FYA--------------------------------SFFSAPLQFNSP------------------......W-GE-
SYDP_SHEFN/3-180----FYG--------------------------------QYFSAPLPFTAS------------------......F-GD-
SYDP_SHEAM/3-180----FYG--------------------------------HLFGGPLQFDSP------------------......W-GE-
SYDP_COLP3/8-192----YFT--------------------------------TIFSGDIEAQSD------------------......D-GE-
SYDP_TOLAT/5-177----YYG--------------------------------HGYAGQITASFK------------------......G-LA-
SYDP_HAHCH/6-185----FYG--------------------------------SYWSDGLWCSSP------------------......F-GE-
A3WM07_9GAMM/6-183----LFG--------------------------------DWFSGDLSLAFA------------------TGETTPS-MG-
A6F6I4_9GAMM/5-184----FFG--------------------------------AYFSDHMPASFN------------------......D-EI-
SYDP_PSEA6/5-182----FYS--------------------------------RYWSDNIVAQHP------------------......S-GK-
D2U272_9ENTR/7-182----FYT--------------------------------TQLAADMRVRFQ------------------......G-RQ-
Q1ZGY9_9GAMM/5-180----FFC--------------------------------SVYSAGIPCLFE------------------......S-HP-
SYDP_PSYIN/5-180----FFC--------------------------------SAYSAGLPAVYQ------------------......D-HP-
SYDP_IDILO/4-175----LFG--------------------------------RWYAGDLALDYQ------------------......G-HT-
A4C5J8_9GAMM/3-179----FYG--------------------------------AFYSNNVPVTSH------------------......F-GQ-
C6CC04_DICDC/5-179----FFS--------------------------------CQYAGDMEAEFG------------------......D-IR-
E6WGC7_PANSA/4-178----FYT--------------------------------TQFAGDMTARFQ------------------......Q-RD-
D4GLK5_PANAM/5-179----FYT--------------------------------HQFAGDMRATHD------------------......Q-IR-
A6D8T1_9VIBR/5-179----FYG--------------------------------HQYSADMEATWH------------------......G-NE-
C9P9P0_VIBFU/5-179----FYG--------------------------------AQFSADMPARWR------------------......G-RE-
D0ICP4_VIBHO/5-179----FYA--------------------------------GQYCGDMTARFD------------------......G-LA-

PF14435

Q11UH8_CYTH3/2-179----FLSMVGLPKEAA....PYLTFNITS............FPAFVSPDDL.YDLE......................D-
C3G535_BACTU/11-190----FLIKAGFPESAP....PFLTFEPAD............NGGGIRLSEIQHEL........................-
C3BLX0_9BACI/3-181----FLSEAGLPASAA....PFIEFDNA.............TELMQNVTRK.FGM........................-
C3G534_BACTU/3-181----FLSIGGLPETPP....PYLEFTSS.............QSFVRSIINV.FHM........................-
D7C074_STRBB/3-186----LLTEVGMPQSLL....GHLYFGNVR............TDPPQTISQA.VDTGTPDK..................F-
E0QLS9_9FIRM/4-167----FSYLEDYQKMG......FSFINL.................PNKLIDI............................-
A3IE36_9BACI/4-165----FMIDIGVPKEFD....DFEFYEFTS..............FRKTVIKE............................-
D3GZ30_ECO44/1-160----IKSPLLIPYEN.....QGVTFYCD.................ELYVFD............................-
B7LQU5_ESCF3/2-167----DKVYLIQPYDN.....YALTFYHN.................TLYYFT.A..........................-
B1VPR4_STRGG/6-176----FRESVEDPRVP.....KYFDVPDE.............AIGSVYQALD.FLEPVT....................I-
C6PRK9_9CLOT/16-217----FLLKTKIEKDEFQDINIKFFNKEHGVLCDVVEWTKINDSTVTNLDEK.FVSEFLK...................D-
B8CKE1_SHEPW/1-161----FLSDIGLPEWCA....PNMFFGEE.............DCWLPELLIQ............................-
A3ZNI5_9PLAN/58-240----FLQSFGLPHTVQFSGAQELKISFAP...........LTSPIVGYNSL.IGWGIFFDSE................L-
D3E916_GEOS4/1-200----TLVHRGMPVFD.....PQEPPLG..................LLFHEA.LPL........................-
E2N2L1_CAPSP/5-173----FALLNDYPQMG.....FYFIRFPD.................ELVPM.............................-
C0DUS3_EIKCO/1-171----IAYLADYPPAR.....FHFVRLPD.................ETIDI.............................-
B5HAW8_STRPR/39-232----VARRYGLPHGDT....MCLPVPG..................SAPFS.............................-
E8RXJ9_MICSL/4-174----FPPDGALPVEVP....ILFTVDVSV.............PEVELFSTL.SIELG......................-
D1A3F0_THECD/3-170----LSPEAAIPAEVP....LLFTAYIDD..............EIKLFNVL.EIQVG......................-
Q47PK6_THEFY/247-430----ALTRFGLPSLIP....HFFVADPPH............QPPAGGLFCD.AATHLHARGTPASDPT..........L-
E4NDB7_KITSK/233-420----PLQRVGLPRELP....GFFALHLPEADGI....AEQAAPPLPDLAEY.LAGLGRGRRATAA.............A-
C9YY18_STRSW/732-910----TLVVAGLPVDMG....PFFWAQAQP............GRPVPTLAEL.AQERGVQ...................P-
B5HAJ0_STRPR/6-189----FLTEIGLPDDEE....FEITF................RMPVTFDAAF.IWDRASREARGWH.............F-
D6K842_9ACTO/6-208----LLRTVGVPDGT.....VLLRQPGED............DGLLPLVQGV.VSVGDLEDFEGFEGLEGLEGFEGFGDA-
B5I6T5_9ACTO/6-184----FLRNVGIPARPN....PWFDLVDGS............PEQARTLGDA.YDDLRERWTD................L-
E4N1Q1_KITSK/249-422----FLREVGLPEDA.....AFLALEPEI.............RWGGSLIGD.EYWVSRA...................A-
D1A5L5_THECD/6-199----FLTSVGLPNST.....AGGLVDVDEA..........FAAGLPPMSEH.EYFGSGEHGGWE..............L-
D6K293_9ACTO/144-316----FLRETGLPEAD.....RVFHPADPD............DAPLPTLTEP.PQPCE.....................L-
D6KEF7_9ACTO/214-404----FLTEVGLPGDG.....FMFYGPAP..............EPLPTLPQR.WAESRSDPRLAHLWKGDEQ.......L-
Q82D46_STRAW/203-389----FLREVGLPENG.....YWFEVDTD..............VPLPTLAEH.YADELSGAFTDGE.............L-
D9WNF8_9ACTO/13-197----FLTTVGFPAVTI....GLIRFDSTH........LRDAERRHTFDADE.LYGRRYPDD.................H-
Q2U157_ASPOR/71-266----FLINIGFPSVKL....PRIGFNSTH........LKTFADKGDSLCRY.TGEELYGIYDP...............D-

PF02393

C8CFJ8_HCMV/54-179------...QIYAR---------------------SLAADYL.--C-----CDDTLEAVGVLAVRP--------------
C8CFJ9_HCMV/42-158------....ELRD---------------------QLLDDVI.--C-----CPERLIVLGKCVIMV--------------
A8T729_HCMV/26-179------AAVTDGPE---------------------TPWGQLI.--C-----CEESLESLGVLQFST--------------
A8T728_HCMV/45-168------....TAAK---------------------QAASKLI.--C-----CREPLTPLGYAVILL--------------
D3YRX5_HCMVO/17-135------FVGKMGTV---------------------CSQGAYV.--C-----CQEYLHPFGFVEGPG--------------
D2K4G8_HCMV/126-245------YFGHLNIK---------------------GLEKTFL.--C-----CDKFLLPVGTVSRCE--------------
UL298_HCMVM/399-518------.VVRDHKT---------------------YRRFSCL.--R-----QAGRLYFIGLVSVYE--------------
B9VXJ9_HCMVT/55-169------SLTEIDLE---------------------HCQNDFF.--G-----EFRALHLIGTVSHA.--------------
D2K5D0_HCMV/11-135------.RDEGRDA---------------------QRLASYL.--C-----CPEPLRFVGSICTYN--------------
B9VXD4_HCMVT/116-247------....GVGA---------------------TDLRQLS.--P-----RDAWIVLVATVVHEV--------------
D3YRW4_HCMVO/11-132------.DFKPEDV---------------------KAWSHYL.--C-----CQTRLAFVGRFVNEG--------------
D2K4S5_HCMV/202-333------MSAADFRD---------------------LLNFIRQ.--R-----LCCEWYVVGLVGYYL--------------
D3YS52_HCMVO/180-322------APAARLAE---------------------CEMYVTL.--Q-----LRCRWYLLGAVGSYR--------------
D2K3X0_HCMV/202-332------METEQFND---------------------LLKFFVD.--R-----LCCETMIMGVVGESL--------------
A8T728_HCMV/200-332------LTEVESRR---------------------WWWAVRA.--N-----LATPWYVLGVTGRPR--------------
B8YE72_HCMV/157-296------GGSIQTME---------------------LMIRTVP.--R-----ITCYHQLLGALGHEV--------------
B9VXG6_HCMVT/274-510------PHPASLLT---------------------AVRRHLNQ--R-----LCCGWLALGAVLPAR--------------
B9VXL1_HCMVT/265-382------EDPAHGNW---------------------LKETCSL.--N-----VLQVFVVRAVPVESQ--------------
B9VXJ9_HCMVT/546-653------....ADEA---------------------NNFVIGV.--L-----EQAHFVVIGWMEP..--------------
D2K5D5_HCMV/214-331------..LSASML---------------------RRFQRSL.--Y-----TREPVMPLGEIEGAE--------------
D2K5D0_HCMV/151-256------...WSEIN---------------------DWRVMV..--.-----GSNHVEPLGWLVSP.--------------
B8YE60_HCMV/153-278------.EGGHLLR---------------------NIKTAFG.--M-----RVLGLGTVSLKGENA--------------
C8BKJ5_HCMV/34-153------QMNLSKIS---------------------WLERHCP.--P-----LDQELIMFGVIEAWE--------------
D2K595_HCMV/6-123------..LTPRDV---------------------EYWKLLV.--V-----TQGQLRVIGTIGLAN--------------
B4YEM5_9ALPH/49-167------KGQEELLE---------------------YCEALYL.--P-----QHVKMEIVGIVDDVP--------------
D2E8A7_9VIRU/5-121------WGDDDIVS---------------------AWETLFL.--P-----TPEKMVVLGAIDHID--------------
C3RWK6_9VIRU/35-153------SGETFMLE---------------------SWRVLYL.--P-----KPTQMEVLGTLENCC--------------
C3RWV3_9VIRU/65-186------SGEQYTLE---------------------SWEELYL.--P-----EPTKMEVFGVLESSK--------------
Q070N0_CPRV/47-172------GDLEHQME---------------------DWAYLYL.--P-----RPQRLAVLGSINNIL--------------
B1NFI8_ADEGX/15-131------HAGQHLKE---------------------YCEVLYL.--P-----SPKRMTVIGIVDNVI--------------
Q4KS78_ISKNV/1-104------.YDSNTIR---------------------GWSKFYL.--P-----DVVQMEVVGIVEGLP--------------
B5XAY6_SALSA/21-139------AGDGEQLE---------------------VWKDCYL.--P-----ERMEMVVIGALDDFR--------------
C3Y900_BRAFL/167-275------..ERFRVW---------------------KCSFAYV.--N-----PPEKLTVIGYLED..--------------
C3Z365_BRAFL/157-265------..ARFRLL---------------------ECSFGYV.--N-----PPEKLIVIGYLQD..--------------
C1C3V1_LITCT/15-136------SGENYRLE---------------------SWGQNFL.--P-----KPTKMKVLGIIESSS--------------
Q14VM9_9VIRU/5-123------VTRPQVVE---------------------DWNSCYL.--E-----TSVNFMVVGRCAHRS--------------

PF14433

C3WDW2_FUSMR/11-172------PFEEEDKE---------------------YELKQIPE--E.....VRDKVIPIVETG..---------------
F0KCA1_CLOAE/2-150------LNG.MLSR---------------------DCISEYEE--E....YVEEKLVVVGSL...---------------
C3BLQ7_9BACI/6-145------.....VLD---------------------SSCFGLDD--F.....IDDKVIPIGSLY..---------------
F0KCA3_CLOAE/3-152------YEDMKYYY---------------------EHNANYDE--K.....VGERTIPVCKLY..---------------
B1HSL5_LYSSC/5-144------GD...LDR---------------------RHYKRYEV--I.....IGEDLVVIGTAF..---------------
C0Z7L3_BREBN/2-133------.....DNC---------------------GSFKSEEK--Y.....AGESLVPVGMID..---------------
B7N9G4_ECOLU/6-148------GW..IDSK---------------------WITEVYEP--L.....VNKRLCPVGVGF..---------------
A8RVU3_9CLOT/13-150------.....LVN---------------------GIKNHLEE--......PISGICPAVSWR..---------------
A9B4M5_HERA2/3-169------AFS.EATF---------------------WRSHAYVQ--L.....RNLQIAPIGRLSCP---------------
C2M481_CAPGI/2-151------.....PTR---------------------EEMLYYES--.D...AGVTKLIPFGAIN..---------------
A9B4M4_HERA2/9-180------QH..ADYE---------------------AAPYWLNH--PLI.ANYGRLLCPIGSYD..---------------
A9B983_HERA2/9-180------AI...DDE---------------------DFIVYWSS--HPLVQLHGGGICPIGSYH..---------------
D1ALL2_SEBTE/5-152------ES...VFR---------------------MRVRDYEI--H.....FNKNMIPIAEVP..---------------
C2G2C6_9SPHI/5-144------GH..YDSD---------------------GDFTYYSS--I.....LGKQIFNLGYFK..---------------
A9DRL2_9FLAO/4-142------VP...RKR---------------------LKIKSYLQ--KPS.LEGNVLTFPVGFYQN.---------------
D7VVD7_9FLAO/4-136------.....FLK---------------------NNVSANLP--......FPGIYYKVGYF...---------------
D6B4A2_9ACTO/10-151------S....GQR---------------------DLAAEVES--V.....LGGDYFPIGEW...---------------
C5UVJ4_CLOBO/2-147------GDN.LDSE---------------------YFMEIFDE--Y....DIDDVVYPIGIAN..---------------
A4A0B2_9PLAN/1-122------.....ECI---------------------EECSEFEA--H.....VDTQLFPIGHCS..---------------
A2W0F4_9BURK/45-178------.....HQD---------------------EQIAAWER--A.....LDTTMIGIAEDD..---------------
B7WUX3_COMTE/6-150------FTG.EDAD---------------------DALLSWEQ--R.....LHTRLIAVAEVH..---------------
C6DGM5_PECCP/1-142------LE...LYR---------------------EQVESYEQ--I.....TQCPLVPIGECD..---------------
B7M4P5_ECO8A/11-152------NR...IFI---------------------ERVNDYIE--R.....AGYNMIPVGECS..---------------
C4GHT1_9NEIS/5-139------.....CSR---------------------EWFLEIAN--M.....VGENGLVVGSTP..---------------
D1A3E8_THECD/9-150------.....KMR---------------------PYFQRVGR--A.....AVGELYPIGSVA..---------------
D9X9L6_STRVR/182-321------.....WDA---------------------EIIDDLAE--Q.....AGVDLYPIGMRD..---------------
Q82G08_STRAW/7-151------D....GDA---------------------GNIKELGA--G.....LGVELFPVGYEA..---------------
B1VX82_STRGG/7-150------FK...GDA---------------------EEIDELAG--D.....LGVKLFPVGYDT..---------------
D6K3Y2_9ACTO/7-151------R....GAA---------------------EDVQELAD--G.....LGKKVFPIAHDT..---------------
A4X261_SALTO/97-242------G....VLA---------------------DCSEIFAE--E.....FNNPVFPLGNNA..---------------
D6K3Y4_9ACTO/15-161------.....FQL---------------------IKLDRLSA--E.....LRVALFPVGVT...---------------
B1VX84_STRGG/1-149------.....SAL---------------------RPFMLLGE--S.....LGSRMFPFGRT...---------------
D9UTG4_9ACTO/29-176------.....HLA---------------------RTLGDLGH--A.....LGTHLCPLGLDT..---------------
C4RQ15_9ACTO/292-437------.....HNA---------------------DTLADFAA--V.....LGVRLFPIGTE...---------------
A4X254_SALTO/6-153------.....RSV---------------------GTLAELAA--A.....IGAPLTPIGEEG..---------------

PF09346

SMI1_DEBHA/98-296------LKLMPIDE---------------------VMVMTEHW..R-----KVADYLNSKLLHANQTNKLQELSKLETSH
SMI2_DEBHA/142-319------LTLLDLEG---------------------IIEEYAIW..A-----KVNQRLEKQQYMFQHQQQQQQHQKATSSA
YOBM_BACSU/42-161------HNGAKIFE---------------------ILSDGENI..G-----GGLQLFSLEEIEEELKY............
A7VFJ3_9CLOT/24-132------SDGGELFL---------------------PAGVQLYG..I-----EHKPLIDVNDNSRPS..............
A1ZXR5_9BACT/30-166------YKSLSISD---------------------IYDNWRLL..T-----NLKTQGEFEHLTPWYIKEKG.........
A3KB11_9RHOB/18-152------PDEDDPER---------------------FLDRLNRP..A-----RVQELANGKTFGDGT..............
A5UTX3_ROSS1/55-202------IFSTLELV---------------------TINQNLLK..D-----FRAMLGNDPDFRDLH..............
A1C9R6_ASPCL/143-317------CMLLDCEE---------------------IVQEWKNW..R-----TVNEEFLSGSNVMNPPPLPKATASSSSTV
A0JSM0_ARTS2/15-129------YGLGLLWS---------------------TQRIASDN..A-----YFRNDADVSDSFMPF..............
SMI1_CANGA/103-288------LQLMTLDE---------------------IVAMTQRW..R-----SVADKLNKQATMSKHSSVGVSNGSSMGST
Q89MJ4_BRAJA/28-170------WPQGHWAG---------------------AVQEVLGL..R-----RDECSLVQTRQTPQW..............
Q22E93_TETTS/424-535------..VADGKF---------------------QLHDSYKT..L-----SVQQIIEQNEVNAVS..............
A7MRN6_CROS8/1-150------EGAIAFNA---------------------LFGLGTEN..E-----YCDIEYNNEELFSEL..............
E6XKE0_SHEP2/21-128------.YASDVIY---------------------GAIEPVTV..A-----DPYSHTYLPEVTCYAW.............
Q63C14_BACCZ/25-143------ASDRFFFN---------------------RFMDPFSV..S-----DFRLREDIYEYTPNID.............
Q0VKY9_ALCBS/4-130------FEIHPFYD---------------------TSDKKRIK..R-----TCNSILHETKIAREH..............
A5TTM3_FUSNP/176-315------FFDVHYIY---------------------GVDSSSDY..S-----LCGKFGHKFWIEKSK..............
Q5LEL2_BACFN/13-124------GKLGDNYI---------------------YIWAIEDV..I-----AYNHDYGIQKYLQKE..............
Q2BBP1_9BACI/47-165------YGISFVWS---------------------IEQMIKEN..L-----FFWTLHERSDFMKPL..............
Q4K9A1_PSEF5/28-140------CGGGYFAL---------------------AMLYSLDS..S-----SDFHLVQINRAHPAI..............
A7Z5R7_BACA2/23-158------LADNGNLR---------------------LGYFYGLN..N-----NDANIIKLKEDLSEQ..............
FBX3_HUMAN/121-251------PGLLGSMA---------------------LSNHYRSE..D-----LLDVDTAAGGFQQRQ..............
Q81H93_BACCR/13-142------PNQDEDSL---------------------NNLLTLDS..E-----RKISMLQTYNSIKDR..............
A6G0Q7_9DELT/31-170------NDPKRIAE---------------------GIRGTREI..D-----FSRHFANVTSWGDGRFDDG..........
Q3EQ17_BACTI/32-156------GTVLSEIH---------------------TAAQGPKQ..R-----GGSYLNDSFKKERRP..............
A1INP6_NEIMA/28-167------HVQICEVS---------------------GIGFEKEG..S-----LCGETGQKLWMEEWE..............
A6FHD8_9GAMM/19-145------TKICDLNS---------------------DISEVQDF..L-----SLEDVASLSQLYEMS..............
Q6CS49_KLULA/64-193------FDIKNFLP---------------------ISYPRFDG..D-----MTVEQAYEILVENKY..............
Q1L2J9_STRHY/18-144------NWALMPLD---------------------AVIEVYRM..Q-----MRFQEENGEDEDALV..............
A3I618_9BACI/42-194------HGQENISV---------------------LVLGSDLG..D-----YPYYLKAVEQILADAQNQRETIFERYQD.
Q47R76_THEFY/31-145------LFQGSDIH---------------------YPDCLGIN..A-----YAEEFARDDDPGLTT..............
A3ZN04_9PLAN/36-149------DDGCEIGG---------------------LDANGVYV..T-----ERLWVSDQHKRGHKH..............
A0PQE6_MYCUA/4-131------WDLHPFFD---------------------TSDKQRLK..R-----TCNDIVRETASSKEW..............
Q7M7B0_PHOLL/25-133------NIFYGTID---------------------LLSVTRDK..K-----YYGELSQALSDAREQ..............
Q3IK24_PSEHT/8-124------KDQLDISN---------------------RLECVVDY..F-----INLSLVIQISKDINQ..............
A5FAZ7_FLAJ1/185-329------NWSYDLIP---------------------FQDIAEEW..N-----SIQDLQFDEDDLPEQELDFE.........
Q92KA2_RHIME/32-167------NQRWLPLD---------------------LVLIAWED..L-----CLRYGGEVYPSRGDGRQF...........
Q4K6P0_PSEF5/56-173------SVGPGHTP---------------------IQPLLEAY..P-----GIVEIGDVDLALAGK..............
Q6HGF3_BACHK/15-125------GFSIGSGL---------------------LIYGTEHI..A-----ERNEVWEVDEYARGY..............
B4SN74_STRM5/28-184------YPGGEVCV---------------------LMLGSDVEGGG-----YPYYLRSVAQVFEDQRQWDDSIRSIYEEW
Q82RV7_STRAW/96-236------LQGQETAW---------------------LLPRKHGI..P-----PVQHLPYWDEGPHTIGR............
A1ZUI6_9BACT/29-147------IRGFTWAP---------------------GFFYSFIM..Y-----ETEMLIAPKGLWNYE..............
A9B016_HERA2/24-146------YASIDRFD---------------------ETLEVVQD..L-----IAEGLIPWLD...................
A1RPC3_SHESW/26-168------YDFLSLAS---------------------SLKFRDRM..K-----KQAQYYADYQEPEVRDPK...........
A0RE58_BACAH/19-133------CTNAEINV---------------------KNEIYIRI..L-----GPIDCIEMNEAHDIQ..............
A4X5D2_SALTO/28-164------HIGVDILA---------------------AIGHTAPF..S-----LCGELGSAFWVAEWG..............
Q1CV91_HELPH/17-134------FMVGNESY---------------------TFKHVLHF..N-----LESLFVDFMQSLKEW..............
O64025_BPSPB/23-165------YKPLEKDP---------------------WMGKGDDT..Q-----LLEGFYGLANDHNSLQKAI..........
A7GQ33_BACCN/21-130------FGSGGICG---------------------VEVLGVEG..M-----EYASVVDDTERYRKL..............
Q816C2_BACCR/16-147------HVNVSGLY---------------------GISFNENE..S-----...SILESRYLIREW..............
Q633D5_BACCZ/17-131------SNGAEGAI---------------------GENGYLQL..W-----SIDVLIQHNEGYEVK..............
Q81BA7_BACCR/48-167------FWEVHVPY---------------------ELLDIIDE..E-----NNIEYYTIIARKEHG..............
B1YF88_EXIS2/9-123------AGEWQFHP---------------------IKDEQYIK..R-----TWEDVVHVNSTDAED..............
Q9F2N4_STRCO/160-298------ELGLLVDQ---------------------PFFTVREE..A-----AVNDLVYVNKCLRDH..............
A8FAT3_BACP2/17-145------HVSFDHLR---------------------GIAKGEG....-----....IMDSDYLIEEW..............
A0R498_MYCS2/11-150------IRGIGTRF---------------------PRLEKDAW..W-----HDDEDFEPRPSDAEW..............
A4YB72_SHEPC/14-135------VQEPDDSV---------------------VLWSAKEI..S-----ELTEAYCYEQYLPGL..............
Q927J5_LISIN/124-264------CVAITGIM---------------------GIGDCGVS..T-----LNGMHNTNFWTEEWG..............
Q6HHY9_BACHK/33-185------YGENEVTV---------------------CILGSDVE..E-----YPYYLLSTQEMIESSKEGEDVSYLLEYQ.
Q7DD43_NEIMB/1-117------YDEQYSFP---------------------WWFENAES..N-----ISEVIDIYFEITGIP..............
Q82GY4_STRAW/63-178------YGNHLVSP---------------------IETIVQRN..V-----ELRS..SFSELYMAF..............
Q55KB3_CRYNB/120-282------LYFLPLEE---------------------VMREWAFW..R-----YAEDDPTVGGNPAILATMASVP.......
B8I5J3_CLOCE/15-125------GFVTDDGI---------------------AIFGTDII..A-----ERNLTYEVPEYAEGY..............
Q6HGD1_BACHK/12-154------NNHSYAVI---------------------RFLCILEAPEN-----IEIGMFDIDVTWTQLDERL..........
A5Z4Q5_9FIRM/17-131------PIGKANYL---------------------SIWPINEL..I-----ELNQEYAVDEFLPGI..............
Q4EKD7_LISMN/14-152------LLEEDFLE---------------------NEDDAFSW..N-----SFEQMSLEAAEGDTNLEN...........
A7FEI4_YERP3/10-144------IDSKDGSC---------------------VDKFLSTN.GD-----KSDSIAACYDLYKKR..............
B1KPX6_SHEWM/17-136------IGDISISG---------------------ITCENLDD..G-----GGSVLSDTLYFQRDY..............
O07689_LISSE/36-156------LFGKTIIP---------------------SDFEQIKG..T-----FSINLEEIEFFTAPLV.............
Q81B84_BACCR/8-142------ELNQEIPL---------------------DVLYGIGV..K-----KTFDLSECYEEFEED..............
Q5LEK4_BACFN/11-139------YYEVEIMR---------------------FMALNTVE..E-----KNLAQRSSDSNYINI..............
A7VE32_9CLOT/35-145------CYLAEPWI---------------------FTLKELEK..A-----YPIFQEAYEDYMSEY..............
A0RAF8_BACAH/19-149------AQRKELVA---------------------KALLSFDQ..T-----NVENIWTTYENLKNQ..............
Q3BQF4_XANC5/29-173------AEWLFPRA---------------------RLLGSAEL..F-----SFAQVRAREEYRDDAFAG...........
Q81Q97_BACAN/4-119------SGGLDGMD---------------------IHGCETTA..A-----DSSVVYHTKSYRETY..............
Q3EVG8_BACTI/12-138------NDDEGGAV---------------------FDCLLSFT..S-----KDANIEVVYELTS................
Q1DBU4_MYXXD/34-167------MEEPGFLR---------------------AAAPDPSD..A-----VNGDDPEVEEAINQA..............
A3ZX25_9PLAN/22-154------EYAVILTE---------------------DGSIAPGS..F-----FGDDLAGALNDFSER..............
A1TSU7_ACIAC/17-133------AQVGSAYF---------------------SFWRVWDI..V-----DRNISASIKKYMSPL..............
Q9F2V0_STRCO/29-155------YGLLPLLD---------------------HDPSGEPA..A-----VAQYLANRDSGAKDPD.............
B1YEY9_EXIS2/39-159------HDGAKLFM---------------------LGDEGLVL..Y-----PLEEVIEKTIEAKEDGL............
Q28UU7_JANSC/42-166------GHGAYLAP---------------------SLIHNLMF..P-----PLASVADTKAFLDDMIGYD..........
Q9CND2_PASMU/14-158------YSSFGFEG---------------------FETESNKY..E-----PPENIFAQYLYDDEI..............
Q65VI9_MANSM/10-134------DNYLYPIW---------------------AFSCLSEI..E-----DDLQLIDENWCPNGF..............
B7KWA7_METC4/14-155------HGVALALD---------------------GLRDEDSD..E-----PHRFTIEGDADAGLM..............
Q5DWB0_CLOPF/25-151------EEIFGIVS---------------------SEDLTIKG..E-----PNGIWLTLKERESSN..............
Q63F89_BACCZ/18-127------LNGHEVFG---------------------LGTSGYLN..V-----VESTLEERQFEKALT..............
A1RND9_SHESW/4-129------WEFYPIKD---------------------ISNRKRLS..R-----TCNHIINETESCQGF..............
Q3EVG9_BACTI/12-152------TNDTTKKG---------------------VITSSVSM..F-----FPLSIENEINLEEKLRSY...........
Q8F615_LEPIN/16-123------GKVGNRYL---------------------SLWKIEEL..V-----QFNEDYQIKKYIPEI..............
Q5WBD2_BACSK/23-138------SFPGDILN---------------------VSSGKTNG..N-----DTIEFTYDYEIKQGG..............
A5FGR4_FLAJ1/41-198------KMSDEFWE---------------------ESIKNIEE..N-----DDISEEDFEAELGRI..............
A6X425_OCHA4/20-140------LPKMERND---------------------PPLWQDVV..A-----VTKQLREWKQIGADR..............
Q9RYT7_DEIRA/27-166------GELLSLER---------------------MADERKVWMDL-----LQDGTFDGNASHNESSEA...........
Q5WJU2_BACSK/38-153------HNGARIYE---------------------SMYSGEPA..G-----GGLELFALDQMKEAQ..............
Q880E4_PSESM/25-133------DSIFNGKD---------------------ALRLTVDR..N-----SPRELLNVVAEAREQ..............
A5DZP7_LODEL/117-382------LKLMSLDE---------------------IMVQTENW..R-----KVSDYINNEARLENYKLNNLSKLPTSHAN
Q6HMR4_BACHK/23-143------LVLYGVDS---------------------SLLETKKD..E-----HICGFIDTNEIWYEN..............
Q8GDM6_PHOLU/25-137------ICGDEIYS---------------------IYCIPFEE..A-----IGGDLVYQNTIANNY..............
A4X269_SALTO/103-245------HHVPGRPF---------------------VLIPERPL..C-----GVHPQHPSRDLVHAQRVH...........
Q4KGS7_PSEF5/46-175------LGALEVFP---------------------VFDARDPR..K-----TWESIVRHFEGGWRAWQDN..........
A4IKF8_GEOTN/21-132------YGSGGICG---------------------VEILGIEG..N-----LGASVVKATERWRKL..............
A7RYE8_NEMVE/119-257------PGLIGSMS---------------------ISSHYQSE..S-----LLDLNVASSGLQHRD..............
A4VZJ4_STRS2/19-128------YGVISFYG---------------------TEWNGLKG..D-----TWTDVVATTLEARSLY.............
Q1CY42_MYXXD/19-141------FGTVDPAF---------------------SFFPLAEI..R-----RARVTMRKKDTDKAG..............
Q1ZQF0_PHOAS/14-166------AHRQLELY---------------------LKYYQEFS..N-----SDFVYSSEGDLPISR..............
SMI1_YARLI/171-356------ITLLDLET---------------------IAEEWYSW..K-----KAAIRINREIARATGQTPTKQGGIFINPN
A3ZX28_9PLAN/24-139------YPVFGLRG---------------------SDVMEDDR..W-----SVIDVTNEVRQSVTD..............
A6C6S9_9PLAN/31-128------........---------------------.......V..T-----NGMDLLSAELFDADS..............
Q65PK7_BACLD/18-132------FGDHLIWP---------------------ADRIIEEN..L-----DMR....CTDCFKPF..............
Q81BW2_BACCR/27-144------YGD.FIWS---------------------ASKIKTEN..M-----SMRNIVDFKDLYMPF..............
A4Y9N5_SHEPC/8-116------.SGYDLGD---------------------APIEALEI..S-----NPPSHADIFETLANARK............
Q5LEK4_BACFN/167-306------WVEINAFF---------------------PIKERTNA..F-----ETIEVIAKDIWSKNL..............
A4SRI0_AERS4/8-116------.TGSDVAN---------------------AIFEAAVI..L-----PGAGRLDIFEMARIAWE............
A3I6Z7_9BACI/22-146------TVSQPEYR---------------------DIDDSDIL..Y-----IHRLNLADEDWYKKY..............
Q2SDZ5_HAHCH/28-140------YGGGYFAF---------------------GNVFSLEA..G-----SEWNLIDINAEFAHL..............
Q0RKI3_FRAAA/56-185------LHASAEVA---------------------WFRDTPDG..T-----GFIDLYGEPRNDDEDDS............
A3ZX34_9PLAN/23-143------VVEEEVSG---------------------IEDDDPTL..E-----HRGTVYGDTLLCRED..............
A8M704_SALAI/21-139------LGTDAFFP---------------------TILEMSEW..A-----DEFFEENASNLARPK..............
B8I223_CLOCE/15-131------GSDSTAIN---------------------RMIDPGTI..A-----DIRLRKGFYESDPDLD.............
Q4PAY0_USTMA/184-339------AALLSLDQ---------------------VAQEWNFW..R-----AVDEDPETAANPQLRNLMASCP.......
Q21ED8_SACD2/11-151------QNATGPYS---------------------DSIIRYFF..A-----FSDDYDESIKHNHEAYT............
A0RAV0_BACAH/42-162------IAGQPKVG---------------------GLSDEEEY..F-----QPFDLYNFQQLYASK..............
A8FII6_BACP2/13-123------GCSVGGDV---------------------LIYGTEDI..A-----ERNATWEVHHYANGY..............
Q09D40_STIAD/24-149------LPNSPYLI---------------------LPLGEIVR..A-----RVAIFGKRKDDDQHG..............
B7X333_COMTE/152-284------APDADMDA---------------------IGPVQVVF..P-----GIADIVEMSAPQQAQA.............
Q38V57_LACSS/13-131------RFSLPTSE---------------------PTSDGLDH..V-----ECHYLAGIATGSQAVIE............
Q8NRK2_CORGL/4-116------WILHPVRD---------------------DSDRKRLV..R-----TANDIIRETESAREW..............
A5TXY3_FUSNP/37-189------YKGKTVAS---------------------YFLGSDVE..E-----YPYYLLSSSQILETKNEAYDFYADYVDR.
Q5LEK9_BACFN/11-148------YQEVEIED---------------------FFPFKYNK..D-----FKNDPRYTAEGETLELR............
Q7N9I9_PHOLL/23-147------FGGDDYYG---------------------ITKKGING..N-----QAPCILYVTKQARDS..............
Q52KV8_XENLA/36-166------PGLMGSMA---------------------LSNHYRSE..D-----FLDIDTAAGGFQRRM..............
Q6HGG3_BACHK/12-159------VEGKRKVF---------------------GTLLTYDM..D-----DDENIIEVFNDYNGT..............
A5TTY9_FUSNP/35-181------HWGLDFLL---------------------NFEESRQG..W-----VDICYPDYNDEYDKV..............
A5Z4R9_9FIRM/9-151------DLAFDFID---------------------IASNKKNS..T-----DIREFYIFYPEGESSYDDIIKV.......
A6CCT7_9PLAN/22-151------HDIFSYKD---------------------PETYQEIR..S-----CLGALISFNSEDENNILDYL.........
Q0VNR5_ALCBS/21-130------.SASDIVC---------------------GSLEPATV..M-----DDYAHNFLPEMAANSW.............
B8I222_CLOCE/15-149------ADGRRYEV---------------------EHFIPIKN..S-----NNKRSLDKVLSLHYDD.............
Q59YV1_CANAL/104-343------LKLMSLDE---------------------ITTATENW..R-----RVAGHLNEELKQNFKSGLTKLPSSHSNSN
Q93JL3_STRCO/163-310------AVGCELLP---------------------LDQLYVAD..A-----RSRPCLWQFAATDAAVTAPD.........
A0RFK3_BACAH/36-159------LFGIEQLK---------------------KSTIMEYA..Q-----MLLTVIDDDVLKESG..............
Q73QC3_TREDE/40-189------LMSLQTVT---------------------NTKEHFQN..R-----DALLTEFTDYFTNEDIENMKD........
Q4UXL8_XANC8/219-365------WECVLVDR---------------------YLSPLAQI..G-----SVLDFAAAFEDPQDFSSA...........
Q5LEK2_BACFN/47-168------YGMRKSYN---------------------RDLNATPA..P-----FGLLEPNIYEKPKNA..............
B1J8X4_PSEPW/139-260------LLLTGFVP---------------------IKYGRIPM...-----.DIAYRELVEDFPQM..............
A5FCA9_FLAJ1/44-161------..TFGIAD---------------------IGEQLQDF..E-----EVDWIKDIWSDAPQYGPDF..........
A5Z4R3_9FIRM/12-152------PFIEINPN---------------------TNIEFVQE..T-----DVEKFFSLNEMEFEYGDI...........
A5FLI6_FLAJ1/11-131------FILGGFNS---------------------IKYGKLPI...-----.ERIYKDLIEDFNNL..............
Q1C2E7_YERPA/11-153------IAAFKPFK---------------------YHKMTNDN..P-----NSLIDGCYNEMIRKN..............
A6VZI9_MARMS/37-168------FGEGFYEI---------------------GTFSNIDP..N-----AENSIFSSMSSGREW..............
A5FMA4_FLAJ1/23-172------HNSAGIID---------------------MIIAFWANDRP-----ELQEYKLLTEEQTQKI.............
A7Z7P3_BACA2/41-156------HNGARIFD---------------------LLFYGENV..G-----GGLHILNVEEIEKYMQ.............
Q39NE9_BURS3/28-182------YGGTTVNV---------------------LVLGSDVY..E-----YPYYLLSAGQMLEEGAKYRDSIAEIYGDD
A0AMA9_LISW6/21-137------IHAFSNES---------------------LIGKATVV..D-----FTLKFRDTYGESVPR..............
Q2BBP3_9BACI/17-145------SVYVNELY---------------------GIGEKSGI..I-----DSIYLRQEWGIRSKK..............
B1KH37_SHEWM/28-163------NLNGVSMS---------------------FLSMFSAA..D-----DALIGTEMWSDSKNQS.............
A4EPD0_9RHOB/35-163------PTLALLTA---------------------ITDREIDL..H-----DLSELYQPEMIVTQTLDW...........
A6CDZ7_9PLAN/19-143------FEIAGLFD---------------------SSDDSAPP..M-----WRHVVKTSVQLGRVNQ.............
Q9F3Q3_STRCO/47-179------AGTADARW---------------------HDDASGLA..D-----TFEEDLDEEAGPQERR.............
A6DN67_9BACT/17-158------ESKSEYVL---------------------TNVNLYHD..E-----KYSLYFTRSKFKKEN..............
A7ML24_CROS8/19-151------RWGMPVGG---------------------FNPIKYGP..L-----PIETLINDIFSISPADSE...........
A1ZMA9_9BACT/9-138------THRQTHVG---------------------DLDETIIV..N-----SFFSLEQIQEECKKYK.............
Q1DEQ7_MYXXD/33-153------LPDANYSI---------------------LSLEGIAA..A-----TPRLRQRAQGASETA..............
B1YF81_EXIS2/16-130------TNGAQFGE---------------------WTLYPIPTRRT-----VSIDLVRHNEKRPAG..............
Q5WC01_BACSK/21-135------RSPHITQG---------------------CNNQYEPL..P-----LEKLFIPDSTFFTTD..............
A5FJY1_FLAJ1/42-170------EYFAKFEL---------------------YNLEQLKN..Y-----NALVQQEIEGEDEAS..............
B1YEX8_EXIS2/15-147------FKNSWSDE---------------------ETGLYLPL..Y-----EFMPLTIGKFVENTSVL............
A6EFN0_9SPHI/29-161------TGLIPIHN---------------------FLSLQDAI..S-----YYHESMEFEQSFHNWTR............
Q6HGE4_BACHK/13-160------VGNVERCF---------------------GSLFSFDE..E-----SSEYIVKKYEIYKPT..............
A5UV09_ROSS1/24-144------LMIYASNE---------------------SFLQGRQD..L-----SVWGIIEANILHRSD..............
A4BCB8_9GAMM/14-147------HVPLNELF---------------------GIVTDEAV..E-----TAQNILDTEYMTEEW..............
Q11VT9_CYTH3/29-168------HVEISGIM---------------------GIGRSKTY..S-----LGGSFGSRFMIDEWG..............
A4FNW2_SACEN/30-166------VLADVLPP---------------------FYTPYSPS..A-----ALRAWRGHRELWTARWERPSCD.......
A7Z5G8_BACA2/23-137------YGSGGVYG---------------------IDLLGYDF..G-----GASVVETTREYHEYR..............
Q6NG79_CORDI/14-156------LPLDDRSE---------------------YYELSIDQ..I-----LGNGKTSSGDNNDLLTYGR..........
B1KH38_SHEWM/29-165------KLNGVSLS---------------------FLDWFRDA..I-----DVLTFTQMASEKEDK..............
Q47P53_THEFY/18-133------YGDAVVWS---------------------AERIIEDN..L-----AMRSEPDYRELYAPF..............
Q926X2_LISIN/25-149------FNGVSFYG---------------------ISKRGLSA..A-----SIPDVKFATEQARTF..............

PF14568

A0AMA9_LISW6/24-135......FAGISIHA.....FSNESL..........IGKATVVD--F-----TLKFRDTYGESVPRE--------------
A3I6Z7_9BACI/25-144......LNGGNILT.....VSQPEYRD........IDDSDILY--I-----HRLNLADEDWYKKYP--------------
A3ZX34_9PLAN/26-141......VVEEEVSG.....IE..............DDDPTLEH--R-----GTVYGDTLLCREDYS--------------
A4IKF8_GEOTN/24-130......ICGVEILG........................IEGNL--G-----ASVVKATERWRKL.G--------------
A4VZJ4_STRS2/22-126......FYGTEWNG.....LKGDTWTD........VVATTLEA--R-----SLY...ENFPKEKFI--------------
A6CDZ7_9PLAN/22-141......GVGFEIAG.....LFDSSD..........DSAPPMWR--H-----VVKTSVQLGRVNQGH--------------
A6X425_OCHA4/23-138......AGGLEVYG.....LPK.............MERNDPPL--W-----QDVVAVTKQLREWKQ--------------
A7FEI4_YERP3/13-142......PEPDGFYF....................IDSKDGSCV--D-----KFLSTNGDKSDSIAA--------------
A7GQ33_BACCN/24-128......ICGVEVLG........................VEGME--Y-----ASVVDDTERYRKL.G--------------
A7Z5G8_BACA2/26-135......VYGIDLLG.........................YDFG--G-----ASVVETTREYHEYRG--------------
A7ZAC8_BACA2/3-116......IGEWIFSP.....IRE.............QSRLQKTW--D-----DVI.RQNSVCREESM--------------
A8UFY5_9FLAO/12-126.....IPSGKEYFF.....................SFRNKELV--L-----SSL.DEVEEVKDFFR--------------
A9DRK0_9FLAO/13-128.....IKEGNLWYP...................NYVSEEGELV--L-----KKI.HRLEIAISLTE--------------
A9INX3_BART1/38-152......IGGDEVFS.....IYGDYGEG........IPAGDIVY--R-----NLL.DRKDGFATPEQ--------------
A9INY0_BART1/31-145......ICGEEILS.....VYNTNFEI........ARSDDIVY--Y-----HIT.DIENGLATPQQ--------------
A9INY3_BART1/35-149......IGSEEIFS.....IYNASFEE........HPAGDIVD--K-----NLY.HRKYGFVTLEQ--------------
A9INY6_BART1/35-148......IGGDEIFS.....LY.EHPIG........VSVNDIVY--Q-----NLN.ARKRGFMTAEQ--------------
A9INZ4_BART1/35-149......IGGEEVYS.....LYKECGAD........IPGGDIVF--Q-----NLN.DRKRGFTTPEQ--------------
B0ALZ7_BACAN/9-120......LDGMDIHG.......................CETTAA--D-----SSVVYHTKSYRETYN--------------
B1BP25_CLOPF/31-145F.....VGPSEIML.....................LSLSEDKY--L-----EKCLLSEEEVLGCGL--------------
B1KH37_SHEWM/31-161......IEDDRVNL.........NLNGVSMSFLSMFSAADDAL--I-----GTEMWSDSKNQSPRI--------------
B1KPX6_SHEWM/20-134......IGDISISG.....IT..............CENLDDGG--G-----SVL.SDTLYFQRDYD--------------
B3ZML8_BACCE/21-125......LNGHEVFG.....LGTSGYLN........VVESTLEE--R-----QFE...KALTTDYIV--------------
B4AJF6_BACPU/18-123......IGGDVLLY......................GTEDMVE--R-----NATWEVQQYASGYV.--------------
B5ULT3_BACCE/26-136......LMSEYVFP.....................GDILNVSR--G-----KTNGNDTIEFIYDYE--------------
B5UUA7_BACCE/17-130......IGEWILYP.....IKD.............NRNVTKTW--D-----DIV.RQNVDMRDEYM--------------
B7INQ5_BACC2/11-140.....KVRYSKFFV.....KELNQEIPLDV.....LYGIGVTK--T-----FDL.SECYEEFEEDM--------------
B7JLP8_BACC0/25-134......LFGVDILG........................VAKSN--I-----ASVVIETESYRDL.G--------------
B8DA94_LISMH/28-135......ICGEEIYS.....IYSIPFDE........AVGGDIVY--Q-----NVI...SSNNIMNGY--------------
B8DD33_LISMH/29-148......FKGESFYG.....VSHNGLSA........TSIPDVRY--A-----TEQ......ARVLGD--------------
B8DD37_LISMH/24-135......FGGISIHA.....FNNGSL..........IGKATVID--L-----TLKFRKIYGETISKE--------------
C2KY92_9FIRM/22-126......FGSTEWTG.....LNIQGRLN........TVTATQQE--K-----NVN...NAFPKKSFV--------------
C2M8M5_CAPGI/23-138......VCGIDFKT.....IAPPEYQE........DADIDIYY--T-----YQVNLQNNLFQKDEL--------------
C2PY06_BACCE/26-128.......NGLYVND.............................--C-----NDILHYHDRFKSF.N--------------
C2TZ07_BACCE/17-130......IGEWILYP.....IKD.............NKNVAKTW--D-----DVV.RQNIELRDEYI--------------
C2ZR32_BACCE/17-130......IGEWILYP.....IKD.............SRNLKKTW--D-----DII.RQNIEMREEDI--------------
C3BVU2_9BACI/35-154FIPGTVLSEIYIAA......................WGPKQRG--G-----SYLNDSFKKERRPTG--------------
C3WVX7_9FUSO/23-127......FLGNEWTG.....LNVDGYLN........VVNMTEEE--R-----ALN...EFFPKKYFV--------------
C4L6I6_EXISA/20-124......VDSEEIFG.....LGVEGYLN........VVETTLKE--R-----EVS...QGKLNGYIV--------------
C6ABU4_BARGA/31-145......IGYEEIMS.....VYLIDFEI........ARSDDIVY--N-----HLT.DIKNGLAKPQQ--------------
C6ABU7_BARGA/31-144......IGGEEIFS.....IYEICAG.........IPAGDIVY--R-----NLL.DRRDGFTDPKQ--------------
C6AD58_BARGA/31-144......IGSEEIFS.....VY.AEYKG........IHAGDIVY--R-----NLN.DIKNGLAKPQR--------------
C6AD60_BARGA/31-146......IAGYEIYS.....LYKECGED........IPFDDIVL--Q-----NLNYYRKHGFVTPEQ--------------
C6AEU7_BARGA/31-145......IGGYEIFS.....IYNASFDK........CPAGDIVF--Y-----HLT.DIKNGFAKPNQ--------------
C6CF14_DICZE/28-135......ICGEEIYS.....IYCLPFDE........AVGGDLVY--Q-----NVI...SSDNVSIGK--------------
C7GI90_9FIRM/31-150......FFGNEIYG.....IDPEDDSG........ILEGNSVA--Y-----ALN......DREEYN--------------
C7N7K9_SLAHD/25-127......INGTEILG........................IGMTG--K-----IMFLEETLEYRRY.G--------------
C8K547_LISMN/28-148......FGSIEIYG.....VFKEDFED........SGIPDTVW--S-----TMN......ERKLVD--------------
D0KCB2_PECWW/28-147......FNGESFYG.....ISKKGLSA........ISAPDVRY--V-----TLE......TRKLGD--------------
D0KCZ5_PECWW/26-145......FCGDTYYG.....ITQDGKEA........NEVPCVYF--S-----TVD......AREQGD--------------
D1W447_9BACT/21-143......YGDVNILG.....................IAKDENSV--T-----YSVVEVTKQMRNEVN--------------
D3EC77_GEOS4/25-144......LSGTGILM.....LAPPDVRE........YTDTDILY--I-----HRLNQDDEEWREQYP--------------
D3FRA3_BACPE/26-146......FGAQEIYG.....ILNDEFEN........SSVPDAIW--F-----TLT......ERRESN--------------
D3FRA5_BACPE/24-128......ICGVDILG........................IKGVD--Y-----ASVVEKTQQYREL.G--------------
D3I7I1_9BACT/41-148.....CYVGVDIYG.....IRSSNDLKEKT.....VVDLTKLY--K-----EAGWAIADDCY....--------------
D3I8Y5_9BACT/21-120......LKGEEIFG.....................IDVVDITL--K-----AKE.KNPDFPKDMYV--------------
D4FV91_BACNA/25-133......IYGVNILG.........................HGKV--S-----ARVVTVTEEYRTHYD--------------
D4FXH9_BACNA/26-163......LESKKTSD....EIEYDVCYKPIEKDPWMGKGDDTQL--L-----EGFYGLANDHDSLQK--------------
D4FXI0_BACNA/26-142......FNGLVIYG.....LDQELLREENDEEVYGFIETNEQW--H-----ENDEQKKY.......--------------
D4FXI1_BACNA/25-133......LFGVLVLG.........................YNFD--H-----ASVVNRTNEYKEHYG--------------
D5HHH7_9FIRM/25-128......LDGIETLG........................VGKNG--K-----MIFVEKTLEFRSY.G--------------
D5SSH7_PLAL2/27-142......IVGEEISG.....IE..............DDNPSLDY--R-----GTIYGDTMLSRTDYG--------------
D6CWW7_9BACE/84-197.....IFWDLDVRL.....................YPKPIHSW--N-----KILIENNEELQEEIL--------------
D7JDE8_9BACT/35-142......IKEKEIYG.....LRNSEMMGDDD.....IINLTKVF--R-----ENESENNDWL.....--------------
D7VC45_LACPN/26-146......FGAAEIYG.....VFTEDFEN........SGVPDAVW--A-----TLD......ERRVVK--------------
E1UUR3_BACAS/39-142......FDGIEILS.............................--.-----..L.EGIIEYNEVQD--------------
E1UUR6_BACAS/25-133......AYGTMILG.........................YDSH--G-----AEVVEQTNEYKKYYN--------------
E2MKG2_PSEUB/45-159......VGTEEIYS.....IYGMDFDD........INGGDIVF--Q-----HIN.GLKNKSTTPEK--------------
E3YTZ2_9LIST/29-148......FNGESFYG.....ISKRGLSA........ASIPDVRF--A-----TEQ......ARALGD--------------
E3ZJV4_LISIV/35-139......VLGIDVLG.....................IARNNIAT--V-----ENI...TERLRKEFN--------------
E4LF31_9FIRM/27-134......VRDTQIYG.....IHNSEFLGEDT.....IIDLNKEF--S-----DYLKDGQSNL.....--------------
E5W3S4_9BACI/29-137......SFGVEILG.........................HGLV--S-----PEVVEFTKDYRELYD--------------
E5W3S5_9BACI/24-128......ICGVEVLG........................VEGDG--Y-----ASVVEATERFRNF.G--------------
E6UJN0_RUMA7/22-127......FNGHELTG.....ISCDRNLD........VVAVTEKQ--W-----NKN...LIEEHLLYV--------------
E8K361_9STRE/11-132.....SPNHFKVDG........................KVEIF--N-----NLISLDENEYDNIYE--------------
E9SF19_RUMAL/19-157......PEEDLAYGFIDVVTNKTNDSDLRELFVFYEDEENDNF--D-----DIM.RIYKSMVNEKL--------------
F0RDN6_CELLC/80-198.......GGTWIYT......................NSIDSIR--N-----RSWLSDYRNELNEKI--------------
Q0VKY9_ALCBS/7-128.......GGVEVST...DYFEIHPFYDTSD.....KKRIKRTC--N-----SIL.HETKIAREHYR--------------
Q2SDZ5_HAHCH/31-138......FAFGNVFS.....LEAGSEWN........LIDINAEF--A-----HLRAGRV........--------------
Q4K9A1_PSEF5/31-138......FALAMLYS.....LDSSSDFH........LVQINRAH--P-----AITGRHL........--------------
Q4KGS7_PSEF5/49-173......LGALEVFP.....VFDARDP.........RKTWESIV--R-----HFEGGWRAWQDNVCA--------------
Q5DWB0_CLOPF/28-149......FNGEEIFG....IVSSEDLTI........KGEPNGIW--L-----TLK......ERESSN--------------
Q5WIS2_BACSK/30-150......FGAQEIYG.....IIDADFEN........SSVPDAIW--Y-----TLT......ERKEIR--------------
Q7M7B0_PHOLL/28-131......YGTIDLLS.....................VTRDKKYY--G-----ELS..QALSDAREQG--------------
Q7N9I9_PHOLL/26-145......FGGDDYYG.....ITKKGING........NQAPCILY--V-----TKQ......ARDSGD--------------
Q8GDM6_PHOLU/28-135......ICGDEIYS.....IYCIPFEE........AIGGDLVY--Q-----NTI...ANNYLNEGR--------------

PF14567

A0KT76_SHESA/1-131------YGAIEPVT---------------------AADPYSHT--Y-----..LPEVTCYAWS.IG--------------
Q0VNR5_ALCBS/1-133------CGSLEPAT---------------------VMDDYAHN--F-----..LPEMAANSWN.QG--------------
D4ZBL0_SHEVD/1-131------YGSLEPVT---------------------ASDPYSHT--Y-----..LAEVTAYAWS.IG--------------
A4SRI0_AERS4/1-119------NAIFEAAV---------------------ILPGAGRL--D-----..IFEMARIAWEIIG--------------
Q21KG4_SACD2/2-132------YGRLEPVT---------------------VADRNSHT--Y-----..LPEVAAEAWS.RG--------------
A6X428_OCHA4/5-137------VGYLSPLI---------------------LNEEMGGV--Y-----GELLTTIQQARS.VG--------------
A8H7F8_SHEPA/1-132------CGSLEPVT---------------------ASDPNSHT--Y-----..LSEVTSYAWS.IG--------------
A0Y938_9GAMM/1-109------CGSIEPVT---------------------VADVNSHT--Y-----..LPEVAAMAWS.LG--------------
C1DFY0_AZOVD/1-133------YGSLEPVT---------------------VSDPQSHT--Y-----..LPEVAAVAWD.QG--------------
C4S745_YERBE/5-136------YGTVELLS---------------------VTKD.GNY--Y-----GELAQALRDAKE.QG--------------
B0KR80_PSEPG/1-133------YGSLEPVT---------------------CTDPQSHT--Y-----..LPEVAATAWD.AG--------------
Q2BMU0_9GAMM/1-131------FGSIEPAT---------------------VTDSSSHT--F-----..LPEMAATAWD.RG--------------
B2C6T5_ACIBA/7-138------YGTIELAS---------------------LTDE.KEC--Y-----RGLSQILNDARE.QG--------------
B8CKE3_SHEPW/1-119------DAPLEALE---------------------IVDPPSYA--D-----..IYEALESARKFYD--------------
E3A4U8_PSEAI/1-131------YGRLEPVT---------------------VTDPHSHT--Y-----..LPEVAATAWD.LG--------------
Q086X2_SHEFN/1-131------YGTLEPVT---------------------AADPSSHT--Y-----..LPEVACYAWS.IG--------------
Q880E4_PSESM/5-136------FNGKDALR---------------------LTVD.RNS--P-----RELLNVVAEARE.QG--------------
B3PC71_CELJU/34-164------YGSIEPVT---------------------AADPHSHT--Y-----..LPEVTATAWS.LG--------------
D4RXT0_9FIRM/2-135------GYGVEIVA---------------------CGRN.GHS--R-----..LVEDTLRFRK.NG--------------
A4Y9N5_SHEPC/1-119------DAPIEALE---------------------ISNPPSHA--D-----..IFETLANARKYFQ--------------
Q12R95_SHEDO/1-131------YGHIEPVT---------------------ASDPQSHT--Y-----..LPEVTCYAWS.IG--------------
D0WEZ4_9ACTN/5-134------IG.FEILG---------------------VGFDGSIS--F-----..LEETLEYRED..G--------------
A3QH89_SHELP/1-131------HGTLEPVT---------------------AADPYAHT--Y-----..LPEVTSYAWS.IG--------------
C1D4A4_DEIDV/3-141------AGAYWPLV---------------------IHHELTGG--R-----..LLDQTRDLRA.IG--------------
A1S8W2_SHEAM/1-131------VGSLEPVT---------------------VADPHSHT--Y-----..LSEVAAYAWS.IG--------------
Q7M7B0_PHOLL/5-136------YGTIDLLS---------------------VTRD.KKY--Y-----GELSQALSDARE.QG--------------
D1W447_9BACT/1-147------YGDVNILG---------------------IAKDENSV--T-----YSVVEVTKQMRNEVN--------------

PF07348

C6RW74_VIBCL/5-179------LTLLQVWS---------------------EDDFTRLQ--E-----NILGHLVMQRRLKQK--------------
B8K7V3_VIBPA/10-184------LTLLQVWS---------------------DDDFVRLQ--E-----NILGHLVTQRRLKLK--------------
SYDP_SHEON/3-180------GELLQVWN---------------------EADFDALQ--Q-----NIIGHLMMKQKLKQP--------------
C3BLV0_9BACI/6-177------IELNPVIP---------------------GIELRDFY--T-----FLQDYKKAH..HNEL--------------
C2X4F6_BACCE/18-189------ISLEAVLP---------------------NKELDSFK--E-----KLEGYEKN...HCKL--------------
SYDP_ERWCT/5-179------CQLLQVWS---------------------EEDFTRMQ--E-----NLIGHLLTQKRLKLT--------------
Q6HGE7_BACHK/3-177------VNLEPIEP---------------------CKSILEFF--E-----VMKQYEENN..RREF--------------
D4I9V3_ERWAE/5-179------ISLLQTWS---------------------EDDFLRVQ--E-----NLIGHLLMKRRLKQS--------------
C2QKP9_BACCE/1-174------INLHPVIP---------------------GIEPDYFI--S-----LVKDYAESK..EDIF--------------
SYDP_SHEPW/3-180------GELLQAWS---------------------QSDFEHLQ--Q-----NMIGHLMMKKKLKQE--------------
SYDP_PHOPR/5-179------LDLLQVFS---------------------EQDGVRLQ--E-----NILGHLVTQRRLKLK--------------
B4F2E3_PROMH/4-178------FTLLQIWS---------------------EEDFIRLQ--E-----NMIGHLVTQKRLKLT--------------
SYDP_PHOLL/5-180------LSLIQVWS---------------------EDDFIRLQ--E-----NLIGHLVTQKRLKLS--------------
SYDP_EDWI9/5-178------MDLVQVWS---------------------VEDLHRLQ--E-----NQIGHLVTQRRLKLS--------------
SYDP_VIBF1/5-179------IELLQVWS---------------------DEDLERLQ--G-----NMLGHLVMQRRLKLV--------------
SYDP_ALTMD/5-178------CELLQVFN---------------------REDFERLQ--Q-----NLIGHLLMKQRLNQA--------------
A7GQ41_BACCN/1-173------IRLEPVLP---------------------NIELDSFE--S-----NLEGYKNN...HNKV--------------
A9DDC7_9GAMM/3-186------GELLQVWN---------------------QTDFEYLQ--Q-----NMIGHLMMKKKLKQA--------------
A0Y507_9GAMM/15-191------IELLQAWN---------------------SDDFDMLQ--Q-----NITGHVLMKRKLKQP--------------
SYDP_AERHH/5-179------LEFVLPWN---------------------EADLDLLK--E-----NLIGHLLMLRKLKRS--------------
C6CEU0_DICZE/5-179------CTLLQVWS---------------------EDDFIRLQ--E-----NLIGHLLTQKRLKLS--------------
C3BLV7_9BACI/3-176------IELEAVLP---------------------NIELHSFK--E-----RLKGYKGNHQ..ERL--------------
SYDP_SHELP/3-184------GELLQPWN---------------------QQDFEYLQ--Q-----NLIGHLMMKQKLKQP--------------
SYDP_SHEDO/3-180------GELLLAWS---------------------LEDFEYLQ--Q-----NIIGHLLMKQKLKQA--------------
SYDP_SHEFN/3-180------GELLQAWN---------------------QDDFENLQ--Q-----NVIGHLIMKKKLKQP--------------
SYDP_SHEAM/3-180------GELIQIWN---------------------EDDFVLLQ--Q-----NILGHLMMKKQLKQP--------------
SYDP_COLP3/8-192------LSLLFAWN---------------------KDDFERLQ--E-----NIIGHILMKQKLKQV--------------
SYDP_TOLAT/5-177------VTLVQPWN---------------------EEDFERLQ--Q-----NLVAHVLMLRRLKLP--------------
SYDP_HAHCH/6-185------ISLIQLWN---------------------EDDMETLR--E-----NLLGHAFQKSKRRQG--------------
A3WM07_9GAMM/6-183------FELLMPQC---------------------QEDAERLL--Q-----NLTGHILMKRKLKQP--------------
A6F6I4_9GAMM/5-184------IELVQVWS---------------------ADDFDRLQ--E-----NMIAHLMMKKTLKQP--------------
SYDP_PSEA6/5-182------LQILQAWN---------------------EEDFERLQ--Q-----NIVGHILMKRRLRQP--------------
D2U272_9ENTR/7-182------LDLIQVWN---------------------MTDFTRLQ--K-----NLIAHLITQKRHRLT--------------
Q1ZGY9_9GAMM/5-180------IELIQVWN---------------------EEDFQLLQ--E-----NMIAHFMMQKKLGKP--------------
SYDP_PSYIN/5-180------IELIQAWN---------------------DEDFNLLQ--E-----NMLAHFMMQKRLKQP--------------
SYDP_IDILO/4-175------ISLLQTQS---------------------AEDGERLL--E-----NITGHILMKRRLKQP--------------
A4C5J8_9GAMM/3-179------FELLQAWN---------------------EDDFERLQ--Q-----NITGHILMKRKLKQP--------------
C6CC04_DICDC/5-179------CSLLQVWS---------------------EEDFIRMQ--E-----NLIGHLLTQKRLKLS--------------
E6WGC7_PANSA/4-178------ITLLQVWS---------------------EDDFTRLQ--E-----NLIGHLVMKRRLKQS--------------
D4GLK5_PANAM/5-179------LTLLQVWS---------------------EEDFVRLQ--E-----NLIGHLVMQRRLKQA--------------
A6D8T1_9VIBR/5-179------LTLLQVWS---------------------DDDFTRLQ--E-----NILGHLVTQRRLKLK--------------
C9P9P0_VIBFU/5-179------LTLLQVWS---------------------DADFQRLQ--E-----NILGHLVMQRRLKHK--------------
D0ICP4_VIBHO/5-179------LEIVQVWS---------------------DEDLPRLQ--E-----NMLGHLLMQKRLKQN--------------

PF14435

Q11UH8_CYTH3/2-179------RPDLSDWF---------------------IIGETGN...S-----DPICIDPMGGYRICY--------------
C3G535_BACTU/11-190------GTMYDKFI---------------------YFGFTGS...G-----NPICIDE.SKSQLVY--------------
C3BLX0_9BACI/3-181------PIDFEFYW---------------------FIGTTGS...G-----DPLCIDE.RTNKVVY--------------
C3G534_BACTU/3-181------PEEFRKYW---------------------YLGTTSS...G-----DPICIIE.KQEKIVF--------------
D7C074_STRBB/3-186------PPEVRDDI---------------------VIAAGM....G-----GFACMSR.ADYRIYW--------------
E0QLS9_9FIRM/4-167------SDGQDTYS---------------------LFGECF....L-----GYFVID..KEGKVLL--------------
A3IE36_9BACI/4-165------....VQFI---------------------KVGNCSSY..E-----YGLYLKE.GSDELFT--------------
D3GZ30_ECO44/1-160------...SDGYI---------------------VFGHDL....D-----GYFIVSV.KNKKVYY--------------
B7LQU5_ESCF3/2-167------..NSKRYI---------------------VFGHDL....E-----GHFAIEE.KSRKIYH--------------
B1VPR4_STRGG/6-176------GA.HGEFV---------------------KFGSTGL...F-----GSILWDP.RTGHVVQ--------------
C6PRK9_9CLOT/16-217------LEKFRSYY---------------------VVADNLDS..G-----NLIAIQE.VTGEIYE--------------
B8CKE1_SHEPW/1-161------...NEKLA---------------------VLGSDRD...D-----NHICIST.TSNEVFR--------------
A3ZNI5_9PLAN/58-240------DARLGEQL---------------------VIGQEDSAAGV-----ASLCVDR.ITGVVNR--------------
D3E916_GEOS4/1-200------QDIHGAYI---------------------AIGREIWS.EG-----LHVAIQK.DTGGVWA--------------
E2N2L1_CAPSP/5-173------QQQGQHFQ---------------------CFEKCCY....-----GYFVLN..TKGNVYL--------------
C0DUS3_EIKCO/1-171------QTPRGEAR---------------------CFGKYGY...G-----GSYFVVA.ADDAVWL--------------
B5HAW8_STRPR/39-232------.RVAGRFW---------------------SLGLTDTW.PA-----PEYVLD..ETGRVWV--------------
E8RXJ9_MICSL/4-174------DQGPRPYV---------------------VLGASPED.PA-----LLFCLDA.GTGAVIL--------------
D1A3F0_THECD/3-170------DNEPMGLL---------------------ALGAVPDE..K-----MYYCLDG.DTGRVLL--------------
Q47PK6_THEFY/247-430------AATLGEYV---------------------RIGSDG....G-----SVVAVRR.AEPDAGT--------------
E4NDB7_KITSK/233-420------RAALLGQR---------------------LIGTDG....W-----ALLTVDT.AQGRVRA--------------
C9YY18_STRSW/732-910------AADAGSYL---------------------VMGSDF....G-----KALCVQY.GTANIVA--------------
B5HAJ0_STRPR/6-189------PAGVESVV---------------------KIGAFP....I-----NAVVIDP.NTGVVYQ--------------
D6K842_9ACTO/6-208------AGGVGGWP---------------------VIGWLL....H-----AHLVLDP.ASGTVYA--------------
B5I6T5_9ACTO/6-184------PEGAEGWL---------------------LLGMVP....Y-----DDIALDG.VSGVVYC--------------
E4N1Q1_KITSK/249-422------PLDATAWL---------------------PLGRFG....E-----DSFHLDT.VTGRVHN--------------
D1A5L5_THECD/6-199------PAMCADFL---------------------LLGDWNSA.VL-----GVVGLNP.RTGAVYV--------------
D6K293_9ACTO/144-316------PPAADRLI---------------------RLGDLTG...D-----AEAVLDG.ATGEVWL--------------
D6KEF7_9ACTO/214-404------PPDAEHLV---------------------VLGGLVH...D-----FEVLIDG.RTGALFY--------------
Q82D46_STRAW/203-389------PAGADHLI---------------------RLGHLLE...D-----TSLVVDG.ATGAVLC--------------
D9WNF8_9ACTO/13-197------SPPESFCF---------------------CFGTRY....E-----DMLMLAG.ALGDIDL--------------
Q2U157_ASPOR/71-266------DEVPALSF---------------------CLGEVY....T-----QLVMLEN.EHGHVFW--------------

PF02393

C8CFJ8_HCMV/54-179--------PDSDLTRNTKQ.............................................................
C8CFJ9_HCMV/42-158--------EDH.....................................................................
A8T729_HCMV/26-179--------TVLPRVHGPRSSSEDEDSDDDDFFVYVEEIEP........................................
A8T728_HCMV/45-168--------PEPRRDHHDG..............................................................
D3YRX5_HCMVO/17-135--------F.......................................................................
D2K4G8_HCMV/126-245--------AI......................................................................
UL298_HCMVM/399-518--------CVPD....................................................................
B9VXJ9_HCMVT/55-169--------........................................................................
D2K5D0_HCMV/11-135--------FLKHKG..................................................................
B9VXD4_HCMVT/116-247--------DPAADPTVGDKAGHPEGL......................................................
D3YRW4_HCMVO/11-132--------VLSPD...................................................................
D2K4S5_HCMV/202-333--------AYGP....................................................................
D3YS52_HCMVO/180-322--------AGGF....................................................................
D2K3X0_HCMV/202-332--------PSGV....................................................................
A8T728_HCMV/200-332--------PGRS....................................................................
B8YE72_HCMV/157-296--------PERK....................................................................
B9VXG6_HCMVT/274-510--------WLGCAAGPATMTAGTTAMATGTTLPAGASGTETEAAGGDAPCAIAGAVGSAVTLPPQPYGAAGGSAVCVPNA
B9VXL1_HCMVT/265-382--------........................................................................
B9VXJ9_HCMVT/546-653--------........................................................................
D2K5D5_HCMV/214-331--------DKT.....................................................................
D2K5D0_HCMV/151-256--------........................................................................
B8YE60_HCMV/153-278--------PFPHLR..................................................................
C8BKJ5_HCMV/34-153--------EASV....................................................................
D2K595_HCMV/6-123--------LF......................................................................
B4YEM5_9ALPH/49-167--------CLA.....................................................................
D2E8A7_9VIRU/5-121--------GE......................................................................
C3RWK6_9VIRU/35-153--------GIP.....................................................................
C3RWV3_9VIRU/65-186--------GMA.....................................................................
Q070N0_CPRV/47-172--------GTVNSIRQME..............................................................
B1NFI8_ADEGX/15-131--------SFA.....................................................................
Q4KS78_ISKNV/1-104--------C.......................................................................
B5XAY6_SALSA/21-139--------CSA.....................................................................
C3Y900_BRAFL/167-275--------........................................................................
C3Z365_BRAFL/157-265--------........................................................................
C1C3V1_LITCT/15-136--------GML.....................................................................
Q14VM9_9VIRU/5-123--------VQ......................................................................

PF14433

C3WDW2_FUSMR/11-172--------------------------------------------------------------------------------
F0KCA1_CLOAE/2-150--------------------------------------------------------------------------------
C3BLQ7_9BACI/6-145--------------------------------------------------------------------------------
F0KCA3_CLOAE/3-152--------------------------------------------------------------------------------
B1HSL5_LYSSC/5-144--------------------------------------------------------------------------------
C0Z7L3_BREBN/2-133--------------------------------------------------------------------------------
B7N9G4_ECOLU/6-148--------------------------------------------------------------------------------
A8RVU3_9CLOT/13-150--------------------------------------------------------------------------------
A9B4M5_HERA2/3-169--------------------------------------------------------------------------------
C2M481_CAPGI/2-151--------------------------------------------------------------------------------
A9B4M4_HERA2/9-180--------------------------------------------------------------------------------
A9B983_HERA2/9-180--------------------------------------------------------------------------------
D1ALL2_SEBTE/5-152--------------------------------------------------------------------------------
C2G2C6_9SPHI/5-144--------------------------------------------------------------------------------
A9DRL2_9FLAO/4-142--------------------------------------------------------------------------------
D7VVD7_9FLAO/4-136--------------------------------------------------------------------------------
D6B4A2_9ACTO/10-151--------------------------------------------------------------------------------
C5UVJ4_CLOBO/2-147--------------------------------------------------------------------------------
A4A0B2_9PLAN/1-122--------------------------------------------------------------------------------
A2W0F4_9BURK/45-178--------------------------------------------------------------------------------
B7WUX3_COMTE/6-150--------------------------------------------------------------------------------
C6DGM5_PECCP/1-142--------------------------------------------------------------------------------
B7M4P5_ECO8A/11-152--------------------------------------------------------------------------------
C4GHT1_9NEIS/5-139--------------------------------------------------------------------------------
D1A3E8_THECD/9-150--------------------------------------------------------------------------------
D9X9L6_STRVR/182-321--------------------------------------------------------------------------------
Q82G08_STRAW/7-151--------------------------------------------------------------------------------
B1VX82_STRGG/7-150--------------------------------------------------------------------------------
D6K3Y2_9ACTO/7-151--------------------------------------------------------------------------------
A4X261_SALTO/97-242--------------------------------------------------------------------------------
D6K3Y4_9ACTO/15-161--------------------------------------------------------------------------------
B1VX84_STRGG/1-149--------------------------------------------------------------------------------
D9UTG4_9ACTO/29-176--------------------------------------------------------------------------------
C4RQ15_9ACTO/292-437--------------------------------------------------------------------------------
A4X254_SALTO/6-153--------------------------------------------------------------------------------

PF09346

SMI1_DEBHA/98-296ANSSQLKFSSSNLDLIE...............................................................
SMI2_DEBHA/142-319DASETHGH........................................................................
YOBM_BACSU/42-161................................................................................
A7VFJ3_9CLOT/24-132................................................................................
A1ZXR5_9BACT/30-166................................................................................
A3KB11_9RHOB/18-152................................................................................
A5UTX3_ROSS1/55-202................................................................................
A1C9R6_ASPCL/143-317PPPQATN.........................................................................
A0JSM0_ARTS2/15-129................................................................................
SMI1_CANGA/103-288ASIGSSSQQQR.....................................................................
Q89MJ4_BRAJA/28-170................................................................................
Q22E93_TETTS/424-535................................................................................
A7MRN6_CROS8/1-150................................................................................
E6XKE0_SHEP2/21-128................................................................................
Q63C14_BACCZ/25-143................................................................................
Q0VKY9_ALCBS/4-130................................................................................
A5TTM3_FUSNP/176-315................................................................................
Q5LEL2_BACFN/13-124................................................................................
Q2BBP1_9BACI/47-165................................................................................
Q4K9A1_PSEF5/28-140................................................................................
A7Z5R7_BACA2/23-158................................................................................
FBX3_HUMAN/121-251................................................................................
Q81H93_BACCR/13-142................................................................................
A6G0Q7_9DELT/31-170................................................................................
Q3EQ17_BACTI/32-156................................................................................
A1INP6_NEIMA/28-167................................................................................
A6FHD8_9GAMM/19-145................................................................................
Q6CS49_KLULA/64-193................................................................................
Q1L2J9_STRHY/18-144................................................................................
A3I618_9BACI/42-194................................................................................
Q47R76_THEFY/31-145................................................................................
A3ZN04_9PLAN/36-149................................................................................
A0PQE6_MYCUA/4-131................................................................................
Q7M7B0_PHOLL/25-133................................................................................
Q3IK24_PSEHT/8-124................................................................................
A5FAZ7_FLAJ1/185-329................................................................................
Q92KA2_RHIME/32-167................................................................................
Q4K6P0_PSEF5/56-173................................................................................
Q6HGF3_BACHK/15-125................................................................................
B4SN74_STRM5/28-184................................................................................
Q82RV7_STRAW/96-236................................................................................
A1ZUI6_9BACT/29-147................................................................................
A9B016_HERA2/24-146................................................................................
A1RPC3_SHESW/26-168................................................................................
A0RE58_BACAH/19-133................................................................................
A4X5D2_SALTO/28-164................................................................................
Q1CV91_HELPH/17-134................................................................................
O64025_BPSPB/23-165................................................................................
A7GQ33_BACCN/21-130................................................................................
Q816C2_BACCR/16-147................................................................................
Q633D5_BACCZ/17-131................................................................................
Q81BA7_BACCR/48-167................................................................................
B1YF88_EXIS2/9-123................................................................................
Q9F2N4_STRCO/160-298................................................................................
A8FAT3_BACP2/17-145................................................................................
A0R498_MYCS2/11-150................................................................................
A4YB72_SHEPC/14-135................................................................................
Q927J5_LISIN/124-264................................................................................
Q6HHY9_BACHK/33-185................................................................................
Q7DD43_NEIMB/1-117................................................................................
Q82GY4_STRAW/63-178................................................................................
Q55KB3_CRYNB/120-282................................................................................
B8I5J3_CLOCE/15-125................................................................................
Q6HGD1_BACHK/12-154................................................................................
A5Z4Q5_9FIRM/17-131................................................................................
Q4EKD7_LISMN/14-152................................................................................
A7FEI4_YERP3/10-144................................................................................
B1KPX6_SHEWM/17-136................................................................................
O07689_LISSE/36-156................................................................................
Q81B84_BACCR/8-142................................................................................
Q5LEK4_BACFN/11-139................................................................................
A7VE32_9CLOT/35-145................................................................................
A0RAF8_BACAH/19-149................................................................................
Q3BQF4_XANC5/29-173................................................................................
Q81Q97_BACAN/4-119................................................................................
Q3EVG8_BACTI/12-138................................................................................
Q1DBU4_MYXXD/34-167................................................................................
A3ZX25_9PLAN/22-154................................................................................
A1TSU7_ACIAC/17-133................................................................................
Q9F2V0_STRCO/29-155................................................................................
B1YEY9_EXIS2/39-159................................................................................
Q28UU7_JANSC/42-166................................................................................
Q9CND2_PASMU/14-158................................................................................
Q65VI9_MANSM/10-134................................................................................
B7KWA7_METC4/14-155................................................................................
Q5DWB0_CLOPF/25-151................................................................................
Q63F89_BACCZ/18-127................................................................................
A1RND9_SHESW/4-129................................................................................
Q3EVG9_BACTI/12-152................................................................................
Q8F615_LEPIN/16-123................................................................................
Q5WBD2_BACSK/23-138................................................................................
A5FGR4_FLAJ1/41-198................................................................................
A6X425_OCHA4/20-140................................................................................
Q9RYT7_DEIRA/27-166................................................................................
Q5WJU2_BACSK/38-153................................................................................
Q880E4_PSESM/25-133................................................................................
A5DZP7_LODEL/117-382NGQYQKKIGLGVGVNTSSTTNLININNNNNNSSNNNNNNNNSNNNINNNNSNNNNINTSEMSSRRTSFDLSQVESRSSTS
Q6HMR4_BACHK/23-143................................................................................
Q8GDM6_PHOLU/25-137................................................................................
A4X269_SALTO/103-245................................................................................
Q4KGS7_PSEF5/46-175................................................................................
A4IKF8_GEOTN/21-132................................................................................
A7RYE8_NEMVE/119-257................................................................................
A4VZJ4_STRS2/19-128................................................................................
Q1CY42_MYXXD/19-141................................................................................
Q1ZQF0_PHOAS/14-166................................................................................
SMI1_YARLI/171-356AGSPNSSTPGSPV...................................................................
A3ZX28_9PLAN/24-139................................................................................
A6C6S9_9PLAN/31-128................................................................................
Q65PK7_BACLD/18-132................................................................................
Q81BW2_BACCR/27-144................................................................................
A4Y9N5_SHEPC/8-116................................................................................
Q5LEK4_BACFN/167-306................................................................................
A4SRI0_AERS4/8-116................................................................................
A3I6Z7_9BACI/22-146................................................................................
Q2SDZ5_HAHCH/28-140................................................................................
Q0RKI3_FRAAA/56-185................................................................................
A3ZX34_9PLAN/23-143................................................................................
A8M704_SALAI/21-139................................................................................
B8I223_CLOCE/15-131................................................................................
Q4PAY0_USTMA/184-339................................................................................
Q21ED8_SACD2/11-151................................................................................
A0RAV0_BACAH/42-162................................................................................
A8FII6_BACP2/13-123................................................................................
Q09D40_STIAD/24-149................................................................................
B7X333_COMTE/152-284................................................................................
Q38V57_LACSS/13-131................................................................................
Q8NRK2_CORGL/4-116................................................................................
A5TXY3_FUSNP/37-189................................................................................
Q5LEK9_BACFN/11-148................................................................................
Q7N9I9_PHOLL/23-147................................................................................
Q52KV8_XENLA/36-166................................................................................
Q6HGG3_BACHK/12-159................................................................................
A5TTY9_FUSNP/35-181................................................................................
A5Z4R9_9FIRM/9-151................................................................................
A6CCT7_9PLAN/22-151................................................................................
Q0VNR5_ALCBS/21-130................................................................................
B8I222_CLOCE/15-149................................................................................
Q59YV1_CANAL/104-343QLTRKFTSTSNNADTSLNSIGAINDIDMANIGQDPISTRS.....................SIDISTTTSRTSSTHSTNT
Q93JL3_STRCO/163-310................................................................................
A0RFK3_BACAH/36-159................................................................................
Q73QC3_TREDE/40-189................................................................................
Q4UXL8_XANC8/219-365................................................................................
Q5LEK2_BACFN/47-168................................................................................
B1J8X4_PSEPW/139-260................................................................................
A5FCA9_FLAJ1/44-161................................................................................
A5Z4R3_9FIRM/12-152................................................................................
A5FLI6_FLAJ1/11-131................................................................................
Q1C2E7_YERPA/11-153................................................................................
A6VZI9_MARMS/37-168................................................................................
A5FMA4_FLAJ1/23-172................................................................................
A7Z7P3_BACA2/41-156................................................................................
Q39NE9_BURS3/28-182................................................................................
A0AMA9_LISW6/21-137................................................................................
Q2BBP3_9BACI/17-145................................................................................
B1KH37_SHEWM/28-163................................................................................
A4EPD0_9RHOB/35-163................................................................................
A6CDZ7_9PLAN/19-143................................................................................
Q9F3Q3_STRCO/47-179................................................................................
A6DN67_9BACT/17-158................................................................................
A7ML24_CROS8/19-151................................................................................
A1ZMA9_9BACT/9-138................................................................................
Q1DEQ7_MYXXD/33-153................................................................................
B1YF81_EXIS2/16-130................................................................................
Q5WC01_BACSK/21-135................................................................................
A5FJY1_FLAJ1/42-170................................................................................
B1YEX8_EXIS2/15-147................................................................................
A6EFN0_9SPHI/29-161................................................................................
Q6HGE4_BACHK/13-160................................................................................
A5UV09_ROSS1/24-144................................................................................
A4BCB8_9GAMM/14-147................................................................................
Q11VT9_CYTH3/29-168................................................................................
A4FNW2_SACEN/30-166................................................................................
A7Z5G8_BACA2/23-137................................................................................
Q6NG79_CORDI/14-156................................................................................
B1KH38_SHEWM/29-165................................................................................
Q47P53_THEFY/18-133................................................................................
Q926X2_LISIN/25-149................................................................................

PF14568

A0AMA9_LISW6/24-135--------------------------------------------------------------------------------
A3I6Z7_9BACI/25-144--------------------------------------------------------------------------------
A3ZX34_9PLAN/26-141--------------------------------------------------------------------------------
A4IKF8_GEOTN/24-130--------------------------------------------------------------------------------
A4VZJ4_STRS2/22-126--------------------------------------------------------------------------------
A6CDZ7_9PLAN/22-141--------------------------------------------------------------------------------
A6X425_OCHA4/23-138--------------------------------------------------------------------------------
A7FEI4_YERP3/13-142--------------------------------------------------------------------------------
A7GQ33_BACCN/24-128--------------------------------------------------------------------------------
A7Z5G8_BACA2/26-135--------------------------------------------------------------------------------
A7ZAC8_BACA2/3-116--------------------------------------------------------------------------------
A8UFY5_9FLAO/12-126--------------------------------------------------------------------------------
A9DRK0_9FLAO/13-128--------------------------------------------------------------------------------
A9INX3_BART1/38-152--------------------------------------------------------------------------------
A9INY0_BART1/31-145--------------------------------------------------------------------------------
A9INY3_BART1/35-149--------------------------------------------------------------------------------
A9INY6_BART1/35-148--------------------------------------------------------------------------------
A9INZ4_BART1/35-149--------------------------------------------------------------------------------
B0ALZ7_BACAN/9-120--------------------------------------------------------------------------------
B1BP25_CLOPF/31-145--------------------------------------------------------------------------------
B1KH37_SHEWM/31-161--------------------------------------------------------------------------------
B1KPX6_SHEWM/20-134--------------------------------------------------------------------------------
B3ZML8_BACCE/21-125--------------------------------------------------------------------------------
B4AJF6_BACPU/18-123--------------------------------------------------------------------------------
B5ULT3_BACCE/26-136--------------------------------------------------------------------------------
B5UUA7_BACCE/17-130--------------------------------------------------------------------------------
B7INQ5_BACC2/11-140--------------------------------------------------------------------------------
B7JLP8_BACC0/25-134--------------------------------------------------------------------------------
B8DA94_LISMH/28-135--------------------------------------------------------------------------------
B8DD33_LISMH/29-148--------------------------------------------------------------------------------
B8DD37_LISMH/24-135--------------------------------------------------------------------------------
C2KY92_9FIRM/22-126--------------------------------------------------------------------------------
C2M8M5_CAPGI/23-138--------------------------------------------------------------------------------
C2PY06_BACCE/26-128--------------------------------------------------------------------------------
C2TZ07_BACCE/17-130--------------------------------------------------------------------------------
C2ZR32_BACCE/17-130--------------------------------------------------------------------------------
C3BVU2_9BACI/35-154--------------------------------------------------------------------------------
C3WVX7_9FUSO/23-127--------------------------------------------------------------------------------
C4L6I6_EXISA/20-124--------------------------------------------------------------------------------
C6ABU4_BARGA/31-145--------------------------------------------------------------------------------
C6ABU7_BARGA/31-144--------------------------------------------------------------------------------
C6AD58_BARGA/31-144--------------------------------------------------------------------------------
C6AD60_BARGA/31-146--------------------------------------------------------------------------------
C6AEU7_BARGA/31-145--------------------------------------------------------------------------------
C6CF14_DICZE/28-135--------------------------------------------------------------------------------
C7GI90_9FIRM/31-150--------------------------------------------------------------------------------
C7N7K9_SLAHD/25-127--------------------------------------------------------------------------------
C8K547_LISMN/28-148--------------------------------------------------------------------------------
D0KCB2_PECWW/28-147--------------------------------------------------------------------------------
D0KCZ5_PECWW/26-145--------------------------------------------------------------------------------
D1W447_9BACT/21-143--------------------------------------------------------------------------------
D3EC77_GEOS4/25-144--------------------------------------------------------------------------------
D3FRA3_BACPE/26-146--------------------------------------------------------------------------------
D3FRA5_BACPE/24-128--------------------------------------------------------------------------------
D3I7I1_9BACT/41-148--------------------------------------------------------------------------------
D3I8Y5_9BACT/21-120--------------------------------------------------------------------------------
D4FV91_BACNA/25-133--------------------------------------------------------------------------------
D4FXH9_BACNA/26-163--------------------------------------------------------------------------------
D4FXI0_BACNA/26-142--------------------------------------------------------------------------------
D4FXI1_BACNA/25-133--------------------------------------------------------------------------------
D5HHH7_9FIRM/25-128--------------------------------------------------------------------------------
D5SSH7_PLAL2/27-142--------------------------------------------------------------------------------
D6CWW7_9BACE/84-197--------------------------------------------------------------------------------
D7JDE8_9BACT/35-142--------------------------------------------------------------------------------
D7VC45_LACPN/26-146--------------------------------------------------------------------------------
E1UUR3_BACAS/39-142--------------------------------------------------------------------------------
E1UUR6_BACAS/25-133--------------------------------------------------------------------------------
E2MKG2_PSEUB/45-159--------------------------------------------------------------------------------
E3YTZ2_9LIST/29-148--------------------------------------------------------------------------------
E3ZJV4_LISIV/35-139--------------------------------------------------------------------------------
E4LF31_9FIRM/27-134--------------------------------------------------------------------------------
E5W3S4_9BACI/29-137--------------------------------------------------------------------------------
E5W3S5_9BACI/24-128--------------------------------------------------------------------------------
E6UJN0_RUMA7/22-127--------------------------------------------------------------------------------
E8K361_9STRE/11-132--------------------------------------------------------------------------------
E9SF19_RUMAL/19-157--------------------------------------------------------------------------------
F0RDN6_CELLC/80-198--------------------------------------------------------------------------------
Q0VKY9_ALCBS/7-128--------------------------------------------------------------------------------
Q2SDZ5_HAHCH/31-138--------------------------------------------------------------------------------
Q4K9A1_PSEF5/31-138--------------------------------------------------------------------------------
Q4KGS7_PSEF5/49-173--------------------------------------------------------------------------------
Q5DWB0_CLOPF/28-149--------------------------------------------------------------------------------
Q5WIS2_BACSK/30-150--------------------------------------------------------------------------------
Q7M7B0_PHOLL/28-131--------------------------------------------------------------------------------
Q7N9I9_PHOLL/26-145--------------------------------------------------------------------------------
Q8GDM6_PHOLU/28-135--------------------------------------------------------------------------------

PF14567

A0KT76_SHESA/1-131--------------------------------------------------------------------------------
Q0VNR5_ALCBS/1-133--------------------------------------------------------------------------------
D4ZBL0_SHEVD/1-131--------------------------------------------------------------------------------
A4SRI0_AERS4/1-119--------------------------------------------------------------------------------
Q21KG4_SACD2/2-132--------------------------------------------------------------------------------
A6X428_OCHA4/5-137--------------------------------------------------------------------------------
A8H7F8_SHEPA/1-132--------------------------------------------------------------------------------
A0Y938_9GAMM/1-109--------------------------------------------------------------------------------
C1DFY0_AZOVD/1-133--------------------------------------------------------------------------------
C4S745_YERBE/5-136--------------------------------------------------------------------------------
B0KR80_PSEPG/1-133--------------------------------------------------------------------------------
Q2BMU0_9GAMM/1-131--------------------------------------------------------------------------------
B2C6T5_ACIBA/7-138--------------------------------------------------------------------------------
B8CKE3_SHEPW/1-119--------------------------------------------------------------------------------
E3A4U8_PSEAI/1-131--------------------------------------------------------------------------------
Q086X2_SHEFN/1-131--------------------------------------------------------------------------------
Q880E4_PSESM/5-136--------------------------------------------------------------------------------
B3PC71_CELJU/34-164--------------------------------------------------------------------------------
D4RXT0_9FIRM/2-135--------------------------------------------------------------------------------
A4Y9N5_SHEPC/1-119--------------------------------------------------------------------------------
Q12R95_SHEDO/1-131--------------------------------------------------------------------------------
D0WEZ4_9ACTN/5-134--------------------------------------------------------------------------------
A3QH89_SHELP/1-131--------------------------------------------------------------------------------
C1D4A4_DEIDV/3-141--------------------------------------------------------------------------------
A1S8W2_SHEAM/1-131--------------------------------------------------------------------------------
Q7M7B0_PHOLL/5-136--------------------------------------------------------------------------------
D1W447_9BACT/1-147--------------------------------------------------------------------------------

PF07348

C6RW74_VIBCL/5-179--------------------------------------------------------------------------------
B8K7V3_VIBPA/10-184--------------------------------------------------------------------------------
SYDP_SHEON/3-180--------------------------------------------------------------------------------
C3BLV0_9BACI/6-177--------------------------------------------------------------------------------
C2X4F6_BACCE/18-189--------------------------------------------------------------------------------
SYDP_ERWCT/5-179--------------------------------------------------------------------------------
Q6HGE7_BACHK/3-177--------------------------------------------------------------------------------
D4I9V3_ERWAE/5-179--------------------------------------------------------------------------------
C2QKP9_BACCE/1-174--------------------------------------------------------------------------------
SYDP_SHEPW/3-180--------------------------------------------------------------------------------
SYDP_PHOPR/5-179--------------------------------------------------------------------------------
B4F2E3_PROMH/4-178--------------------------------------------------------------------------------
SYDP_PHOLL/5-180--------------------------------------------------------------------------------
SYDP_EDWI9/5-178--------------------------------------------------------------------------------
SYDP_VIBF1/5-179--------------------------------------------------------------------------------
SYDP_ALTMD/5-178--------------------------------------------------------------------------------
A7GQ41_BACCN/1-173--------------------------------------------------------------------------------
A9DDC7_9GAMM/3-186--------------------------------------------------------------------------------
A0Y507_9GAMM/15-191--------------------------------------------------------------------------------
SYDP_AERHH/5-179--------------------------------------------------------------------------------
C6CEU0_DICZE/5-179--------------------------------------------------------------------------------
C3BLV7_9BACI/3-176--------------------------------------------------------------------------------
SYDP_SHELP/3-184--------------------------------------------------------------------------------
SYDP_SHEDO/3-180--------------------------------------------------------------------------------
SYDP_SHEFN/3-180--------------------------------------------------------------------------------
SYDP_SHEAM/3-180--------------------------------------------------------------------------------
SYDP_COLP3/8-192--------------------------------------------------------------------------------
SYDP_TOLAT/5-177--------------------------------------------------------------------------------
SYDP_HAHCH/6-185--------------------------------------------------------------------------------
A3WM07_9GAMM/6-183--------------------------------------------------------------------------------
A6F6I4_9GAMM/5-184--------------------------------------------------------------------------------
SYDP_PSEA6/5-182--------------------------------------------------------------------------------
D2U272_9ENTR/7-182--------------------------------------------------------------------------------
Q1ZGY9_9GAMM/5-180--------------------------------------------------------------------------------
SYDP_PSYIN/5-180--------------------------------------------------------------------------------
SYDP_IDILO/4-175--------------------------------------------------------------------------------
A4C5J8_9GAMM/3-179--------------------------------------------------------------------------------
C6CC04_DICDC/5-179--------------------------------------------------------------------------------
E6WGC7_PANSA/4-178--------------------------------------------------------------------------------
D4GLK5_PANAM/5-179--------------------------------------------------------------------------------
A6D8T1_9VIBR/5-179--------------------------------------------------------------------------------
C9P9P0_VIBFU/5-179--------------------------------------------------------------------------------
D0ICP4_VIBHO/5-179--------------------------------------------------------------------------------

PF14435

Q11UH8_CYTH3/2-179--------------------------------------------------------------------------------
C3G535_BACTU/11-190--------------------------------------------------------------------------------
C3BLX0_9BACI/3-181--------------------------------------------------------------------------------
C3G534_BACTU/3-181--------------------------------------------------------------------------------
D7C074_STRBB/3-186--------------------------------------------------------------------------------
E0QLS9_9FIRM/4-167--------------------------------------------------------------------------------
A3IE36_9BACI/4-165--------------------------------------------------------------------------------
D3GZ30_ECO44/1-160--------------------------------------------------------------------------------
B7LQU5_ESCF3/2-167--------------------------------------------------------------------------------
B1VPR4_STRGG/6-176--------------------------------------------------------------------------------
C6PRK9_9CLOT/16-217--------------------------------------------------------------------------------
B8CKE1_SHEPW/1-161--------------------------------------------------------------------------------
A3ZNI5_9PLAN/58-240--------------------------------------------------------------------------------
D3E916_GEOS4/1-200--------------------------------------------------------------------------------
E2N2L1_CAPSP/5-173--------------------------------------------------------------------------------
C0DUS3_EIKCO/1-171--------------------------------------------------------------------------------
B5HAW8_STRPR/39-232--------------------------------------------------------------------------------
E8RXJ9_MICSL/4-174--------------------------------------------------------------------------------
D1A3F0_THECD/3-170--------------------------------------------------------------------------------
Q47PK6_THEFY/247-430--------------------------------------------------------------------------------
E4NDB7_KITSK/233-420--------------------------------------------------------------------------------
C9YY18_STRSW/732-910--------------------------------------------------------------------------------
B5HAJ0_STRPR/6-189--------------------------------------------------------------------------------
D6K842_9ACTO/6-208--------------------------------------------------------------------------------
B5I6T5_9ACTO/6-184--------------------------------------------------------------------------------
E4N1Q1_KITSK/249-422--------------------------------------------------------------------------------
D1A5L5_THECD/6-199--------------------------------------------------------------------------------
D6K293_9ACTO/144-316--------------------------------------------------------------------------------
D6KEF7_9ACTO/214-404--------------------------------------------------------------------------------
Q82D46_STRAW/203-389--------------------------------------------------------------------------------
D9WNF8_9ACTO/13-197--------------------------------------------------------------------------------
Q2U157_ASPOR/71-266--------------------------------------------------------------------------------

PF02393

C8CFJ8_HCMV/54-179...................................AQELPCV--------LMLS----HYGTVYVYD------------W
C8CFJ9_HCMV/42-158...................................YEETELV--------LCMG----GGTRLYIYE------------P
A8T729_HCMV/26-179...................................PSQARLV--------LLLG----RYETVWCLD------------R
A8T728_HCMV/45-168...................................MVATPYV--------VFMG----RFSRVYAYD------------T
D3YRX5_HCMVO/17-135....................................MRYQLI--------VLIG----QRGGVYCYD------------D
D2K4G8_HCMV/126-245....................................GRPPLP--------VLIG----EGGRVYVYS------------P
UL298_HCMVM/399-518....................................ANTAPE--------IWVS----GHGHAFAYL------------P
B9VXJ9_HCMVT/55-169.....................................TCRYQ--------VFVD----AYGAVFAYD------------A
D2K5D0_HCMV/11-135...................................DHNVPSE--------LYLG----ASGAMYLWT------------D
B9VXD4_HCMVT/116-247...................................CAQDGLY--------LALG----AGFRVFVYD------------L
D3YRW4_HCMVO/11-132...................................QQKKTAV--------CLIS----DEGYVFCYV------------R
D2K4S5_HCMV/202-333....................................FVPSGL--------VLLD----KFGVVYLHK------------I
D3YS52_HCMVO/180-322....................................FDTSFL--------IIFD----RFCRFYVVI------------V
D2K3X0_HCMV/202-332....................................FHADFV--------ILVD----RACEFFYFD------------V
A8T728_HCMV/200-332....................................FVAEVL--------VLLD----WFGAVYAIQ------------M
B8YE72_HCMV/157-296...................................EFLVRQY--------VLVD----TFGVVYGYD------------P
B9VXG6_HCMVT/274-510DTHAVVGTDAAAAAAAAPTVMVGPTAMAGPAASGTVPRAMLV--------VVLD----ELGAVFGYC------------P
B9VXL1_HCMVT/265-382....................................QRLDIS--------ILVN----ESGAVFGVH------------P
B9VXJ9_HCMVT/546-653......................................VNKA--------VFMD----AHGGIHVLL------------Y
D2K5D5_HCMV/214-331....................................FFHRVR--------ILCG----DTGTVYAAL------------V
D2K5D0_HCMV/151-256.....................................YDVIN--------LFVD----DCMRVFAVN------------N
B8YE60_HCMV/153-278...................................WPVDLIP--------IVVA----YTGAVYACD------------V
C8BKJ5_HCMV/34-153...................................RPTRQLV--------LFMT----PKWDVFAYD------------S
D2K595_HCMV/6-123....................................SWDRSV--------AGVA----ADGSVLCYE------------I
B4YEM5_9ALPH/49-167....................................TGMQLL--------ILVA----EGGEVYAYE------------E
D2E8A7_9VIRU/5-121....................................WICQVI--------VLVG----EGGCVYFVD------------A
C3RWK6_9VIRU/35-153....................................PFPECI--------VLVG----EDQCVYAYG------------D
C3RWV3_9VIRU/65-186....................................PFPQWI--------VLVG----EDGHVYGYE------------D
Q070N0_CPRV/47-172....................................NWQQLV--------ILVS----EFGTVFAAD------------C
B1NFI8_ADEGX/15-131....................................DGLQVV--------ILVA----EDKTVYGYE------------E
Q4KS78_ISKNV/1-104.....................................SDQMV--------LMTC----GDSHVYVYD------------G
B5XAY6_SALSA/21-139....................................AGWQLV--------LLLC----EDGNVYAYE------------F
C3Y900_BRAFL/167-275......................................DAVV--------MVGT----LSGKVYMDK------------D
C3Z365_BRAFL/157-265......................................DAVV--------MVGT----QSGKVYLDK------------D
C1C3V1_LITCT/15-136....................................LFPQWI--------VLVA----KNGRVYGYK------------E
Q14VM9_9VIRU/5-123....................................NTRRPV--------VLLA----DSGRIYLYY------------K

PF14433

C3WDW2_FUSMR/11-172------------------------------------WHIGGT--------LWID....DKGKFYHTL------------Y
F0KCA1_CLOAE/2-150------------------------------------.NGNQY--------LMIS....ESGKMFTE.------------.
C3BLQ7_9BACI/6-145------------------------------------.DFGLD--------LYIS....ESGRLFKS.------------.
F0KCA3_CLOAE/3-152------------------------------------.QGEYI--------VCIS....ESGKFFVSE------------G
B1HSL5_LYSSC/5-144------------------------------------.RDNAV--------LYMS....KAGEVYAVR------------D
C0Z7L3_BREBN/2-133------------------------------------.SGYLV--------LFVS....ESGKVYCST------------.
B7N9G4_ECOLU/6-148------------------------------------.SEHMT--------YFIS....DDGALYGGF------------D
A8RVU3_9CLOT/13-150------------------------------------.RSNRL--------PVRS....ASPSVISAT------------T
A9B4M5_HERA2/3-169------------------------------------NRGVSS--------LFVL....SNGQIMHNS------------T
C2M481_CAPGI/2-151------------------------------------.ADEIL--------LCID....SVGSVWAVL------------D
A9B4M4_HERA2/9-180------------------------------------.VENTI--------FLTADGWVMTGQFYNLR------------W
A9B983_HERA2/9-180------------------------------------.PWDTL--------LVCG....DGLIVHGSP------------E
D1ALL2_SEBTE/5-152------------------------------------.TEEMT--------VFLA....EDGVFYGGF------------D
C2G2C6_9SPHI/5-144------------------------------------.PDGYY--------ICCD....VDGRVYKIG------------E
A9DRL2_9FLAO/4-142------------------------------------AHFPYT--------VECD....KTGAIHLIG------------E
D7VVD7_9FLAO/4-136------------------------------------YPDHYM--------IYTD....LKSSVYLVG------------D
D6B4A2_9ACTO/10-151------------------------------------.LSYSS--------VFVE....SGGRVVAAG------------M
C5UVJ4_CLOBO/2-147------------------------------------.RGNLL--------MLMT....ENETFYRYT------------D
A4A0B2_9PLAN/1-122------------------------------------.GCDFI--------YIVA...DIEGRIYLLN------------D
A2W0F4_9BURK/45-178------------------------------------.LGYVE--------FYVD....TQGRVFTTN------------C
B7WUX3_COMTE/6-150------------------------------------.HAHGQ--------LLMA....GDGRCFSWS------------F
C6DGM5_PECCP/1-142------------------------------------.NGYII--------LMYG....D.GVIYGVF------------D
B7M4P5_ECO8A/11-152------------------------------------.NGHIT--------LLYG....ENNVIYGGL------------D
C4GHT1_9NEIS/5-139------------------------------------.A..VF--------LIIG....ESGRMYGYC------------D
D1A3E8_THECD/9-150------------------------------------.GGHAL--------LAID....EAETVFMLF------------G
D9X9L6_STRVR/182-321------------------------------------.RGNQH--------LALA....EDGSVYAGM------------D
Q82G08_STRAW/7-151------------------------------------.SEFGI--------LLVD....GRGRLFHLH------------H
B1VX82_STRGG/7-150------------------------------------.YDGST--------ILMD....ESGRFFFSH------------H
D6K3Y2_9ACTO/7-151------------------------------------.YDGGT--------FLMD....EAGRFFYLH------------H
A4X261_SALTO/97-242------------------------------------.DGPSE--------LVMD....AQGRVFQLH------------W
D6K3Y4_9ACTO/15-161------------------------------------.ENDSA--------LAVG....EEGQLLSSG------------L
B1VX84_STRGG/1-149------------------------------------.DADAL--------LAVD....EQGRLFSID------------H
D9UTG4_9ACTO/29-176------------------------------------.TTHAA--------LAID....DEGRVYALD------------H
C4RQ15_9ACTO/292-437------------------------------------.NQESI--------LAVD....ERGRVFALD------------Q
A4X254_SALTO/6-153------------------------------------.DGVGI--------LAVD....EPGRVFVLD------------H

PF09346

SMI1_DEBHA/98-296...PVKIAKQQRHESAGSPNIPRQKSIPPGTIHDSFAHPMWI--------PIIT...DEVGNCIGID------LCPPTNG
SMI2_DEBHA/142-319............ENKINNSFIANQKSIPPNAIQPYYAHRGWI--------PFLK...DFCGNQIAID------LAPGPQG
YOBM_BACSU/42-161................................EDLFEDINGI--------PIGY...LLEECHLMID------KDKVNQG
A7VFJ3_9CLOT/24-132......................................DDYI--------VIGA...FASGDPILCK------KAE....
A1ZXR5_9BACT/30-166..............................AVKFKWWHKGWI--------PFAE...DNNGNLLCID------LAPAKKG
A3KB11_9RHOB/18-152.....................................PQGFA--------PIGE...DPGGLIVLLS------LHPGDFG
A5UTX3_ROSS1/55-202.....................................TLNYV--------AFCD...AHDGNYLAIL------REGPEQ.
A1C9R6_ASPCL/143-317.............PLWRNELLERQDSQPPGAVQKAYAHPAWI--------PLAR...DWGGNHIAID------LAPGPTG
A0JSM0_ARTS2/15-129......................................TGLV--------FFAD...AGNGDQFAVT------LSGN...
SMI1_CANGA/103-288.........EKPRNKFKLPYIPEQKSIPPETVLPLYAHAMWI--------PVLT...DNAGNHIGID------LSPARLG
Q89MJ4_BRAJA/28-170...................................PTVDELL--------WIMS...DHGGNPICMT------IDKAHF.
Q22E93_TETTS/424-535..................................AFWKKNYL--------TVAQ...DIDSNYLIIE------CNNDGTS
A7MRN6_CROS8/1-150...................................DFIDSKL--------IIGD...DPGGNYYLML------NGERQ..
E6XKE0_SHEP2/21-128.................................SIGMPRDMI--------AICQ....MGDDFYCID------QE.....
Q63C14_BACCZ/25-143..................................GVDDEESL--------VFFE...VTELNFLTIK------FKEENEL
Q0VKY9_ALCBS/4-130..................................YRLPENLI--------VIGN...NGGGDVLVYK------TEKEGSI
A5TTM3_FUSNP/176-315....................................YPNIGI--------AICGS.VSGGHDMIFLD------YSDCGAE
Q5LEL2_BACFN/13-124........................................YW--------AFGM...DGDIGYILHL------SDNSI..
Q2BBP1_9BACI/47-165......................................DTFL--------FFSD...AGNGDLFGYS------IADGRVQ
Q4K9A1_PSEF5/28-140.....................................TGRHL--------LFSE...NGCGDFYGFR------IENRHCL
A7Z5R7_BACA2/23-158....................................MPDWII--------PIAD...GDGGDQICLG------VKGEAA.
FBX3_HUMAN/121-251....................................GLKYCL--------PLTFCIHTGLSQYIAVE------AAEGRNK
Q81H93_BACCR/13-142....................................LVDKVY--------PFAR...DPFGNLLCFD------YRNNPQS
A6G0Q7_9DELT/31-170..............................RLARTYWQPQWV--------PLAQ...DGCGNEYCYD------LAPGPNG
Q3EQ17_BACTI/32-156..................................TKMPDTYL--------IIAD...LNYGDSICID------LESSNGY
A1INP6_NEIMA/28-167....................................YPPIGV--------YFAND.PSGGHAMFALD------YRECGKD
A6FHD8_9GAMM/19-145...................................GMPKGHI--------LFAS...DCKGNMFCFK------LSDCLSQ
Q6CS49_KLULA/64-193...................................LVPRDYI--------PIVI...DGGGFPFCLR------KGS....
Q1L2J9_STRHY/18-144...................................LWKPSWI--------PFCSFNPDDTVYGLYLN------GETG...
A3I618_9BACI/42-194.....................FLEYVDIDKRINMHVPLNERL--------CFADCMNNGGTSCLYLD------FSPAEGG
Q47R76_THEFY/31-145......................................EGRF--------FFYV...HQGYAFYFFE------HGK....
A3ZN04_9PLAN/36-149.........................................I--------VFANYWMYADGDQLLID------AADLN..
A0PQE6_MYCUA/4-131..................................FGFPVNAV--------AIGA...NGCGDRLVLL------PGVIGSA
Q7M7B0_PHOLL/25-133...................................GLPENLL--------PICE....DNGSYYCID------YD.....
Q3IK24_PSEHT/8-124......................................ENFI--------AVAS...DPFGNYYGYL------KESNHI.
A5FAZ7_FLAJ1/185-329.............................KINTNNYTNPKWI--------PFAT...GRNGDYLLYD------TDPASKG
Q92KA2_RHIME/32-167...............................LGTMVWSPNWL--------PLFG...SPRGDHYCID------LRPELTN
Q4K6P0_PSEF5/56-173........................................LV--------AFGD..YLGNGNLFCFH------RES....
Q6HGF3_BACHK/15-125.........................................V--------SIGD...DGGGNVFLMA------QHAEE..
B4SN74_STRM5/28-184....................LDDEPEILGEGIDADLPMNRRL--------CFSHCMNNGGTSMLYLD------FDPAPGG
Q82RV7_STRAW/96-236.................................PDDPMVRYL--------AFAA...TDRSGLYGLF------TDCTPGT
A1ZUI6_9BACT/29-147..................................NVIPKDAL--------IFEG..FDDCRKFIRLS------EGND...
A9B016_HERA2/24-146.....................................DRAII--------PFTQ...HAGYVVYYIR------CDDGDDP
A1RPC3_SHESW/26-168...............................IQSGWYQEGWL--------PFAQ...FGGGTLLLIA------DHSPSAL
A0RE58_BACAH/19-133...................................KYIPNSL--------AIGD..DEGGMALLYID------GKEGFGL
A4X5D2_SALTO/28-164....................................YPDIGI--------YIADC.PSAGHDMIALD------YRSPGS.
Q1CV91_HELPH/17-134....................................LEPEEI--------VFAN...DGYGGYYLLN------TTT....
O64025_BPSPB/23-165..............................DTYSDRFPRNII--------PIAS...SAGGNEICMD------IDN....
A7GQ33_BACCN/21-130...................................GLPENYL--------VIEN....VDEFVYCIN------TKD....
Q816C2_BACCR/16-147...................................EMPENIV--------LLSG....DGHTWIALD------YRNVAEN
Q633D5_BACCZ/17-131...................................EFAPGVT--------LFGS...DGGNVAYGFF------EKGGETQ
Q81BA7_BACCR/48-167....................................FPNKYL--------VLTE...MTANAVLVLD------SVT....
B1YF88_EXIS2/9-123....................................YPDGFF--------RIAA...DGSGDELGYL------LPDT...
Q9F2N4_STRCO/160-298....................................LTKDYL--------GVAF....VQGGLLAVK------VKGE...
A8FAT3_BACP2/17-145...................................ELPEGLV--------LICG....DGHTWIALD------YRETKEH
A0R498_MYCS2/11-150........................................LV--------PFDG....DGHWDLCLD------YRRSTTD
A4YB72_SHEPC/14-135.........................................V--------AIGS...DGGGESIVFD------TTHNISS
Q927J5_LISIN/124-264....................................YPDVGL--------AIADC.PSAGHDMVFLD------YRNCGKT
Q6HHY9_BACHK/33-185.....................DDEDVVDSKINPEGLLPGTYI--------HFSDCMNNGGTSKLYID------FNPSDEG
Q7DD43_NEIMB/1-117.......................................NLL--------PFAR....NQEWAACFD------ISDKSGN
Q82GY4_STRAW/63-178......................................DQLL--------FFSD..IPGNGDLFGMV------LVPGQY.
Q55KB3_CRYNB/120-282............................PQWIKTVYACKGWI--------PLLS...DRTGNYVGVD------LDPGANG
B8I5J3_CLOCE/15-125.........................................I--------AVGS...NGGGKFLLML------ANEES..
Q6HGD1_BACHK/12-154..............................TDDGDLLGVALL--------PIAV...LFAGDFLCLD------FRESRSN
A5Z4Q5_9FIRM/17-131.........................................K--------YFGS...DGGDMAYGFE------FDHDRTT
Q4EKD7_LISMN/14-152................................EVKLFWNAHL--------PIMMS.VGGCYEYYAIT------LNDG...
A7FEI4_YERP3/10-144....................................IPQGFV--------PIAT...DPGGNLLLLC------GTKEN..
B1KPX6_SHEWM/17-136...................................DLPENLI--------VIQP....DEDAPYCLD------TTDKNSV
O07689_LISSE/36-156..................................KIKVRRLL--------KIAK...SIDGEDIIYD------LKE....
Q81B84_BACCR/8-142....................................MLPTSL--------IIGD...DPSSGLIVLI------TDTEN..
Q5LEK4_BACFN/11-139.........................................L--------IFAI...SWMGERIAVN------ITNGAIY
A7VE32_9CLOT/35-145....................................DHGPAF--------PIGG...LGDGSIVFID------LES....
A0RAF8_BACAH/19-149....................................LPKQIV--------PFMS...DQFGNYICFD------YRTSNE.
Q3BQF4_XANC5/29-173...............................LAAGGDDRHLI--------VIAAD.DRSPSRALCLD------YSAFGAE
Q81Q97_BACAN/4-119...................................NLPEQYI--------VLND....IDGTMTCLD------TNQMKDG
Q3EVG8_BACTI/12-138....................................LPEGII--------PFAR...DPFGGLICFN------YCDTKDS
Q1DBU4_MYXXD/34-167.........................................L--------FFQRADDDAVDNFWCFN------PRDVTPE
A3ZX25_9PLAN/22-154....................................LPRLVI--------PIND...DGAGNLICIS------LRPDCF.
A1TSU7_ACIAC/17-133........................................FV--------GIGT...NGGGECYALD------YSDDISS
Q9F2V0_STRCO/29-155..................................WPWPEGVL--------PISH...WGCAMYACVD------CRTPQ..
B1YEY9_EXIS2/39-159.................................IDEDYDHYW--------IIGE....VNEGYLLIH------TNHAKTE
Q28UU7_JANSC/42-166..............................FPDSGFWERHWI--------PFLD...NGGGDYLTIV------TDGTAQG
Q9CND2_PASMU/14-158...................................YGYEHVY--------SFGR...SGCGDFVFFD------YRDDPKG
Q65VI9_MANSM/10-134....................................APQELL--------PFAY...NAVGGFFALS------LRKQDF.
B7KWA7_METC4/14-155......................................ERAC--------FFGQ...TERGDFLFFD------VTPGFPE
Q5DWB0_CLOPF/25-151....................................LPNNLI--------VIYN...TGYSELLCLD------YNNVNKE
Q63F89_BACCZ/18-127......................................TDYI--------VIEN...MGSEGILILL------H......
A1RND9_SHESW/4-129..................................GYFPESAI--------TIAG...NGFGDQMVFL------KEGESFG
Q3EVG9_BACTI/12-152...............................NLMQVVPSNFL--------PIGI...DPAGSLICLS------IDGKDR.
Q8F615_LEPIN/16-123.........................................V--------SIGT...DGGEFCYAFD------YRNNSNI
Q5WBD2_BACSK/23-138....................................WKEELI--------PFYS...IGNGDYFCLL------SNECPN.
A5FGR4_FLAJ1/41-198.....................................FAGIL--------PLGT...EGCTYYYGLV------LNGK...
A6X425_OCHA4/20-140......................................QSFI--------PICD...DGSGVYFYLD------TLAS...
Q9RYT7_DEIRA/27-166...............................LQPGWWNPAWI--------PLDA...DGGGNGAVID------LAPGPQG
Q5WJU2_BACSK/38-153..................................KYLDTKDI--------PIAF...LLEECHLIIN------KKKVRER
Q880E4_PSESM/25-133...................................GVPKSWL--------PICE....DNGNYYCLL------ED.....
A5DZP7_LODEL/117-382TTSHDALNIETATKKHKTKKMPRQRAIPPGTIHETFAHPMWI--------PMVT...DEVGNYIGID------LCPASQG
Q6HMR4_BACHK/23-143...................................EFQKEYL--------FFGD....SNIAWFCKS------LLD....
Q8GDM6_PHOLU/25-137....................................LNEGRL--------VVSN...TDFGEEFYFN------TN.....
A4X269_SALTO/103-245................................RDPWLSPDWL--------VIAN...LGGGLLLLSL------RVRDMER
Q4KGS7_PSEF5/46-175..............................VCADPAGFSNLL--------PFAQ...FGTGDYYCFD------YAVLGEA
A4IKF8_GEOTN/21-132...................................GLDKKLI--------VIED....SGEFVRCMY------SADVRD.
A7RYE8_NEMVE/119-257....................................GLRNCL--------LISLCIYTGNGQFIALT------DEEGHIT
A4VZJ4_STRS2/19-128..................................ENFPKEKF--------ILED...LHLDDMLVLA------DST....
Q1CY42_MYXXD/19-141.....................................PSSWY--------ALCD...VRDSNYILLD------VSHQLDG
Q1ZQF0_PHOAS/14-166.....................................VANGF--------VVAE....ENGDLLYLD------PADN...
SMI1_YARLI/171-356........ASVARQKNISSWLASQDSVPEGAVQLVYAHPGWI--------PLAN...DRAGNNIAVD------LAPGKKG
A3ZX28_9PLAN/24-139....................................GVSDWV--------IFSE...DHSGNPIGMD------VN.....
A6C6S9_9PLAN/31-128..................................LQYVQGFI--------TFHS...FGNGDFTCIA------TKKSEYP
Q65PK7_BACLD/18-132......................................DCLL--------FIAG...AGNGDLFAYS------ILNGSIR
Q81BW2_BACCR/27-144......................................DCLL--------FFAD...GGNGDLFGYS------ILNGKVQ
A4Y9N5_SHEPC/8-116.................................YFQLPSELC--------PICE....DNSDYYCLN------QK.....
Q5LEK4_BACFN/167-306....................................MPCNLL--------PFAM...DSGGNYYTLN------LKNKKIY
A4SRI0_AERS4/8-116.................................IIGVSRDLL--------PFIE....DNGDYFCIS------KT.....
A3I6Z7_9BACI/22-146.....................................PNRLD--------LFVS....DADELYFFD------LSAKDED
Q2SDZ5_HAHCH/28-140.....................................RAGRV--------LISE...NSNGDFFGFD------VRDGVCQ
Q0RKI3_FRAAA/56-185................................DMLSLFRRSL--------VIAS.....GEDFWLLD------PADPGPD
A3ZX34_9PLAN/23-143..................................YSLPENLV--------VIYL...GADDVVWCLD------VSQFDGD
A8M704_SALAI/21-139.......................................DAL--------VFAM...HQGYLAYWMS------DASISD.
B8I223_CLOCE/15-131.................................GVYDEESML--------IFFE...VNEGVYLALD------LNNNDK.
Q4PAY0_USTMA/184-339............................HKWIRAEYSCRGWI--------PLIT...DHAGNYIGVD------LSPHPAG
Q21ED8_SACD2/11-151................................LADRVPKNIL--------PIAE...DPGGNIVCLS------LAGDDV.
A0RAV0_BACAH/42-162...................................KNPDSYF--------VFAD..SMDLGTIYAIN------.......
A8FII6_BACP2/13-123.........................................V--------AIGD...DGGGQVFLMR------QTEEE..
Q09D40_STIAD/24-149.....................................PASVY--------AICD...VQDGNFVLMD------VSRQQNG
B7X333_COMTE/152-284.................................LKAKLSELV--------VFGD..YLGNGNLWCFD------RRD....
Q38V57_LACSS/13-131.................................VAQWPDYLI--------PFSQ....HGTQYFAFD------YQQSPDN
Q8NRK2_CORGL/4-116..................................DNFPENAI--------AIAN...DGTGDLIILL------PDD....
A5TXY3_FUSNP/37-189.....................EYEEVEIDEEIISDSKKMKWL--------HFSDCMNNGGTSQLFID------FSPSEKG
Q5LEK9_BACFN/11-148................................KAGAISDSIL--------IFAM..ESTDEGRITID------LVN....
Q7N9I9_PHOLL/23-147..................................GDIDEGMI--------KIKS...SGYGPSYSID------TNIKGKT
Q52KV8_XENLA/36-166....................................GLNQCL--------PITFCIHTGLSQYLALA------DTDGRRR
Q6HGG3_BACHK/12-159....................................LPSALV--------PFAF...DPAGNLICFD------YKNHKED
A5TTY9_FUSNP/35-181.....................................WHNKL--------AFYE...VGNGDYFAIE------LEKENY.
A5Z4R9_9FIRM/9-151...........................NYIMKSEGLVPEECL--------VFAD...DSAGNPICMK------TGGENQ.
A6CCT7_9PLAN/22-151..............................SRPSEGMSSELA--------PFAA...VGNGNLICLK------KNS....
Q0VNR5_ALCBS/21-130.................................NQGLPRYLI--------PVCE....TPNGIYAMS------QE.....
B8I222_CLOCE/15-149..................................KLLPSWLI--------PLAD...EAGGDLYCYS------LRENEI.
Q59YV1_CANAL/104-343ATSMCYNSNILPSTKKRGMNIPKQRSIPPNFIRETFAHPMWI--------PLIT...DGVGNYIGID------LSPASEG
Q93JL3_STRCO/163-310.............................AAVQGLVGSPGWI--------AFGD...NGGGDRLALD------LTPGPGG
A0RFK3_BACAH/36-159...................................VVRQELL--------PIAVTEFDKDLFVLCLP------NSSRP..
Q73QC3_TREDE/40-189.............................SRIKPYLFNKKWI--------PFAE...YCDSCFLMLD------FDPDTAG
Q4UXL8_XANC8/219-365...............................AYLHAGLDQVL--------VLSS...HNVDCLLCLD------YRGRGPH
Q5LEK2_BACFN/47-168.....................................KDTYF--------FIGG..YRYDGSKLYID------SED....
B1J8X4_PSEPW/139-260......................................KGRV--------PFAF...DEGGNYFLLT------LSGEEQ.
A5FCA9_FLAJ1/44-161..............................TEEDKLLLPYLI--------SFSD..YLGNGNMFCFH------SET....
A5Z4R3_9FIRM/12-152...............................VDEDYISEEYV--------PFAR...TSFGNLLLIR------LDESEFN
A5FLI6_FLAJ1/11-131......................................NQMI--------PFAY...DYGGNCFLLS------LKKENS.
Q1C2E7_YERPA/11-153...................................VIPSNII--------PFGN...DWGGNFFCLN------KDDDSVV
A6VZI9_MARMS/37-168...................................GLPKTYV--------PLEG....DGHTWLALD------YSDSLTN
A5FMA4_FLAJ1/23-172.................................NEAFPCIGW--------MMSEEDINESGEYVIFD------KNGNF..
A7Z7P3_BACA2/41-156.................................NGFLKPQFI--------PVAH...LLDGCYLLID------KTKMST.
Q39NE9_BURS3/28-182....................ANDDGELVDSRIDIALPMNRRL--------CFSHCMNNGGTSQLYID------FEPAPGG
A0AMA9_LISW6/21-137....................................ELRNSY--------VISD...DGSGNPILMD------TA.....
Q2BBP3_9BACI/17-145........................................LI--------IISA....EPPAFICLD------YRRRKN.
B1KH37_SHEWM/28-163..................................PRILPETL--------IIAD...SISNDLVIMD------LSETNY.
A4EPD0_9RHOB/35-163................................CKIGMPESLV--------AIGS...DSLGNLFCFD------KQHLQSE
A6CDZ7_9PLAN/19-143..................................GHLPPTLV--------PISD...DGCGTTFYID------SAQRSDE
Q9F3Q3_STRCO/47-179.................................EAGIWRRGL--------QLDV...ASDATYVLMD------PEDVDED
A6DN67_9BACT/17-158...................................LDPNKIL--------IFYT....DYDNFYALD------YNNNQE.
A7ML24_CROS8/19-151................................YGPWHEKEFI--------PFAY...DNGGNPFFLS------LKASDY.
A1ZMA9_9BACT/9-138..................................NILPEHLL--------PIGF...DELGNRICIS------KETTNN.
Q1DEQ7_MYXXD/33-153.......................................SLY--------PLVD...CQDSDFVLVN------VANTGGP
B1YF81_EXIS2/16-130....................................LPDDLI--------CIGE...NMTGDKLCYR------IRKRFLQ
Q5WC01_BACSK/21-135......................................KAFL--------VFYQVEESVIYCGIRLD------ELEKED.
A5FJY1_FLAJ1/42-170.....................................EDNYF--------MIGSHLSMGDWIGFCTT------KQDTNN.
B1YEX8_EXIS2/15-147................................NEWGLAGKKM--------IFGE...GEGSYLWYFD------FDENPKN
A6EFN0_9SPHI/29-161.................................GFSPGKQLF--------PFLE...DGAGNCYWVD------LNERTPD
Q6HGE4_BACHK/13-160....................................LPQKVF--------PIAI...DPAGNLICLD------YKNNTEN
A5UV09_ROSS1/24-144...................................PFYNDFL--------VFGQ....GNMDYYTLH------LPD....
A4BCB8_9GAMM/14-147...................................GLPERQV--------LLSG....AGHWWITLD------YRNGGE.
Q11VT9_CYTH3/29-168....................................YPDTGI--------YVCTC.PSAGHEMILLD------YSICGPK
A4FNW2_SACEN/30-166...........................YYAGSAGSSFHPAWI--------PIAG...DGFADELVVD------LRPGPLH
A7Z5G8_BACA2/23-137...................................GLPSGLV--------VIEH....VDFFGYCLD------TNKINSE
Q6NG79_CORDI/14-156..............................FLTEEYEIPDEV--------LLCAISEAGMHEYLVIN------YGLKDFP
B1KH38_SHEWM/29-165..................................MQTSFNLV--------VISS...SISHDEVLLD------VSAGHY.
Q47P53_THEFY/18-133......................................DNLM--------FFGD...SDMGPQFAYV------HTGYG..
Q926X2_LISIN/25-149..................................GDINKEMI--------MIKN...SGYGSIFSID------TSIIGSE

PF14568

A0AMA9_LISW6/24-135------------------------------------LRNSY.........VISD---DGSGNPILMD.........TA.G
A3I6Z7_9BACI/25-144------------------------------------NRLDL.........FVSD---ADELYFFDLS......AKDED.G
A3ZX34_9PLAN/26-141------------------------------------LPENLV........VIYL---GADDVVWCLD.....VSQFDG.D
A4IKF8_GEOTN/24-130------------------------------------LDKKL.........IVIE---DSGEFVRCMY.......SADV.R
A4VZJ4_STRS2/22-126------------------------------------LEDLHLDDM.....LVLA---DSTGKVFLWH.............
A6CDZ7_9PLAN/22-141------------------------------------LPPTL...V.....PISD---DGCGTTFYID.SA...QRSDE.T
A6X425_OCHA4/23-138------------------------------------IGADRQSFI.....PICD---DGSGVYFYLD.......TLAS.P
A7FEI4_YERP3/13-142------------------------------------CYDLYKKRIPQGFVPIAT---DPGGNLLLLC......GTKEN.S
A7GQ33_BACCN/24-128------------------------------------LPENY.........LVIE---NVDEFVYCIN.........TK.D
A7Z5G8_BACA2/26-135------------------------------------LPSGL.........VVIE---HVDFFGYCLD.....TNKINSEG
A7ZAC8_BACA2/3-116------------------------------------PDDLI.........VIAD---NGTGDKLCLK......KTDSV.M
A8UFY5_9FLAO/12-126------------------------------------LKKSF...LYPKLLSIGT---LEGGYLAIGY......VDDNY.G
A9DRK0_9FLAO/13-128------------------------------------IYDFLPKAV.....NIGG---FFGGIIAMSL......SDNDY.G
A9INX3_BART1/38-152------------------------------------L.............VVSR---TDFGETFYFD.....YTQFQD.G
A9INY0_BART1/31-145------------------------------------L.............VVSR---TDFGETFYFD.....YSKFQD.A
A9INY3_BART1/35-149------------------------------------L.............VVSR---TDFGETFYFD.....YTQFQD.G
A9INY6_BART1/35-148------------------------------------L.............FVSS---TDFDETFYFD.....YTQFRD.G
A9INZ4_BART1/35-149------------------------------------L.............IVCD---ADFGETFYFD.....YTQFRD.G
B0ALZ7_BACAN/9-120------------------------------------LPEQY.........IVLN---DIDGTMTCLD.....TNQMKD.G
B1BP25_CLOPF/31-145------------------------------------DKGNYL........VISS---ECDGSLSVID......LNNSN.K
B1KH37_SHEWM/31-161------------------------------------LPETL.........IIAD---SISNDLVIMD.......LSET.N
B1KPX6_SHEWM/20-134------------------------------------LPENL.........IVIQ---PDEDAPYCLD.TT...DKNSV.G
B3ZML8_BACCE/21-125------------------------------------IENMGSEGI.....LILL---HKDGMVYECA.............
B4AJF6_BACPU/18-123------------------------------------..............AIGD---DGGGRVFLMR......QAEEE.K
B5ULT3_BACCE/26-136------------------------------------MKEGFWKKELI...PFYS---IGNGDYFCLH.......SKEG.Q
B5UUA7_BACCE/17-130------------------------------------PENLI.........IIGD---DGSGDKLCFK......INNGK.M
B7INQ5_BACC2/11-140------------------------------------LPTSL.........IIGD---DPNSGLIVLI......TDTEN.H
B7JLP8_BACC0/25-134------------------------------------MSENL.........VVIE---NIGEYAYCLD.....TSNMEN.N
B8DA94_LISMH/28-135------------------------------------V.............VVSN---TDFGEEFFFD.........IK.D
B8DD33_LISMH/29-148------------------------------------INEELI........IVKN---SGYGSIFSID....TSMIGSA.G
B8DD37_LISMH/24-135------------------------------------LSESY.........VVSD---DGSGNPILMD.........TA.G
C2KY92_9FIRM/22-126------------------------------------LEDLAIDAK.....KIVV---DEDGKVYLLQ.............
C2M8M5_CAPGI/23-138------------------------------------A.............FLEM---DEETYFFKIE......EAGQA.N
C2PY06_BACCE/26-128------------------------------------IPKGY.........IIIE---HCDEYSYCLD.....TEKMMN.N
C2TZ07_BACCE/17-130------------------------------------SEDLM.........IIGD---DGSGDKLCFK......IHNGI.V
C2ZR32_BACCE/17-130------------------------------------PENLI.........IIGD---DGSGDKLCFK......INNGV.M
C3BVU2_9BACI/35-154------------------------------------MPDMYL........IIAD---LNYGDTICID.....LESSNG.Y
C3WVX7_9FUSO/23-127------------------------------------IENIGVDRM.....LVIS---DEKGKIYTIQ.............
C4L6I6_EXISA/20-124------------------------------------LQNIGMEGI.....LIVV---DEQDRVFEYQ.............
C6ABU4_BARGA/31-145------------------------------------L.............VVCT---NDLDESFYFD.....YSQFRD.G
C6ABU7_BARGA/31-144------------------------------------L.............VICT---TDFGETFYFD.....YTQFRD.G
C6AD58_BARGA/31-144------------------------------------L.............VVSR---TDFGETFYFD.....YSQFQD.G
C6AD60_BARGA/31-146------------------------------------L.............AVSR---TDFGETFYFD.....YTQFRD.G
C6AEU7_BARGA/31-145------------------------------------L.............AVNR---TDFGETFYFD.....YTQFQD.G
C6CF14_DICZE/28-135------------------------------------I.............VLSN---TDFGEEYYFK.........ID.E
C7GI90_9FIRM/31-150------------------------------------LPKEWI........PIYD---FGDGNMAYLD....YSSLNME.K
C7N7K9_SLAHD/25-127------------------------------------LPNNL.........IVVE---NCDEWVYCLD..........A.E
C8K547_LISMN/28-148------------------------------------MPKHLT........ILLN---TGMGELYCLN....FAVLNSH.N
D0KCB2_PECWW/28-147------------------------------------IDNGMV........QIKS---SGCGPVFSID....TSMLGES.G
D0KCZ5_PECWW/26-145------------------------------------ISSSMI........KIKS---SGYGPSYSID....TDVTGKI.G
D1W447_9BACT/21-143------------------------------------LSNDL.........IVLN---YEVGEYLTLYKVS...ENQEL.E
D3EC77_GEOS4/25-144------------------------------------HRLDL.........FVPD---EDELYFFDTS......AKDEQ.G
D3FRA3_BACPE/26-146------------------------------------LPANLL........VIYD---TGSDELFCLD....FNQLDSI.G
D3FRA5_BACPE/24-128------------------------------------LPKKY.........IVIE---NVGEFVYCLD.........TL.E
D3I7I1_9BACT/41-148------------------------------------..............IISF---DSSGNPIMMN.........KS.G
D3I8Y5_9BACT/21-120------------------------------------ISNTYIDGI.....LLVQ---DTTGVIYTYQ.............
D4FV91_BACNA/25-133------------------------------------LSDGI.........IVIE---YVDEFSYCLD.....TNKMEN.G
D4FXH9_BACNA/26-163------------------------------------AIDTYSDRFPRNIIPIAS---SAGGNEICMD........IDN.G
D4FXI0_BACNA/26-142------------------------------------..............LFFG---DSDTAWYCLDVIQNEYLELDK.P
D4FXI1_BACNA/25-133------------------------------------LTDGL.........VVIE---DVDYFAYCLD.....TNKMKD.G
D5HHH7_9FIRM/25-128------------------------------------LNDDK.........IVIE---NCDEWIYCID..........V.K
D5SSH7_PLAL2/27-142------------------------------------LPLNLI........VVYL---GSDDVVLCID.....TNLFTG.D
D6CWW7_9BACE/84-197------------------------------------NKGYF.........AIGR---YSDYGVIALKLTD...DENKE.G
D7JDE8_9BACT/35-142------------------------------------..............IIGT---DYAGNPVGID.........KD.G
D7VC45_LACPN/26-146------------------------------------MPTNLV........MIYN---TEMGEILCLN....YRELNTN.Q
E1UUR3_BACAS/39-142------------------------------------FPEGY...V.....LIGY---HFDGRYVIDT......NKSKN.G
E1UUR6_BACAS/25-133------------------------------------LSDGL.........VVIE---YVDEFSYCLD.....TNKMKG.G
E2MKG2_PSEUB/45-159------------------------------------L.............VISK---TDLGEVFFFN.....YDTYKD.N
E3YTZ2_9LIST/29-148------------------------------------INKELI........MIKN---SGYGSVFSID....TSTIGDA.G
E3ZJV4_LISIV/35-139------------------------------------LDNKM.........YIVE---DCDEFFYCGK..........S.G
E4LF31_9FIRM/27-134------------------------------------..............IIGT---DGWGNPIYIS.........PS.K
E5W3S4_9BACI/29-137------------------------------------LPNHI.........VVIV---DVDAFAYCLD.....TQKMDN.G
E5W3S5_9BACI/24-128------------------------------------LPEKY.........LVIE---NVDEFVYCLN.........TE.E
E6UJN0_RUMA7/22-127------------------------------------IEEAHIDGI.....VIWQ---SPSGEIFQTS.............
E8K361_9STRE/11-132------------------------------------ILEDLQDRLSDQLIPFAE---DGFGNLLCFD.......YSAD.K
E9SF19_RUMAL/19-157------------------------------------IPPFF...F.....PIGD---DSGGDPLCMN.....LSQEEY.G
F0RDN6_CELLC/80-198------------------------------------ELDNKEIKVDSLLCLMSE---DSNGGAWCWL.TS...EDTKD.G
Q0VKY9_ALCBS/7-128------------------------------------LPENL...I.....VIGN---NGGGDVLVYK.TE...KEGSI.N
Q2SDZ5_HAHCH/31-138------------------------------------..............LISE---NSNGDFFGFD......VRDGV.C
Q4K9A1_PSEF5/31-138------------------------------------..............LFSE---NGCGDFYGFR.IE...NRHCL.A
Q4KGS7_PSEF5/49-173------------------------------------DPAGFSNLL.....PFAQ---FGTGDYYCFD.YA...VLGEA.G
Q5DWB0_CLOPF/28-149------------------------------------LPNNLI........VIYN---TGYSELLCLD....YNNVNKE.N
Q5WIS2_BACSK/30-150------------------------------------LPDNLL........VIYD---TGSDELFCLD....FNQRADN.G
Q7M7B0_PHOLL/28-131------------------------------------LPENL.........LPIC---EDNGSYYCID.........YD.G
Q7N9I9_PHOLL/26-145------------------------------------IDEGMI........KIKS---SGYGPSYSID....TNIKGKT.G
Q8GDM6_PHOLU/28-135------------------------------------L.............VVSN---TDFGEEFYFN.........TN.N

PF14567

A0KT76_SHESA/1-131------------------------------------LPRDLI--------AI.C---QLGDDFYCID------.....QD
Q0VNR5_ALCBS/1-133------------------------------------LPRYLI--------PV.C---ETPNGIYAMS------.....QE
D4ZBL0_SHEVD/1-131------------------------------------MSREYV--------AI.C---QQGNSFYCID------.....QE
A4SRI0_AERS4/1-119------------------------------------VSRDLL--------PF.I---EDNGDYFCIS------.....KT
Q21KG4_SACD2/2-132------------------------------------MPREMI--------PL.C---VDGDNVYCVA------.....ED
A6X428_OCHA4/5-137------------------------------------LPDNWL--------PI.C---EDNGDYYCIA------.....PD
A8H7F8_SHEPA/1-132------------------------------------LPREFV--------PI.C---QQGDNFFFIS------.....QE
A0Y938_9GAMM/1-109------------------------------------VSRELI--------PV.C---EYQGGYYCAD------.....EV
C1DFY0_AZOVD/1-133------------------------------------MPRDLV--------PL.C---QVGDDYYAVD------.....IE
C4S745_YERBE/5-136------------------------------------LPEGWL--------PI.C---EDNGSYYCLV------.....PD
B0KR80_PSEPG/1-133------------------------------------VPRELI--------PL.C---QDGDNYYCVE------.....ED
Q2BMU0_9GAMM/1-131------------------------------------MPREFI--------PI.C---EHATGYYCIT------.....QE
B2C6T5_ACIBA/7-138------------------------------------LPEDWL--------PI.C---EDNGSYYCLS------.....PN
B8CKE3_SHEPW/1-119------------------------------------LPAELL--------PI.C---EDSSDYYCIN------.....DK
E3A4U8_PSEAI/1-131------------------------------------VPRELI--------PL.C---QDDGSYYCVA------.....ED
Q086X2_SHEFN/1-131------------------------------------LPREQI--------AI.C---QIGDSFYCID------.....EE
Q880E4_PSESM/5-136------------------------------------VPKSWL--------PI.C---EDNGNYYCLL------.....ED
B3PC71_CELJU/34-164------------------------------------VPRYLM--------PL.C---EVNGNYYCVE------.....PE
D4RXT0_9FIRM/2-135------------------------------------LEKKYI--------VI.E---GDGELAYCLN------N....ET
A4Y9N5_SHEPC/1-119------------------------------------LPSELC--------PI.C---EDNSDYYCLN------.....QK
Q12R95_SHEDO/1-131------------------------------------LPRELI--------AI.C---QQGDNFYCID------.....QD
D0WEZ4_9ACTN/5-134------------------------------------LPDSLL--------VI.E---SCDEWLYCID------V....NT
A3QH89_SHELP/1-131------------------------------------MPREYI--------AI.C---QQGDDFYCID------.....QE
C1D4A4_DEIDV/3-141------------------------------------LPQFLV--------PFET---SQDGDAFCFD------TRSAGPE
A1S8W2_SHEAM/1-131------------------------------------LPREMI--------PI.C---QNGDNFYCID------.....QE
Q7M7B0_PHOLL/5-136------------------------------------LPENLL--------PI.C---EDNGSYYCID------.....YD
D1W447_9BACT/1-147------------------------------------LSNDLI--------VL.N---YEVGEYLTLY------KVSENQE

PF07348

C6RW74_VIBCL/5-179-------------------------------------PTVFI--------ATTE---D.EMAVVSVC------NLS----
B8K7V3_VIBPA/10-184-------------------------------------PTVFI--------AATD---A.ELDVISIC------NLT----
SYDP_SHEON/3-180-------------------------------------PTWFI--------GLLD---E.GDKMLTVD------NAD----
C3BLV0_9BACI/6-177-------------------------------------KNIPI--------GMEC---..NGLLVVVD------NEN----
C2X4F6_BACCE/18-189-------------------------------------DKIPI--------GVEG---..NGSLVVLN------NVS----
SYDP_ERWCT/5-179-------------------------------------PTLFL--------ATTD---S.EMTMVSLC------NVS----
Q6HGE7_BACHK/3-177-------------------------------------RYIQI--------GFVS---P.EDMAIIFD------NKT----
D4I9V3_ERWAE/5-179-------------------------------------PTLFI--------ATTD---S.ELEVISVC------NMS----
C2QKP9_BACCE/1-174-------------------------------------KFIPI--------GFES---..NGMLIVLD------NNT----
SYDP_SHEPW/3-180-------------------------------------PTWFI--------GVFD---D.EDKMITVN------NAD----
SYDP_PHOPR/5-179-------------------------------------PTVFI--------GVID---S.ADKVIAIC------NLT----
B4F2E3_PROMH/4-178-------------------------------------PTLFI--------GTTA---S.ENDIISVC------NLS----
SYDP_PHOLL/5-180-------------------------------------PTAFI--------ATME---SDDMGIISLC------NLT----
SYDP_EDWI9/5-178-------------------------------------PTLFL--------ASTA---D.ELSMVTLC------NLS----
SYDP_VIBF1/5-179-------------------------------------PTLFV--------AVTD---D.EMEVVSIC------NQS----
SYDP_ALTMD/5-178-------------------------------------PTLFF--------GLTD---E.EDFILTVI------NET----
A7GQ41_BACCN/1-173-------------------------------------DKTPI--------GVEG---..NGLIVVLD------NVS----
A9DDC7_9GAMM/3-186-------------------------------------PTWFI--------GVLG---D.GDKMLTVD------NSD----
A0Y507_9GAMM/15-191-------------------------------------ETVFI--------GLTD---K.EDLLVSVL------IHT----
SYDP_AERHH/5-179-------------------------------------PSLFI--------ATTR---N.EMTLVSLD------NES----
C6CEU0_DICZE/5-179-------------------------------------PTLFL--------ATTD---S.EMSLISLC------NLS----
C3BLV7_9BACI/3-176-------------------------------------KHIPI--------GIEG---..NGMLVVID------NEN----
SYDP_SHELP/3-184-------------------------------------ATWFI--------GVLG---E.GDEMLVVE------NET----
SYDP_SHEDO/3-180-------------------------------------PTWFI--------GVLS---D.GDTMITVE------NDT----
SYDP_SHEFN/3-180-------------------------------------ATWFI--------GVLG---E.GDEMLTVN------NDD----
SYDP_SHEAM/3-180-------------------------------------QTWFV--------GLIG---D.VDEMVSVN------NAD----
SYDP_COLP3/8-192-------------------------------------ETVFF--------AVTD---E.EDMIISVD------NSS----
SYDP_TOLAT/5-177-------------------------------------ITLFL--------ATVS---D.ESRVISLD------NET----
SYDP_HAHCH/6-185-------------------------------------LTFFI--------GLTA---..DDRIVTVD------NHS----
A3WM07_9GAMM/6-183-------------------------------------VTIFI--------GILH---EHDDCLVSID------NST----
A6F6I4_9GAMM/5-184-------------------------------------PTLFI--------ASCV---D.EMQIIALD------NVS----
SYDP_PSEA6/5-182-------------------------------------ETIFI--------ALTD---E.DDFVLSVD------NQT----
D2U272_9ENTR/7-182-------------------------------------PTLFI--------GSLD---S.EFEIISVD------NIT----
Q1ZGY9_9GAMM/5-180-------------------------------------ASMFI--------GTCS---D.EMQIISIA------NDS----
SYDP_PSYIN/5-180-------------------------------------ASMFI--------ASCS---D.EMQIVSVL------NAT----
SYDP_IDILO/4-175-------------------------------------ETVFI--------GLGS---EDDGLLVTID------NQS----
A4C5J8_9GAMM/3-179-------------------------------------PTIFI--------GLTE---E.EDLLLTLD------CTS----
C6CC04_DICDC/5-179-------------------------------------PTLFL--------ASTD---S.EMTLISLC------NIS----
E6WGC7_PANSA/4-178-------------------------------------PTLFI--------ATTD---S.EQDVISLC------NLT----
D4GLK5_PANAM/5-179-------------------------------------PTLFI--------ATTD---S.EENIISLC------NLS----
A6D8T1_9VIBR/5-179-------------------------------------PTVFI--------AATD---A.DMDVISIC------NIT----
C9P9P0_VIBFU/5-179-------------------------------------PTVFI--------ATTA---D.EMAVISIC------NLT----
D0ICP4_VIBHO/5-179-------------------------------------PTVFI--------ASTQ---D.ELDVVSIC------NVS----

PF14435

Q11UH8_CYTH3/2-179------------------------------------VETENE.....FNAVFMNSSLDKLAICIYLYEKFIEKFSTEESE
C3G535_BACTU/11-190------------------------------------IDYDNE.....NKVVLINSTIEKFAESLLVYVEFIKEVKAANGR
C3BLX0_9BACI/3-181------------------------------------LHHDNN.....YEEIFINSSIHQFAESLLLFSKLIDEAIQINGE
C3G534_BACTU/3-181------------------------------------LNNSDA.....YKEVFMNSSIQQFAACLLVYSKMIDKAVEINGE
D7C074_STRBB/3-186------------------------------------YEPGSSN....RKFALVNTSLERFLETAYQLRLKFKGLDLLYSA
E0QLS9_9FIRM/4-167------------------------------------ICNDEAYEVFQNRIVFVNSSLELFVSSYSFFLSKLFILKSKFY.
A3IE36_9BACI/4-165------------------------------------SSSVHH.....PLIYTLNQNLRTFFLFHLIKQEISMNIKKEGV.
D3GZ30_ECO44/1-160------------------------------------LYDIDECAN..FTMMYCNSGINDFIIFNNIFMQAVFKQSELMEK
B7LQU5_ESCF3/2-167------------------------------------ISNGKNDQCS.YSLIFCNTNINHFISFNNIFIFMVLEQAKILNY
B1VPR4_STRGG/6-176------------------------------------SGKSL......EHVVLVNTNLERFSLCVRGLIERYPFD.ADEG.
C6PRK9_9CLOT/16-217------------------------------------LEHEVIEE...VVTYFVNSSFSKFHESMNYFKKMKNEILKLKEE
B8CKE1_SHEPW/1-161------------------------------------LNN........SNLDFVATNPALFGKALEEFQACINAAVESNDN
A3ZNI5_9PLAN/58-240------------------------------------LDITAA.....PPQMFVNSSVLQFGQSLQAAVAWSQEREQFR..
D3E916_GEOS4/1-200------------------------------------VTEGGT.....QKPTYMNASIDSLLAFMDRVLRFKQQTERLQPD
E2N2L1_CAPSP/5-173------------------------------------LSTNDDYTD..ASVVWVNHSLDEFIKSYSRLLAGVFQLKGSDTS
C0DUS3_EIKCO/1-171------------------------------------YSPRAKNAW.EQEWVLVNSSLALFVQTYCRLMSAVFLLKADFAQ
B5HAW8_STRPR/39-232------------------------------------LAEGVD.....PAKRFVNSSMIDFLDALAAWEYRCEHVDDFDDL
E8RXJ9_MICSL/4-174------------------------------------LDLET......PNLETVNSTFAAFVEFLYRLGQLIATDP.....
D1A3F0_THECD/3-170------------------------------------LDLGDQ.....VGLEPVNSSLATFVEFLYRLEQFIRADQ.....
Q47PK6_THEFY/247-430------------------------------------VWAIDMRS...GAARYINRSVADFSHCLVVLAYTLPKMRGQD..
E4NDB7_KITSK/233-420------------------------------------VDPDT......CEARYCNADLTAFTRCLALLAEHRPALLDLP..
C9YY18_STRSW/732-910------------------------------------VPVEAGPGGAPVPPQFVNTGLPEFARCLALLGRMWRLRFGLN..
B5HAJ0_STRPR/6-189------------------------------------FTDAI......KELIPVHGDLSSLARTVSSFLEYIGTYSRHEDE
D6K842_9ACTO/6-208------------------------------------LDPDE......ETVRGLHTDVSSLVEVAFRFQRLLEEFAFGGDH
B5I6T5_9ACTO/6-184------------------------------------LPGDE......SEIYPLNKDLPSFANFLYLLEKERPNYDFDSEL
E4N1Q1_KITSK/249-422------------------------------------VPDG.......EAPQLAATRIDAFVLALHALEAERPFYEPGLRY
D1A5L5_THECD/6-199------------------------------------VSEMEYE....DEAALLNSDITCLAYFLYILDRAHQPDFDPARF
D6K293_9ACTO/144-316------------------------------------RTAQG......PALHPLAKDVSTFTCALWLLHGEDRDTA..PT.
D6KEF7_9ACTO/214-404------------------------------------TEFQA......DHVVPVNADVSTLAFTLWLHQREQELNQEHDF.
Q82D46_STRAW/203-389------------------------------------WSEPD......GMLRPLNTDISTLAFTAWLLHREKALDADHDL.
D9WNF8_9ACTO/13-197------------------------------------YDPNGWDHG.RGYKGTVASSLPSLAVLLGLLAERAEAIDAIED.
Q2U157_ASPOR/71-266------------------------------------YNGDCYDSL.GRDRGLVAQGLDSLAVLLGMVVAVTKDLRESPLD

PF02393

C8CFJ8_HCMV/54-179ET............DG--------LY--------EVA.S--------DIKAFSKN-GL------------------LW--
C8CFJ9_HCMV/42-158SQ............EI--------LL--------LCA.R--------HLDELARY-GM------------------MY--
A8T729_HCMV/26-179DR............GV--------LY--------YLA.H--------SLDDFARH-GL------------------LH--
A8T728_HCMV/45-168RE............KY--------MV--------LVS.H--------NLDELARY-GV------------------SR--
D3YRX5_HCMVO/17-135LR............DC--------VY--------ELA.P--------TMKDFLRH-GF------------------RH--
D2K4G8_HCMV/126-245VV............ES--------LY--------LVSRS--------GFRGFVQE-GL------------------RN--
UL298_HCMVM/399-518GE............DK--------VY--------VLG.L--------SFGEFFEN-GL------------------FA--
B9VXJ9_HCMVT/55-169QE............DC--------LY--------ELA.S--------DLAGFFAK-GM------------------IR--
D2K5D0_HCMV/11-135HIY..........SDS--------LT--------FVA.E--------SITEFLNI-GL------------------RR--
B9VXD4_HCMVT/116-247AN............NT--------LI--------LAA.R--------DADEWFRH-GA------------------GE--
D3YRW4_HCMVO/11-132ED............TA--------VY--------YLA.R--------NLMEFARV-GL------------------RA--
D2K4S5_HCMV/202-333ED............SD--------LY--------RIA.D--------NFHMFLKC-GL------------------LK--
D3YS52_HCMVO/180-322KSHLDRSPPLQRLAGE--------IY--------RLA.D--------SLEELFRA-GL------------------MK--
D2K3X0_HCMV/202-332SR............RE--------IW--------RLA.D--------SVDMLLTV-GL------------------LK--
A8T728_HCMV/200-332DDP..........NHY--------VR--------RVA.N--------TITEFFRM-GL------------------LK--
B8YE72_HCMV/157-296AM............DA--------VY--------RLAED--------VVMFTCVM-GK------------------KG--
B9VXG6_HCMVT/274-510LD............GH--------VY--------PLA.A--------ELSHFLRA-GV------------------LG--
B9VXL1_HCMVT/265-382ET............RQ--------AH--------FLA.R--------GLLGFFRV-GF------------------LR--
B9VXJ9_HCMVT/546-653G.............TM--------LV--------KLA.E--------TLRGFIRQ-GS------------------FW--
D2K5D5_HCMV/214-331GQ............DK--------LV--------RLA.R--------DLRGFVRV-GL------------------AL--
D2K5D0_HCMV/151-256..............QH--------VC--------IVA.D--------SLMEFVTR-GM------------------TR--
B8YE60_HCMV/153-278RD............DR--------YI--------RVG.D--------NLNTFMCL-GL------------------NL--
C8BKJ5_HCMV/34-153..............GI--------LF--------FLA.P--------SMAQFWHG-AI------------------VL--
D2K595_HCMV/6-123SR............EN--------FV--------VRAAD--------SLQQLLER-GL------------------LH--
B4YEM5_9ALPH/49-167..............DT--------LH--------KLA.T--------SFSEFLEI-GV------------------KS--
D2E8A7_9VIRU/5-121..............DE--------LH--------YMAPS--------IAELDTNV-SP------------------TT--
C3RWK6_9VIRU/35-153..............EE--------IL--------LFA.Y--------SVKQLVEE-GI------------------QE--
C3RWV3_9VIRU/65-186..............ER--------LY--------LFA.D--------SLQKLVKD-GI------------------KT--
Q070N0_CPRV/47-172..............QE--------VH--------VLA.S--------SLEQFLRD-GV------------------LN--
B1NFI8_ADEGX/15-131..............DT--------LH--------KLA.S--------TIPEFFRI-GM------------------QN--
Q4KS78_ISKNV/1-104..............DE--------LH--------LVATG--------GMEQLRRR-GL------------------EY--
B5XAY6_SALSA/21-139..............EV--------LH--------LVA.R--------SLEDLFET-GA------------------EF--
C3Y900_BRAFL/167-275..............DI--------VY--------NVA.D--------TLSDFAAY-GC------------------PN--
C3Z365_BRAFL/157-265..............EI--------VY--------NVA.D--------TLSDFADQ-GC------------------PQ--
C1C3V1_LITCT/15-136..............EV--------LF--------LHA.N--------SLEYLVKD-GI------------------KN--
Q14VM9_9VIRU/5-123..............HK--------MW--------YAA.Y--------SLQHLLEE-GV------------------CN--

PF14433

C3WDW2_FUSMR/11-172YRNDCMEQYD----SI--------FD--------YLE-Y--------NFRYYLGN-EI------------------YV--
F0KCA1_CLOAE/2-150..........----..--------HG--------FFG-N--------NAEEFWDR-IL------------------NY--
C3BLQ7_9BACI/6-145..........----..--------TG--------WVG-D--------NALEAFDN-NI------------------LG--
F0KCA3_CLOAE/3-152MWAED..SDN----FW--------NG--------LLG-E--------YKSGFLNW-ID------------------YK--
B1HSL5_LYSSC/5-144D.........----YY--------IW--------KIG-C--------GIYEALNN-LC------------------EG--
C0Z7L3_BREBN/2-133..........----..--------.G--------KLG-D--------NSIEAWEN-LI------------------SG--
B7N9G4_ECOLU/6-148N.........----.Y--------FC--------IIG-G--------NINDAMLH-LF------------------FE--
A8RVU3_9CLOT/13-150..........----.T--------RR--------RSG-S--------PSTGNCMR-NM------------------ST--
A9B4M5_HERA2/3-169SNYY....HP----KG--------LS--------LLG-E--------SLPLAMQR-LL------------------QS--
C2M481_CAPGI/2-151LTSWV..PRK----TY--------YH--------FYG-G--------DLYTALEN-II------------------KG--
A9B4M4_HERA2/9-180GGLAD..VTK----SV--------FK--------IWG-T--------TPSEGLNA-LA------------------EY--
A9B983_HERA2/9-180FMN.....PA----PG--------LV--------VLG-S--------NIETALNQ-LA------------------HQ--
D1ALL2_SEBTE/5-152E.........----.S--------VI--------EFG-N--------NLNTVLYN-LK------------------NG--
C2G2C6_9SPHI/5-144..........----.Y--------CF--------YVG-V--------DLYEGIEN-IL------------------LM--
A9DRL2_9FLAO/4-142..........----.F--------PA--------KFT-T--------NFKKGIEK-II------------------LE--
D7VVD7_9FLAO/4-136..........----.S--------YF--------KMN-T--------IFIKGIEN-LI------------------ED--
D6B4A2_9ACTO/10-151G.........----.W--------IW--------ELG-S--------TFEDSLEL-AV------------------CA--
C5UVJ4_CLOBO/2-147..........----GF--------LC--------KDG-E--------NIEEMLDC-VV------------------GE--
A4A0B2_9PLAN/1-122..........----.E--------LR--------LYA-L--------DIYGAIEC-LL------------------LD--
A2W0F4_9BURK/45-178VM........----DG--------VY--------LAG-F--------TFGDAIER-TL------------------LG--
B7WUX3_COMTE/6-150V.........----.G--------MS--------FEG-E--------NIQQALEH-LL------------------LG--
C6DGM5_PECCP/1-142E.........----.C--------V