Sequence alignment for CL0530

PF14529

D7EM17_TRICA/220-332--------------------------------------------------------------------------------
D8Q682_SCHCM/470-595--------------------------------------------------------------------------------
A7ENE7_SCLS1/419-538--------------------------------------------------------------------------------
A7EV44_SCLS1/169-288--------------------------------------------------------------------------------
B7Q7X7_IXOSC/39-155--------------------------------------------------------------------------------
E9HS52_DAPPU/293-409--------------------------------------------------------------------------------
E9H8A1_DAPPU/103-219--------------------------------------------------------------------------------
E9HMD6_DAPPU/94-210--------------------------------------------------------------------------------
E9H5U8_DAPPU/53-167--------------------------------------------------------------------------------
B7PJV5_IXOSC/324-438--------------------------------------------------------------------------------
E6ZRW9_SPORE/1185-1312--------------------------------------------------------------------------------
E9H822_DAPPU/420-535--------------------------------------------------------------------------------
E9HYG6_DAPPU/19-132--------------------------------------------------------------------------------
E9HDY2_DAPPU/149-262--------------------------------------------------------------------------------
E9HRI7_DAPPU/460-571--------------------------------------------------------------------------------
E9HZZ2_DAPPU/118-231--------------------------------------------------------------------------------
E9HRK8_DAPPU/106-221--------------------------------------------------------------------------------
E9HSQ7_DAPPU/121-236--------------------------------------------------------------------------------
E9HE10_DAPPU/492-604--------------------------------------------------------------------------------
E2C5Q1_HARSA/10-124--------------------------------------------------------------------------------
B0W1L0_CULQU/467-584--------------------------------------------------------------------------------
D7GXY3_TRICA/106-218--------------------------------------------------------------------------------
D2A4F4_TRICA/101-212--------------------------------------------------------------------------------
E2AVN7_CAMFO/107-222--------------------------------------------------------------------------------
B6QWM9_TALMQ/555-687--------------------------------------------------------------------------------
A2QSQ0_ASPNC/504-636--------------------------------------------------------------------------------
Q2HHJ7_CHAGB/475-603--------------------------------------------------------------------------------
Q2H3B9_CHAGB/415-543--------------------------------------------------------------------------------
Q2GZF1_CHAGB/632-760--------------------------------------------------------------------------------
E9FE00_METRA/199-327--------------------------------------------------------------------------------
B6QNK9_TALMQ/286-414--------------------------------------------------------------------------------
B6H8V5_PENRW/395-529--------------------------------------------------------------------------------
Q2U1R5_ASPOR/105-240--------------------------------------------------------------------------------
A2QZW2_ASPNC/91-226--------------------------------------------------------------------------------
Q2TX40_ASPOR/104-239--------------------------------------------------------------------------------
B8MUV7_TALSN/118-253--------------------------------------------------------------------------------
A6R6U1_AJECN/368-494--------------------------------------------------------------------------------
A7S3V7_NEMVE/68-188--------------------------------------------------------------------------------
A7S2X0_NEMVE/168-291--------------------------------------------------------------------------------
C3YN84_BRAFL/1345-1466--------------------------------------------------------------------------------
D6WYM2_TRICA/271-393--------------------------------------------------------------------------------
A7S0T7_NEMVE/341-458--------------------------------------------------------------------------------
E3N7S5_CAERE/136-251--------------------------------------------------------------------------------
E3MXD9_CAERE/375-485--------------------------------------------------------------------------------
E3MA06_CAERE/30-140--------------------------------------------------------------------------------
E3LJB4_CAERE/350-458--------------------------------------------------------------------------------
E3N681_CAERE/36-144--------------------------------------------------------------------------------
E3ND32_CAERE/223-331--------------------------------------------------------------------------------
E3MKX6_CAERE/106-217--------------------------------------------------------------------------------
C5KXY0_PERM5/413-539--------------------------------------------------------------------------------
A6RES2_AJECN/586-706--------------------------------------------------------------------------------
B6QF01_TALMQ/823-943--------------------------------------------------------------------------------
B8MCU2_TALSN/715-835--------------------------------------------------------------------------------
A6QSA7_AJECN/584-704--------------------------------------------------------------------------------
Q0TWS8_PHANO/49-171--------------------------------------------------------------------------------
B7PHI8_IXOSC/55-177--------------------------------------------------------------------------------
C5LYL7_PERM5/137-253--------------------------------------------------------------------------------
E0VEI2_PEDHC/13-127--------------------------------------------------------------------------------
E9GSG1_DAPPU/115-230--------------------------------------------------------------------------------
B7QBV7_IXOSC/96-214--------------------------------------------------------------------------------
B7QN21_IXOSC/94-212--------------------------------------------------------------------------------
B7PD65_IXOSC/108-226--------------------------------------------------------------------------------
B7PS20_IXOSC/108-226--------------------------------------------------------------------------------
B7PXF9_IXOSC/95-213--------------------------------------------------------------------------------
C5K8V2_PERM5/55-185--------------------------------------------------------------------------------
B4HD52_DROPE/236-352--------------------------------------------------------------------------------
E2AWP2_CAMFO/83-203--------------------------------------------------------------------------------
E2B1G0_CAMFO/3-123--------------------------------------------------------------------------------
E2B0F5_CAMFO/1-121--------------------------------------------------------------------------------
E2BFV3_HARSA/10-133--------------------------------------------------------------------------------
E2AA34_CAMFO/86-207--------------------------------------------------------------------------------

PF03372

APEA_DICDI/108-351ISWNVAG.....................................................FKSVLSKGFTEY...VEKEN
C0W5Q6_9ACTO/5-307LTLNLQHALPGPGALSD.................PATAPLARADIT...DPAAARQVLGALALQLREI...........S
Q9ZBN3_STRCO/24-259ATYNIHA......................................G...AGSDGVFDLDRQAAALRAL...........D
A7T3Q8_NEMVE/115-319CHWNARS.............................................FNNDKYEQIKEILTHP...........R
B3SRB8_ASCTA/220-428ITVNVNG.............................................YSVAKAVQIRNLIDKH...........H
B8MHG3_TALSN/453-675LQLNIGH............................................APDAHEIALTLAYTSDI............
Q1QVQ0_CHRSD/109-317LVANVLT....................................SNR...QSAS.......LMRQIRET...........D
A0M2U8_GRAFK/107-314LVSNVLT....................................PNK...RSDK.......LISLVNEK...........K
A6CGC2_9PLAN/130-329LFWNIGD.................................................RLWGLEHAINEM...........R
INP5K_MOUSE/37-330VTWNVAS.....................................AA...P.......TVDLSDLLQLNN........QDL
RRP1_DROME/430-670CSWNVAG.....................................................LRAWLKKDGLQL...IDLEE
C7QE92_CATAD/155-383LSQNLSS...........................................GDAGAPDLSGIGQLAEQR...........G
C0W5C1_9ACTO/126-340LSFNTYM....................................GRA...KVID.......LALEVRQV...........A
A9DSA8_9FLAO/61-246VVWNAYR.........................................................................
A3ITE0_9CYAN/5-368ATFNASLNRNSEG.........................ELIADLL......TPNNEQGQTVAEIIQRV...........N
C7ZMD9_NECH7/94-389ASWNLFFT...................................SRG...PATRATAALDHLRTLFGQE...........P
I5P2_CAEEL/8-272FTYNLAM.....................................KA...S......DSEAVHNML..............N
C1A7M1_GEMAT/266-540AQWNVSEGSF...............................RKPEM...HARL.......LAAVMP..............
Q9RZQ3_DEIRA/490-782GGANVLNYFTTYG.........................GSTDRGAN...NAGELARQRAKMATTLTTL...........N
O27012_METTH/6-222LTWNLNR....................................ASY...RRRK.......LWSYMGEL...........E
Q08525_CHICK/66-271LYTNAHS............................................LSNKQDELETVMHLESY............
Q0CY83_ASPTN/48-313TTWNIDFQ...................................VPC...KNERTAAALRYLSQRPPAP...........Y
C2Q910_BACCE/40-333LTWNIYQGFNVTPLFAAPP.............KLIPEVVTQVFRQF...LATNFPVRAKAIAKAIASE...........K
O15921_TRYCR/109-396ITWNVAG.....................................................LRGLLRKDDQAIQRLLEEEG
A3ZS40_9PLAN/129-366ASFNIQV....................................FGR...SKADKPHVMARLAQIVRQY............
Q11NA1_CHESB/104-316VTANVYV....................................DNP...DPAD.......FLSLPSIA...........A
Q0URF7_PHANO/122-382ISWNIDVL...................................IGF...AEQRMRAALRYMHEVVTST...........P
Q0FLB9_PELBH/11-291AIWNADLSREGPG.........................LLLRDLR.........DGEGAGLVAEVAAV...........A
Q9ZVF0_ARATH/390-645GEVSILSNSYS.............................ALNGKD...ESGEDIITADSVEKQAEET............
Q9RS34_DEIRA/101-311LTYNVAR.............................................GSQGTAAALLSTLQAS...........D
C4FH07_9BIFI/165-380MTLNAKE....................................GAA...DADH.......IVRMVRDE...........H
B7S366_9GAMM/60-266LSWNIQK............................................ASNSGWMEDLLMLGGES............
M6BNC3_LEPBO/89-364LTHNVFL.....................................................LPKTLPGW...........G
YAFD_ECOLI/47-252LVWNIYK............................................QQRAEWLSVLKNYGKDA............
Q9F2J2_STRCO/121-324LTSNVEF....................................GQG...TDA........LIAAVRRE...........K
Q7USG9_RHOBA/118-325LVTNVEM....................................END...RFEQ.......WSQVIRDT...........D
A3SVB7_SULSN/110-316LASNVKQ....................................SNR...QYQR.......LIDLIRTE...........D
A5FED8_FLAJ1/31-384ATYNVSMESDNYSPKGAM...............GKSEQILIYQLN......SGVNAQIRNIAHIIQTV...........R
DNAS1_BOVIN/26-274AAFNIRT....................................FGE...TKMSNATLASYIVRIVRRY............
Q54E13_DICDI/8-231ITWNCRGFT................................ENPNN...QHNSYQKAVDTLQLLISKL...........P
D3R3H2_BIFAB/133-356FTLNCRY....................................GEA...NAHE.......IVNTVRTN............
Q0PC57_CAMJE/24-257GTWNLQG......................................S...SAATESKWSVSVRQLVSGA...........N
Q1MZ88_9GAMM/34-259LSFNIQVGIETQAYHQYLT.............KSWQHLLPQMHRNL...ALRR.......IAQVMTHF............
Q9VXE7_DROME/36-332VTWNVGS.....................................RF...P.........DNISLRHLLGLQDVTVDKDTK
DNSL2_HUMAN/25-288GAFNIQS....................................FGD...SKVSDPACGSIIAKILAGY............
Q9U4W1_AEDAE/10-212IQWNMNG.........................................................................
O15922_LEIMA/133-437ITWNVAG.....................................................LRGLLKKNASALRAFMEAEK
Q2PWA8_MONPI/4-202IQANVGR..............................................GGPSHDLLLSFTA..............
V9FYL2_PHYPR/6-366LTFNIFF..........................................DEVARSMRMKAIGRLVEHF...........R
Q9SN65_ARATH/347-583MLYNQAEAEEESAV.......................LGHIRKRDK...KGIGVPLTQSQLSNLCKVF...........K
Q985E5_RHILO/120-323LQMNLRF....................................NNP...TPKK.......VLSLIGRT...........N
SMASE_MYCTU/228-473LTYNIAGLP................................FPLSS...AILPRFFYTKEIGKRLNAY...........Y
CDTB_ECOLX/26-261ATWNLQG......................................A...SATTESKWNINVRQLISGE...........N
Q9PTX0_XENLA/23-272ASFNIQR....................................FSM...TKVDDPVVLELLMRILSRY............
C4RQR9_9ACTN/168-411FSWNTEY............................................WYDGADPQHFHDYLAAQ...........R
Q9YI04_XENLA/21-271CSFNVQS....................................FGE...SKRDKPAVMNVVRKIISRC............
Q3JBC2_NITOC/104-311LIANVLM....................................GNR...NVQR.......FLAIVREA...........D
O34095_LEPIR/84-361LSYNLFM.....................................................YHKGLFNS...........G
Q315C8_DESAG/101-322LSCNLRV....................................GEV...DFEA.......LSRVVREY...........D
O77366_PLAF7/563-897LSYNILAPIYTNTKYA...................LEHMFKNIDPC...YLKTNYRSHLLIHDINNNY............
A6GK21_9DELT/6-259LAWNVRKFGG...............................KRSKV...RVER.......VAEFIHSF...........D
D5UUF8_TSUPD/40-343LTINTWM..........................................NGTKVPDGLNRVAAVIRQV...........D
B1LXH2_METRJ/33-216VSWNLLR.............................................RTGAAVDDVAALVAQE...........R
O46184_DROSU/14-220LQINLHH.............................................CKAASAALILRLVASG...........G
A6VUZ0_MARMS/30-246LLWNVFK............................................CKRKGWQSDFASLINNK............
Q8I3R5_PLAF7/2121-2476MTWNVLAEIYGTI.........................EAFPHCDP...YMLAWSYRKTKIIQEILNN...........S
O22148_ARATH/4-222LSWNCQG............................................VGNTPTVRHLREIRGLY...........F
P96273_MYCTU/27-281ATWNVNS....................................IRT...RLDR.......VLDWLGRA...........D
APEX2_HUMAN/5-304VSWNINGIRR..............................PLQGVA...NQEPSNCAAVAVGRILDEL...........D
Q9RKB3_STRCO/12-265TSVNVNG.....................................................LRAAAKKGFVEW...LAGTS
Q63291_RAT/38-257ISLNING............................................LNSPIKRHRLTNWIRNE...........D
INP5E_RAT/307-587ATWNMQG.....................................QK...E......LPASLDEFLLPTE........ADY
A5V5B1_SPHWW/53-337MTYNVEGLPWP............................ARFGRGD...ALARIGERLAALRATGAQP............
Q281W3_PHACH/39-344ATYNLRF.............................................DSMPDNITVQQTLAAL...........P
B2B0A0_PODAN/123-383WSWNIDFK...................................LDV...PVARMRAALNHVRSLVASQ............
DNAS1_CHICK/24-272SAFNIRT....................................FGD...SKMSNQTVAGFIVSILVQY............
C5C387_BEUC1/53-411ATFNASLNRAAAG.........................ELVADLS......TPDDAQAATIAEILQRN...........R
SHIP1_RAT/411-703GTWNMGN.....................................AP...P......PKK.ITSWF..LSKGQ..GKTRDD
EXOA_BACSU/4-243ISWNVNG.....................................................LRAVMRKMDFLS..YLKEED
IP5PC_ARATH/581-914GSWNVGQ.....................................GK...A......SHDALMSWL..GSV......ASDV
H2PHM7_PONAB/192-531MCYNVLCDKYATR.........................QLYGYCPS...WALNWDYRKKAIIQEILSC...........N
INP52_YEAST/596-874GTFNVNG.....................................NS...R.......RADLSKWL..FPI......GDKF
IP5PD_ARATH/576-908GTWNVGQ.....................................GR...A......SHDALMSWL..GSV......TSDV
RTJK_DROME/9-214GLWNARG..............................................LTRGSEELRIFLSDH...........D
B9J7A5_AGRRK/98-299LSFNIENS...................................NFE...NGTR.......IADLIVGS...........N
O86610_STRCO/4-250ATWNVNS....................................ITA...RLPR.......LLAWLESS...........G
A3VZN2_9RHOB/19-338ASWNVKLDRAGPG.........................LLLRDIL......SGSDPQIEAVAGVLLVV...........R
H2R3J5_PANTR/15-385VTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN...YEASMSHVDKFVKELLSSD............
EXOA_STRR6/4-266ISWNIDS....................................LNAALTSDSARAKLSQEVLQTLVAE...........N
PI5PA_HUMAN/428-721VTWNVGT.....................................AM...P.......PDDVTSLLHLGG........GDD
D1AXA7_STRM9/113-329VEWNVEN...............................................ELESKSIYKIFGEF...........D
Q1GKT6_RUEST/32-332ATFNTELSRKGPG.........................LLLRDLR......RGDD.QIRAVVGTIVEA...........G
Q2H5K7_CHAGB/308-508LLWNTEG.................................................NKQALEALLEEA...........Q
A1SIW4_NOCSJ/70-299AQANIPR...............................................RSGLDGFRASMPKV...........L
Q9ZDR5_RICPR/4-252VTWNINS..............................................LRLRIDLLRKLAYEH...........Q
D7WDI6_9CORY/121-321VTYNSQN.....................................TL...TAAD.......VQDIVDRF............
Q07995_CHITU/11-220LYWNANG..............................................LTDKMLAFLDYLSKQ...........N
Q9S2L9_STRCO/24-240LSYNIRS..............................................LRDDTDALARVIKAC...........A
NSMA_CAEEL/42-318VTLNAWCLP................................QPWPI...GSTDRVHRLNKIGQYMIDE...........L
O93520_ORYLA/9-231LTLNING............................................LHNPVKRWKTLSKLKQD...........K
Q5LX09_RUEPO/24-347ATFNTELSRKGPG.........................LMLRDIA......GGRDTQVAAVVSVIASA...........R
NSMA_DROME/9-264LTLNIWG....................................IPY...VSSDRRPRIDAICKELASG...........K
Q9SIQ5_ARATH/113-377LHAKLAGVKTDAPVEK..................DLLLESSDNAQN...EFVFMKRKRVRLEEMYQQV..........EA
Q83GA3_TROWT/91-308VTQDMNSEASV.............................SEAQTT...HRSRNNSPPDNINRDVKTL...........L
Q2C5E7_9GAMM/445-703MEFNTLGK..................................SASG...TEVAPVHGSEYAAEIIRNN...........N
A1RCE7_ARTAT/41-258LNWRGASHYTRN...........................PHPGERP...YRER.......VPNMVTKI...........G
D2B0I5_STRRD/117-322LTLNMLF....................................GGA...EPEP.......VTALVRRL...........R
Q15NA1_PSEA6/104-315INSNVLM....................................TNH...DAPK.......LLKLVDQE...........K
Q9P8H7_CANAX/14-261GSKNIGS......................................H...QSTDFKKLLDIFLKLIGEH...........S
Q9VTW2_DROME/396-695GTWNMNG.....................................HS...P.......PKQLNDFVLPAN........VEH
A6W517_KINRD/120-329LAANVLH....................................GQA...DPAA.......LTRLVVDG...........G
A5C0G0_VITVI/310-530ISWNCRG............................................LGNPRTVLALCEINKSR...........K
A7T4C3_NEMVE/164-372GSWNVDC.............................................LTMPKFEQLKLLMLDK...........D
CCR4_SCHPO/339-664MSYNVLCERYATS.........................TLYGYTPS...WALSWSYRKDLIMQELGGY...........N
D2B2Z6_STRRD/114-320LASNLAR....................................GDA...DTKT.......IMDLVVRL...........K
SYJ1_SCHPO/563-839ASYNLNG.....................................CS...A.......TTKLENWL..FPE.......NTP
Q1D7J7_MYXXD/85-296VTFNLSF.....................................AE...KVTE.......AITALSRP...........P
C0X2X7_ENTFL/9-266HSWLEEE..............................................PLKKLEEIAKVILSS...........E
Q2UNN7_ASPOR/69-326YTWNIDFM...................................VPF...AAARMRPALAHLYQLTRLL...........P
TYDP2_CAEEL/123-353MSWNIDG......................................L...DGRSLLTRMKAVAHIVKNV...........N
C2L0P4_9FIRM/115-330VEWNVAN...............................................NINEENIRDIFGRF...........D
Q9SA95_ARATH/176-431LSYNVWF......................................R...EDLELNLRMRAIGHLIQLH...........S
Q50321_MYCPL/166-460GHWNVLK..........................................LSDKNDKKIAAIAALIKKI...........D
B0WQS5_CULQU/1836-2048MSINVQS............................................LRAHQMDINTDPVLPRV............
A0JXK8_ARTS2/115-328MTINSEF....................................GQA...EAAG.......IVRLVREN...........G
Q24335_DROME/7-215ATWNANG..............................................VSQRKLELAQFLHEK...........H
O83555_TREPA/304-613ASYNVENFS................................AGNKA...DSARARVFAKHFVNDLKAP............
E8RN27_ASTEC/87-283IFANLYV....................................NNE...TPER.......LLDWVTAE...........N
D0KX69_HALNC/290-639ATFNTYLNRTVEG.........................ELAADLG......AGD.AQAAAVAEIIQRV...........R
Q5L902_BACFN/414-668LQWNIWHGGI...............................HLGNE...GQQR.......VLDLIRSS...........R
Q1CXT2_MYXXD/230-492GNWNIEWFG.................................DPLN...GPNDELLQLTNAQAVIADA...........G
EEPD1_XENLA/257-520ATWNLQNCSL...............................DKANN...PGVREVVCMTLLENSIK..............
A4A5W6_9GAMM/35-389ATFNVSMEGGNYVGKGV................TPSGHELPAALS......NSEHPQIKNIAEIIQRI...........R
D9QM28_BRESC/100-303YSANVWV....................................GNT...DVGG.......MARSIEAA...........G
O05382_AGGAC/4-259MSFNING....................................LRA...RPHQ.......LEEIINKY...........Q
YNTB_SCHPO/124-492MTYNVLAQTNIR..........................RSMFPHSG...EALKWKNRSRMLANELTYY...........S
NGL1_YEAST/30-353LTYNMLSPSYMWP........................QVYTYVAEP...YKNWSYRHRLLEKELLNTF...........K
NGL3_YEAST/112-485MTYNTLAQTLIR..........................RDFFPESG...PALKWHKRSKVLVHELKKY...........R
APN2_YEAST/20-354LTFNVNGIRT...............................FFHYQ...PFSQMNQSLRSVFDFFRA.............
SYNJ1_RAT/538-859GTWNVNG.....................................GK...QFRSIAFKNQTLTDWL..LDAPKLAGIQEFQ
A7T299_NEMVE/40-247IHLNINSCQ.................................NKLD...ELLL.......LNKELRSH............
O68855_9STAP/43-321VTHNVYM.....................................................LPKSL..Y...........P
O13348_MAGGR/17-223VWANVGK..............................................RMGVHLSLLELCHQR...........K
Q9Y026_TRYCR/56-263LQMNVSC......................................L...TPSK.......LATLMAQG...........A
D2AT04_STRRD/93-301LSSNLEV....................................GGV...PPTA.......LVDLVRRL...........R
Q9Y1H3_DICDI/7-211LLWNCRGNQS...............................TNAKN...KTEE.......TIKRIGTQ............
C5BVQ8_BEUC1/110-317LQLNTYG....................................GAS...SPED.......VARLAYAA...........Q
P74492_SYNY3/14-266ASWNVNS....................................VRS...RQQH.......ILDWLGTN...........P
A4EK32_9RHOB/102-307MAVNVLM....................................ENT...RYDD.......LINIIERE...........D
C7PRF4_CHIPD/618-892VNWNIEWFG.................................SPVQ...NPANDSLQQANVTTILKKM...........D
TYDP2_HUMAN/117-351ITWNIDG......................................L...DLNNLSERARGVCSYLALY...........S
A3TK42_9MICO/109-315AASNLQF....................................GRA...EPGA.......IVDRIRTL...........D
DNAS1_HUMAN/26-274AAFNIQT....................................FGE...TKMSNATLVSYIVQILSRY............
Q9NAL5_CAEEL/311-526LLANVRSC..................................KKLE...KASQ.......LCAKLHSN............
A7C3D0_9GAMM/108-325LHWNVKWGGI..............................GYNGHL...TSQYTGDEWPSIREDIFQH...........Y
NSMA_HUMAN/12-272FNLNCWG....................................IPY...LSKHRADRMRRLGDFLNQE...........S
O65598_ARATH/3-223CGFNIPS.................................................HRNGFKKWFKVN...........R
C5NNP0_ORYSI/360-581IFWNSRG............................................LLDLAKYRYVAENIKEH...........N
Q9ZQF8_ARATH/4-230ISWNCQG............................................VGPKTTSRRLEEMCRMY...........S
Q17003_ANOGA/83-316YYQNVRG.....................................................LRTKTKEF...........H
LIN1_NYCCO/10-229FSINVNG............................................LNCPLKRHRLADWIQKL...........K
O97240_PLAF7/281-607VTWNMNS.....................................................ITVRYKNK...........K
A1U6L7_MARHV/41-269LTFNIQVGINTSSYHHYLT.............RSWQHFLPNRRRYE...NLDR.......IATLLSQY............
Q5QUK7_IDILO/105-312MTANVLT....................................PNH...NSDG.......LLKLVHDF...........T
A1T8I1_MYCVP/118-329LQTNIKL....................................GEA...DVPA.......LAGRVRSE...........G
B1KQZ4_SHEWM/42-455ATYNLSFDRATFEDLVSEMQITAP...EQEVLMQGWFDKTLTDDEL...KVAEKVIQIRNVAAVIQTE...........R
A3XAE4_9RHOB/4-211LVANVLT....................................TNR...SVER.......VLDLVRAQ...........K
A8M5G8_SALAI/105-315LTANLLA....................................GSA...DARA.......LVDLVRRH...........S
Q2SQK9_HAHCH/44-408ATFNASLNRSAPG.........................ELIADLN......SGDNAQIQAVAEIIQRT...........Q
Q1JZE6_DESAC/7-207ISYNLQG...............................................CHDSGAVFQLIDHY...........H
O42110_9SAUR/47-252LYTNARS............................................LGNKQEELEVLAQSRNY............
OCRL_HUMAN/245-524GTWNVNG.....................................QS...P.......DSGLEPWL..NC........DPN
O44201_BOMMO/8-204LQCNLNH..................................................SARAQDLLVHT...........M
A4BGZ7_9GAMM/1324-1668ATFNAYLNRSSEG.........................QILADAQ......SGDDAQIQNVAEIIQRV...........R
C2G3V9_9SPHI/103-310MISNVYE....................................DNN...NYDG.......CIGVINDT...........D
YBHP_ECOLI/13-244LTINIHKGFTA............................FNRRFI...............LPELRDAV...........R
G3XDB0_PSEAE/4-246ISVNVNG.....................................................IQAAAERGLLSW...LQAQN
Q04135_DROME/7-214SLWNANG..............................................VSRHTQELTQFIYEK...........N
Q9XAL0_STRCO/104-321ASHNVGA....................................ENP...DPAG.......TARDLAAS...........G
Q9ZAB7_AGGAC/30-274ATWNLQG......................................S...SAVNESKWNINVRQLLSGE...........Q
Q9YGS2_TAKRU/70-277GLLNIRS..............................................LLCKSLLVHDLIADH...........H
Q7UV93_RHOBA/76-326ATFNIQV....................................FGK...SKSEKPDVMRQLAQVCLLF............
PHL3_BACCE/40-305MTHNVYM.....................................................LSTNL..Y...........P
Q868R2_ANOGA/5-211LQFNANH..............................................CENAQDLALHVITTE...........S
Q9X9W4_STRCO/312-604ATYNVEN....................................LDP...SDDTFTAHAETIVHRLKSP............
A4ESR5_9RHOB/34-347ATYNTEFSRRGPG.........................LLLRDIE......RGTDPQVKAVLQVIQEI...........Q
C6RT65_ACIRA/105-312IVSNVLT....................................PNT...QYHL.......LIEQIQKY...........Q
APE2_ARATH/4-324VTYNVNG...........................................LRQRVSQFDSLLKLLDSF...........D
APN2_SCHPO/4-295LSWNVNGIQ................................NPFNY...FPWNKKNSYKEIFQELQA.............
A6ENA6_9BACT/100-307FAANVLQ....................................TNK...EYDK.......LIAEIKEK...........D
DNAS1_OREMO/30-276GAFNIKS....................................FGD...TKASNATLMNIITKIVKRY............
SYJ2_SCHPO/573-851STFNANG.....................................KV...P......STDEFKRLL..LPFGE...RTSAY
Q9SIS9_ARATH/366-584GFWNCQG............................................LGQPLTVRRLEEVQRVY...........F
A3SUZ8_SULSN/8-305ATFNTELSRAGPG.........................LLLRDIA......KGSDPQITAVTRLLADV...........A
C3JMR5_RHOER/45-349LSLNTWH..........................................GGTKINGGLQLIADMIIST...........Q
B8K751_9VIBR/38-447ATYNLSFDRATFEDLVKEMQIEPK...QQTALVTRYLDGSISEEDK...QTAEKVIQIRNVAAIIQKN...........R
CCR4_YEAST/508-818LSYNTLCQHYATP.........................KMYRYTPS...WALSWDYRRNKLKEQILSY...........D
ANGE1_HUMAN/248-656MSYNILAQDLMQQS.......................SELYLHCHP...DILNWNYRFVNLMQEFQHW...........D
T0PZ96_9STRA/35-481LSYNLMRQLHATT.........................KYKPYCAE...YILGSTRRKDQLLAEITAY...........D
O46094_DROME/190-469ATWNVNN.....................................KTCSDS.......NNPLRAWL..AC........SEK
Q86GH0_DROAE/65-291AYWNAAG.....................................................VSNKCREM...........E
Q6MMC5_BDEBA/32-239FVWNVYK...........................................GQKAHLFEQDFKRLGENK............
A0Y1P5_9GAMM/101-305KQINVNY.................................................SNKYLSTHLLSL...........R
Q9TZX4_CAEEL/118-349CTFNCRS.....................................LS...SDDR.......LAELLEET...........R
A1SIW4_NOCSJ/519-746GTLNLLGAGH...............................TDKPG...ERAGYDTWDKRLPGAMRTI...........E
O96546_LYMDI/17-226GTFNANS..............................................LTQQKDEVGTFLREH...........Q
D0LKU2_HALO1/119-323TLFNVYI..............................................GNGDYTGAIEYLRAQ...........S
INP51_YEAST/532-813GTFNISG.....................................KI...P.......KDDIKDWI..FPKSM...SKEDE
Q1QA26_PSYCK/112-319MVSNVLT....................................TND...DTYK.......LVELVQQK...........Q
DNSL1_HUMAN/22-265CAFNAQR....................................LTL...AKVAREQVMDTLVRILARC............
Q9RFY5_HELHT/24-265STWNLQG......................................S...SANTESKWNISVRQLITGD...........N
A0A023EDJ4_AERSA/37-444ATFNLSFDRTAPGMLSGELALTRA...EQDTLLARLADGGLSGAEK...TKALDVQQIRNIAEIVQRT...........R
Q93137_BOMMO/15-220GFFNAYG..............................................LANQRDQVSDFLRDH...........Q
D0LNM2_HALO1/11-267TTHNLAMGR.................................LSTE...PRRA.......LAAWAAEH...........R
A6WD12_KINRD/15-239ATVNVRE....................................LLD...DTAA.......LGALLRTA...........A
A5P939_9SPHN/105-310LAVNVKV....................................KNT...DFQS.......VIDQIDAV...........D
C0DYX5_EIKCO/70-259VWYNVHL....................................DNP...AAEA.......ESTALLAE...........Q
IP5P8_ARATH/88-411GTWNVGG.....................................KS...P.....HEGLDLKDWL..KS.........PA
YTX2_XENLA/6-230STLNTNG............................................CRNPFRMFQVLSFLRQG...........G
ANGEL_DROME/71-344VSYNILAQDLLLEH.......................LFLYVGIPH...EFLSWQRRQQNLLRELLKL...........D
SHIP2_HUMAN/429-718GTWNMGS.....................................VP...P......PKN.VTSWF..TSKGL..GKTLDE
I5P2_MOUSE/350-629GTYNVNG.....................................QS...P.......KECLRPWL..SH........SAL
D2T850_ERWP6/102-309MVSNVLT....................................PNR...QAPR.......LLAQVQAE...........Q
A0YXL3_LYNSP/4-376ATFNASLNRDTAG.........................QLITDLT......IPDNPQAQNIAEIIQQV...........N
SYNJ2_MOUSE/535-855GTWNVNG.....................................GK...QFRSNLLGTAELTDWL..LDAPQLSGAVDSQ
C5BJD9_TERTT/346-705ATFNAGFDPFKVA........................GGLKAAFD......NGDYVKAQKVAEIIQRT...........N
C6WGJ0_ACTMD/106-312MASNFLV....................................GKA...DAEA.......VVREVVER...........D
Q6LKH0_PHOPR/93-303FQYNLRY..............................................ENPNLDPLVYYLQQF...........P
A0Y3X6_9GAMM/104-311MSANVLM....................................SNH...NSEQ.......LIALVNQH...........K
Q7M558_DANRE/2777-2983FLMNVQN.................................................LKQHLADLIFRT...........Q
D2B8I2_STRRD/121-420MAWNLFVGGT..............................FDRKET...TGEN.......LTQMIDYM...........N
C7NG46_KYTSD/144-354VTYNSLG.....................................SL...TASD.......LERLESEF...........Q
B5GR87_STRC2/14-301SNFELDG............................................RGDEQKLAAFYRLLRAH............
C5C297_BEUC1/17-258VTLNLQHGL.................................GTGG...GALDADALAAAVAPLAGTH............
Q1I8E8_PSEE4/192-431VTLNMQG......................................I...SSAHTDKFRTIVLPMIRQH............
D0LH64_HALO1/68-276ATWNVAI.............................................AGFSSIDTLARELREI...........D
B7QXZ5_9RHOB/33-347ATFNTELSRKGPG.........................LLLRDLL......RQKDPQIAAVAETITAA...........D
C0W4G5_9ACTO/4-304LQLNIWM..........................................SGTKVPDGIARCADIVRTT...........H
O29675_ARCFU/5-248ATFNVNS....................................IRS...RLHI.......VIPWLKEN...........K
G1UB84_HAEDU/4-259ISFNING....................................LRA...RPHQ.......LEAIINKH...........Q
D4BMH5_BIFBR/190-433MTLNCRY....................................GRA...DAND.......IIANIRKR............
Q8PBH9_XANCP/68-425ATYNTSLYSDEA..........................GGLVREL......QGDSAHARKIAAVLQRV...........R
CCR4_CANAL/459-769LSYNTLCQHYATP.........................KMYKFTPS...WALQWDYRKNLLEKEVLNY...........N
F2G584_ALTMD/107-313LSSNVYM....................................PNN...DFRK.......LIEHVRNK...........Q
E7KT29_YEASL/115-504MTYNCLAQALIR..........................RKLFPDSG...DALKWYRRSKVLLNEFKYY...........N
DNSL3_RAT/29-279CSFNVRS....................................FGE...SKKENHNAMDIIVKIIKRC............
D1NTE5_9BIFI/129-340MTLDAND....................................GHA...DATA.......IVDTVRDQ...........H
Q95041_RHOPR/31-304ATWNVNG.....................................RK...P........TTITNLI..GQ.........NS
B9NTP9_9RHOB/22-326ASFNTELSRKGPG.........................LLLRDIQ.......RDDPQVEAVVQVLAAT...........R
Q5QWX6_IDILO/38-393ATFNVSMDASNYLSDSEL...............PQLDKSPVPEVL......QQDHEQIRGIAEILQRV...........R
APEX1_RAT/64-308CSWNVDG.....................................................LRAWIKKKGLDW...VKEEA
D2S515_GEOOG/4-252GTVNTAS.....................................GR...SPGGPVLDAAGLEKAVAGL...........D
Q24690_DROTE/6-206IQWNLKG..............................................YVNNYSQLLILIKKY...........S
Q9ZCP7_RICPR/4-250ATWNINS....................................IKT...RLNL.......LRNFLSKE...........N
O62658_CANLF/11-230VTLNVNG............................................LNDPIKRRRVSDWIKKQ...........D
O17590_CAEEL/100-403STFNVNG.....................................RS...P.......LSVFPTWF..SQK.......PED
PHLC_LISIV/48-325TSHNVYL.....................................................FSRNI..Y...........P
O64428_CHLVU/12-249LSLNVNGL..................................RDRD...KRRC.......LFNLLERD...........R
Q9RXF9_DEIRA/38-271TTFNVNG.....................................................LRSALRKGLADW...VESNQ
EX3_ECOLI/4-259VSFNING....................................LRA...RPHQ.......LEAIVEKH...........Q
O26314_METTH/7-248ISWNVNG.....................................................LRAVHRKGFLKW...FMEEK
B4WAV6_9CAUL/100-305YSANLWV....................................DNT...DVAA.......IRRSIVDA...........D
D0LI27_HALO1/46-296ATWNLSWLAS...............................EDGAG...TNPRTEADYARLRTYAARL...........D
A7A3N5_BIFAD/144-355MTLNCRY....................................GRA...NAAA.......IVSAVKEH............
O01419_BOMMO/9-206LQGNLNR..................................................SARAQDLLIQS...........M
O18005_CAEEL/310-619MSYNILADLYLNLTLPQE...............QLFFNYCQKSSQR...IIYRTPIFLKQLHDFIHSA...........R
B5GU93_STRC2/121-326LTSNVEY....................................GNA...APA........LVATVRRE...........Q
Q9S1Z5_STRCO/42-270MTFNIHH......................................A...QGTDDVLDLRRVANVIRKS...........G
B1MNW1_MYCA9/96-305LQANLRV....................................GAG...DAGA.......VVAAIREH............
Q2C775_9GAMM/365-634MEFNIWGI..................................DDRG...TNAAPKYGSKYVAEVIENA...........G
Q6UE72_TETTH/99-328TGFNTQGV...................................AKA...NKRNKQYSTLYLQKLFAES............
O83162_TREPA/8-255ISWNVNG.....................................................IRAIERKDFLSW...LAREA
D2PNL1_KRIFD/62-287LNFNMCG............................................NKCNHGTLGVADHVAQA...........I
A1R797_ARTAT/136-351MSLNSEY....................................GEA...DAAA.......IVKLVRDN...........G
D0NNT3_PHYIT/6-323LQYNLFGRPYEV...........................SKDGQSE...RLQRVPESLHRISEAI...............
A5LH53_9CAUD/25-260ATWNLQG......................................S...NAPTENKWNTHVRQLVTGS...........G
D4DUX1_NEIEG/102-289LWYNVNL....................................DNP...KAAE.......ESAKILAA...........A
O76745_CIMLE/32-291VSWNSGH.....................................ER...A.......PTNLEELLGLNS.........GE
Q094F5_STIAD/52-257VTANLAFRGPDAVRN.....................DWNTIGPEA...................................
B6QFL9_TALMQ/445-668LQLNVGK..................................................RDTIQQSLMN.............
Q1YK76_AURMS/120-327MVANVKK....................................GNR...DFAA.......FRAVVTNA...........D
D0L3V4_GORB4/96-309MQANIYL....................................GQA...DTAD.......LARTVADR...........R
A3SLI1_ROSNI/16-332ATWNVELSRAGP..........................GILLRDL......RRGDAQADAVAEIIADH...........A
CSS1_SCHPO/12-289LSFNCWG....................................LRF...VSKYRTERLKAVGEKLAKC...........D
D1BKV9_SANKS/134-342LTANVRGER.................................AGEE...TVSA.......IVDLIISS...........G
B5ZY66_RHILW/98-299MSFNIEND...................................NFA...NGAD.......IAAMVIAS...........G
PHLC_STAA8/46-322VSHNVYM.....................................................LSTVL..Y...........P
INP54_YEAST/11-313TTFNCGK.....................................EF...P...VENSKAIVKQLLFPYDDG....ISQLE
RTJK_DROFU/9-214GLWMHRG..............................................LTRGSEELRLFLSVH...........N
D0Z4R5_PHODD/38-450ATFNLSFDRKTFEQLVTEMQISPA...KQQELVDGFIANTLNGTDK...TLAEKVIQIRNVAAIIQTK...........R
ARP_ARATH/279-527MTWNVNG.....................................................LRGLLKFESFSALQLAQREN
IP5PF_ARATH/543-875GTWNVGE.....................................GR...A......STDSLVSWL..GCA......ATGV
B1C336_9FIRM/825-1040ASFNIAAN...................................RHP...NIAA.......ISDLMEEK............
Q26816_9TRYP/95-297MQWNCAG.....................................LS...QGKRLALHKTLVDERIA..............
A6BZ11_9PLAN/4-223VVWNTQW...........................................AVPGSKRGLLLSELIQQQ...........Q
A4FQX0_SACEN/43-251LQLNLCNGGFAH..........................CYSAGRS...............VDSAIAAI...........R
P72938_SYNY3/1331-1646TGFNVLNYFKTIDLSGV.................STAIGQDPRGAD...TTAEFDRQTDKLVTALLAI...........D
A1K8S1_AZOSB/38-302ATWNIRE.....................................FG...KKPRSEAAIHYVAEILGQF............
B0X3H8_CULQU/1636-1848MTINVQS............................................LSAHHQDISIDSILTSV............
C8N9G3_9GAMM/89-278IWYNVNL....................................DNR...DARG.......ESARLLAA...........D
Q9A7Y4_CAUCR/110-315VQFNVWH....................................DNR...SPEK.......SLAWILAQ...........D
Q01375_NEUCS/7-217LYWNVGK....................................SYE...RGKL.......LLEQEETY............
A9DTY1_9RHOB/15-313ATFNTELSRKGPG.........................LLLRDIL......RGDDPSVSSVVQTISAA...........N
YE8A_SCHPO/794-1114CSWNAGA.....................................SK...P.......SDLDSDTIGASMIPMM.IRDNGY
Q2UFE1_ASPOR/75-351TTWNIDFQ...................................QPC...KAERTQAGLNYLSTVLLKP...........S
Q09BG4_STIAD/252-512GNWNLEWFG.................................STTN...GPSDDSLQLSNVRAVMADA...........G
Q44070_AERHY/480-826ASFNVLNFFTTVVGGD...................ANPTNSNRGAL...TVGEFELQRTKIVSAITRL...........N
I9U9G4_HELPX/4-242ISWNVNG.....................................................LRACMTKGFMDF...FNSVD
A5VCJ2_SPHWW/55-332LTYNIEGLGWPARKG.....................RVTQLREIGR...RLAG.......LREQGIAP............
Q9RWN4_DEIRA/100-318LSLNADF....................................ASA...PAAQ.......VAALARRE...........G
Q55DR4_DICDI/251-565NTWNFNE.............................................PWKDRRILMADLIEKE...........L
INP53_YEAST/571-849GSFNVNG.....................................AT...K.......KVDLSKWL..FPI......GEKF
C9P6A0_VIBME/38-446ATYNLSFDRNTFAELVTEMQVEPA...QQQALVEAYLAGKIEQKDK...TLAQNVIQIRNVAAVIQHN...........R
B4R9Q2_PHEZH/109-311VQINLWS....................................RNG...SLDD.......TLNWVLAQ...........D
O51484_BORBU/4-243ISWNVNG.....................................................IRAVLKKGFLEF...VKEYT
IP5P9_ARATH/63-371STWNVGG.....................................IV...P.....DDGLDMEDLLETHK.........TP
D2R9U6_GARV4/132-368MTLNCRY....................................GKA...SASE.......IIEITKKY...........H
P91740_HYDVU/57-349ITWNINSE..................................NNQT...EEADWENSKKELCEYLKKL............
NOCT_MOUSE/144-412MQWNILAQALGEG........................KDNFVQCPV...EALKWEERKCLILEEILAY...........Q
A5ZI49_9BACE/408-663LQWNIWHGGK...............................HLGKD...GRER.......IIDLIKQS...........G

PF14529

D7EM17_TRICA/220-332------------------------------------------------------------------------------LR
D8Q682_SCHCM/470-595------------------------------------------------------------------------------TT
A7ENE7_SCLS1/419-538------------------------------------------------------------------------------FQ
A7EV44_SCLS1/169-288------------------------------------------------------------------------------IQ
B7Q7X7_IXOSC/39-155------------------------------------------------------------------------------LY
E9HS52_DAPPU/293-409------------------------------------------------------------------------------LD
E9H8A1_DAPPU/103-219------------------------------------------------------------------------------ID
E9HMD6_DAPPU/94-210------------------------------------------------------------------------------TK
E9H5U8_DAPPU/53-167------------------------------------------------------------------------------ID
B7PJV5_IXOSC/324-438------------------------------------------------------------------------------ID
E6ZRW9_SPORE/1185-1312------------------------------------------------------------------------------CL
E9H822_DAPPU/420-535------------------------------------------------------------------------------YH
E9HYG6_DAPPU/19-132------------------------------------------------------------------------------IR
E9HDY2_DAPPU/149-262------------------------------------------------------------------------------LC
E9HRI7_DAPPU/460-571------------------------------------------------------------------------------YR
E9HZZ2_DAPPU/118-231------------------------------------------------------------------------------YR
E9HRK8_DAPPU/106-221------------------------------------------------------------------------------IF
E9HSQ7_DAPPU/121-236------------------------------------------------------------------------------LC
E9HE10_DAPPU/492-604------------------------------------------------------------------------------LN
E2C5Q1_HARSA/10-124------------------------------------------------------------------------------LN
B0W1L0_CULQU/467-584------------------------------------------------------------------------------VL
D7GXY3_TRICA/106-218------------------------------------------------------------------------------IT
D2A4F4_TRICA/101-212------------------------------------------------------------------------------IL
E2AVN7_CAMFO/107-222------------------------------------------------------------------------------LF
B6QWM9_TALMQ/555-687------------------------------------------------------------------------------IF
A2QSQ0_ASPNC/504-636------------------------------------------------------------------------------IF
Q2HHJ7_CHAGB/475-603------------------------------------------------------------------------------VL
Q2H3B9_CHAGB/415-543------------------------------------------------------------------------------VL
Q2GZF1_CHAGB/632-760------------------------------------------------------------------------------VL
E9FE00_METRA/199-327------------------------------------------------------------------------------VL
B6QNK9_TALMQ/286-414------------------------------------------------------------------------------VL
B6H8V5_PENRW/395-529------------------------------------------------------------------------------IL
Q2U1R5_ASPOR/105-240------------------------------------------------------------------------------ML
A2QZW2_ASPNC/91-226------------------------------------------------------------------------------YL
Q2TX40_ASPOR/104-239------------------------------------------------------------------------------YL
B8MUV7_TALSN/118-253------------------------------------------------------------------------------FL
A6R6U1_AJECN/368-494------------------------------------------------------------------------------IL
A7S3V7_NEMVE/68-188------------------------------------------------------------------------------IY
A7S2X0_NEMVE/168-291------------------------------------------------------------------------------LY
C3YN84_BRAFL/1345-1466------------------------------------------------------------------------------LY
D6WYM2_TRICA/271-393------------------------------------------------------------------------------FV
A7S0T7_NEMVE/341-458------------------------------------------------------------------------------VL
E3N7S5_CAERE/136-251------------------------------------------------------------------------------VR
E3MXD9_CAERE/375-485------------------------------------------------------------------------------FT
E3MA06_CAERE/30-140------------------------------------------------------------------------------FN
E3LJB4_CAERE/350-458------------------------------------------------------------------------------TR
E3N681_CAERE/36-144------------------------------------------------------------------------------TR
E3ND32_CAERE/223-331------------------------------------------------------------------------------IR
E3MKX6_CAERE/106-217------------------------------------------------------------------------------TR
C5KXY0_PERM5/413-539------------------------------------------------------------------------------VT
A6RES2_AJECN/586-706------------------------------------------------------------------------------VS
B6QF01_TALMQ/823-943------------------------------------------------------------------------------LY
B8MCU2_TALSN/715-835------------------------------------------------------------------------------IH
A6QSA7_AJECN/584-704------------------------------------------------------------------------------IH
Q0TWS8_PHANO/49-171------------------------------------------------------------------------------IA
B7PHI8_IXOSC/55-177------------------------------------------------------------------------------LL
C5LYL7_PERM5/137-253------------------------------------------------------------------------------LK
E0VEI2_PEDHC/13-127------------------------------------------------------------------------------GV
E9GSG1_DAPPU/115-230------------------------------------------------------------------------------IS
B7QBV7_IXOSC/96-214------------------------------------------------------------------------------FY
B7QN21_IXOSC/94-212------------------------------------------------------------------------------LY
B7PD65_IXOSC/108-226------------------------------------------------------------------------------LY
B7PS20_IXOSC/108-226------------------------------------------------------------------------------LR
B7PXF9_IXOSC/95-213------------------------------------------------------------------------------II
C5K8V2_PERM5/55-185------------------------------------------------------------------------------YG
B4HD52_DROPE/236-352------------------------------------------------------------------------------WQ
E2AWP2_CAMFO/83-203------------------------------------------------------------------------------MV
E2B1G0_CAMFO/3-123------------------------------------------------------------------------------MI
E2B0F5_CAMFO/1-121------------------------------------------------------------------------------II
E2BFV3_HARSA/10-133------------------------------------------------------------------------------MV
E2AA34_CAMFO/86-207------------------------------------------------------------------------------IV

PF03372

APEA_DICDI/108-351P.........................D...................................................VL
C0W5Q6_9ACTO/5-307P.........................D...................................................VI
Q9ZBN3_STRCO/24-259A.........................D...................................................VI
A7T3Q8_NEMVE/115-319TE.......................ID...................................................VI
B3SRB8_ASCTA/220-428A.........................E...................................................FA
B8MHG3_TALSN/453-675..........................D...................................................II
Q1QVQ0_CHRSD/109-317P.........................D...................................................IV
A0M2U8_GRAFK/107-314P.........................D...................................................IL
A6CGC2_9PLAN/130-329HL......................DPD...................................................LI
INP5K_MOUSE/37-330NL......................DIY...................................................II
RRP1_DROME/430-670P.........................D...................................................IF
C7QE92_CATAD/155-383A.........................D...................................................VV
C0W5C1_9ACTO/126-340P.........................D...................................................VV
A9DSA8_9FLAO/61-246TENFEDAF...........EVNGNLPD...................................................VM
A3ITE0_9CYAN/5-368P.........................D...................................................VI
C7ZMD9_NECH7/94-389H........................NL...................................................VV
I5P2_CAEEL/8-272GMIDD.................HTHLV...................................................AI
C1A7M1_GEMAT/266-540..........................D...................................................VV
Q9RZQ3_DEIRA/490-782A.........................D...................................................VL
O27012_METTH/6-222F.........................D...................................................AG
Q08525_CHICK/66-271..........................D...................................................LV
Q0CY83_ASPTN/48-313P.........................E...................................................VI
C2Q910_BACCE/40-333P.........................D...................................................LL
O15921_TRYCR/109-396P.........................D...................................................AL
A3ZS40_9PLAN/129-366..........................D...................................................VM
Q11NA1_CHESB/104-316A.........................D...................................................IL
Q0URF7_PHANO/122-382AE......................TAA...................................................VV
Q0FLB9_PELBH/11-291P.........................D...................................................VL
Q9ZVF0_ARATH/390-645..........................QNSTQDPPQE................................KKWVDEQNFQFG
Q9RS34_DEIRA/101-311A.........................D...................................................LI
C4FH07_9BIFI/165-380V.........................E...................................................VL
B7S366_9GAMM/60-266..........................H...................................................IT
M6BNC3_LEPBO/89-364NWGQNERAQR......IVSSNYIQNQD...................................................VI
YAFD_ECOLI/47-252..........................H...................................................LV
Q9F2J2_STRCO/121-324P.........................D...................................................LV
Q7USG9_RHOBA/118-325V.........................D...................................................MV
A3SVB7_SULSN/110-316P.........................D...................................................IA
A5FED8_FLAJ1/31-384P.........................D...................................................VI
DNAS1_BOVIN/26-274..........................D...................................................IV
Q54E13_DICDI/8-231PR.......................PT...................................................IS
D3R3H2_BIFAB/133-356..........................DI.................................................AVL
Q0PC57_CAMJE/24-257P........................LD...................................................IL
Q1MZ88_9GAMM/34-259..........................D...................................................VV
Q9VXE7_DROME/36-332ETNAH.................LPDIY...................................................AL
DNSL2_HUMAN/25-288..........................D...................................................LA
Q9U4W1_AEDAE/10-212..........................NINNL..........................................PDLELLV
O15922_LEIMA/133-437P.........................D...................................................VL
Q2PWA8_MONPI/4-202..........................D...................................................II
V9FYL2_PHYPR/6-366P.........................A...................................................VI
Q9SN65_ARATH/347-583F.........................D...................................................VL
Q985E5_RHILO/120-323P.........................D...................................................VI
SMASE_MYCTU/228-473VANVQEDFAYHQFLIKKSKMPSQTPPEPPT............................................LLWPIG
CDTB_ECOLX/26-261A........................VD...................................................IL
Q9PTX0_XENLA/23-272..........................E...................................................II
C4RQR9_9ACTN/168-411A.........................D...................................................VY
Q9YI04_XENLA/21-271..........................D...................................................IT
Q3JBC2_NITOC/104-311A.........................D...................................................VV
O34095_LEPIR/84-361NWGQEKRARL......LVDSKYVKDQD...................................................VL
Q315C8_DESAG/101-322V.........................D...................................................VV
O77366_PLAF7/563-897..........................D...................................................II
A6GK21_9DELT/6-259EGR.....................GPD...................................................VF
D5UUF8_TSUPD/40-343A.........................D...................................................IV
B1LXH2_METRJ/33-216P.........................D...................................................LL
O46184_DROSU/14-220..........................D...................................................IV
A6VUZ0_MARMS/30-246..........................D...................................................LI
Q8I3R5_PLAF7/2121-2476P.........................D...................................................IV
O22148_ARATH/4-222P.........................E...................................................VI
P96273_MYCTU/27-281V.........................D...................................................VL
APEX2_HUMAN/5-304A.........................D...................................................IV
Q9RKB3_STRCO/12-265A.........................D...................................................VL
Q63291_RAT/38-257P.........................A...................................................FC
INP5E_RAT/307-587TQ......................DLY...................................................VI
A5V5B1_SPHWW/53-337..........................R...................................................VV
Q281W3_PHACH/39-344DPLTAPPFLGKTGEQPWSTRRIKVWQD...................................................LM
B2B0A0_PODAN/123-383..........................DGT...............................................PCIV
DNAS1_CHICK/24-272..........................D...................................................IT
C5C387_BEUC1/53-411P.........................D...................................................VV
SHIP1_RAT/411-703SADYI.................PHDIY...................................................VI
EXOA_BACSU/4-243A.........................D...................................................II
IP5PC_ARATH/581-914G........................IL...................................................VV
H2PHM7_PONAB/192-531A.........................D...................................................IV
INP52_YEAST/596-874KP......................DVV...................................................VL
IP5PD_ARATH/576-908G........................IV...................................................AV
RTJK_DROME/9-214I.........................D...................................................VM
B9J7A5_AGRRK/98-299A.........................D...................................................VV
O86610_STRCO/4-250T.........................D...................................................VL
A3VZN2_9RHOB/19-338P.........................D...................................................IL
H2R3J5_PANTR/15-385..............................................................................AM
EXOA_STRR6/4-266A.........................D...................................................II
PI5PA_HUMAN/428-721SDG....................ADMI...................................................AI
D1AXA7_STRM9/113-329A.........................D...................................................IV
Q1GKT6_RUEST/32-332A.........................D...................................................IL
Q2H5K7_CHAGB/308-508Y.........................D...................................................LM
A1SIW4_NOCSJ/70-299SK......................NPE...................................................FV
Q9ZDR5_RICPR/4-252P.........................D...................................................II
D7WDI6_9CORY/121-321..........................DP.................................................HVV
Q07995_CHITU/11-220V.........................D...................................................VA
Q9S2L9_STRCO/24-240P.........................D...................................................LV
NSMA_CAEEL/42-318Y.........................D...................................................IV
O93520_ORYLA/9-231A.........................E...................................................IV
Q5LX09_RUEPO/24-347P.........................D...................................................IL
NSMA_DROME/9-264Y.........................D...................................................IV
Q9SIQ5_ARATH/113-377ADEMGVLSQLCKKGRKTESAGSCSIHD.....................................................
Q83GA3_TROWT/91-308ES......................NPD...................................................II
Q2C5E7_9GAMM/445-703A.........................D...................................................II
A1RCE7_ARTAT/41-258AS......................ATS...................................................II
D2B0I5_STRRD/117-322P.........................D...................................................VL
Q15NA1_PSEA6/104-315P.........................H...................................................IL
Q9P8H7_CANAX/14-261M........................ID...................................................IW
Q9VTW2_DROME/396-695VP......................DIV...................................................VM
A6W517_KINRD/120-329A.........................D...................................................VV
A5C0G0_VITVI/310-530P.........................D...................................................FI
A7T4C3_NEMVE/164-372SRP.....................QVD...................................................VL
CCR4_SCHPO/339-664A.........................D...................................................II
D2B2Z6_STRRD/114-320P.........................D...................................................IL
SYJ1_SCHPO/563-839LA......................DIY...................................................VV
Q1D7J7_MYXXD/85-296LA......................GAD...................................................VI
C0X2X7_ENTFL/9-266S.........................E...................................................II
Q2UNN7_ASPOR/69-326LH......................VAP...................................................VI
TYDP2_CAEEL/123-353P.........................D...................................................IL
C2L0P4_9FIRM/115-330A.........................D...................................................IA
Q9SA95_ARATH/176-431P.........................H...................................................LI
Q50321_MYCPL/166-460Y.........................D...................................................VV
B0WQS5_CULQU/1836-2048..........................H...................................................LL
A0JXK8_ARTS2/115-328V.........................G...................................................LL
Q24335_DROME/7-215I.........................D...................................................VM
O83555_TREPA/304-613..........................D...................................................VI
E8RN27_ASTEC/87-283P.........................D...................................................VV
D0KX69_HALNC/290-639P.........................D...................................................VI
Q5L902_BACFN/414-668A.........................D...................................................VI
Q1CXT2_MYXXD/230-492V.........................D...................................................FW
EEPD1_XENLA/257-520..............................................................................LL
A4A5W6_9GAMM/35-389P.........................D...................................................VL
D9QM28_BRESC/100-303A.........................D...................................................IV
O05382_AGGAC/4-259P.........................D...................................................VL
YNTB_SCHPO/124-492P.........................T...................................................LG
NGL1_YEAST/30-353A.........................D...................................................IM
NGL3_YEAST/112-485P.........................D...................................................VV
APN2_YEAST/20-354..........................D...................................................II
SYNJ1_RAT/538-859DKRSK.................PTDIF...................................................AI
A7T299_NEMVE/40-247..............................................................................VI
O68855_9STAP/43-321NWGQSIRADL......ISQSFYIKGND...................................................VV
O13348_MAGGR/17-223V.........................D...................................................LV
Q9Y026_TRYCR/56-263..........................D...................................................II
D2AT04_STRRD/93-301P.........................D...................................................VL
Q9Y1H3_DICDI/7-211..............................................................................LA
C5BVQ8_BEUC1/110-317A.........................D...................................................VL
P74492_SYNY3/14-266V.........................D...................................................VL
A4EK32_9RHOB/102-307P.........................D...................................................VL
C7PRF4_CHIPD/618-892A.........................D...................................................IF
TYDP2_HUMAN/117-351P.........................D...................................................VI
A3TK42_9MICO/109-315V.........................D...................................................TL
DNAS1_HUMAN/26-274..........................D...................................................IA
Q9NAL5_CAEEL/311-526..........................DY.................................................QII
A7C3D0_9GAMM/108-325P.........................D...................................................II
NSMA_HUMAN/12-272F.........................D...................................................LA
O65598_ARATH/3-223P.............................................................................IF
C5NNP0_ORYSI/360-581L.........................D...................................................FV
Q9ZQF8_ARATH/4-230P.........................G...................................................FL
Q17003_ANOGA/83-316LAVS..................EADFD...................................................LI
LIN1_NYCCO/10-229P.........................D...................................................IC
O97240_PLAF7/281-607KWDEFMN............FFNNLNAD...................................................VL
A1U6L7_MARHV/41-269..........................D...................................................VV
Q5QUK7_IDILO/105-312P.........................D...................................................VL
A1T8I1_MYCVP/118-329V.........................D...................................................VL
B1KQZ4_SHEWM/42-455P.........................A...................................................VL
A3XAE4_9RHOB/4-211P.........................D...................................................IF
A8M5G8_SALAI/105-315V.........................D...................................................VL
Q2SQK9_HAHCH/44-408P.........................D...................................................VL
Q1JZE6_DESAC/7-207A.........................D...................................................YV
O42110_9SAUR/47-252..........................D...................................................MI
OCRL_HUMAN/245-524PP......................DIY...................................................CI
O44201_BOMMO/8-204AEWSIDVAVA......AEPYFVPTDQDCWIGDVDGSVAIVLRHSAALPPLDMVARGPGYVAARIDGTVVIGAYFSPNRSL
A4BGZ7_9GAMM/1324-1668P.........................H...................................................VV
C2G3V9_9SPHI/103-310A.........................D...................................................IV
YBHP_ECOLI/13-244TV......................SAD...................................................IV
G3XDB0_PSEAE/4-246A.........................D...................................................VI
Q04135_DROME/7-214I.........................D...................................................VM
Q9XAL0_STRCO/104-321V.........................D...................................................VL
Q9ZAB7_AGGAC/30-274G........................AD...................................................IL
Q9YGS2_TAKRU/70-277I.........................D...................................................LF
Q7UV93_RHOBA/76-326..........................D...................................................VV
PHL3_BACCE/40-305NWGQTERADL......FGAADYIKNQD...................................................VV
Q868R2_ANOGA/5-211L.........................D...................................................VL
Q9X9W4_STRCO/312-604..........................D...................................................IV
A4ESR5_9RHOB/34-347P.........................D...................................................IL
C6RT65_ACIRA/105-312P.........................D...................................................IV
APE2_ARATH/4-324A.........................D...................................................II
APN2_SCHPO/4-295..........................D...................................................VI
A6ENA6_9BACT/100-307P.........................D...................................................IV
DNAS1_OREMO/30-276..........................D...................................................VI
SYJ2_SCHPO/573-851D........................LY...................................................VV
Q9SIS9_ARATH/366-584L.........................D...................................................ML
A3SUZ8_SULSN/8-305A.........................D...................................................II
C3JMR5_RHOER/45-349A.........................S...................................................IV
B8K751_9VIBR/38-447P.........................D...................................................VI
CCR4_YEAST/508-818S.........................D...................................................LL
ANGE1_HUMAN/248-656P.........................D...................................................IL
T0PZ96_9STRA/35-481A.........................D...................................................VV
O46094_DROME/190-469PP......................DIY...................................................AI
Q86GH0_DROAE/65-291AFMC..................HHNVD...................................................IM
Q6MMC5_BDEBA/32-239..........................D...................................................FI
A0Y1P5_9GAMM/101-305DE......................NWD...................................................VL
Q9TZX4_CAEEL/118-349RI......................QFD...................................................VI
A1SIW4_NOCSJ/519-746NA......................GVT...................................................IT
O96546_LYMDI/17-226L.........................D...................................................IL
D0LKU2_HALO1/119-323PA.......................PD...................................................LL
INP51_YEAST/532-813MA......................DLY...................................................VI
Q1QA26_PSYCK/112-319P.........................D...................................................IL
DNSL1_HUMAN/22-265..........................D...................................................IM
Q9RFY5_HELHT/24-265P........................AN...................................................IL
A0A023EDJ4_AERSA/37-444P.........................D...................................................VF
Q93137_BOMMO/15-220I.........................D...................................................IF
D0LNM2_HALO1/11-267LLRPLLACWPPLA.ERYAAHPWLGASD...................................................IL
A6WD12_KINRD/15-239A.........................D...................................................VV
A5P939_9SPHN/105-310P.........................D...................................................VL
C0DYX5_EIKCO/70-259A.........................D...................................................LL
IP5P8_ARATH/88-411DA......................DIY...................................................VL
YTX2_XENLA/6-230Y.........................S...................................................VS
ANGEL_DROME/71-344P.........................D...................................................IL
SHIP2_HUMAN/429-718VTVTI.................PHDIY...................................................VF
I5P2_MOUSE/350-629AP......................DVY...................................................CV
D2T850_ERWP6/102-309P.........................D...................................................VL
A0YXL3_LYNSP/4-376P.........................D...................................................VL
SYNJ2_MOUSE/535-855DDGS..................PADVF...................................................AI
C5BJD9_TERTT/346-705A.........................D...................................................VL
C6WGJ0_ACTMD/106-312V.........................D...................................................VL
Q6LKH0_PHOPR/93-303Q.........................H...................................................LL
A0Y3X6_9GAMM/104-311P.........................D...................................................LL
Q7M558_DANRE/2777-2983HL......................QPD...................................................CI
D2B8I2_STRRD/121-420EV......................NPD...................................................IL
C7NG46_KYTSD/144-354P.........................D...................................................LL
B5GR87_STRC2/14-301..........................DP.................................................HLV
C5C297_BEUC1/17-258..............................................................................VL
Q1I8E8_PSEE4/192-431..........................H...................................................VV
D0LH64_HALO1/68-276A.........................D...................................................VV
B7QXZ5_9RHOB/33-347P.........................D...................................................IL
C0W4G5_9ACTO/4-304A.........................D...................................................VV
O29675_ARCFU/5-248P.........................D...................................................IL
G1UB84_HAEDU/4-259P.........................D...................................................VI
D4BMH5_BIFBR/190-433..........................GI.................................................SVL
Q8PBH9_XANCP/68-425P.........................D...................................................LV
CCR4_CANAL/459-769T.........................D...................................................IV
F2G584_ALTMD/107-313P.........................D...................................................FL
E7KT29_YEASL/115-504S.........................D...................................................VI
DNSL3_RAT/29-279..........................D...................................................LI
D1NTE5_9BIFI/129-340V.........................E...................................................LL
Q95041_RHOPR/31-304DKYEN.................LPDMV...................................................IV
B9NTP9_9RHOB/22-326P.........................D...................................................IV
Q5QWX6_IDILO/38-393P.........................D...................................................IV
APEX1_RAT/64-308P.........................D...................................................IL
D2S515_GEOOG/4-252V.........................D...................................................VL
Q24690_DROTE/6-206P.........................H...................................................II
Q9ZCP7_RICPR/4-250P.........................D...................................................IL
O62658_CANLF/11-230P.........................S...................................................IC
O17590_CAEEL/100-403IA......................EFY...................................................AV
PHLC_LISIV/48-325NWGQMHRADL......IAQADYMKNND...................................................VV
O64428_CHLVU/12-249W.........................D...................................................II
Q9RXF9_DEIRA/38-271P.........................D...................................................VL
EX3_ECOLI/4-259P.........................D...................................................VI
O26314_METTH/7-248P.........................D...................................................IL
B4WAV6_9CAUL/100-305A.........................D...................................................IV
D0LI27_HALO1/46-296A.........................D...................................................VI
A7A3N5_BIFAD/144-355..........................DV.................................................AVL
O01419_BOMMO/9-206AERLTHLAVVAEPYRVPSVPDWAGDIDGLVAVVQRRSAVGAPPEFDVVQR.....GRGFVAVFWAGLLVVGVYFSPNRPL
O18005_CAEEL/310-619C.........................S...................................................LI
B5GU93_STRC2/121-326P.........................D...................................................LV
Q9S1Z5_STRCO/42-270A.........................D...................................................VV
B1MNW1_MYCA9/96-305..........................DV.................................................GVV
Q2C775_9GAMM/365-634A.........................D...................................................VA
Q6UE72_TETTH/99-328..........................D...................................................AT
O83162_TREPA/8-255P.........................D...................................................VL
D2PNL1_KRIFD/62-287L.........................DRPT.............................................RPRTA
A1R797_ARTAT/136-351V.........................Q...................................................LL
D0NNT3_PHYIT/6-323..........................D...................................................VV
A5LH53_9CAUD/25-260A........................VD...................................................IL
D4DUX1_NEIEG/102-289P.........................E...................................................VL
O76745_CIMLE/32-291TP......................DVI...................................................AV
Q094F5_STIAD/52-257..........................D...................................................IV
B6QFL9_TALMQ/445-668..........................DNKI............................................RDYGVI
Q1YK76_AURMS/120-327P.........................D...................................................IL
D0L3V4_GORB4/96-309I.........................D...................................................VL
A3SLI1_ROSNI/16-332P.........................D...................................................IL
CSS1_SCHPO/12-289Y.........................D...................................................IV
D1BKV9_SANKS/134-342A.........................D...................................................VV
B5ZY66_RHILW/98-299A.........................D...................................................VV
PHLC_STAA8/46-322NWGQYKRADL......IGQSSYIKNND...................................................VV
INP54_YEAST/11-313LQ......................DLY...................................................VL
RTJK_DROFU/9-214I.........................D...................................................VM
D0Z4R5_PHODD/38-450P.........................D...................................................II
ARP_ARATH/279-527F.........................D...................................................IL
IP5PF_ARATH/543-875E........................IV...................................................VV
B1C336_9FIRM/825-1040..........................Q...................................................IT
Q26816_9TRYP/95-297..............................................................................VC
A6BZ11_9PLAN/4-223P.........................E...................................................LI
A4FQX0_SACEN/43-251QR......................RPD...................................................VV
P72938_SYNY3/1331-1646A.........................D...................................................VL
A1K8S1_AZOSB/38-302..........................D...................................................LI
B0X3H8_CULQU/1636-1848..........................D...................................................YL
C8N9G3_9GAMM/89-278A.........................D...................................................IL
Q9A7Y4_CAUCR/110-315A.........................D...................................................VV
Q01375_NEUCS/7-217..........................D...................................................IV
A9DTY1_9RHOB/15-313P.........................D...................................................II
YE8A_SCHPO/794-1114PD.......................IV...................................................VF
Q2UFE1_ASPOR/75-351DDKNN................DVTPIN...................................................II
Q09BG4_STIAD/252-512I.........................D...................................................FW
Q44070_AERHY/480-826A.........................D...................................................VV
I9U9G4_HELPX/4-242A.........................D...................................................VF
A5VCJ2_SPHWW/55-332..........................D...................................................VV
Q9RWN4_DEIRA/100-318A.........................D...................................................LL
Q55DR4_DICDI/251-565P.........................D...................................................VI
INP53_YEAST/571-849KP......................DIV...................................................VL
C9P6A0_VIBME/38-446P.........................D...................................................VL
B4R9Q2_PHEZH/109-311P.........................D...................................................VV
O51484_BORBU/4-243P.........................D...................................................IL
IP5P9_ARATH/63-371CD.......................IY...................................................VL
D2R9U6_GARV4/132-368V.........................N...................................................TL
P91740_HYDVU/57-349..........................DL.................................................MIF
NOCT_MOUSE/144-412P.........................D...................................................IL
A5ZI49_9BACE/408-663A.........................D...................................................VV

PF14529

D7EM17_TRICA/220-332L-------------------------------------------------------------------------------
D8Q682_SCHCM/470-595L-------------------------------------------------------------------------------
A7ENE7_SCLS1/419-538I-------------------------------------------------------------------------------
A7EV44_SCLS1/169-288L-------------------------------------------------------------------------------
B7Q7X7_IXOSC/39-155V-------------------------------------------------------------------------------
E9HS52_DAPPU/293-409I-------------------------------------------------------------------------------
E9H8A1_DAPPU/103-219L-------------------------------------------------------------------------------
E9HMD6_DAPPU/94-210R-------------------------------------------------------------------------------
E9H5U8_DAPPU/53-167F-------------------------------------------------------------------------------
B7PJV5_IXOSC/324-438V-------------------------------------------------------------------------------
E6ZRW9_SPORE/1185-1312F-------------------------------------------------------------------------------
E9H822_DAPPU/420-535F-------------------------------------------------------------------------------
E9HYG6_DAPPU/19-132I-------------------------------------------------------------------------------
E9HDY2_DAPPU/149-262L-------------------------------------------------------------------------------
E9HRI7_DAPPU/460-571F-------------------------------------------------------------------------------
E9HZZ2_DAPPU/118-231F-------------------------------------------------------------------------------
E9HRK8_DAPPU/106-221F-------------------------------------------------------------------------------
E9HSQ7_DAPPU/121-236F-------------------------------------------------------------------------------
E9HE10_DAPPU/492-604F-------------------------------------------------------------------------------
E2C5Q1_HARSA/10-124I-------------------------------------------------------------------------------
B0W1L0_CULQU/467-584F-------------------------------------------------------------------------------
D7GXY3_TRICA/106-218F-------------------------------------------------------------------------------
D2A4F4_TRICA/101-212F-------------------------------------------------------------------------------
E2AVN7_CAMFO/107-222I-------------------------------------------------------------------------------
B6QWM9_TALMQ/555-687M-------------------------------------------------------------------------------
A2QSQ0_ASPNC/504-636M-------------------------------------------------------------------------------
Q2HHJ7_CHAGB/475-603V-------------------------------------------------------------------------------
Q2H3B9_CHAGB/415-543V-------------------------------------------------------------------------------
Q2GZF1_CHAGB/632-760M-------------------------------------------------------------------------------
E9FE00_METRA/199-327V-------------------------------------------------------------------------------
B6QNK9_TALMQ/286-414V-------------------------------------------------------------------------------
B6H8V5_PENRW/395-529L-------------------------------------------------------------------------------
Q2U1R5_ASPOR/105-240I-------------------------------------------------------------------------------
A2QZW2_ASPNC/91-226V-------------------------------------------------------------------------------
Q2TX40_ASPOR/104-239I-------------------------------------------------------------------------------
B8MUV7_TALSN/118-253I-------------------------------------------------------------------------------
A6R6U1_AJECN/368-494I-------------------------------------------------------------------------------
A7S3V7_NEMVE/68-188M-------------------------------------------------------------------------------
A7S2X0_NEMVE/168-291N-------------------------------------------------------------------------------
C3YN84_BRAFL/1345-1466L-------------------------------------------------------------------------------
D6WYM2_TRICA/271-393I-------------------------------------------------------------------------------
A7S0T7_NEMVE/341-458F-------------------------------------------------------------------------------
E3N7S5_CAERE/136-251F-------------------------------------------------------------------------------
E3MXD9_CAERE/375-485F-------------------------------------------------------------------------------
E3MA06_CAERE/30-140F-------------------------------------------------------------------------------
E3LJB4_CAERE/350-458I-------------------------------------------------------------------------------
E3N681_CAERE/36-144I-------------------------------------------------------------------------------
E3ND32_CAERE/223-331I-------------------------------------------------------------------------------
E3MKX6_CAERE/106-217V-------------------------------------------------------------------------------
C5KXY0_PERM5/413-539I-------------------------------------------------------------------------------
A6RES2_AJECN/586-706V-------------------------------------------------------------------------------
B6QF01_TALMQ/823-943I-------------------------------------------------------------------------------
B8MCU2_TALSN/715-835I-------------------------------------------------------------------------------
A6QSA7_AJECN/584-704I-------------------------------------------------------------------------------
Q0TWS8_PHANO/49-171I-------------------------------------------------------------------------------
B7PHI8_IXOSC/55-177V-------------------------------------------------------------------------------
C5LYL7_PERM5/137-253V-------------------------------------------------------------------------------
E0VEI2_PEDHC/13-127V-------------------------------------------------------------------------------
E9GSG1_DAPPU/115-230I-------------------------------------------------------------------------------
B7QBV7_IXOSC/96-214V-------------------------------------------------------------------------------
B7QN21_IXOSC/94-212V-------------------------------------------------------------------------------
B7PD65_IXOSC/108-226I-------------------------------------------------------------------------------
B7PS20_IXOSC/108-226V-------------------------------------------------------------------------------
B7PXF9_IXOSC/95-213I-------------------------------------------------------------------------------
C5K8V2_PERM5/55-185I-------------------------------------------------------------------------------
B4HD52_DROPE/236-352R-------------------------------------------------------------------------------
E2AWP2_CAMFO/83-203I-------------------------------------------------------------------------------
E2B1G0_CAMFO/3-123F-------------------------------------------------------------------------------
E2B0F5_CAMFO/1-121L-------------------------------------------------------------------------------
E2BFV3_HARSA/10-133I-------------------------------------------------------------------------------
E2AA34_CAMFO/86-207V-------------------------------------------------------------------------------

PF03372

APEA_DICDI/108-351C........LQETKINPSNIKKDQMP......................................................
C0W5Q6_9ACTO/5-307A........LQEVDLGQARSGRLNQAAELASALGWDSYRFAATYAGAVVGLR............................
Q9ZBN3_STRCO/24-259G........LQEVDVHWGARSQGLDVAGELARRL..............................................
A7T3Q8_NEMVE/115-319I........ITETWLNSSHTNEEYGI......................................................
B3SRB8_ASCTA/220-428I........ITETNTRIHQQLPGMG.......................................................
B8MHG3_TALSN/453-675L........IQEPYIFKDLSRQITKKHPSYECFSPTDSWAISGRPRVLTYVRKKKGIRT.....................
Q1QVQ0_CHRSD/109-317L........TLESDAWWQERLDETLDESHPY.................................................
A0M2U8_GRAFK/107-314L........TLESDKRWEDELS.VLEKDYKN.................................................
A6CGC2_9PLAN/130-329G........LVEAGADSAEMKQFWK.......................................................
INP5K_MOUSE/37-330G........LQE.......MNFGII.......................................................
RRP1_DROME/430-670C........LQETKCANDQLPEEVTRL.....................................................
C7QE92_CATAD/155-383V........LQGLSKNVQATDQTAP.......................................................
C0W5C1_9ACTO/126-340V........LLEASEELTQQLLELTG......................................................
A9DSA8_9FLAO/61-246V........LVECDAHDYQKIKEKY.......................................................
A3ITE0_9CYAN/5-368L........INEFDFDS...VGGAAQLFNNNYLNVSQKGVNPIDYPYFYVA.............................
C7ZMD9_NECH7/94-389M........FQEVCQESLHAILEDRWTQDNFSVTAVKPPPFYYREEWNDVRDENVGSM......................
I5P2_CAEEL/8-272G........LQE....................................................................
C1A7M1_GEMAT/266-540M........LDEVYEQVTADSLRRFFDLPALRALGPWQFVLGGSGGRQRTVVAARRRAVRPVESMAAMRYIDGSLDSLRR
Q9RZQ3_DEIRA/490-782S........LMEVQNNGDTALNDLVAALNE..................................................
O27012_METTH/6-222F........FQEVYMIPNEVRWNYH.......................................................
Q08525_CHICK/66-271A........ITETWWDDSHNWNTTID......................................................
Q0CY83_ASPTN/48-313F........LQEMVASDLELIKATP.......................................................
C2Q910_BACCE/40-333G........LQE....................................................................
O15921_TRYCR/109-396C........LQETKLNPDDPQNEKLGE.....................................................
A3ZS40_9PLAN/129-366A........IQEIRSLDQSILPEFIDQINAAGRHYDYVIGPRLGRSDSKEQYAYIYDTASIELDRTQLYTIDDPGDALH.
Q11NA1_CHESB/104-316V........LQEMTPRWQDALAASGIWPFE..................................................
Q0URF7_PHANO/122-382F........LQEMGQSDLRQIREAE.......................................................
Q0FLB9_PELBH/11-291L........LTDIDFDH...DLVALGALAARLEAAGLSYPHRFA....................................
Q9ZVF0_ARATH/390-645C........LIETRVKEENSQWLGSKLFKDWS................................................
Q9RS34_DEIRA/101-311L........LQETNLLDPAKGLALR.......................................................
C4FH07_9BIFI/165-380A........LQEVSHGLVQRLRDAGLE.....................................................
B7S366_9GAMM/60-266F........IQEATLRAELGEVQLGGP.....................................................
M6BNC3_LEPBO/89-364V........FDEAFDTDARKILLDGVRSEYPYQTDV............................................
YAFD_ECOLI/47-252L........LQEAQTTPELVQFATA.......................................................
Q9F2J2_STRCO/121-324F........VQECERTCGAALRRDLA......................................................
Q7USG9_RHOBA/118-325I........AAEIDDRWKPILE.ELKPIFPH.................................................
A3SVB7_SULSN/110-316A........ALEVDPDWVDALYDALKDQYPH.................................................
A5FED8_FLAJ1/31-384L........LNEFDYIK..DPELGVKAFIKNYLNVSQGGAVAIDYPYY................................
DNAS1_BOVIN/26-274L........IQEVRDSHLVAVGKLLDYLNQ..................................................
Q54E13_DICDI/8-231I........LTELNSSPLQLKHDFP.......................................................
D3R3H2_BIFAB/133-356A........LQEMSPDLVTELHDAGL......................................................
Q0PC57_CAMJE/24-257M........IQEAGTLPRTATPTGRHVQQGGTPIDEY...........................................
Q1MZ88_9GAMM/34-259G........IQEADGGSFRSGHVNQVEYLAR.................................................
Q9VXE7_DROME/36-332G........LQE.......VNAQPQ.......................................................
DNSL2_HUMAN/25-288L........VQEVRDPDLSAVSALMEQINS..................................................
Q9U4W1_AEDAE/10-212RDQQPIILAIQETHRINTNRLNHSLQK.....................................................
O15922_LEIMA/133-437C........LQETKLNVDEADANATLGV....................................................
Q2PWA8_MONPI/4-202L........VQEPWTKMAKHLTKTHPRYQLFSPTTRWEIRPRTLTYVRKDL.............................
V9FYL2_PHYPR/6-366G........FQEVTRDALAMLKAQQWA.....................................................
Q9SN65_ARATH/347-583F........LIETLNKCEVISNLASV......................................................
Q985E5_RHILO/120-323T........LDEVSQMWTTELGFIASAYPYR.................................................
SMASE_MYCTU/228-473VPFSDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLP...................................
CDTB_ECOLX/26-261A........VQEAGSPPSTAVDTGTLIPSPGIPVREL...........................................
Q9PTX0_XENLA/23-272A........IEEVMNADNTAIISLVKELSL..................................................
C4RQR9_9ACTN/168-411L........LQEYVGWDLAGHRPVPVDHVAELRR..............................................
Q9YI04_XENLA/21-271L........LMEIKDSSNTVIRLLMAQLNSQ.................................................
Q3JBC2_NITOC/104-311L........MLEPDQWWEEQVR.ELEVKYAY.................................................
O34095_LEPIR/84-361V........LEGVFDTKSKNILMNGLRSQYPNQIDV............................................
Q315C8_DESAG/101-322A........VQEYIGDRRLTLPEGW.......................................................
O77366_PLAF7/563-897S........LQEVSEYLHSHLFCTF.......................................................
A6GK21_9DELT/6-259G........LFEIEQGRVVNALYNDFPDYDFYMTDGPQSL........................................
D5UUF8_TSUPD/40-343L........LSEAKTATADLVPLLA.......................................................
B1LXH2_METRJ/33-216L........MQEATRAIGFLLDRIG.......................................................
O46184_DROSU/14-220L........IQEPWVVGGRVCGLAT.......................................................
A6VUZ0_MARMS/30-246L........LQEAILNSPFDGMFNHSS.....................................................
Q8I3R5_PLAF7/2121-2476C........LQEIQNEHFLDFFKPSLGEFGY.................................................
O22148_ARATH/4-222F........LCETKKRRNYLENVVGH......................................................
P96273_MYCTU/27-281A........MQETKCPDGQFPALPLF......................................................
APEX2_HUMAN/5-304C........LQETKVTRDALTEPLAIV.....................................................
Q9RKB3_STRCO/12-265C........LQEVRAEPHQLPDHAGAP.....................................................
Q63291_RAT/38-257C........LQETHLRDKDRHYLRVK......................................................
INP5E_RAT/307-587G........VQE....................................................................
A5V5B1_SPHWW/53-337L........LQEAFSDDAKAIRAASGHRYAAFGPDDA...........................................
Q281W3_PHACH/39-344SEGV.VLFGIQEGLVRQVNDLATLLGSEWAWIGVGRDDGKQAGEFSAIFYNKNFIELREWDTF.................
B2B0A0_PODAN/123-383M........FNEMVASDLDVIADDE.......................................................
DNAS1_CHICK/24-272L........VQEVRDADLSSVKKLVSQLNS..................................................
C5C387_BEUC1/53-411L........LNEFDYVP...DHVAVDLFRDNYLEVSQGGAEPIEYPY.................................
SHIP1_RAT/411-703G........TQEDPLG........E.......................................................
EXOA_BACSU/4-243C........LQETKIQDGQVDLQPE.......................................................
IP5PC_ARATH/581-914G........LQEVEMGAGFLAMSAA.......................................................
H2PHM7_PONAB/192-531S........LQEVETEQYYSFFLVELKERGY.................................................
INP52_YEAST/596-874G........LQE.......VIELTA.......................................................
IP5PD_ARATH/576-908G........LQEVEMGAGFLAMSAA.......................................................
RTJK_DROME/9-214L........TTETHMRVGQRIYLPG.......................................................
B9J7A5_AGRRK/98-299E........IFEAEPIKAELQRIGG.......................................................
O86610_STRCO/4-250C........LQEAKVAEAQFPFDALR......................................................
A3VZN2_9RHOB/19-338V........LQGVDHDL...DLLAVKALRDRIAQGGGPRYDHLFA...................................
H2R3J5_PANTR/15-385KEYNRARVYLDENYKSQEHFTALGS.......................................................
EXOA_STRR6/4-266A........IQETKLSAKGPTKKHVEIL....................................................
PI5PA_HUMAN/428-721G........LQE.......VNSMLN.......................................................
D1AXA7_STRM9/113-329V........FPELEGYYKGDPANNRLKELFK.................................................
Q1GKT6_RUEST/32-332A........LQGVDWDY...DLYSLRALQHRLKGAGQDYPYAFA....................................
Q2H5K7_CHAGB/308-508A........IQEPWINQQTKSTYCP.......................................................
A1SIW4_NOCSJ/70-299T........LNEASGWSLEQIEAAAPGY....................................................
Q9ZDR5_RICPR/4-252L........LQETKVANSLFPLEVIK......................................................
D7WDI6_9CORY/121-321V........LPEASNDKVVAA...........................................................
Q07995_CHITU/11-220C........ISETFLKPNSKIDSHPDYVIH..................................................
Q9S2L9_STRCO/24-240L........LQEAPRFFRWRKKITRL......................................................
NSMA_CAEEL/42-318G........LQELWSYYDFVRLSEQVS.....................................................
O93520_ORYLA/9-231F........LQETHLPEAEHLKLNKM......................................................
Q5LX09_RUEPO/24-347A........LQGLDWDH...EGRALDALAAQLAAAGWEMAHIFA....................................
NSMA_DROME/9-264S........LQEVWAQEDSELLQKGTE.....................................................
Q9SIQ5_ARATH/113-377.........GLETLNQCDKVCKLAYD......................................................
Q83GA3_TROWT/91-308A........LQGIKNAAIGTLVGSLSPS....................................................
Q2C5E7_9GAMM/445-703S........FQEGNNMCKTVAELLD.......................................................
A1RCE7_ARTAT/41-258G........FQEFEPPQAQAFLNATNG.....................................................
D2B0I5_STRRD/117-322S........TQELTAEMVEKLDAAGL......................................................
Q15NA1_PSEA6/104-315V........TLETNQWWQDALS.PLHDDYPY.................................................
Q9P8H7_CANAX/14-261F........IQEIRFVSQEQFNYINKI.....................................................
Q9VTW2_DROME/396-695G........TQE....................................................................
A6W517_KINRD/120-329S........LPESDLALAEDLAARVEAA....................................................
A5C0G0_VITVI/310-530F........LIETLVHSAQVEKLKSK......................................................
A7T4C3_NEMVE/164-372S........INESALKPSIPDSLYSIP.....................................................
CCR4_SCHPO/339-664C........LQEVDVENYDTFFAPQMSLKGY.................................................
D2B2Z6_STRRD/114-320T........LQELTPEAAERLEKAGI......................................................
SYJ1_SCHPO/563-839G........FQE.......IVQLTP.......................................................
Q1D7J7_MYXXD/85-296A........MQEMDAASVDRIASELGLA....................................................
C0X2X7_ENTFL/9-266A........LQEVNQKVASKKVPLEQLTTFCPVATQTPVH........................................
Q2UNN7_ASPOR/69-326F........LQECTPSDLETIAATP.......................................................
TYDP2_CAEEL/123-353F........LQEVVDRDLAPIDKLQ.......................................................
C2L0P4_9FIRM/115-330V........FPELEGYEKGDMSNRKLADLFK.................................................
Q9SA95_ARATH/176-431C........FQEVTPEIYDIFRKSNWW.....................................................
Q50321_MYCPL/166-460G........LTEVFSEEAVKEVVAQLNKLAGSGTYSYVASKKLKG...................................
B0WQS5_CULQU/1836-2048A........LSETWMDDNASIELEG.......................................................
A0JXK8_ARTS2/115-328T........VQEHSRALEDRLAAAGL......................................................
Q24335_DROME/7-215L........LSETHLTSKYNFQIRD.......................................................
O83555_TREPA/304-613C........LVEIQDDDGAKKHHHCTSAQHTLDLLVRAMAEFSAVRYKAVNIDPQDNA......................
E8RN27_ASTEC/87-283A........IVEAGPLAEETLAAKLRQTY...................................................
D0KX69_HALNC/290-639L........LNEFDYDP...SGDALDLFERRYLAIGQNGAHSIQYPYH................................
Q5L902_BACFN/414-668M........MQEAYGIQQMLADSLG.......................................................
Q1CXT2_MYXXD/230-492G........LAEIVSTAQFNELKARLPGYDG.................................................
EEPD1_XENLA/257-520A........VQELSDKDALEKLCTELNQPSLPNIRKWKGMRGSWKCIIS...............................
A4A5W6_9GAMM/35-389L........LNEFDYHA..DPERGVKPFIERYLQQSQTDVEAIDYPYY................................
D9QM28_BRESC/100-303V........LVEVGDTPAGQMDRIVGA.....................................................
O05382_AGGAC/4-259G........LQEIKVSDEVFPYDLVD......................................................
YNTB_SCHPO/124-492C........MQEVDAEFVPNFYKKLLGGLGYE................................................
NGL1_YEAST/30-353C........LQEMTARDYEDYWHDSIGVDVN.................................................
NGL3_YEAST/112-485S........LQEVDYNEL.NFWQENFHKLGFD................................................
APN2_YEAST/20-354T........FQELKTEKLSISKWGRVD.....................................................
SYNJ1_RAT/538-859G........FEE.......MVELNA.......................................................
A7T299_NEMVE/40-247F........LTETKIDSSYTNDQLALEG....................................................
O68855_9STAP/43-321I........LNEAFDNSASNQLLNNLKNEYPHQTGV............................................
O13348_MAGGR/17-223N........VQEPWCGLNTTTQTHPGYDVFAPVDEWHANTYEAMTGLRPRVLTY..........................
Q9Y026_TRYCR/56-263A........IQETWKSSEQIASMHTGDY....................................................
D2AT04_STRRD/93-301A........LQELTPSAAEGLRKAGL......................................................
Q9Y1H3_DICDI/7-211L........LTETNFNGFNHHKTMF.......................................................
C5BVQ8_BEUC1/110-317T........LPETTAESARAIAALLAA.....................................................
P74492_SYNY3/14-266C........LQETKVVDEDFPRQPFE......................................................
A4EK32_9RHOB/102-307L........LMETDALWAEALE.STLARYAT.................................................
C7PRF4_CHIPD/618-892A........LAEVVDTARFRAVANQMPGYSYIISDFGS..........................................
TYDP2_HUMAN/117-351F........LQEVIPPYYSYLKKRS.......................................................
A3TK42_9MICO/109-315V........LTEVTPETADAIDAAGA......................................................
DNAS1_HUMAN/26-274L........VQEVRDSHLTAVGKLLDNLNQ..................................................
Q9NAL5_CAEEL/311-526A........VTESWLQESVSSALFTSFG....................................................
A7C3D0_9GAMM/108-325V........LNEPPQIDSWLAQLTQQMGPNWSMFKY............................................
NSMA_HUMAN/12-272L........LEEVWSEQDFQYLRQKLS.....................................................
O65598_ARATH/3-223G.......GVIEKHVKQPKDKKFINALLPGWF................................................
C5NNP0_ORYSI/360-581A........LLETRKNDVSKTNLDHLA.....................................................
Q9ZQF8_ARATH/4-230F........LSETKNDLVYLQNVQVS......................................................
Q17003_ANOGA/83-316A........LTETWLVDNIPSALLFNN.....................................................
LIN1_NYCCO/10-229C........IQESHLTLKDKYRLKVK......................................................
O97240_PLAF7/281-607C........FQEVRLPAMNLSEPCDNKNKNKNKNDGIRDRGKIKNSDQKSLADYEIMEQI....................
A1U6L7_MARHV/41-269A........LQECDGGSLRSGYINQVQYLAE.................................................
Q5QUK7_IDILO/105-312V........TLESDDWWQEKLD.AIESDYPH.................................................
A1T8I1_MYCVP/118-329T........VAELTPPAADRLAAAGI......................................................
B1KQZ4_SHEWM/42-455M........MGEFNNDGIAENQDAIKGFRLNYLAVPQNALGTTADDKKMLEP............................
A3XAE4_9RHOB/4-211L........AVETDGWWQAKLD.GLSPDYPY.................................................
A8M5G8_SALAI/105-315T........VQEFTPAVAAELDQAGL......................................................
Q2SQK9_HAHCH/44-408L........INEFDYDA...AGEAARLFQQNYLSLSQNGAAPAIYPYVYS..............................
Q1JZE6_DESAC/7-207A........LQNIQDLPHGQTLEAL.......................................................
O42110_9SAUR/47-252X........XTETWWNNSHDWNTVMD......................................................
OCRL_HUMAN/245-524G........FQE.......L.DLST.......................................................
O44201_BOMMO/8-204AEFERFLGGLEALLHRLGSRP...........................................................
A4BGZ7_9GAMM/1324-1668L........LQEFDYVA...DGSAVKALQENYLGKGWNGAERIEYPYV................................
C2G3V9_9SPHI/103-310L........LLETSHAWEKALR.SIDKKYPY.................................................
YBHP_ECOLI/13-244C........LQEVMGAHEVHPLHVENWPDTSHY...............................................
G3XDB0_PSEAE/4-246C........LQDTRASAFDLDDPSFQL.....................................................
Q04135_DROME/7-214L........LSETHLTNKNNFHIPG.......................................................
Q9XAL0_STRCO/104-321A........LEEITAQDREVYEKGLARE....................................................
Q9ZAB7_AGGAC/30-274M........VQEAGSLPSSAVRTSRVIQHGGTPIEEY...........................................
Q9YGS2_TAKRU/70-277C........LTETWLQEEEYVSLNEST.....................................................
Q7UV93_RHOBA/76-326A........IQEIKGDPALPMNGLLDEIASLGGRYDATVSAPQGRTSQTERYGYVWDTDRIDLIPESDYLVNDDLDRMHR
PHL3_BACCE/40-305I........LNEVFDNSASDRLLGNLKKEYPNQTAV............................................
Q868R2_ANOGA/5-211L........LSEPYCVPRN.............................................................
Q9X9W4_STRCO/312-604S........LEEIQDNNGATDDGTVAADATVGRLIDAIVAAGGPRYDWRGIDP...........................
A4ESR5_9RHOB/34-347L........LQGVDWDF...ELRALKALERKLSLAGHPYPHLFM....................................
C6RT65_ACIRA/105-312L........TLETDETWQNELS.GIEKDYPF.................................................
APE2_ARATH/4-324C........FQETKLRRQELTADLAIA.....................................................
APN2_SCHPO/4-295C........VQELKMQKDSFPQQYAVV.....................................................
A6ENA6_9BACT/100-307V........TMESNKAWEKGIS.SIEKTYPY.................................................
DNAS1_OREMO/30-276L........IQEVRDSDLSATQTLMNYVNK..................................................
SYJ2_SCHPO/573-851A........VQE.......IITLNM.......................................................
Q9SIS9_ARATH/366-584F........LIETKQQDNYTRDLGVK......................................................
A3SUZ8_SULSN/8-305V........LQGVDYDL...GGTTLGALADRVGEAGPSYPYRFA....................................
C3JMR5_RHOER/45-349L........LSEAGTATTALADMLT.......................................................
B8K751_9VIBR/38-447M........MAEFNNDGTGEDKAALIGFQTNYLSVPQSSEGAGGQPNLTAIE............................
CCR4_YEAST/508-818C........LQEVESKTFEEYWVPLLDKHGY.................................................
ANGE1_HUMAN/248-656C........LQEVQEDHYWEQLEPSLR.....................................................
T0PZ96_9STRA/35-481C........LQEVDDYELFWIPALNALGYDSV................................................
O46094_DROME/190-469G........LQE.......L.DTPT.......................................................
Q86GH0_DROAE/65-291M........VIELRQRASQSASNSVRGPFANN................................................
Q6MMC5_BDEBA/32-239F........LQEALLDQRMPAMWRSDFSAYEWHL..............................................
A0Y1P5_9GAMM/101-305I........LQEFSDKNRHLLTQFIT......................................................
Q9TZX4_CAEEL/118-349G........LCETKRAAEAHLIHHDGTG....................................................
A1SIW4_NOCSJ/519-746G........LQEVHGPQAQALENQY.......................................................
O96546_LYMDI/17-226L........VQETFLKPFNKDPRVA.......................................................
D0LKU2_HALO1/119-323V........ILEPSPRWLEPLAAAF.......................................................
INP51_YEAST/532-813G........LEE.......VVELTP.......................................................
Q1QA26_PSYCK/112-319I........TLESDEKWEKALD.QVESDYPY.................................................
DNSL1_HUMAN/22-265V........LQEVVDSSGSAIPLLLRELNRF.................................................
Q9RFY5_HELHT/24-265M........VQEAGAIPASARRTGRMVQPGGTPVEEF...........................................
A0A023EDJ4_AERSA/37-444L........LNEFDNDGKGENTADLKAFNDNYLAHAQHSEVQAISYPV................................
Q93137_BOMMO/15-220L........VQETLLKPARRDPKIA.......................................................
D0LNM2_HALO1/11-267G........LQEVCLGQPAQLDALADIFRVR.................................................
A6WD12_KINRD/15-239C........VQEAPTHSLAVHRLGVL......................................................
A5P939_9SPHN/105-310L........LMETDQKWADALA.PVVGRYRQ.................................................
C0DYX5_EIKCO/70-259T........LGEINLDNPGWQSLRQAYPHG..................................................
IP5P8_ARATH/88-411G........FQE.......IVPLNA.......................................................
YTX2_XENLA/6-230F........LQETHTTPELEASWNLEWKGRV.................................................
ANGEL_DROME/71-344C........LQEMQFDHLPVLVQRLRMG....................................................
SHIP2_HUMAN/429-718G........TQENSVG........D.......................................................
I5P2_MOUSE/350-629G........FQE.......L.DLSK.......................................................
D2T850_ERWP6/102-309I........ALETDRWWQSQLD.VLSADYPY.................................................
A0YXL3_LYNSP/4-376L........INEFDYNSE.NPNQAIDLFQQNYLGVDQNIADSAGTVNYPFVY............................
SYNJ2_MOUSE/535-855G........FEE.......MVELSA.......................................................
C5BJD9_TERTT/346-705L........LNEIDGND...NMATINSFSENYLKVSQNGAGAITYDY.................................
C6WGJ0_ACTMD/106-312A........MQELSPAMVRDLENAGL......................................................
Q6LKH0_PHOPR/93-303I........FQETTPEHGGMLKEALRT.....................................................
A0Y3X6_9GAMM/104-311I........TLESDSWWEEKLS.VLKKNYPH.................................................
Q7M558_DANRE/2777-2983A........VTETWLPADTLSEAVHIDEYSFHS...............................................
D2B8I2_STRRD/121-420F........VVEGYGSGQKILDGLNAGRAEGDRFTGVQLTTPEDYSHNGDNLWLYTKLKVEKVYPRYADADIDS......
C7NG46_KYTSD/144-354V........LPETSHARAQAAVDAAGW.....................................................
B5GR87_STRC2/14-301G........RAEFLAGPGNGQRRLLDAEAALTPEGRPWL.........................................
C5C297_BEUC1/17-258A........LQEVDRGQVRSGGLDQAAVVAAALGLPHVRQAAAL....................................
Q1I8E8_PSEE4/192-431M........LQEAGVWPLSSQFIADIQVADQFGVQHVVY.........................................
D0LH64_HALO1/68-276L........LQELEVGARRSGRVNQPRALAEAMGMD............................................
B7QXZ5_9RHOB/33-347L........LQGMDWDL...NSATLNAFADLLAETIAPYPHRFA....................................
C0W4G5_9ACTO/4-304I........TSESTPQAVEELRHLLGDGWY..................................................
O29675_ARCFU/5-248C........MQETKVENRKFPEADFH......................................................
G1UB84_HAEDU/4-259G........LQEIKVADEDFPHQLVE......................................................
D4BMH5_BIFBR/190-433A........LQEVTDELIARLTEAGL......................................................
Q8PBH9_XANCP/68-425L........LNEFDFDP...AHRAADLFQQRYLQVAQPGGGDALSYPYRY..............................
CCR4_CANAL/459-769C........MQEVETKTFQEFWLPVMTANGY.................................................
F2G584_ALTMD/107-313V........TLESNEKWQKGIS.EIESEYPY.................................................
E7KT29_YEASL/115-504C........LQEIDHIQFQSFWKDEFSKLGYD................................................
DNSL3_RAT/29-279L........LMEIKDSNNNICPMLMEKLNGN.................................................
D1NTE5_9BIFI/129-340A........LQHTTPALVDALNTAGI......................................................
Q95041_RHOPR/31-304G........LQE.......VTMSAV.......................................................
B9NTP9_9RHOB/22-326A........LQGIDWDL...DGLTLAAFTRRLSESGLSYPFSFT....................................
Q5QWX6_IDILO/38-393L........LNEFDYVD...KEIGVNVFQEKYLSIPQNGQKAIEYPYT................................
APEX1_RAT/64-308C........LQETKCSENKLPAELQEL.....................................................
D2S515_GEOOG/4-252A........VQEVDAGQPRSHGVDQAAALAAGLGAADWRGAATVAGT.................................
Q24690_DROTE/6-206S........LQETHIQHTNTIPTPINYKLL..................................................
Q9ZCP7_RICPR/4-250L........LQEIKCETEKFPFNELS......................................................
O62658_CANLF/11-230C........LQETHFRQKDTYSLKIK......................................................
O17590_CAEEL/100-403G........LQE.......M.DLSV.......................................................
PHLC_LISIV/48-325I........LNEAFDTSASHRLLNNLREMYPHQTPV............................................
O64428_CHLVU/12-249L........LQETHHSSTEEGTAWAQEGPA..................................................
Q9RXF9_DEIRA/38-271L........LQEVRAEP.......MPD.....................................................
EX3_ECOLI/4-259G........LQETKVHDDMFPLEEVA......................................................
O26314_METTH/7-248C........LQEIKAAPEQLPRKLRHV.....................................................
B4WAV6_9CAUL/100-305V........LVEVGDAPSDRLDEVLAG.....................................................
D0LI27_HALO1/46-296A........LQEVADEFAARRVFDP.......................................................
A7A3N5_BIFAD/144-355A........LQELTDDLVAALDEAGL......................................................
O01419_BOMMO/9-206AEFESFLDELGQVVGRSRSRR...........................................................
O18005_CAEEL/310-619F........LQEVDLSRHENFIVPF.......................................................
B5GU93_STRC2/121-326F........VQECPITCSRALAEEIP......................................................
Q9S1Z5_STRCO/42-270G........LQEVDKHYSARSDWADQPAELAELL..............................................
B1MNW1_MYCA9/96-305T........INELTPEARAKLVAAGI......................................................
Q2C775_9GAMM/365-634V........LTEGRLNAKAVAEELG.......................................................
Q6UE72_TETTH/99-328I........LLETNCKENMRVDIHNPDYIQMNNHCKVRQ.........................................
O83162_TREPA/8-255C........LQEIKAHESQLSAALRAPVWS..................................................
D2PNL1_KRIFD/62-287T........LQEVCAGQAIRIRNRLSDA....................................................
A1R797_ARTAT/136-351A........IQEHTQGLEDRLEYEGL......................................................
D0NNT3_PHYIT/6-323T........FAEADIRTQRDAMLDQFRVFG..................................................
A5LH53_9CAUD/25-260M........VQEAGAVPASATLTEREFSTPGIPMNEY...........................................
D4DUX1_NEIEG/102-289A........LAEIDLADRGWQALRRSYPYG..................................................
O76745_CIMLE/32-291A........VQG....................................................................
Q094F5_STIAD/52-257F........VQEAKNVRLRDILGDG.......................................................
B6QFL9_TALMQ/445-668A........ISEPYARMIGNTMITS.......................................................
Q1YK76_AURMS/120-327L........VLETDQWWDTQLG.ALQDRYRAS................................................
D0L3V4_GORB4/96-309T........VVELTPDAVGRIDRSGL......................................................
A3SLI1_ROSNI/16-332L........LQGVDHDA...DHLALLALQSRIAQAGYSLPYRYA....................................
CSS1_SCHPO/12-289L........LQEVWSIYDFQEIRNLVS.....................................................
D1BKV9_SANKS/134-342A........LPEGQPVVDEVVAQLIGH.....................................................
B5ZY66_RHILW/98-299S........ILEAEPLLSELPRLLK.......................................................
PHLC_STAA8/46-322I........FNEAFDNGASDKLLSNVKKEYPYQTPV............................................
INP54_YEAST/11-313G........FQE.......VVPIWQ.......................................................
RTJK_DROFU/9-214L........VTESHMREGQRIFLPG.......................................................
D0Z4R5_PHODD/38-450L........LAEFNNDGIGENKAALKGFQDNYLSVAQSPNSIDGGDKLEPIH............................
ARP_ARATH/279-527C........LQETKLQVKDVEEIKKTLI....................................................
IP5PF_ARATH/543-875G........LQEVEMGAGVLAMSAA.......................................................
B1C336_9FIRM/825-1040VA......GVQEVDVFTSRNNYDMMQEFVN..................................................
Q26816_9TRYP/95-297L........LSETRMTPGEAACFSV.......................................................
A6BZ11_9PLAN/4-223C........LTEAQ..................................................................
A4FQX0_SACEN/43-251T........LNEVCAPDITRLTHETGYAGEF.................................................
P72938_SYNY3/1331-1646G........LAELENDFLPGSSGNAIENLVN.................................................
A1K8S1_AZOSB/38-302S........VVELRENLGDLKRVLD.......................................................
B0X3H8_CULQU/1636-1848A........LSETWLDDNSSVEIEG.......................................................
C8N9G3_9GAMM/89-278A........LAEIQLHDPGWQPLRQHYPHG..................................................
Q9A7Y4_CAUCR/110-315V........IEEGAGESWPIVK..........................................................
Q01375_NEUCS/7-217A........IQEPGRNLNGDIYRPRGGRYFGVDCSEKGRAVIYVNKKWNLK.............................
A9DTY1_9RHOB/15-313V........LQGIDYDL...ELSALTALADALTAAGAPYPYRFA....................................
YE8A_SCHPO/794-1114G........FQE.......LVDLEN.......................................................
Q2UFE1_ASPOR/75-351F........LQEMVPNDLTIIQQTK.......................................................
Q09BG4_STIAD/252-512A........LQEVVNAGTLAQLKQAMPGYD..................................................
Q44070_AERHY/480-826G........LMEIEDNGYGNNSAIANLVGALNAA..............................................
I9U9G4_HELPX/4-242C........IQESKMQQEQNTFEFK.......................................................
A5VCJ2_SPHWW/55-332M........FQEMFSGGAKRAVAASGYPAIVAGPQRLT..........................................
Q9RWN4_DEIRA/100-318L........IQEGLTRQRDTVTYAA.......................................................
Q55DR4_DICDI/251-565S........FQELRFSAWDSEVKSSNPIKMGEERNQVQHL........................................
INP53_YEAST/571-849G........LQE.......VIELSA.......................................................
C9P6A0_VIBME/38-446M........MAEFNNDGTGEDTSALIGFQKNYLSVAQSRQGAGGEPDLEPID............................
B4R9Q2_PHEZH/109-311V........MEETSPPLREKVRGLAGWHV...................................................
O51484_BORBU/4-243C........IQETKALREQLPKDLIL......................................................
IP5P9_ARATH/63-371G........FQE.......VVPLRA.......................................................
D2R9U6_GARV4/132-368L........LQELSKSLVKNLEKLGIY.....................................................
P91740_HYDVU/57-349A........MQELTESQLKFMTLCLPHYSYVEPE..............................................
NOCT_MOUSE/144-412C........LQEVDHYFDTFQPLLSRLGYQ..................................................
A5ZI49_9BACE/408-663T........MQEGYGSQEMIAKAIG.......................................................

PF14529

D7EM17_TRICA/220-332--------------------------------------------------------------------------------
D8Q682_SCHCM/470-595--------------------------------------------------------------------------------
A7ENE7_SCLS1/419-538--------------------------------------------------------------------------------
A7EV44_SCLS1/169-288--------------------------------------------------------------------------------
B7Q7X7_IXOSC/39-155--------------------------------------------------------------------------------
E9HS52_DAPPU/293-409--------------------------------------------------------------------------------
E9H8A1_DAPPU/103-219--------------------------------------------------------------------------------
E9HMD6_DAPPU/94-210--------------------------------------------------------------------------------
E9H5U8_DAPPU/53-167--------------------------------------------------------------------------------
B7PJV5_IXOSC/324-438--------------------------------------------------------------------------------
E6ZRW9_SPORE/1185-1312--------------------------------------------------------------------------------
E9H822_DAPPU/420-535--------------------------------------------------------------------------------
E9HYG6_DAPPU/19-132--------------------------------------------------------------------------------
E9HDY2_DAPPU/149-262--------------------------------------------------------------------------------
E9HRI7_DAPPU/460-571--------------------------------------------------------------------------------
E9HZZ2_DAPPU/118-231--------------------------------------------------------------------------------
E9HRK8_DAPPU/106-221--------------------------------------------------------------------------------
E9HSQ7_DAPPU/121-236--------------------------------------------------------------------------------
E9HE10_DAPPU/492-604--------------------------------------------------------------------------------
E2C5Q1_HARSA/10-124--------------------------------------------------------------------------------
B0W1L0_CULQU/467-584--------------------------------------------------------------------------------
D7GXY3_TRICA/106-218--------------------------------------------------------------------------------
D2A4F4_TRICA/101-212--------------------------------------------------------------------------------
E2AVN7_CAMFO/107-222--------------------------------------------------------------------------------
B6QWM9_TALMQ/555-687--------------------------------------------------------------------------------
A2QSQ0_ASPNC/504-636--------------------------------------------------------------------------------
Q2HHJ7_CHAGB/475-603--------------------------------------------------------------------------------
Q2H3B9_CHAGB/415-543--------------------------------------------------------------------------------
Q2GZF1_CHAGB/632-760--------------------------------------------------------------------------------
E9FE00_METRA/199-327--------------------------------------------------------------------------------
B6QNK9_TALMQ/286-414--------------------------------------------------------------------------------
B6H8V5_PENRW/395-529--------------------------------------------------------------------------------
Q2U1R5_ASPOR/105-240--------------------------------------------------------------------------------
A2QZW2_ASPNC/91-226--------------------------------------------------------------------------------
Q2TX40_ASPOR/104-239--------------------------------------------------------------------------------
B8MUV7_TALSN/118-253--------------------------------------------------------------------------------
A6R6U1_AJECN/368-494--------------------------------------------------------------------------------
A7S3V7_NEMVE/68-188--------------------------------------------------------------------------------
A7S2X0_NEMVE/168-291--------------------------------------------------------------------------------
C3YN84_BRAFL/1345-1466--------------------------------------------------------------------------------
D6WYM2_TRICA/271-393--------------------------------------------------------------------------------
A7S0T7_NEMVE/341-458--------------------------------------------------------------------------------
E3N7S5_CAERE/136-251--------------------------------------------------------------------------------
E3MXD9_CAERE/375-485--------------------------------------------------------------------------------
E3MA06_CAERE/30-140--------------------------------------------------------------------------------
E3LJB4_CAERE/350-458--------------------------------------------------------------------------------
E3N681_CAERE/36-144--------------------------------------------------------------------------------
E3ND32_CAERE/223-331--------------------------------------------------------------------------------
E3MKX6_CAERE/106-217--------------------------------------------------------------------------------
C5KXY0_PERM5/413-539--------------------------------------------------------------------------------
A6RES2_AJECN/586-706--------------------------------------------------------------------------------
B6QF01_TALMQ/823-943--------------------------------------------------------------------------------
B8MCU2_TALSN/715-835--------------------------------------------------------------------------------
A6QSA7_AJECN/584-704--------------------------------------------------------------------------------
Q0TWS8_PHANO/49-171--------------------------------------------------------------------------------
B7PHI8_IXOSC/55-177--------------------------------------------------------------------------------
C5LYL7_PERM5/137-253--------------------------------------------------------------------------------
E0VEI2_PEDHC/13-127--------------------------------------------------------------------------------
E9GSG1_DAPPU/115-230--------------------------------------------------------------------------------
B7QBV7_IXOSC/96-214--------------------------------------------------------------------------------
B7QN21_IXOSC/94-212--------------------------------------------------------------------------------
B7PD65_IXOSC/108-226--------------------------------------------------------------------------------
B7PS20_IXOSC/108-226--------------------------------------------------------------------------------
B7PXF9_IXOSC/95-213--------------------------------------------------------------------------------
C5K8V2_PERM5/55-185--------------------------------------------------------------------------------
B4HD52_DROPE/236-352--------------------------------------------------------------------------------
E2AWP2_CAMFO/83-203--------------------------------------------------------------------------------
E2B1G0_CAMFO/3-123--------------------------------------------------------------------------------
E2B0F5_CAMFO/1-121--------------------------------------------------------------------------------
E2BFV3_HARSA/10-133--------------------------------------------------------------------------------
E2AA34_CAMFO/86-207--------------------------------------------------------------------------------

PF03372

APEA_DICDI/108-351.................................................................KGYEYHFIE.....A
C0W5Q6_9ACTO/5-307.......................................RRPRRSALDSPADDVLGPLRAAAGLPMAG............
Q9ZBN3_STRCO/24-259.........................................................GMRVSFAPIYSLDPVTA.....G
A7T3Q8_NEMVE/115-319.................................................................PGYHIERKD.....R
B3SRB8_ASCTA/220-428...................................................................KPFTIQ......G
B8MHG3_TALSN/453-675................................SQLRPFTTDTKEASDLLFLQIFSPTGKSALIVNIYNAPAGSI.....R
Q1QVQ0_CHRSD/109-317...........................................................ATRIPLDNL............
A0M2U8_GRAFK/107-314...........................................................TVKIPKDNL............
A6CGC2_9PLAN/130-329...................................................................QTCPDH......P
INP5K_MOUSE/37-330................................................................................
RRP1_DROME/430-670.................................................................PGYHPYWL......C
C7QE92_CATAD/155-383...................................................................ARYPY........
C0W5C1_9ACTO/126-340.................................................................QDGFSFTAFT...AG
A9DSA8_9FLAO/61-246...................................................................KNYYF........
A3ITE0_9CYAN/5-368........................................PSNTGIASEFDLDNNGEVITNPGELGYGNDAFGF.....G
C7ZMD9_NECH7/94-389................................PTRHFTLMMIPRGLRISNCFRVPFVSESERDVLVVHLPVSEN.....G
I5P2_CAEEL/8-272................................................................................
C1A7M1_GEMAT/266-540ITPPAGHRLIDIEEAAQISSVGAWVDVHGTETMFVPLDLQSGGYAGSVHDNLRVLQVEAIRRYIRAEIAQR.........
Q9RZQ3_DEIRA/490-782.............................................................KAGAGTYAAVTTG.....S
O27012_METTH/6-222...................................................................TFR..........
Q08525_CHICK/66-271..................................................................GYRLFRRD.....R
Q0CY83_ASPTN/48-313................................................................................
C2Q910_BACCE/40-333................................................................................
O15921_TRYCR/109-396...............................................................VPGYRFVDHVC.....R
A3ZS40_9PLAN/129-366............REPLVAWFRVRGPNPEQAFTFTLVNIHTDPDEVKDEINVMDDVLRAVRGDGRGEDD............
Q11NA1_CHESB/104-316............................................................SSRDLHAN............
Q0URF7_PHANO/122-382................................................................................
Q0FLB9_PELBH/11-291..............................................QRPNTGVPTGLDLDGDGRLGGPRDAQGY.....G
Q9ZVF0_ARATH/390-645..........................................................MLTNYEFNRR............
Q9RS34_DEIRA/101-311................................................................................
C4FH07_9BIFI/165-380...............................................................ATLPYSNVAKW.....S
B7S366_9GAMM/60-266.................................................................LYQSFAQGY.....T
M6BNC3_LEPBO/89-364.......................................................IGRTKKGWDATLGLYRT........
YAFD_ECOLI/47-252...................................................................NYLAADQVP.AFV
Q9F2J2_STRCO/121-324..................................................................AGYPHRRA.....V
Q7USG9_RHOBA/118-325...........................................................QIIYPQDNW............
A3SVB7_SULSN/110-316...........................................................WVKVPKDNS............
A5FED8_FLAJ1/31-384...........................................YYSTVNTGQPSPYDLNNDGKLNNFGNDAWGF.....G
DNAS1_BOVIN/26-274............................................................DDPNTYHYVVSEPL.....G
Q54E13_DICDI/8-231...................................................................DHIIS........
D3R3H2_BIFAB/133-356.................................................................DDLLPFHQFG..DPS
Q0PC57_CAMJE/24-257......................................................EWNLGTLSRPDRVFIYYSRV.....D
Q1MZ88_9GAMM/34-259............................................................QANFPHWYSQLNRN.....F
Q9VXE7_DROME/36-332................................................................................
DNSL2_HUMAN/25-288............................................................VSEHEYSFVSSQPL.....G
Q9U4W1_AEDAE/10-212.................................................................RYSWTLKCN.....E
O15922_LEIMA/133-437...............................................................VDGYSFVDHPC.....A
Q2PWA8_MONPI/4-202.......................................PAHTLPQPSSPDITAVEVDGLTIINVYRPPNDSVT.....P
V9FYL2_PHYPR/6-366................................................................KFYDCSVDTA.....P
Q9SN65_ARATH/347-583.................................................................LGFPNVITQ.....P
Q985E5_RHILO/120-323...........................................................ILCPYPNGM............
SMASE_MYCTU/228-473.............................................GGDTVDVYNLHTNTGGGPTTNANLAQVAN.....Y
CDTB_ECOLX/26-261......................................................IWNLSTNSRPQQVYIYFSAV.....D
Q9PTX0_XENLA/23-272............................................................ATKLNYNVLISDHL.....G
C4RQR9_9ACTN/168-411........................................................HFPDYQVVAVGE............
Q9YI04_XENLA/21-271...........................................................SETRNQFDLTISQRL.....G
Q3JBC2_NITOC/104-311...........................................................TVKKPLDNR............
O34095_LEPIR/84-361.......................................................IGRATYGWNQTLGDFRAFP.....L
Q315C8_DESAG/101-322...................................................................QGK..........
O77366_PLAF7/563-897...................................................................LNENYFSNY.KPK
A6GK21_9DELT/6-259...................................................EMVVAARHGVFGQASFVVKREFR.....G
D5UUF8_TSUPD/40-343...................................................................AAGATY.......
B1LXH2_METRJ/33-216...................................................................GHYAWA......P
O46184_DROSU/14-220...................................................................KDYNLIV.....A
A6VUZ0_MARMS/30-246...............................................................QHQWIMASSFKNVKSNI
Q8I3R5_PLAF7/2121-2476...........................................................EGVYKQKTKEIFTSPSGKRRG
O22148_ARATH/4-222.................................................................LGFFDLHTV.....E
P96273_MYCTU/27-281..................................................................ELGYDVAH.....V
APEX2_HUMAN/5-304................................................................EGYNSYFSFS.....R
Q9RKB3_STRCO/12-265.................................................................EGWHVTHAP.....A
Q63291_RAT/38-257..................................................................GWKTTFQA.....N
INP5E_RAT/307-587................................................................................
A5V5B1_SPHWW/53-337......................................................LAGPPTRSPADRAFAAEASFLKGERS
Q281W3_PHACH/39-344...........................WLSNTPFDVSRFPGAGSLRICTAARMTLKTTSGPINFSYLNTHLDDQ.....S
B2B0A0_PODAN/123-383................................................................................
DNAS1_CHICK/24-272............................................................ASSYPYSFLSSIPL.....G
C5C387_BEUC1/53-411...........................................AYVAPSNTGIPSGFDLNNDGTVGGGDDALGF.....G
SHIP1_RAT/411-703................................................................................
EXOA_BACSU/4-243..................................................................DYHVYWNY.....A
IP5PC_ARATH/581-914................................................................................
H2PHM7_PONAB/192-531...........................................................NGFFSPKSRARTMSE.....Q
INP52_YEAST/596-874................................................................................
IP5PD_ARATH/576-908................................................................................
RTJK_DROME/9-214..................................................................YLMYHAHH.....P
B9J7A5_AGRRK/98-299..................................................................AYPYRIGC.....S
O86610_STRCO/4-250..................................................................EAGYEAAV.....H
A3VZN2_9RHOB/19-338..............................................PRPNSGMATALDMDGDGRRGGPRDAQGY.....G
H2R3J5_PANTR/15-385................................................................................
EXOA_STRR6/4-266...............................................................EELFPGYENTWRSSQEP
PI5PA_HUMAN/428-721................................................................................
D1AXA7_STRM9/113-329...........................................................SINIDYDKYEVFTSI.....P
Q1GKT6_RUEST/32-332..............................................VRPNSGLASGLDLDGDGRLAEPEDSWGW.....G
Q2H5K7_CHAGB/308-508................................................................................
A1SIW4_NOCSJ/70-299..............................................................SAFRVAAPAGTG.....T
Q9ZDR5_RICPR/4-252.................................................................NIGYEHVIY.....S
D7WDI6_9CORY/121-321...................................................................F............
Q07995_CHITU/11-220............................................................RLDRVDRP............
Q9S2L9_STRCO/24-240.................................................................AAAGDLVLL.....S
NSMA_CAEEL/42-318.................................................................SVYPYFHYF.....H
O93520_ORYLA/9-231.................................................................GFKHVFYSS.....H
Q5LX09_RUEPO/24-347..............................................AQPNSGRATDLDLDGDRRIGGPGDAQGY.....G
NSMA_DROME/9-264.................................................................AVLPHSHYF.....H
Q9SIQ5_ARATH/113-377.................................................................LGFPNVITQ.....P
Q83GA3_TROWT/91-308..............................................................FPFWHI............
Q2C5E7_9GAMM/445-703...................................................................YNFIKV......P
A1RCE7_ARTAT/41-258.................................................................AWAIVKGKN.....G
D2B0I5_STRRD/117-322.................................................................RELLPYRLL.....A
Q15NA1_PSEA6/104-315...........................................................RVNFPLENL............
Q9P8H7_CANAX/14-261................................................................LKQHNAQLRM.....H
Q9VTW2_DROME/396-695................................................................................
A6W517_KINRD/120-329...............................................................TGTPVQVFHLR.....D
A5C0G0_VITVI/310-530.................................................................LGFEGAFCV.....D
A7T4C3_NEMVE/164-372.................................................................HFDMYRRDR.....K
CCR4_SCHPO/339-664...........................................................KGVHFPKSRVRTMNE.....V
D2B2Z6_STRRD/114-320.................................................................RKALPHMVG.....E
SYJ1_SCHPO/563-839................................................................................
Q1D7J7_MYXXD/85-296..............................................................YVYYPASVQV........
C0X2X7_ENTFL/9-266...................................................EDNFAYLIVQYLAEKGQHYYWSWEMSHIG
Q2UNN7_ASPOR/69-326................................................................................
TYDP2_CAEEL/123-353...................................................................SLYKIYY.....S
C2L0P4_9FIRM/115-330...........................................................KANIDFEKYKAYISE.....P
Q9SA95_ARATH/176-431................................................................KAYSCSVSVD.....V
Q50321_MYCPL/166-460..............................................SYAGNLQAEHVGVIYNSQKIKTIPFEKT.....K
B0WQS5_CULQU/1836-2048..................................................................FTRIVQSK.....R
A0JXK8_ARTS2/115-328.................................................................SGLLPYRIS.....S
Q24335_DROME/7-215..................................................................YHFYGTNH.....P
O83555_TREPA/304-613................................PAGVQSLDADGGQPGGNIRCCYLYRTDRVQLVQDQTGSAGTFH...SV
E8RN27_ASTEC/87-283..............................................................PHMARR............
D0KX69_HALNC/290-639...........................................YVAPVNTGVQSGKDLDHNGTPGDPGDAFGF......G
Q5L902_BACFN/414-668...................................................................YHLKT........
Q1CXT2_MYXXD/230-492............................................................FLADDSSRVSSGTS.....D
EEPD1_XENLA/257-520.........................................EKSLCGPSEKEEYFGFLWDVSAGIELKNVNLSE.....N
A4A5W6_9GAMM/35-389...........................................YQGPVNTGVDSGMDLDRDGEASGTGNDAFGY.....G
D9QM28_BRESC/100-303................................................................YPYRVTGNRN.....P
O05382_AGGAC/4-259..................................................................HLGYHVNH.....F
YNTB_SCHPO/124-492..........................................................LHFIKGEGKT............
NGL1_YEAST/30-353...........................................................YGSKFISKTPPKYWK.....K
NGL3_YEAST/112-485..........................................................VIFKRHEGKT............
APN2_YEAST/20-354.................................................................GFYSFISIP.....Q
SYNJ1_RAT/538-859................................................................................
A7T299_NEMVE/40-247..............................................................YHIYRKDRK.........
O68855_9STAP/43-321.......................................................LGRSRSGWDSTEGSYSS........
O13348_MAGGR/17-223.....................................VKKGAALRAAQRRLPQGQNTRDILWLEINGILFVNVY.....R
Q9Y026_TRYCR/56-263...............................................................VLYAQSRI.........
D2AT04_STRRD/93-301.................................................................ATLLPYKAE.....L
Q9Y1H3_DICDI/7-211...................................................................NFERID......H
C5BVQ8_BEUC1/110-317...............................................................EGGDYQVFTHT.....T
P74492_SYNY3/14-266..................................................................EAGYHCHI.....S
A4EK32_9RHOB/102-307...........................................................VKSYIEDDH............
C7PRF4_CHIPD/618-892....................................................YADSIKDVDYVSAQKLAFLYKT.....S
TYDP2_HUMAN/117-351...................................................................SNYEII......T
A3TK42_9MICO/109-315.................................................................SELLPHRVG.....S
DNAS1_HUMAN/26-274............................................................DAPDTYHYVVSEPL.....G
Q9NAL5_CAEEL/311-526..............................................................ISIHRCDRDVAL.....H
A7C3D0_9GAMM/108-325.......................................................YRTERNGLAIFSLGKLQFE.....R
NSMA_HUMAN/12-272.................................................................PTYPAAHHF.....R
O65598_ARATH/3-223..........................................................FDENYGFSDL............
C5NNP0_ORYSI/360-581................................................................GGADFVWHCL.....P
Q9ZQF8_ARATH/4-230.................................................................LGFDCLKTV.....E
Q17003_ANOGA/83-316...............................................................NFSVYRCDRSL.....S
LIN1_NYCCO/10-229..................................................................GWSSIFQA.....N
O97240_PLAF7/281-607..............................LNDDFKDYNAYFSLANIKYSGQLVLVKKNIHIESIRYNLFFENN.....A
A1U6L7_MARHV/41-269............................................................AAGIPYWYQQLNRN.....L
Q5QUK7_IDILO/105-312...........................................................TVKVPLDNL............
A1T8I1_MYCVP/118-329.................................................................GQTLPYSYL.....M
B1KQZ4_SHEWM/42-455......................................IQFAYFENFSTNTGLLSEFDLDRNGKVALPGDAWGF.....G
A3XAE4_9RHOB/4-211...........................................................RVQRPLDNL............
A8M5G8_SALAI/105-315.................................................................DQLLPYREL.....H
Q2SQK9_HAHCH/44-408.........................................APSNTGVASGFDLNNDGVVGESGFELANDAFGF.....G
Q1JZE6_DESAC/7-207..................................................................AAFCGMDI.....A
O42110_9SAUR/47-252..................................................................GYKLFRKD.....R
OCRL_HUMAN/245-524................................................................................
O44201_BOMMO/8-204................................................................................
A4BGZ7_9GAMM/1324-1668...........................................YLAESNTGIITPFDFNKDGQSGQYGDDAYGF.....G
C2G3V9_9SPHI/103-310...........................................................SVKEPIDNT............
YBHP_ECOLI/13-244.........................................................EFLADTMWSDFAYGRNA.....V
G3XDB0_PSEAE/4-246.................................................................DGYFLYACD.....A
Q04135_DROME/7-214..................................................................YLFYGTNH.....P
Q9XAL0_STRCO/104-321..............................................................YPYHTV............
Q9ZAB7_AGGAC/30-274......................................................TWNLGTRSRPNMVYIYYSRL.....D
Q9YGS2_TAKRU/70-277................................................................PPTHLNYHIP.....R
Q7UV93_RHOBA/76-326APMVASFQTRVTPTATRKPFRFTLLNAHTDPDEVGSRIGDTPANEMNVLDDVFHSVRMYEYQNTGEED............
PHL3_BACCE/40-305......................................................LGRSSGSEWDKTLGNYSS........
Q868R2_ANOGA/5-211................................................................................
Q9X9W4_STRCO/312-604.....................................VDKADGGQPGGNIRQAFLFNPERVSFTDRAGGDATTA.....T
A4ESR5_9RHOB/34-347..............................................AQPNRGMRTGLDLDGDGLLNGPGDAQGY.....A
C6RT65_ACIRA/105-312...........................................................RVAVPLDNL............
APE2_ARATH/4-324................................................................DGYESFFSCTRT.SEK
APN2_SCHPO/4-295................................................................EGFDSYFTFP.....K
A6ENA6_9BACT/100-307...........................................................QLKAPNEAF............
DNAS1_OREMO/30-276.............................................................DSPQYKYIVSEPL.....G
SYJ2_SCHPO/573-851................................................................................
Q9SIS9_ARATH/366-584.................................................................MGFEDMCII.....S
A3SUZ8_SULSN/8-305..............................................LPPNAGRPTGLDMDGDGKTGGARDGQGY.....G
C3JMR5_RHOER/45-349...................................................................KSGTTF.......
B8K751_9VIBR/38-447.......................................YPFFESYATNTGLLSDLDLDNNGKKGQLPGDAWGF.....G
CCR4_YEAST/508-818...........................................................TGIFHAKARAKTMHS.....K
ANGE1_HUMAN/248-656................................................................MMGFTCFYKR.....R
T0PZ96_9STRA/35-481...........................................................YHCRPGDHD............
O46094_DROME/190-469................................................................................
Q86GH0_DROAE/65-291..........................................................VSPSIDGYHTYVATRK.....A
Q6MMC5_BDEBA/32-239........................................................AQSFHYKKDLSS............
A0Y1P5_9GAMM/101-305..................................................................TTDMFGYE.....E
Q9TZX4_CAEEL/118-349..............................................................VFLGKRNES.........
A1SIW4_NOCSJ/519-746...................................................................AAKWGMY.....P
O96546_LYMDI/17-226..................................................................NYNIVRND.....R
D0LKU2_HALO1/119-323...................................................................PEYRMLA.....E
INP51_YEAST/532-813................................................................................
Q1QA26_PSYCK/112-319...........................................................TVKVPLDNL............
DNSL1_HUMAN/22-265............................................................DGSGPYSTLSSPQL.....G
Q9RFY5_HELHT/24-265......................................................TWELGTYSRPNTVYIYYAPL.....D
A0A023EDJ4_AERSA/37-444..........................................LQNFATNTGLMSGHDLNLDGKVGSGPDDAWGF.....G
Q93137_BOMMO/15-220..................................................................NYNMVRND.....R
D0LNM2_HALO1/11-267............................................................GHEPARHSAPESPD.....A
A6WD12_KINRD/15-239.................................................................AADAGLWVA.....A
A5P939_9SPHN/105-310...........................................................TLSEIQPKA............
C0DYX5_EIKCO/70-259............................................................CQHREHSP............
IP5P8_ARATH/88-411................................................................................
YTX2_XENLA/6-230...........................................................FFNHLTWTS............
ANGEL_DROME/71-344...............................................................NGKKLAYVYKK.....K
SHIP2_HUMAN/429-718................................................................................
I5P2_MOUSE/350-629................................................................................
D2T850_ERWP6/102-309...........................................................SLKCPQDNL............
A0YXL3_LYNSP/4-376......................................VAPSNTGVASGFDLDNNGEIVNTPGADGYGNDALGF.....G
SYNJ2_MOUSE/535-855................................................................................
C5BJD9_TERTT/346-705...........................................IYTNDCNTGVPSGFDLNNDGSDNTADDAYGF.....G
C6WGJ0_ACTMD/106-312.................................................................DAVLPHRAF.....E
Q6LKH0_PHOPR/93-303.................................................................QYPYQFGGQ.....P
A0Y3X6_9GAMM/104-311...........................................................YIECPKDNR............
Q7M558_DANRE/2777-2983..........................................................QPRSLSYHTTNPILTG.....L
D2B8I2_STRRD/121-420.................FNIGGARLGLPNGKHVHAFSLWTWHDGWAYGDTHDAAVQNTHGLPRTKTDEQILEGD.....N
C7NG46_KYTSD/144-354.................................................................PGTAVTHGLAARTAP
B5GR87_STRC2/14-301....................................................RLRGFIGAQAVGEFRT............
C5C297_BEUC1/17-258...............................................VGNVRAGVVRPDRAGAEHPES............
Q1I8E8_PSEE4/192-431....................................................QRRWEAGTSTRPENYMMYYLEV.....N
D0LH64_HALO1/68-276.......................................................YAFAPSVPYDGGI............
B7QXZ5_9RHOB/33-347..............................................PRPNNGLATGLDMDGNGRLGDARDAQGY.....G
C0W4G5_9ACTO/4-304............................................................AASDPARN............
O29675_ARCFU/5-248..................................................................RIGYHVVF.....S
G1UB84_HAEDU/4-259..................................................................HLGYHVFY.....H
D4BMH5_BIFBR/190-433.................................................................NELLPYHQFG..EAK
Q8PBH9_XANCP/68-425........................................LAPVNTGVPSGLDLDNNGSVGGDGRSRGNDAWGY.....G
CCR4_CANAL/459-769...........................................................KGYFFSKTRSKTMSE.....T
F2G584_ALTMD/107-313...........................................................RKFCALENL............
E7KT29_YEASL/115-504..........................................................GQYYRNATKN............
DNSL3_RAT/29-279...........................................................SRRSTTYNYVISSRL.....G
D1NTE5_9BIFI/129-340.................................................................DHELPYSIH.....A
Q95041_RHOPR/31-304................................................................................
B9NTP9_9RHOB/22-326..............................................AQPNSGLETTLDLDGDGKTGGPGDAQGW.....G
Q5QWX6_IDILO/38-393...........................................YIAPVNTGVASPFDLNRDGTAQGTGIDAWGF.....G
APEX1_RAT/64-308...............................................................PGLTHQYWSAP.....S
D2S515_GEOOG/4-252...........................................PDPFRSWSPAGPLLRGPHTPADGPL............
Q24690_DROTE/6-206............................................................TNIATNRF............
Q9ZCP7_RICPR/4-250..................................................................DLPYHFYV.....H
O62658_CANLF/11-230..................................................................GWRTIYHS.....N
O17590_CAEEL/100-403................................................................................
PHLC_LISIV/48-325.......................................................IGRSKHGWDKTEGNYSN........
O64428_CHLVU/12-249.............................................................GVRCNWSGPAFWC.....H
Q9RXF9_DEIRA/38-271...............................................................ALPGYHSAWFP.....A
EX3_ECOLI/4-259..................................................................KLGYNVFY.....H
O26314_METTH/7-248.................................................................EGYRSFFTP.....A
B4WAV6_9CAUL/100-305................................................................YPNRAVMGRI.....E
D0LI27_HALO1/46-296..................................................................TV............
A7A3N5_BIFAD/144-355.................................................................SDLLPYRQLG..ENK
O01419_BOMMO/9-206................................................................................
O18005_CAEEL/310-619...................................................................LNTISYSSEIAKK
B5GU93_STRC2/121-326.................................................................RAEYPYRHV.....V
Q9S1Z5_STRCO/42-270.........................................................GYHVVFGANIDNSPPAP.....G
B1MNW1_MYCA9/96-305.................................................................DSALPYSYT.....I
Q2C775_9GAMM/365-634...................................................................WYYVEH.......
Q6UE72_TETTH/99-328....................................................MGAGTASIHHKEIKLAPYVASL.....N
O83162_TREPA/8-255.............................................................AGAGGTYYTYFHS.....A
D2PNL1_KRIFD/62-287..............................................................GYHVVHVPTAHR.....C
A1R797_ARTAT/136-351.................................................................DRMLPNRVS.....E
D0NNT3_PHYIT/6-323.............................................................FNYSTTILHDPDP.....F
A5LH53_9CAUD/25-260......................................................IWNTGTNSRPQELFIYFSRV.....D
D4DUX1_NEIEG/102-289............................................................CEWESDSP............
O76745_CIMLE/32-291................................................................................
Q094F5_STIAD/52-257...................................................................WVVRQD......T
B6QFL9_TALMQ/445-668...................................................................P............
Q1YK76_AURMS/120-327..........................................................IESLPQAVEY............
D0L3V4_GORB4/96-309.................................................................RARLPFVYL.....D
A3SLI1_ROSNI/16-332..............................................PPPNSGLASGHDLDGDGRLGEPEDAQGF.....G
CSS1_SCHPO/12-289.................................................................CNLVYSRFF.....H
D1BKV9_SANKS/134-342................................................................GESFQSFPA......F
B5ZY66_RHILW/98-299..................................................................TYPYYIGC.....G
PHLC_STAA8/46-322.......................................................LGRSQSGWDKTEGSYSS........
INP54_YEAST/11-313................................................................................
RTJK_DROFU/9-214..................................................................YSTYHVFH.....P
D0Z4R5_PHODD/38-450.......................................YPYFESYATNTGKMSGLDLNNDGKVNSGPNDAWGF.....G
ARP_ARATH/279-527...............................................................DGYDHSFWSCS.....V
IP5PF_ARATH/543-875................................................................................
B1C336_9FIRM/825-1040.............................................................QGYFGYSHFQKAI.....D
Q26816_9TRYP/95-297..................................................................AGYQHHGI.....A
A6BZ11_9PLAN/4-223................................................................................
A4FQX0_SACEN/43-251............................................................TPIGSKVTGAPQPC.....S
P72938_SYNY3/1331-1646............................................................ELNAVAGAGTYNWVNPGTQF
A1K8S1_AZOSB/38-302................................................................................
B0X3H8_CULQU/1636-1848..................................................................YTCVVQSK.....R
C8N9G3_9GAMM/89-278............................................................CVHEENSP............
Q9A7Y4_CAUCR/110-315................................................................................
Q01375_NEUCS/7-217........................................DLDFQAGKDWTAVTFKNLRDPTTVYSIYSPILTQ.....G
A9DTY1_9RHOB/15-313..............................................APPNAGRQSGVDLNGDGKLGGPRDAHGY.....G
YE8A_SCHPO/794-1114................................................................................
Q2UFE1_ASPOR/75-351................................................................................
Q09BG4_STIAD/252-512............................................................GFAANDSRVIYGAS.....Y
Q44070_AERHY/480-826.........................................................LPDEQDHYAFVHSPDDQ.....P
I9U9G4_HELPX/4-242..................................................................GYFDFWNC.....A
A5VCJ2_SPHWW/55-332.....................................................FAGRATDRPLPGHSRFRRGEL.....G
Q9RWN4_DEIRA/100-318................................................................................
Q55DR4_DICDI/251-565...................................................FKLLGERNLKYNFVYLPSMVYPT.....S
INP53_YEAST/571-849................................................................................
C9P6A0_VIBME/38-446.......................................YPFAKAYATNTGLLSEFDLDNNGQKGQLPGDAWGF.....G
B4R9Q2_PHEZH/109-311.............................................................SCATCEV............
O51484_BORBU/4-243.................................................................ENYYSYFSN.....S
IP5P9_ARATH/63-371................................................................................
D2R9U6_GARV4/132-368...............................................................EIFPTSCVGAQ.....S
P91740_HYDVU/57-349........................................................KKRSTNSRLNSIFYKRTH.....F
NOCT_MOUSE/144-412............................................................GTFFPKPWSPCLDV.....E
A5ZI49_9BACE/408-663...................................................................FNLQT........

PF14529

D7EM17_TRICA/220-332--------------------------------------------------------------------------------
D8Q682_SCHCM/470-595--------------------------------------------------------------------------------
A7ENE7_SCLS1/419-538--------------------------------------------------------------------------------
A7EV44_SCLS1/169-288--------------------------------------------------------------------------------
B7Q7X7_IXOSC/39-155--------------------------------------------------------------------------------
E9HS52_DAPPU/293-409--------------------------------------------------------------------------------
E9H8A1_DAPPU/103-219--------------------------------------------------------------------------------
E9HMD6_DAPPU/94-210--------------------------------------------------------------------------------
E9H5U8_DAPPU/53-167--------------------------------------------------------------------------------
B7PJV5_IXOSC/324-438--------------------------------------------------------------------------------
E6ZRW9_SPORE/1185-1312--------------------------------------------------------------------------------
E9H822_DAPPU/420-535--------------------------------------------------------------------------------
E9HYG6_DAPPU/19-132--------------------------------------------------------------------------------
E9HDY2_DAPPU/149-262--------------------------------------------------------------------------------
E9HRI7_DAPPU/460-571--------------------------------------------------------------------------------
E9HZZ2_DAPPU/118-231--------------------------------------------------------------------------------
E9HRK8_DAPPU/106-221--------------------------------------------------------------------------------
E9HSQ7_DAPPU/121-236--------------------------------------------------------------------------------
E9HE10_DAPPU/492-604--------------------------------------------------------------------------------
E2C5Q1_HARSA/10-124--------------------------------------------------------------------------------
B0W1L0_CULQU/467-584--------------------------------------------------------------------------------
D7GXY3_TRICA/106-218--------------------------------------------------------------------------------
D2A4F4_TRICA/101-212--------------------------------------------------------------------------------
E2AVN7_CAMFO/107-222--------------------------------------------------------------------------------
B6QWM9_TALMQ/555-687--------------------------------------------------------------------------------
A2QSQ0_ASPNC/504-636--------------------------------------------------------------------------------
Q2HHJ7_CHAGB/475-603--------------------------------------------------------------------------------
Q2H3B9_CHAGB/415-543--------------------------------------------------------------------------------
Q2GZF1_CHAGB/632-760--------------------------------------------------------------------------------
E9FE00_METRA/199-327--------------------------------------------------------------------------------
B6QNK9_TALMQ/286-414--------------------------------------------------------------------------------
B6H8V5_PENRW/395-529--------------------------------------------------------------------------------
Q2U1R5_ASPOR/105-240--------------------------------------------------------------------------------
A2QZW2_ASPNC/91-226--------------------------------------------------------------------------------
Q2TX40_ASPOR/104-239--------------------------------------------------------------------------------
B8MUV7_TALSN/118-253--------------------------------------------------------------------------------
A6R6U1_AJECN/368-494--------------------------------------------------------------------------------
A7S3V7_NEMVE/68-188--------------------------------------------------------------------------------
A7S2X0_NEMVE/168-291--------------------------------------------------------------------------------
C3YN84_BRAFL/1345-1466--------------------------------------------------------------------------------
D6WYM2_TRICA/271-393--------------------------------------------------------------------------------
A7S0T7_NEMVE/341-458--------------------------------------------------------------------------------
E3N7S5_CAERE/136-251--------------------------------------------------------------------------------
E3MXD9_CAERE/375-485--------------------------------------------------------------------------------
E3MA06_CAERE/30-140--------------------------------------------------------------------------------
E3LJB4_CAERE/350-458--------------------------------------------------------------------------------
E3N681_CAERE/36-144--------------------------------------------------------------------------------
E3ND32_CAERE/223-331--------------------------------------------------------------------------------
E3MKX6_CAERE/106-217--------------------------------------------------------------------------------
C5KXY0_PERM5/413-539--------------------------------------------------------------------------------
A6RES2_AJECN/586-706--------------------------------------------------------------------------------
B6QF01_TALMQ/823-943--------------------------------------------------------------------------------
B8MCU2_TALSN/715-835--------------------------------------------------------------------------------
A6QSA7_AJECN/584-704--------------------------------------------------------------------------------
Q0TWS8_PHANO/49-171--------------------------------------------------------------------------------
B7PHI8_IXOSC/55-177--------------------------------------------------------------------------------
C5LYL7_PERM5/137-253--------------------------------------------------------------------------------
E0VEI2_PEDHC/13-127--------------------------------------------------------------------------------
E9GSG1_DAPPU/115-230--------------------------------------------------------------------------------
B7QBV7_IXOSC/96-214--------------------------------------------------------------------------------
B7QN21_IXOSC/94-212--------------------------------------------------------------------------------
B7PD65_IXOSC/108-226--------------------------------------------------------------------------------
B7PS20_IXOSC/108-226--------------------------------------------------------------------------------
B7PXF9_IXOSC/95-213--------------------------------------------------------------------------------
C5K8V2_PERM5/55-185--------------------------------------------------------------------------------
B4HD52_DROPE/236-352--------------------------------------------------------------------------------
E2AWP2_CAMFO/83-203--------------------------------------------------------------------------------
E2B1G0_CAMFO/3-123--------------------------------------------------------------------------------
E2B0F5_CAMFO/1-121--------------------------------------------------------------------------------
E2BFV3_HARSA/10-133--------------------------------------------------------------------------------
E2AA34_CAMFO/86-207--------------------------------------------------------------------------------

PF03372

APEA_DICDI/108-351DQKGHHGT........................................................................
C0W5Q6_9ACTO/5-307.....FGN........................................................................
Q9ZBN3_STRCO/24-259EPRREYGV........................................................................
A7T3Q8_NEMVE/115-319TRKERGGV........................................................................
B3SRB8_ASCTA/220-428ETGLLSGV........................................................................
B8MHG3_TALSN/453-675AGEAAKAL........................................................................
Q1QVQ0_CHRSD/109-317.....YGM........................................................................
A0M2U8_GRAFK/107-314.....YGM........................................................................
A6CGC2_9PLAN/130-329YQVVQNGF........................................................................
INP5K_MOUSE/37-330.....SLLSDAAFEDPWSSLFMDMLSPLNFVKISQVRMQGL.......................................
RRP1_DROME/430-670MPGGYAGV........................................................................
C7QE92_CATAD/155-383.HLAMYEF........................................................................
C0W5C1_9ACTO/126-340DGGSSLTT........................................................................
A9DSA8_9FLAO/61-246.VLNDDSI........................................................................
A3ITE0_9CYAN/5-368NFPGQFGM........................................................................
C7ZMD9_NECH7/94-389PPDETNGI........................................................................
I5P2_CAEEL/8-272.......VAHSETIGGAVLTWATTIASWMNTNGRMVLLAKTFQA....................................
C1A7M1_GEMAT/266-540..GDFP..........................................................................
Q9RZQ3_DEIRA/490-782VGTDAIKV........................................................................
O27012_METTH/6-222...GEMNT........................................................................
Q08525_CHICK/66-271RGRKGGGV........................................................................
Q0CY83_ASPTN/48-313................................................................................
C2Q910_BACCE/40-333................................................................................
O15921_TRYCR/109-396AKKGYSGT........................................................................
A3ZS40_9PLAN/129-366................................................................................
Q11NA1_CHESB/104-316.....TDM........................................................................
Q0URF7_PHANO/122-382................................................................................
Q0FLB9_PELBH/11-291WFSGQGGM........................................................................
Q9ZVF0_ARATH/390-645.....GRL........................................................................
Q9RS34_DEIRA/101-311.....SGLSGYALTQGREVWTLSRWPVLRQTQHAVPGSTRTFAETWVK...........................GPDGR
C4FH07_9BIFI/165-380AHDNGGVN........................................................................
B7S366_9GAMM/60-266TARDRTGV........................................................................
M6BNC3_LEPBO/89-364DAFTNGGV........................................................................
YAFD_ECOLI/47-252LPQHPSGV........................................................................
Q9F2J2_STRCO/121-324EGDGAKGS........................................................................
Q7USG9_RHOBA/118-325.....YGM........................................................................
A3SVB7_SULSN/110-316.....YGV........................................................................
A5FED8_FLAJ1/31-384MYPGQYGM........................................................................
DNAS1_BOVIN/26-274RNSYKERY........................................................................
Q54E13_DICDI/8-231VTKRGNGV........................................................................
D3R3H2_BIFAB/133-356SSDNGGFN........................................................................
Q0PC57_CAMJE/24-257VGANRVNL........................................................................
Q1MZ88_9GAMM/34-259GPMAKHSN........................................................................
Q9VXE7_DROME/36-332.....QQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGL.......................................
DNSL2_HUMAN/25-288RDQYKEMY........................................................................
Q9U4W1_AEDAE/10-212NIYHSAAI........................................................................
O15922_LEIMA/133-437FKRGYSGT........................................................................
Q2PWA8_MONPI/4-202SSPTRSTI........................................................................
V9FYL2_PHYPR/6-366PFQEAYFV........................................................................
Q9SN65_ARATH/347-583PQGHSGGL........................................................................
Q985E5_RHILO/120-323.....FGV........................................................................
SMASE_MYCTU/228-473IQQNSAGR........................................................................
CDTB_ECOLX/26-261ALGGRVNL........................................................................
Q9PTX0_XENLA/23-272RSSYREKY........................................................................
C4RQR9_9ACTN/168-411.......L........................................................................
Q9YI04_XENLA/21-271RKSYKEQY........................................................................
Q3JBC2_NITOC/104-311.....YGM........................................................................
O34095_LEPIR/84-361DNDYNGGV........................................................................
Q315C8_DESAG/101-322...RDGQI........................................................................
O77366_PLAF7/563-897NNFGNDGC........................................................................
A6GK21_9DELT/6-259APHLRPGA........................................................................
D5UUF8_TSUPD/40-343HRATSSDP........................................................................
B1LXH2_METRJ/33-216LPGRIHGL........................................................................
O46184_DROSU/14-220QTEGKIRT........................................................................
A6VUZ0_MARMS/30-246ETGVKTGS........................................................................
Q8I3R5_PLAF7/2121-2476GKYTIDGC........................................................................
O22148_ARATH/4-222PIGKSGGL........................................................................
P96273_MYCTU/27-281GFDQWNGV........................................................................
APEX2_HUMAN/5-304NRSGYSGV........................................................................
Q9RKB3_STRCO/12-265AAKGRAGV........................................................................
Q63291_RAT/38-257GQKKQAGV........................................................................
INP5E_RAT/307-587.......GCSDRREWETRLQETLGPQYVLLSSAAHGVLYM........................................
A5V5B1_SPHWW/53-337GKLLDSGL........................................................................
Q281W3_PHACH/39-344DGQRRLGA........................................................................
B2B0A0_PODAN/123-383................................................................................
DNAS1_CHICK/24-272RNSYKEQY........................................................................
C5C387_BEUC1/53-411LFEGQYGM........................................................................
SHIP1_RAT/411-703.....KEWLEILRHSLQEVTSMTFKTVAIHTLWNIRIV..........................................
EXOA_BACSU/4-243VKKGYSGT........................................................................
IP5PC_ARATH/581-914.....KESVGGNEGSTIGQYWIDTIGKTLDEKAVFERMGSRQLA....................................
H2PHM7_PONAB/192-531ERKHVDGC........................................................................
INP52_YEAST/596-874.....GSILNADYTKSSFWETMVTDCLNQYEEKYLLLRVEQMS.....................................
IP5PD_ARATH/576-908.....KETVGLEGSAVGQWWIDAIGKALDEKNTFERMGSRQLA.....................................
RTJK_DROME/9-214SGNSRGGS........................................................................
B9J7A5_AGRRK/98-299DMSVECDS........................................................................
O86610_STRCO/4-250ATGRWNGV........................................................................
A3VZN2_9RHOB/19-338DFAGQGGM........................................................................
H2R3J5_PANTR/15-385................................................................................
EXOA_STRR6/4-266ARKGYAGT........................................................................
PI5PA_HUMAN/428-721.....KRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGV.......................................
D1AXA7_STRM9/113-329TSGNIAPV........................................................................
Q1GKT6_RUEST/32-332QFTGQGGI........................................................................
Q2H5K7_CHAGB/308-508.....RGSKYHLVHKASGRAAIFVSRKFDTGQWEYETSE.........................................
A1SIW4_NOCSJ/70-299GPEQAMGN........................................................................
Q9ZDR5_RICPR/4-252GQKSYNGV........................................................................
D7WDI6_9CORY/121-321.....AGT........................................................................
Q07995_CHITU/11-220....KGGV........................................................................
Q9S2L9_STRCO/24-240GGGTAAGP........................................................................
NSMA_CAEEL/42-318SGFTGSGV........................................................................
O93520_ORYLA/9-231SSGRRRGV........................................................................
Q5LX09_RUEPO/24-347RFTGQGGI........................................................................
NSMA_DROME/9-264SGVMGAGL........................................................................
Q9SIQ5_ARATH/113-377PNGRSGGL........................................................................
Q83GA3_TROWT/91-308....FGTV........................................................................
Q2C5E7_9GAMM/445-703DSNRKYDP........................................................................
A1RCE7_ARTAT/41-258GGQPSTAN........................................................................
D2B0I5_STRRD/117-322PDHGASGS........................................................................
Q15NA1_PSEA6/104-315.....YGM........................................................................
Q9P8H7_CANAX/14-261HFEDLTGF........................................................................
Q9VTW2_DROME/396-695.......STPDRFEWEVTIQETLGPSHVLFHATTLGTLHL........................................
A6W517_KINRD/120-329RGRSRFGT........................................................................
A5C0G0_VITVI/310-530RVGRGGGL........................................................................
A7T4C3_NEMVE/164-372GSKKKGGV........................................................................
CCR4_SCHPO/339-664ERRIVDGC........................................................................
D2B2Z6_STRRD/114-320PTPGVWGS........................................................................
SYJ1_SCHPO/563-839.....QQVISADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQL..................................V
Q1D7J7_MYXXD/85-296.DDDDFGN........................................................................
C0X2X7_ENTFL/9-266YAIYEEGN........................................................................
Q2UNN7_ASPOR/69-326................................................................................
TYDP2_CAEEL/123-353NKGCQYYT........................................................................
C2L0P4_9FIRM/115-330TEGSIAPV........................................................................
Q9SA95_ARATH/176-431AVSRGYYC........................................................................
Q50321_MYCPL/166-460NNKKEIGY........................................................................
B0WQS5_CULQU/1836-2048TGVRAGGV........................................................................
A0JXK8_ARTS2/115-328PTDDGGGS........................................................................
Q24335_DROME/7-215DGKAHGGT........................................................................
O83555_TREPA/304-613AQMVRGGR........................................................................
E8RN27_ASTEC/87-283.....YDT........................................................................
D0KX69_HALNC/290-639SFPGQYGM........................................................................
Q5L902_BACFN/414-668.HSLKDNL........................................................................
Q1CXT2_MYXXD/230-492YSANEQKV........................................................................
EEPD1_XENLA/257-520MQTNGNGK........................................................................
A4A5W6_9GAMM/35-389LYPGQYGM........................................................................
D9QM28_BRESC/100-303GKKGPSRY........................................................................
O05382_AGGAC/4-259GQKGHYGV........................................................................
YNTB_SCHPO/124-492.....HGI........................................................................
NGL1_YEAST/30-353PVKDMDGV........................................................................
NGL3_YEAST/112-485.....HGL........................................................................
APN2_YEAST/20-354TRKGYSGV........................................................................
SYNJ1_RAT/538-859.....GNIVNASTTNQKLWAVELQKTISRDNKYVLLASEQLVG.....................................
A7T299_NEMVE/40-247..KGGGGL........................................................................
O68855_9STAP/43-321TVLEDGGV........................................................................
O13348_MAGGR/17-223APGTEAAL........................................................................
Q9Y026_TRYCR/56-263..GKGGGV........................................................................
D2AT04_STRRD/93-301ALEGPSGS........................................................................
Q9Y1H3_DICDI/7-211GSGKGTGI........................................................................
C5BVQ8_BEUC1/110-317GPWAAFST........................................................................
P74492_SYNY3/14-266GQKSYNGV........................................................................
A4EK32_9RHOB/102-307.....YGM........................................................................
C7PRF4_CHIPD/618-892VIKGLRSY........................................................................
TYDP2_HUMAN/117-351GHEEGYFT........................................................................
A3TK42_9MICO/109-315PQLGADGT........................................................................
DNAS1_HUMAN/26-274RNSYKERY........................................................................
Q9NAL5_CAEEL/311-526TKNSGGGV........................................................................
A7C3D0_9GAMM/108-325LVKIRNGL........................................................................
NSMA_HUMAN/12-272SGIIGSGL........................................................................
O65598_ARATH/3-223.....GKI........................................................................
C5NNP0_ORYSI/360-581PRGRSGGI........................................................................
Q9ZQF8_ARATH/4-230PIGNSGGL........................................................................
Q17003_ANOGA/83-316GSSSRGGG........................................................................
LIN1_NYCCO/10-229GKQKKAGI........................................................................
O97240_PLAF7/281-607HIHHDEGR........................................................................
A1U6L7_MARHV/41-269GQIAQHSN........................................................................
Q5QUK7_IDILO/105-312.....YGM........................................................................
A1T8I1_MYCVP/118-329PKGGGGGG........................................................................
B1KQZ4_SHEWM/42-455FYHGQYAF........................................................................
A3XAE4_9RHOB/4-211.....YGM........................................................................
A8M5G8_SALAI/105-315PVEGTPGS........................................................................
Q2SQK9_HAHCH/44-408VFEGQYGM........................................................................
Q1JZE6_DESAC/7-207SQGETRNL........................................................................
O42110_9SAUR/47-252QGRKGGGV........................................................................
OCRL_HUMAN/245-524.....EAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVG.....................................
O44201_BOMMO/8-204................................................................................
A4BGZ7_9GAMM/1324-1668MFYGQYGM........................................................................
C2G3V9_9SPHI/103-310.....YGM........................................................................
YBHP_ECOLI/13-244YPEGHHGN........................................................................
G3XDB0_PSEAE/4-246ELPEQGGV........................................................................
Q04135_DROME/7-214DGKAHGGT........................................................................
Q9XAL0_STRCO/104-321....QGTV........................................................................
Q9ZAB7_AGGAC/30-274VGANRVNL........................................................................
Q9YGS2_TAKRU/70-277VTGRGGGV........................................................................
Q7UV93_RHOBA/76-326................................................................................
PHL3_BACCE/40-305STPEDGGV........................................................................
Q868R2_ANOGA/5-211.....NGN........................................................................
Q9X9W4_STRCO/312-604GVRKVRGK........................................................................
A4ESR5_9RHOB/34-347RFTGKGGI........................................................................
C6RT65_ACIRA/105-312.....YGM........................................................................
APE2_ARATH/4-324GRTGYSGV........................................................................
APN2_SCHPO/4-295IRKGYSGV........................................................................
A6ENA6_9BACT/100-307.....YGM........................................................................
DNAS1_OREMO/30-276ASTYKERY........................................................................
SYJ2_SCHPO/573-851.....SHLVSSSNQKLRIWEEKILMILNSRDSNNKYMLISSIQM...................................A
Q9SIS9_ARATH/366-584PRGLSGGL........................................................................
A3SUZ8_SULSN/8-305RFFGAGAM........................................................................
C3JMR5_RHOER/45-349YGAASSDV........................................................................
B8K751_9VIBR/38-447FYHGQYAF........................................................................
CCR4_YEAST/508-818DSKKVDGC........................................................................
ANGE1_HUMAN/248-656TGCKTDGC........................................................................
T0PZ96_9STRA/35-481.....DGL........................................................................
O46094_DROME/190-469.....KAMLNSTQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLV....................................
Q86GH0_DROAE/65-291PNQRFGGV........................................................................
Q6MMC5_BDEBA/32-239.....TGV........................................................................
A0Y1P5_9GAMM/101-305VEGIPYGM........................................................................
Q9TZX4_CAEEL/118-349..SVSGGV........................................................................
A1SIW4_NOCSJ/519-746ASGKAQNR........................................................................
O96546_LYMDI/17-226TTSPMGGT........................................................................
D0LKU2_HALO1/119-323ERRDPYAM........................................................................
INP51_YEAST/532-813.....GHMLATDPYVRQFWEKKILTLLNGPGRKKKYIRLWSTQL...................................G
Q1QA26_PSYCK/112-319.....YGM........................................................................
DNSL1_HUMAN/22-265RSTYMETY........................................................................
Q9RFY5_HELHT/24-265VGARRVNL........................................................................
A0A023EDJ4_AERSA/37-444NYHGQYAF........................................................................
Q93137_BOMMO/15-220LSARGGGT........................................................................
D0LNM2_HALO1/11-267APPCRKGQ........................................................................
A6WD12_KINRD/15-239AGRDGAGT........................................................................
A5P939_9SPHN/105-310.....FGM........................................................................
C0DYX5_EIKCO/70-259.....FAL........................................................................
IP5P8_ARATH/88-411.....GNVLGAEDNGPAAKWLSLIREALNNTNNLSPNELEHTKSSQQPRFSFSGLSDDTPIPCNSTPPRGYSLAASKQMV
YTX2_XENLA/6-230.....CGV........................................................................
ANGEL_DROME/71-344TGCRTDGC........................................................................
SHIP2_HUMAN/429-718.....REWLDLLRGGLKELTDLDYRPIAMQSLWNIKVA..........................................
I5P2_MOUSE/350-629.....EAFFFHDTPKEEEWFKAVSESLHPDAKYAKVKFVRLVG.....................................
D2T850_ERWP6/102-309.....YGM........................................................................
A0YXL3_LYNSP/4-376NFPGQFGM........................................................................
SYNJ2_MOUSE/535-855.....GNIVNASTTNRKMWGEQLQKAISRSHRYILLTSAQLVG.....................................
C5BJD9_TERTT/346-705EYPGKYCM........................................................................
C6WGJ0_ACTMD/106-312DEPGGSGS........................................................................
Q6LKH0_PHOPR/93-303RVGYPNGQ........................................................................
A0Y3X6_9GAMM/104-311.....YGM........................................................................
Q7M558_DANRE/2777-2983QTQQHGGV........................................................................
D2B8I2_STRRD/121-420LRRVAMGK........................................................................
C7NG46_KYTSD/144-354ESSPIEAT........................................................................
B5GR87_STRC2/14-301................................................................................
C5C297_BEUC1/17-258.....YGV........................................................................
Q1I8E8_PSEE4/192-431LLRVRLGM........................................................................
D0LH64_HALO1/68-276.....FGL........................................................................
B7QXZ5_9RHOB/33-347RFTGQGGM........................................................................
C0W4G5_9ACTO/4-304................................................................................
O29675_ARCFU/5-248GSKGRNGV........................................................................
G1UB84_HAEDU/4-259GQKGHYGV........................................................................
D4BMH5_BIFBR/190-433DTDNGGFN........................................................................
Q8PBH9_XANCP/68-425LHPGQYGM........................................................................
CCR4_CANAL/459-769DSKKVDGC........................................................................
F2G584_ALTMD/107-313.....YGM........................................................................
E7KT29_YEASL/115-504.....HGV........................................................................
DNSL3_RAT/29-279RNTYKEQY........................................................................
D1NTE5_9BIFI/129-340ASRNGSGS........................................................................
Q95041_RHOPR/31-304.....KAVSNALTGELWSETMEKTLKGNYQKVKSVALLGIV.......................................
B9NTP9_9RHOB/22-326AFSGQNGL........................................................................
Q5QWX6_IDILO/38-393WYPGQYGM........................................................................
APEX1_RAT/64-308DKEGYSGV........................................................................
D2S515_GEOOG/4-252.....YGI........................................................................
Q24690_DROTE/6-206.....GGV........................................................................
Q9ZCP7_RICPR/4-250GQKSYNGV........................................................................
O62658_CANLF/11-230GPQKKAGV........................................................................
O17590_CAEEL/100-403.....GTYIIDNTKKMEGWVDAIHCSLPGGRTQFNVVGSMRLVGI..................................F
PHLC_LISIV/48-325FALEDGGV........................................................................
O64428_CHLVU/12-249FTSQSRGV........................................................................
Q9RXF9_DEIRA/38-271QKAGYSGV........................................................................
EX3_ECOLI/4-259GQKGHYGV........................................................................
O26314_METTH/7-248ERKGYSGV........................................................................
B4WAV6_9CAUL/100-305DPSGRALS........................................................................
D0LI27_HALO1/46-296.....YDF........................................................................
A7A3N5_BIFAD/144-355DTDNGGFN........................................................................
O01419_BOMMO/9-206................................................................................
O18005_CAEEL/310-619VGTVSEGV........................................................................
B5GU93_STRC2/121-326EGYGADGA........................................................................
Q9S1Z5_STRCO/42-270GHRVQYGT........................................................................
B1MNW1_MYCA9/96-305AEPMALGT........................................................................
Q2C775_9GAMM/365-634DDFSKYAP........................................................................
Q6UE72_TETTH/99-328NEKALAQV........................................................................
O83162_TREPA/8-255QRPGYSGT........................................................................
D2PNL1_KRIFD/62-287DDGSAYGI........................................................................
A1R797_ARTAT/136-351PHDDASGG........................................................................
D0NNT3_PHYIT/6-323TSLLNGGV........................................................................
A5LH53_9CAUD/25-260AFANRVNL........................................................................
D4DUX1_NEIEG/102-289.....FAL........................................................................
O76745_CIMLE/32-291.......FGFQTDKPQQGPACVKNFQSLLTSKGYTKLKNTIT......................................
Q094F5_STIAD/52-257SSEDRQGS........................................................................
B6QFL9_TALMQ/445-668.....MGH........................................................................
Q1YK76_AURMS/120-327.....YGL........................................................................
D0L3V4_GORB4/96-309PRDGGSGA........................................................................
A3SLI1_ROSNI/16-332RFRGEGGM........................................................................
CSS1_SCHPO/12-289SAAMGAGL........................................................................
D1BKV9_SANKS/134-342GAGPNRGT........................................................................
B5ZY66_RHILW/98-299VGMQECDT........................................................................
PHLC_STAA8/46-322TVAEDGGV........................................................................
INP54_YEAST/11-313.....GSFPAVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGVN................................SL
RTJK_DROFU/9-214SGNSRGGA........................................................................
D0Z4R5_PHODD/38-450TYHGQYAF........................................................................
ARP_ARATH/279-527SKLGYSGT........................................................................
IP5PF_ARATH/543-875.....KETVGLEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLA.....................................
B1C336_9FIRM/825-1040YGGGEYGV........................................................................
Q26816_9TRYP/95-297RNCKGGGV........................................................................
A6BZ11_9PLAN/4-223.....AGLLPRDGHVIESSP............................................................
A4FQX0_SACEN/43-251EGRGDYGV........................................................................
P72938_SYNY3/1331-1646LGTDAIAV........................................................................
A1K8S1_AZOSB/38-302................................................................................
B0X3H8_CULQU/1636-1848DDARSGGV........................................................................
C8N9G3_9GAMM/89-278.....FAL........................................................................
Q9A7Y4_CAUCR/110-315................................................................................
Q01375_NEUCS/7-217TPEHQWGS........................................................................
A9DTY1_9RHOB/15-313RFFGQGAM........................................................................
YE8A_SCHPO/794-1114.....KRLTARSILSKSSSKGGSSNSANISSQYRLWREKLESEMMRVSSNDDY..................QVLVCENLV
Q2UFE1_ASPOR/75-351................................................................................
Q09BG4_STIAD/252-512YTASEQKP........................................................................
Q44070_AERHY/480-826MGTDAITV........................................................................
I9U9G4_HELPX/4-242IKKGYSGV........................................................................
A5VCJ2_SPHWW/55-332LKLLGSGL........................................................................
Q9RWN4_DEIRA/100-318................................................................................
Q55DR4_DICDI/251-565TGLQFEGL........................................................................
INP53_YEAST/571-849.....GSILNADYSKSSFWENLVGDCLNQYDDKYLLLRVEQMT.....................................
C9P6A0_VIBME/38-446FYHGQYAF........................................................................
B4R9Q2_PHEZH/109-311................................................................................
O51484_BORBU/4-243KIKGYSGV........................................................................
IP5P9_ARATH/63-371.....SNVLGSDNNKVSTKWNSLIRDALNKRARPHRDEDLSESKGINGISQDF..................RCIISKQMV
D2R9U6_GARV4/132-368EHNNGGFN........................................................................
P91740_HYDVU/57-349LKKIDSGT........................................................................
NOCT_MOUSE/144-412HNNGPDGC........................................................................
A5ZI49_9BACE/408-663.PSPGDNL........................................................................

PF14529

D7EM17_TRICA/220-332------------------------------------FACYNRPQ------------------------------------
D8Q682_SCHCM/470-595------------------------------------VHLYNDRR------------------------------------
A7ENE7_SCLS1/419-538------------------------------------INIYNEAD------------------------------------
A7EV44_SCLS1/169-288------------------------------------INIYNEAD------------------------------------
B7Q7X7_IXOSC/39-155------------------------------------LNVYSSPK------------------------------------
E9HS52_DAPPU/293-409------------------------------------ISLYCPNG------------------------------------
E9H8A1_DAPPU/103-219------------------------------------ISVYCPNG------------------------------------
E9HMD6_DAPPU/94-210------------------------------------RSIYCPDG------------------------------------
E9H5U8_DAPPU/53-167------------------------------------TSIYIPRA------------------------------------
B7PJV5_IXOSC/324-438------------------------------------HNTYIMPS------------------------------------
E6ZRW9_SPORE/1185-1312------------------------------------LSVYIRPD------------------------------------
E9H822_DAPPU/420-535------------------------------------YSVFCRPS------------------------------------
E9HYG6_DAPPU/19-132------------------------------------SSIYLRPS------------------------------------
E9HDY2_DAPPU/149-262------------------------------------SYVYLRPS------------------------------------
E9HRI7_DAPPU/460-571------------------------------------ISMYVRPS------------------------------------
E9HZZ2_DAPPU/118-231------------------------------------ISLYLRPS------------------------------------
E9HRK8_DAPPU/106-221------------------------------------FSVYLRPS------------------------------------
E9HSQ7_DAPPU/121-236------------------------------------VSLYCRPS------------------------------------
E9HE10_DAPPU/492-604------------------------------------FSVYCRPS------------------------------------
E2C5Q1_HARSA/10-124------------------------------------AAAYCPPR------------------------------------
B0W1L0_CULQU/467-584------------------------------------IAAYCPRQ------------------------------------
D7GXY3_TRICA/106-218------------------------------------FTYYNSPR------------------------------------
D2A4F4_TRICA/101-212------------------------------------ISYYNPPL------------------------------------
E2AVN7_CAMFO/107-222------------------------------------ISLYRHPS------------------------------------
B6QWM9_TALMQ/555-687------------------------------------ASVYVEGG------------------------------------
A2QSQ0_ASPNC/504-636------------------------------------ASVYVEGE------------------------------------
Q2HHJ7_CHAGB/475-603------------------------------------VSVYVPKQ------------------------------------
Q2H3B9_CHAGB/415-543------------------------------------ASVYVPCG------------------------------------
Q2GZF1_CHAGB/632-760------------------------------------VSVYVEGG------------------------------------
E9FE00_METRA/199-327------------------------------------VSVYVQGK------------------------------------
B6QNK9_TALMQ/286-414------------------------------------VSVYVEGN------------------------------------
B6H8V5_PENRW/395-529------------------------------------FSIYIPPV------------------------------------
Q2U1R5_ASPOR/105-240------------------------------------FSIYVPTT------------------------------------
A2QZW2_ASPNC/91-226------------------------------------FSIYIPPI------------------------------------
Q2TX40_ASPOR/104-239------------------------------------FSVYIPPV------------------------------------
B8MUV7_TALSN/118-253------------------------------------FSVYIPPL------------------------------------
A6R6U1_AJECN/368-494------------------------------------FSTYIPPF------------------------------------
A7S3V7_NEMVE/68-188------------------------------------SSYYRPPN------------------------------------
A7S2X0_NEMVE/168-291------------------------------------GCMYRTPD------------------------------------
C3YN84_BRAFL/1345-1466------------------------------------GSYYRTPS------------------------------------
D6WYM2_TRICA/271-393------------------------------------ACIYRPPT------------------------------------
A7S0T7_NEMVE/341-458------------------------------------SSFYWPDP------------------------------------
E3N7S5_CAERE/136-251------------------------------------ILVYRPPD------------------------------------
E3MXD9_CAERE/375-485------------------------------------CLVYRPPD------------------------------------
E3MA06_CAERE/30-140------------------------------------FLVYRPPD------------------------------------
E3LJB4_CAERE/350-458------------------------------------ISCYHANH------------------------------------
E3N681_CAERE/36-144------------------------------------IVCYHPCH------------------------------------
E3ND32_CAERE/223-331------------------------------------VVGYHPSH------------------------------------
E3MKX6_CAERE/106-217------------------------------------INVYRVPN------------------------------------
C5KXY0_PERM5/413-539------------------------------------IGVYWPAQ------------------------------------
A6RES2_AJECN/586-706------------------------------------FNVYNEVG------------------------------------
B6QF01_TALMQ/823-943------------------------------------HNIYNEPR------------------------------------
B8MCU2_TALSN/715-835------------------------------------HNVYNPGV------------------------------------
A6QSA7_AJECN/584-704------------------------------------HNLYNPET------------------------------------
Q0TWS8_PHANO/49-171------------------------------------HNLYNYER------------------------------------
B7PHI8_IXOSC/55-177------------------------------------VSAYCRPY------------------------------------
C5LYL7_PERM5/137-253------------------------------------VNIYIRPH------------------------------------
E0VEI2_PEDHC/13-127------------------------------------APVLA...------------------------------------
E9GSG1_DAPPU/115-230------------------------------------CNIYHSSQ------------------------------------
B7QBV7_IXOSC/96-214------------------------------------ISVYAPPQ------------------------------------
B7QN21_IXOSC/94-212------------------------------------ISVYAPPH------------------------------------
B7PD65_IXOSC/108-226------------------------------------ISVYAPPH------------------------------------
B7PS20_IXOSC/108-226------------------------------------VNVYNPPN------------------------------------
B7PXF9_IXOSC/95-213------------------------------------INVYISPT------------------------------------
C5K8V2_PERM5/55-185------------------------------------ASWYLHGT------------------------------------
B4HD52_DROPE/236-352------------------------------------LSAAGSKE------------------------------------
E2AWP2_CAMFO/83-203------------------------------------ASCYCSPS------------------------------------
E2B1G0_CAMFO/3-123------------------------------------VSCYCSPN------------------------------------
E2B0F5_CAMFO/1-121------------------------------------ISCYSSPN------------------------------------
E2BFV3_HARSA/10-133------------------------------------VSCYFSPN------------------------------------
E2AA34_CAMFO/86-207------------------------------------VGVYFSPN------------------------------------

PF03372

APEA_DICDI/108-351....................................GVLTKKKP........NAITFGIGIAKHDNEGRVITLEYDQFYI
C0W5Q6_9ACTO/5-307....................................ALLTRLPV........ESWAVQRLGRGPALVTSRAGRGWDPRSY
Q9ZBN3_STRCO/24-259....................................AVLSRFPV........RSATNHEITRLSTQDENPLPAPAPGFGE
A7T3Q8_NEMVE/115-319....................................MMYVSHAM........AYTRLPTLESSDTELLCTQVIPCKSNCP
B3SRB8_ASCTA/220-428....................................AAVFPSHK........PYNITSKTERIIQVLMPNKILVIGAYAP
B8MHG3_TALSN/453-675....................................ATLPEAYF........PQA.........................
Q1QVQ0_CHRSD/109-317....................................HLYSRLPV........HAPQIEWLIQDDIPSIHGWFELPSGDRV
A0M2U8_GRAFK/107-314....................................HLYSKLEL........KEVKVRYLVQEDIPSIHGFVILRNGKKV
A6CGC2_9PLAN/130-329....................................VFLSRLPI........EDTSAGRLADMGQYLKFSLQSDHPDVRA
INP5K_MOUSE/37-330..LLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGVNVCLKLY......GYYV.........................
RRP1_DROME/430-670....................................AIYSKIMP........IHVEYGIGNEEFDDVGRMITAEYEKFYL
C7QE92_CATAD/155-383....................................VVWSRYPI........GSTQPVDLTAGGRPAGFVQSGAAAGDSS
C0W5C1_9ACTO/126-340....................................TVLVSAAI........GPYEQGKVSGMGHGAVYLTPAGGDELNG
A9DSA8_9FLAO/61-246....................................GIFSKTPL........RIYYDTIEKIGTRMVHFTTKNIHFYAVD
A3ITE0_9CYAN/5-368....................................AVYSKYPI........DFSNVRTFQTFLWKDMPNALLPVDPVSG
C7ZMD9_NECH7/94-389....................................LRLCTTHL........ESLDLGYGYR..................
I5P2_CAEEL/8-272TNQVLIFGRKQLIGQIKRIDYRFQRNTMGGLTGHKGSIGVRLQLA.....SPYSI.........................
C1A7M1_GEMAT/266-540................................................................................
Q9RZQ3_DEIRA/490-782....................................AIIYKPSK........VTPVGQFMTDNNSVFSRPPVAQTFRDKT
O27012_METTH/6-222....................................LLLHK.............DLMLDSMKRNYLEISDNHCIEDFYVS
Q08525_CHICK/66-271....................................ALYVKEWI........DCEELPLRNSQEQVESLWVRIRDGTNKG
Q0CY83_ASPTN/48-313......................................................WVQDNFYITDFSTQHWLGSYGTTTLV
C2Q910_BACCE/40-333....................................AVLIKLVI........PTFGTVTYDFIDILLEALEEQGLKYEVA
O15921_TRYCR/109-396....................................RTYIKNTA........AAEWKTVTVKGFDTLKSPQDVGHSEGDE
A3ZS40_9PLAN/129-366................................................................................
Q11NA1_CHESB/104-316....................................KLFSRFPI........LTARTVSPDSADTGGRFAVRYELLVGAR
Q0URF7_PHANO/122-382......................................................WVKQRFNITEFDHRNWLGPLYGTTIL
Q0FLB9_PELBH/11-291....................................ALLSTRPL........QLEADFTALLWRDLPRSRMRGGDPAPEV
Q9ZVF0_ARATH/390-645....................................WVVWRENV........RFTPFYKSDQLITCSVKLESQEEEFFYS
Q9RS34_DEIRA/101-311TLRVVNAHLGTVLITSALRGDTAKVRRTAQARREQVALLCRIAA..........HEP.......................
C4FH07_9BIFI/165-380....................................ALWSAAPM........SDTTGDLIPIESSSIPASSIDFGGVAVR
B7S366_9GAMM/60-266....................................MTLSTHAP........TMQCNFTRTEPWLGTPKAATVTEHALEG
M6BNC3_LEPBO/89-364....................................VIVSKWPI........EEKIQHVFKEKGCGADVFSNKGFAYVRI
YAFD_ECOLI/47-252....................................MTLSAAHP........VYCCPLREREPILRLAKSALVTVYPLPD
Q9F2J2_STRCO/121-324....................................VILSAFPL........RAAPAVPGTLGMPAAVADVRGHPVRLRL
Q7USG9_RHOBA/118-325....................................AMLSRLPI........RESEIRFRIQDDIPSIDAMVELPSGEEI
A3SVB7_SULSN/110-316....................................VMMSKMEP........SETQVRDLLVDDVPSIRTKVAMPSGRMW
A5FED8_FLAJ1/31-384....................................MLLSKYPI........DVNAVRTFQHFKWKDMPGALLTKKADGS
DNAS1_BOVIN/26-274....................................LFLFRPNK........VSVLDTYQYDDGCESCGNDSFSREPAVV
Q54E13_DICDI/8-231....................................IIINHNPN........TLKLKHISTIDGRAILADVIFPNQLPIG
D3R3H2_BIFAB/133-356....................................GLWLRVEP........AEQTPTGVPIPAADVPTVTLPVTSTFNI
Q0PC57_CAMJE/24-257....................................AIVSRMQA........EEV.........................
Q1MZ88_9GAMM/34-259....................................GALCRRQP........DEVKYHSLPGLLPGRGAMVLDFADELAV
Q9VXE7_DROME/36-332..LLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLY......GCGL.........................
DNSL2_HUMAN/25-288....................................LFVYRKDA........VSVVDTYLYPDPEDVFSREPFVVKFSAP
Q9U4W1_AEDAE/10-212....................................GVLPTVPF........SPLPLNTDLPIVAVKLEYPFPMTVISG.
O15922_LEIMA/133-437....................................RTYMKNST........TVKGLHARCTRGFALPSEPQADAAAGSR
Q2PWA8_MONPI/4-202....................................HTLLQYPV........PRN.........................
V9FYL2_PHYPR/6-366....................................ALFSALPV........KSLETHPFSNTGMGRELVIMQVEPIPGK
Q9SN65_ARATH/347-583....................................ALLWKDSV........RLSNLYQDDRHIDVHISINNINFYLSRV
Q985E5_RHILO/120-323....................................ALLSRRPF........VAGTAPRCEPRGAMATATIDFGGIEVDV
SMASE_MYCTU/228-473....................................A...........................................
CDTB_ECOLX/26-261....................................ALVSNRRA........DEV.........................
Q9PTX0_XENLA/23-272....................................AYVYREDI........VKPTEWYHFDDGCENCGTDSFIREPFVA
C4RQR9_9ACTN/168-411....................................LTMSRYPI........VASRALDGMPYLADPTRHGVPADSDFAD
Q9YI04_XENLA/21-271....................................GFIYRKNL........VSVKGTYQYKDLQPGDEDAFSREPYVVW
Q3JBC2_NITOC/104-311....................................LLYSKFEL........VAPEIKFLLKEGIPSIHTEVKLPSGQLV
O34095_LEPIR/84-361....................................IVLSKWPI........EEKIQYIFENHGCGNDYYYNKGFVYVKI
Q315C8_DESAG/101-322....................................AVYSRFPL........QVGEALKLHRAGHKWKRQTVLPAVIRTP
O77366_PLAF7/563-897....................................SLFVNKKK........FTLIEYKNYEFNQVIKTDEFKSIYETFL
A6GK21_9DELT/6-259....................................MLTVKYGN........YRYPLLFLHIDSGRTPADFGNRT.....
D5UUF8_TSUPD/40-343....................................GVLSKFPI........ASAGTLPGMAKAVIPLGDKTLVAYAAHL
B1LXH2_METRJ/33-216....................................AMWSPKPW........TAPPRVIALPSGALVHRVCQILDLGEFG
O46184_DROSU/14-220....................................CILARKHL........NIFLLHNFSNGDNTAASLELQGTRLNLV
A6VUZ0_MARMS/30-246....................................SVVANKHF........FSASAHSEPITKTKKMVLATEYPLARIA
Q8I3R5_PLAF7/2121-2476....................................AIFYNKKK........LKFVETYALEFSKLIKEASVLTLPKEIQ
O22148_ARATH/4-222....................................ALMWKDSV........QIKVLQSDKRLIDALLIWQDKEFYLTCI
P96273_MYCTU/27-281....................................AIASRVGL........DDVRVGFDGQPSWSGKPEVAATTEARAL
APEX2_HUMAN/5-304....................................ATFCKDNA........TPVAAEEGLSGLFATQNGDVGCYGNMDE
Q9RKB3_STRCO/12-265....................................SLYTRREP........DAVRVGFGSTEFDTSGRYVEADLPGVTV
Q63291_RAT/38-257....................................AILISNKI........NFQLKVIKKDKEGHFIFIKGKIHQDELS
INP5E_RAT/307-587....SLFIRRDLIWFCSEVEYSTVTTRIVSQIKTKGALGVSFTFF......GTSF.........................
A5V5B1_SPHWW/53-337....................................VILSDYPI........LSVRRAAFPAAACAGYDCLANKGMVMAV
Q281W3_PHACH/39-344....................................SLILQRAR........FEAFHS......................
B2B0A0_PODAN/123-383......................................................WVRENYNVTDLTGENWDFHDFPPGFG
DNAS1_CHICK/24-272....................................VFIYRSDI........VSVLESYYYDDGCESCGTDIFSREPFIV
C5C387_BEUC1/53-411....................................VVLSRYPI........VERDVRTFQTFLWKDMPGALLPDDPATP
SHIP1_RAT/411-703.....VLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFN......GTSL.........................
EXOA_BACSU/4-243....................................AVFSKQEP........LQVIYGIGVEEHDQEGRVITLEFENVFV
IP5PC_ARATH/581-914GLLISLWVRKNLRTHVGDIDVAAVPCGFGRAIGNKGGVGLRIRVF......DRIM.........................
H2PHM7_PONAB/192-531....................................AIFFKTEK........FTLVQKHTVEFNQLAMANSEGSEAMLNR
INP52_YEAST/596-874SLLILFFARSDRAYNIKEVGGSTKKTGFGGITGNKGAVAIRFDYG......ATSF.........................
IP5PD_ARATH/576-908GLLISLWARKDIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVY......DRIM.........................
RTJK_DROME/9-214....................................AVIIKSRL........CHSPLTPISTNDRQIARVHLQTSVGTVT
B9J7A5_AGRRK/98-299....................................LLLSKRPF........QAQDMRSLGSLWRNRFILATIDMDGQPV
O86610_STRCO/4-250....................................AVLSRVGL........EDVVKGLPGDPGYEGVQEPRAISATCGP
A3VZN2_9RHOB/19-338....................................ALLSRYPV........DQTEAQDFSTLLWRDLPGALLPVRDGLP
H2R3J5_PANTR/15-385....................................FYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEK
EXOA_STRR6/4-266....................................MFLYKKEL..........TPTISFPEIGAPSTMDLEGRIITLEF
PI5PA_HUMAN/428-721..ILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAF......GHML.........................
D1AXA7_STRM9/113-329....................................TIVIKKSF........SKYIDTNQSLMTQFGTIYLKSIDKDMPD
Q1GKT6_RUEST/32-332....................................ALLSKHPI........AASKAVNLTDMLWKDLPGHRMPVTLDGT
Q2H5K7_CHAGB/308-508.....EHCKVWFPGLGNSGLELWSIYNPLEDKTLLQTLLSRPAP........AYS.........................
A1SIW4_NOCSJ/70-299....................................VVLWKSST........WTKVNGGRVQLVDDDKTFYDGRPVTWDR
Q9ZDR5_RICPR/4-252....................................AIISKFPL........NNVFALELYNGDKRHIAAIVNDLEIHNF
D7WDI6_9CORY/121-321....................................SFAERVFT........SEQGGGIAPTSMAVHPDLGELEHIDAPP
Q07995_CHITU/11-220....................................AIIVKRNL........KHQLQPSYNTKLMECIGIKVFINDTDSC
Q9S2L9_STRCO/24-240....................................ALLCSLRA........TVERTEDVLLPLTPGRHRRGIAAAVVRI
NSMA_CAEEL/42-318....................................CVFSRHPI........VSTLTNRYSLNGFAHHIHRGDWFGGKVV
O93520_ORYLA/9-231....................................ATLIAGAV........NYQHVSEYKDKEGRYIMITGKINSILIT
Q5LX09_RUEPO/24-347....................................AILSRHPI........AQAEIQDFSALRWRDLPGATLPESGGHA
NSMA_DROME/9-264....................................LVLSKYPI........LGTLFHAWSVNGYFHRIQHADWFGGKGV
Q9SIQ5_ARATH/113-377....................................ALMWKNNV........SLSLISQDERLIDSHVTFNNKSFYLSCV
Q83GA3_TROWT/91-308....................................GIWSKKPL........ENAVMLQLGSKLTSAGKIDIKISKEQTV
Q2C5E7_9GAMM/445-703....................................CLLSRYPI........VGESYPAQGKNNNRISAHIELPDKEIIE
A1RCE7_ARTAT/41-258....................................AIAYQPSV........WKLDEVRYVSIRYGGPVIQIPLARFTSS
D2B0I5_STRRD/117-322....................................GLYARYPL........DPLEGMFRPVGHNMPAATIVLPGVKPVE
Q15NA1_PSEA6/104-315....................................HVFSRLPL........SDIKTAERVEKGVPSVHCIATLESGEKI
Q9P8H7_CANAX/14-261....................................LIHSPHAK........LKFKIRDNDNHHTTHFEGRISILDITLI
Q9VTW2_DROME/396-695....AVYMRRDLIWYCSVPEDASMSVRTGSAFRTKGAVAISFCLF......GTSM.........................
A6W517_KINRD/120-329....................................ALLVSARL........GEYRATGELTDGVKAVVTAAPVSGTGPV
A5C0G0_VITVI/310-530....................................AFLWRKAG........MFSLLXYSQSHIDMEVSEEDGLQWRVTG
A7T4C3_NEMVE/164-372....................................LMYVNTDL........KHKRRTDLEDTNIESIWMEIYPFKSNRP
CCR4_SCHPO/339-664....................................ATFFKTSK........YVMHEKMVIEYNQAPSLRRQDIKLTSNM
D2B2Z6_STRRD/114-320....................................GVYARFPL........RADQAALNYGNFRQSVAVAPERNLQIVS
SYJ1_SCHPO/563-839GTALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNKGAVAIRFDYE......DTGL.........................
Q1D7J7_MYXXD/85-296....................................ALLSRWPI........VADRKVHLPHDDPYHQRRRIAVLATLDI
C0X2X7_ENTFL/9-266....................................ALLSKCPL........TSEALLISESQEPTNYRTRKILVAETES
Q2UNN7_ASPOR/69-326......................................................WVQANFHLTDIDTTNWATTQYGTTVL
TYDP2_CAEEL/123-353....................................AILVSKMF........DVEKHDVIHFQNSGMYRTLQILEGSIGG
C2L0P4_9FIRM/115-330....................................TIVIKRTV........GTYYVLKDTPMTRFGTVYLLPTSENSPP
Q9SA95_ARATH/176-431....................................MLLSKLGV........KSFSSKSFGNSIMGRELSIAEVEVPGRK
Q50321_MYCPL/166-460....................................SYIEKFNS........EFIKKHNKAEYVRPPYGVKFQWLKGKKE
B0WQS5_CULQU/1836-2048....................................AIYQNTTA........PNTTPATPYTLEVVGAERSQEFSEAAKY
A0JXK8_ARTS2/115-328....................................AIYSAHRL........EAVGVLPDTPFHMPIVRLTVEGAGAPAV
Q24335_DROME/7-215....................................AILIRNRM........KHHFYKEFAENHLQATSINIQLDDNTLL
O83555_TREPA/304-613....................................QMVKNPAR........IGVGQESFQNTRKSLVAHFQFVSGVNKG
E8RN27_ASTEC/87-283....................................FVFSRYPL........TRPRARPIGYSLLTVEVGAPAGAFNLAV
D0KX69_HALNC/290-639....................................VILSMYPI........EADKVRTFQKFLWKDMPNALLPKNPDGS
Q5L902_BACFN/414-668....................................AMYSRFPL........EAIAWREPFKSNPAKITLPNGKRIMFVD
Q1CXT2_MYXXD/230-492....................................GVLFKSDV........VQVLRADVVLGNHEYDFGGRPPLRVDLR
EEPD1_XENLA/257-520....................................HMYLQPYI........AHFKVGTCDLTLVNIHLSPPTVETVK..
A4A5W6_9GAMM/35-389....................................LLLSRYPI........DFEAIRSFQLFKWKDMPDNLMTDMRTET
D9QM28_BRESC/100-303....................................VFASRWPL........RTVQVHAEELDAHGLVAETPLGPVTLVG
O05382_AGGAC/4-259....................................ALLSKQVP........LSVRKGFPTDDEEAQKRIIMIDLETKFG
YNTB_SCHPO/124-492....................................MIFWKSSL........FKKVQDLTIYYDDHDELPGRMNTKNIGC
NGL1_YEAST/30-353....................................SIFYNLAK........FDFISSSGIYLNQLLNVFNQRELKYLYN
NGL3_YEAST/112-485....................................LVAWNNKK........FQLDNDWMLDYDNILAGNVISARTRTKN
APN2_YEAST/20-354....................................GCWIRIPE........KNHPLYHALQVVKAEEGITGYLTIKNGK
SYNJ1_RAT/538-859.VCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFH......TTSL.........................
A7T299_NEMVE/40-247....................................MAYFSSKM........ASRKVKLPKQYRLLEVLAINAIINNNNV
O68855_9STAP/43-321....................................AVVSKYPI........KERIQHVFRRGCGFDNDSNKGFVYTKIE
O13348_MAGGR/17-223....................................EMVCNTVP........NGP.........................
Q9Y026_TRYCR/56-263....................................AVLVRKNL........RSKRIPLTIPQHDTSLEVVVVQVALDQN
D2AT04_STRRD/93-301....................................GVYARHAI........TPGQAIEYGFGQMVATVEVPGAGPVGIV
Q9Y1H3_DICDI/7-211....................................AIENRDTR........KGHISINFKDDDGRILSIKYNSFNSINI
C5BVQ8_BEUC1/110-317....................................ALLVSDEL........GTYHQVPGPPTRAGAVRAEPDDGVGPVL
P74492_SYNY3/14-266....................................AIFSREPL........QDVKIGFAALVEPALTGDLDEQKRVISG
A4EK32_9RHOB/102-307....................................IFATRLDV........VSTEFIWPIDDDTPAVKAILRAPNGPEF
C7PRF4_CHIPD/618-892....................................GVLRKGGS........SNAYYNWSSGRFPFLLEAQAKLNNDSAL
TYDP2_HUMAN/117-351....................................AIMLKKSR........VKLKSQEIIPFPSTKMMRNLLCVHVNVS
A3TK42_9MICO/109-315....................................VILSRHSL........TKVSAEHVPGLFDQPVATVHAPTGDYVV
DNAS1_HUMAN/26-274....................................LFVYRPDQ........VSAVDSYYYDDGCEPCGNDTFNREPAIV
Q9NAL5_CAEEL/311-526....................................AILFKPPL........VVTKLDIQQEHHYNGHQSEVLACRVLNP
A7C3D0_9GAMM/108-325....................................AMLVKVTV........REQALRLLLVDGERSVRKVRTP......
NSMA_HUMAN/12-272....................................CVFSKHPI........QELTQHIYTLNGYPYMIHHGDWFSGKAV
O65598_ARATH/3-223....................................WVLWDPSV........EVVIVAKSLQMITCEVLFPNSRTWIVIS
C5NNP0_ORYSI/360-581....................................LLGINAAV........MDLSLIVEGEFYVKFHLRNKEDRFEWIL
Q9ZQF8_ARATH/4-230....................................ALFYSRDY........PVKFIYVCDRLIDIETIIDGNRVFITFV
Q17003_ANOGA/83-316....................................VLLAVSNA........YESIELPSRDRSLEYICVRVACNNAHLY
LIN1_NYCCO/10-229....................................AILFADAI........GFKPTKIRKDKDGHFIFVKGNTQYDEIS
O97240_PLAF7/281-607....................................VILVEFSN........FFLLSTYTPNNGFDHVKFERRR......
A1U6L7_MARHV/41-269....................................GLLSRFRP........LDVTEHKLPGLIPGRGAIIARYGDEEDP
Q5QUK7_IDILO/105-312....................................HVYSRYAL........SDVSVEYLVEDDKPSVHCFIELPCGQKV
A1T8I1_MYCVP/118-329....................................GIYSRYPL........TDEARLPDLQHNNLRATINVAGAKPVAV
B1KQZ4_SHEWM/42-455....................................GLLSQYPI........DTDNIRTFQNFKWKDMPGETNPTITNCD
A3XAE4_9RHOB/4-211....................................SLFSRLEL........RDPQVLYLVEDKVPSIHAGVVLPNGHLL
A8M5G8_SALAI/105-315....................................GLYARHPI........SAGGVRHNSGGWGFLQAYGTILVPGAPP
Q2SQK9_HAHCH/44-408....................................LLLSKYPI........QEQRTRTFQNFLWRDMPNALLPDNPDTD
Q1JZE6_DESAC/7-207....................................ALLSRRPV........KMIQTYDLGYGAGCMRAELIADDKRCLL
O42110_9SAUR/47-252....................................ALYVREHY........DXSELQCETGDTPVESLWVKLRSKNNKG
OCRL_HUMAN/245-524.MMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFH......NTTF.........................
O44201_BOMMO/8-204................................................................................
A4BGZ7_9GAMM/1324-1668....................................VLLSQYPI........DYANARTFQKFLWKDMPDAKLPVNPETG
C2G3V9_9SPHI/103-310....................................LLFSKFEL........RDAEVKYLVEDDIPSIHTKIVLQNGQEV
YBHP_ECOLI/13-244....................................AVLSRYPI........EHYENRDVSVDGAEKRGVLYCRIVPPMT
G3XDB0_PSEAE/4-246....................................ALYSRLQP........KAVISGLGFETADRYGRYLQADFDKVSI
Q04135_DROME/7-214....................................GILIRNRI........KHHHLNNFDKNYLQSTSIALQLNNGSTT
Q9XAL0_STRCO/104-321....................................GLWSKLPL........SGTRPVDIATDYGPLADTKPADVTMAGN
Q9ZAB7_AGGAC/30-274....................................AIVSRRQA........DEA.........................
Q9YGS2_TAKRU/70-277....................................AAIYHSKL........LINPRPKHGFSSFESLTLGITHLNWRTE
Q7UV93_RHOBA/76-326................................................................................
PHL3_BACCE/40-305....................................AIVSKWPI........AEKIQYVFAKGCGPDNLSNKGFVYTKIK
Q868R2_ANOGA/5-211....................................WVTDESKT........VAIVVNGNRLPIQRIRHRQTLGVVAADV
Q9X9W4_STRCO/312-604....................................AALTHSPG........RVDPANEAWEDSRKPLAGEFVFRGRTVF
A4ESR5_9RHOB/34-347....................................ALLSRLPI........ANAGVTDLSTLLWKDLPGASLPKGKDGT
C6RT65_ACIRA/105-312....................................HLYSRLKL........EDTEVKFILSDEIPSIHTTVRLRSGQPV
APE2_ARATH/4-324....................................ATFCRVKS........ASSSCETALPVTAEEGITGLVNSNSRGG
APN2_SCHPO/4-295....................................GFYVKKDV........AIPVKAEEGITGILPVRGQKYSYSEAPE
A6ENA6_9BACT/100-307....................................HVYSKRTF........DNAEIKYQVENHVPSIFFDMNINETDAI
DNAS1_OREMO/30-276....................................LFLYREAL........VSVVKSYTYDDGPEETGQDTFSREPFVV
SYJ2_SCHPO/573-851GVFLGVFIRKDDHLVVSKVTKTTRKTGFGGFSANKGAVAIEMNVC......DSDF.........................
Q9SIS9_ARATH/366-584....................................VVYWKKHL........SIQVISHDVRLVDLYVEYKNFNFYLSCI
A3SUZ8_SULSN/8-305....................................AILSRYPV........LRTDVQDYSDFLWRDLPDALLPQTDGAP
C3JMR5_RHOER/45-349....................................GILSKFPI........EETADLNSMIKAVVTVDGKQIAAYSAHL
B8K751_9VIBR/38-447....................................ALMSKYEI........DTENTRTFQEFKWKDLAGATIPTITKCN
CCR4_YEAST/508-818....................................CIFFKRDQ........FKLITKDAMDFSGAWMKHKKFQRTEDYL
ANGE1_HUMAN/248-656....................................AVCYKPTR........FRLLCASPVEYFRPGLELLNRDNVGLVL
T0PZ96_9STRA/35-481....................................VIAFRRLN........FQIFRTQRIEFNDLVAQTRRENLAAKLE
O46094_DROME/190-469ATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLGNKGGVAISLQLN......EGNI.........................
Q86GH0_DROAE/65-291....................................AILIRHGI........KHIALEPIMQDACQCAPVAITLSTQETI
Q6MMC5_BDEBA/32-239....................................AIGSKLTP........LSVDFIRSKTRELFWLTPKLTLFSEYSF
A0Y1P5_9GAMM/101-305....................................VVLSRIPM........VYKQQVKLDGDKLGYLKLKFMVGNTLLT
Q9TZX4_CAEEL/118-349....................................GFIVRSTL........LPKIVEVRFLSHRIGLLTFKVSRKFNCT
A1SIW4_NOCSJ/519-746....................................VIWDRNEW........EQTDGRLVGIPYFGGKDVGMPLVQLTST
O96546_LYMDI/17-226....................................LIYYKRSL........HCTPVDPPPLMYIEASICRLALSGHQPI
D0LKU2_HALO1/119-323....................................AVLAREPV........VEARLRQLTAAPIPAAEVVLRRGDSEVA
INP51_YEAST/532-813GILLLLFMNETEYSKVKHIEGDVKKTGFGGMASNKGAVAVSFKYS......ATRF.........................
Q1QA26_PSYCK/112-319....................................HLYSKLEL........IDPEIKYLIIDDIPSIHTQIQLQGGRVI
DNSL1_HUMAN/22-265....................................VYFYRSHK........TQVLSSYVYNDEDDVFAREPFVAQFSLP
Q9RFY5_HELHT/24-265....................................AIVSDRRA........DEV.........................
A0A023EDJ4_AERSA/37-444....................................AVMSQYPI........DTKQIRTFQHFKWKDMPGESNPVIDDCN
Q93137_BOMMO/15-220....................................VIYYRRAL........HCVPLDPPALANIEASVCRISLTGHAPI
D0LNM2_HALO1/11-267....................................LLLSRFAI........AASGVLPLPRVGAARVAIWCDFEVPGLR
A6WD12_KINRD/15-239....................................AVLTAARV........DVRAASVRALPTPRRRGWKPVRRRGTAE
A5P939_9SPHN/105-310....................................IFASRLPV........RSSQMLENTHRDTPTLYATIEIPGSSAF
C0DYX5_EIKCO/70-259....................................ALWSKQPL........AACEVRMIGDYPYIRAQTADGTTLYALH
IP5P8_ARATH/88-411GIFLCVWVRDDLRKRITNLKVSCVGRGIMGYLGNKGSVSISMSLH......ETSL.........................
YTX2_XENLA/6-230....................................VTLFSDSF........QPEVLSATSVIPGRLLHLRVRESGRTYN
ANGEL_DROME/71-344....................................AIVYDSSK........FELLDHQAVELYDQAVALLNRDNVALFA
SHIP2_HUMAN/429-718.....VLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFN......GTSF.........................
I5P2_MOUSE/350-629.IMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQLH......NTSI.........................
D2T850_ERWP6/102-309....................................HVYSRLPL........KDAEIQYLVDDEIPSMHMLVQLDEQTDV
A0YXL3_LYNSP/4-376....................................VLLSKYPI........DTENIRTFQDFLWKDMPDALLPDATPEE
SYNJ2_MOUSE/535-855.VCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQLH......STSF.........................
C5BJD9_TERTT/346-705....................................AVFSKYPL........DETNSRTFQLFKWKDMPGALEPELDGEK
C6WGJ0_ACTMD/106-312....................................GIASRYPL........TPARLVGPSSFRQASAVVELPNGKDVEV
Q6LKH0_PHOPR/93-303....................................LVLSQYPL........FSMKTIATQAGHQIIHGIWHPPKYQPIE
A0Y3X6_9GAMM/104-311....................................HLYSKFKL........LDAQICELIEDDIPSIHILFENDEGLEM
Q7M558_DANRE/2777-2983....................................GIYASNKL........LFNIIQIPNVNLECVVCNCIKYNILTAV
D2B8I2_STRRD/121-420....................................AILEKAIP........SFIGDD......................
C7NG46_KYTSD/144-354....................................TVLLRDGL........PEYTPAEAEPSLQGNVRLEPTEPGQPLV
B5GR87_STRC2/14-301....................................AAFVRTDV..........FTPVSAGSIGDPTGCPPTCVTLRLTP
C5C297_BEUC1/17-258....................................ALLSAFPV........LASFAQPLPGGWVRWPRRRAGRWRVAID
Q1I8E8_PSEE4/192-431....................................VLADNVTV........LGV.........................
D0LH64_HALO1/68-276....................................TVLTRLPL........ARAERHSLDGEIVYEPRIAFEVGACAGA
B7QXZ5_9RHOB/33-347....................................ALLSRHPI........HSSQIRDLSALLWKDLPGAVLPVHPDGS
C0W4G5_9ACTO/4-304....................................GVLARWPV........AKVGRSDDYLATHVAHPGRTLAVYSMHL
O29675_ARCFU/5-248....................................AIASLEEP........EDVSFGLDSEPKDEDRLIRAKIAGIDVI
G1UB84_HAEDU/4-259....................................ALLTKKQP........LTIRKGFPNDTADAQKRMIMAEINTDFG
D4BMH5_BIFBR/190-433....................................VLYSAYEP........GASVPNVVSIPAADVPAITLRIADQAKM
Q8PBH9_XANCP/68-425....................................LVLSRYPI........DAQAVRSFQLLKWSALPGALRPVDPATR
CCR4_CANAL/459-769....................................ATFFKNDK........FSLIHKQNFEYNSVCMGSDKYKKTKDLF
F2G584_ALTMD/107-313....................................HLYSKIPF........EEATLNFLIEDDVPSMKVKIKHKGKDAL
E7KT29_YEASL/115-504....................................AIMWRREL........FHQVDKMLIDYDKESSESISTRTTTNNV
DNSL3_RAT/29-279....................................AFLYKEKL........VSVKAKYLYHDYQDGDTDVFSREPFVVW
D1NTE5_9BIFI/129-340....................................GIWAAAPL........SIPADSQINSTSSKMPAGTVQACDRQLR
Q95041_RHOPR/31-304...LNVFVKLNSAWALKNAAVDEVTTGMAGLYGNKGGVIMKFQLH......DLMF.........................
B9NTP9_9RHOB/22-326....................................AVLSRYPV........KVDQARSFSGMLWRDLPGATLPTEGGKP
Q5QWX6_IDILO/38-393....................................VILSKYPL........LTDKARTFQHFLWKDMPGRHIPYVMNEQ
APEX1_RAT/64-308....................................GLLSRQCP........LKVSYGIGEEEHDQEGRVIVAEFESFIL
D2S515_GEOOG/4-252....................................ALLSRLPV........LEWSVLDLGAGRARLPVQGPDPRTGRVR
Q24690_DROTE/6-206....................................RILVHKSI........QYTTLNITSDPEAIAINIQSKIKLNIF.
Q9ZCP7_RICPR/4-250....................................AIISKFPA........DQIIKDFQNNYCNDQARFLEIKLSSPIG
O62658_CANLF/11-230....................................AILISDKL........KFTPKTVVRDEEGHYIILKGSIQQEDLT
O17590_CAEEL/100-403VIVFQAVNSKVRVSDVNVKYVATGISVLVNKLGNKGGTAVSMKMN......DTWV.........................
PHLC_LISIV/48-325....................................AVVSQWPI........VEKSQHIFQRGGGADRLSNKGFAYVKIM
O64428_CHLVU/12-249....................................AVLLRPTA........STAAITVRHCSTTGRTLLVDFTYCGQPY
Q9RXF9_DEIRA/38-271....................................AILSRLPL........KDVRLGMPHDEMDAEGRVVSAVVAGVRF
EX3_ECOLI/4-259....................................ALLTKETP........IAVRRGFPGDDEEAQRRIIMAEIPSLLG
O26314_METTH/7-248....................................AMYTKVPP........SSLREGFGVERFDTEGRIQIADFDDFLL
B4WAV6_9CAUL/100-305....................................IVASRYPI........QGKLPSFRDDLAAIGAVVETPIGAVNVF
D0LI27_HALO1/46-296....................................AIASKRGA........QRSGFAYKRDLRVRRHADLAALDVGGLR
A7A3N5_BIFAD/144-355....................................GIWIRIEP........SDTSPITAVIPAADVPGVCFPIDAMRGI
O01419_BOMMO/9-206................................................................................
O18005_CAEEL/310-619....................................AIIFDSQR........FQVISSKCYGVAELASGDILGILETSEE
B5GU93_STRC2/121-326....................................AILSKHPL........RKTAGVPGSLAMPGAVAEIAGREVRLQL
Q9S1Z5_STRCO/42-270....................................AILSRYPI........TASDNTWLYKSPGQEQRGLLHATLDVHG
B1MNW1_MYCA9/96-305....................................GIWSRYPL........TPVHQDDQGFAMRQIWAEAEIPGAGPIM
Q2C775_9GAMM/365-634....................................GVVSRFKI........ESIDTTNSRTLSLKLHDKNFNRHYSLGV
Q6UE72_TETTH/99-328....................................LILENQQR........VLIMGLHLQLQANPIEEQA.........
O83162_TREPA/8-255....................................ALFSKRAP........DAVRFFGVPAFDCEGRMLAARFGELTVV
D2PNL1_KRIFD/62-287....................................ALVHKGDR........EWYRVWDLPNPNNHEPRKMVCALLAGQP
A1R797_ARTAT/136-351....................................AVYSVFPL........EPNGLLPDTPFRNDVTRVLVSNPGSGSK
D0NNT3_PHYIT/6-323....................................MVVSKWPI........IREAQHVYRNACHYSDCLAAKGVKYARL
A5LH53_9CAUD/25-260....................................AIVSNRRA........DEV.........................
D4DUX1_NEIEG/102-289....................................AVWSRKPL........AACEVRFVGDYPYIRAVTGNTALFALHP
O76745_CIMLE/32-291.ETMGLTVYCLEKHLDQNTLKNETIIVTVDDQKKSGGIVTSFTIY......NKRF.........................
Q094F5_STIAD/52-257....................................AVVIRKSA........VKSIGELQLVKGTDASDCNSPEGGIMTR
B6QFL9_TALMQ/445-668....................................SYWTKMIP........TERHKGRWPIRSMLWIRSDIEAEQIPVA
Q1YK76_AURMS/120-327....................................HLFSKFPL........ADPAVDFWFETGTPSVTADVTLPAGTVR
D0L3V4_GORB4/96-309....................................GIYSRFPL........TDRHALAGMEHANLRAVADVPGVGRRAL
A3SLI1_ROSNI/16-332....................................ALLSRYPI........AAAQDLSGFLWVDLPHALLFEDTGAPLF
CSS1_SCHPO/12-289....................................AMFSKFPI........IESSMNKYPLNGRPQAFWRGDWYVGKGV
D1BKV9_SANKS/134-342....................................ALLVAESL........GTYREVDGPVGGVRVVPVDGDGPPIAAV
B5ZY66_RHILW/98-299....................................LVLSKRPL........IEPRIRNLGLLWRNRLTISTIDFDGQKV
PHLC_STAA8/46-322....................................AIVSKYPI........KEKIQHVFKSGCGFDNDSNKGFVYTKIE
INP54_YEAST/11-313GAITIIVLYNNNALKVKDDILKRNGKCGWFGTHLKGGTLISFQMTRNGEENWERF.........................
RTJK_DROFU/9-214....................................SVIVRSSI........SHSPQPPISTNDRQIAYIQLQTAEGPVV
D0Z4R5_PHODD/38-450....................................ALMSKYKI........DTANTRTFQNFKWKDLPTAENPIITNCN
ARP_ARATH/279-527....................................AIISRIKP........LSVRYGTGLSGHDTEGRIVTAEFDSFYL
IP5PF_ARATH/543-875GLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKGAVGVRLRMY......DRVL.........................
B1C336_9FIRM/825-1040....................................GIVSQNEL........SGQSGASLPSLPGIEGRAYARAEFEKDG
Q26816_9TRYP/95-297....................................SILVREDL........PVETGMTVVGRSEQVHATIHLARGQALT
A6BZ11_9PLAN/4-223.......................DYGYPIKPGRRKVILWSKHPW........NEVSQHEQLNFPLGRIVSGITRGVRMLG
A4FQX0_SACEN/43-251....................................AVLAHPDQ........GSLVDGLVEKQFAAQDGGKEARVLLCAP
P72938_SYNY3/1331-1646....................................GLIYKVSA........VSLVGDAAILNTQAFLDPNNTGENRNRP
A1K8S1_AZOSB/38-302......................................................ILGPEWRAVYSGVVPDDGGNGERIGF
B0X3H8_CULQU/1636-1848....................................AIYRKTTT........KTSMAVPYTPELVSQDRDELFGVADKYG
C8N9G3_9GAMM/89-278....................................AVFARAPL........AACEVRFIEDYPYIRATLADGRTLYAAH
Q9A7Y4_CAUCR/110-315....................................ALRANYPF........ASCGKGARCETWIFSRKKMIARGGATFE
Q01375_NEUCS/7-217....................................PLLEFIEA........GPPA........................
A9DTY1_9RHOB/15-313....................................AILSRHPI........LTEDLQDFSTLIWRDLPSSLYPMIDGTP
YE8A_SCHPO/794-1114GLFSCVFVKNKLQSKIRMLQSTTVKTGLGGLHGNKGAIVVRFLVD......DTSY.........................
Q2UFE1_ASPOR/75-351......................................................WIQDHFFITDLNHTQWRGSYGTTTLI
Q09BG4_STIAD/252-512....................................AVLFKSGT........VQVLTAEIILTHFNYEFAGRPPLQLRLR
Q44070_AERHY/480-826....................................GLIYRPAK........VSLEGAAQLIPLPLQVAEAVDGADKPVS
I9U9G4_HELPX/4-242....................................VTFTKKEP........LSVSYGIDIKEHDKEGRVVTCEFESFYL
A5VCJ2_SPHWW/55-332....................................AIAARYPL........DGVELHPYGLRSCAGIDCLANKGIVRAL
Q9RWN4_DEIRA/100-318......................................................ALRRALPGWHFAQHDELLSFSRLPLL
Q55DR4_DICDI/251-565....................................SIFSKHEI........SNIDSIKLSRDIKKPDDAHQRSCLRVEI
INP53_YEAST/571-849SLLILFFVKADKAKYVKQVEGATKKTGFRGMAGNKGAVSIRFEYG......ATSF.........................
C9P6A0_VIBME/38-446....................................ALLSKYPI........DASQTRTFQHFKWKDMAGAENPKITICD
B4R9Q2_PHEZH/109-311....................................MILSRRPP........IRSEAVRLRGPNPGPLTRAVFRDRRGRY
O51484_BORBU/4-243....................................CIYSKVEP........ISVRLLGEEIFDNEGRGLVACYDDFILV
IP5P9_ARATH/63-371GILITVWVRGDLWPYIRYPSVSCVGCGIMGCLGNKGSVSVRFQLH......ETTF.........................
D2R9U6_GARV4/132-368....................................AIFTQYSA........ISTCTNSVKIEAASVPSVTTCLDFGANE
P91740_HYDVU/57-349....................................FWLSKTPN........IPFTKVHNSVEEQTCTWIKFQYAVKLNL
NOCT_MOUSE/144-412....................................ALFFLQNR........FKLISSTNIRLTAMTLKTNQVAIAQTLE
A5ZI49_9BACE/408-663....................................CLFSRYPI........QKIKTKNTFYSNPAIITLPSGKKVYLNA

PF14529

D7EM17_TRICA/220-332-----------------------------------------------------------------------I........
D8Q682_SCHCM/470-595-----------------------------------------------------------------------L........
A7ENE7_SCLS1/419-538-----------------------------------------------------------------------Q........
A7EV44_SCLS1/169-288-----------------------------------------------------------------------Q........
B7Q7X7_IXOSC/39-155-----------------------------------------------------------------------D........
E9HS52_DAPPU/293-409-----------------------------------------------------------------------N........
E9H8A1_DAPPU/103-219-----------------------------------------------------------------------N........
E9HMD6_DAPPU/94-210-----------------------------------------------------------------------N........
E9H5U8_DAPPU/53-167-----------------------------------------------------------------------N........
B7PJV5_IXOSC/324-438-----------------------------------------------------------------------V........
E6ZRW9_SPORE/1185-1312-----------------------------------------------------------------------T........
E9H822_DAPPU/420-535-----------------------------------------------------------------------S........
E9HYG6_DAPPU/19-132-----------------------------------------------------------------------I........
E9HDY2_DAPPU/149-262-----------------------------------------------------------------------I........
E9HRI7_DAPPU/460-571-----------------------------------------------------------------------C........
E9HZZ2_DAPPU/118-231-----------------------------------------------------------------------L........
E9HRK8_DAPPU/106-221-----------------------------------------------------------------------L........
E9HSQ7_DAPPU/121-236-----------------------------------------------------------------------A........
E9HE10_DAPPU/492-604-----------------------------------------------------------------------L........
E2C5Q1_HARSA/10-124-----------------------------------------------------------------------H........
B0W1L0_CULQU/467-584-----------------------------------------------------------------------VNS......
D7GXY3_TRICA/106-218-----------------------------------------------------------------------Q........
D2A4F4_TRICA/101-212-----------------------------------------------------------------------E........
E2AVN7_CAMFO/107-222-----------------------------------------------------------------------N........
B6QWM9_TALMQ/555-687-----------------------------------------------------------------------DAQ......
A2QSQ0_ASPNC/504-636-----------------------------------------------------------------------NTS......
Q2HHJ7_CHAGB/475-603-----------------------------------------------------------------------DPQ......
Q2H3B9_CHAGB/415-543-----------------------------------------------------------------------DGE......
Q2GZF1_CHAGB/632-760-----------------------------------------------------------------------SDE......
E9FE00_METRA/199-327-----------------------------------------------------------------------KTE......
B6QNK9_TALMQ/286-414-----------------------------------------------------------------------NKE......
B6H8V5_PENRW/395-529-----------------------------------------------------------------------PLFTGD.DA
Q2U1R5_ASPOR/105-240-----------------------------------------------------------------------NHSQPMEEV
A2QZW2_ASPNC/91-226-----------------------------------------------------------------------AMHEPFEAS
Q2TX40_ASPOR/104-239-----------------------------------------------------------------------ALYEAPEVS
B8MUV7_TALSN/118-253-----------------------------------------------------------------------DVHQATSTT
A6R6U1_AJECN/368-494-----------------------------------------------------------------------DP.......
A7S3V7_NEMVE/68-188-----------------------------------------------------------------------QP.......
A7S2X0_NEMVE/168-291-----------------------------------------------------------------------RQ.......
C3YN84_BRAFL/1345-1466-----------------------------------------------------------------------GK.......
D6WYM2_TRICA/271-393-----------------------------------------------------------------------GASF.....
A7S0T7_NEMVE/341-458-----------------------------------------------------------------------DSD......
E3N7S5_CAERE/136-251-----------------------------------------------------------------------TS.......
E3MXD9_CAERE/375-485-----------------------------------------------------------------------TS.......
E3MA06_CAERE/30-140-----------------------------------------------------------------------AS.......
E3LJB4_CAERE/350-458-----------------------------------------------------------------------S........
E3N681_CAERE/36-144-----------------------------------------------------------------------N........
E3ND32_CAERE/223-331-----------------------------------------------------------------------H........
E3MKX6_CAERE/106-217-----------------------------------------------------------------------C........
C5KXY0_PERM5/413-539-----------------------------------------------------------------------TSS......
A6RES2_AJECN/586-706-----------------------------------------------------------------------T........
B6QF01_TALMQ/823-943-----------------------------------------------------------------------S........
B8MCU2_TALSN/715-835-----------------------------------------------------------------------N........
A6QSA7_AJECN/584-704-----------------------------------------------------------------------S........
Q0TWS8_PHANO/49-171-----------------------------------------------------------------------A........
B7PHI8_IXOSC/55-177-----------------------------------------------------------------------T........
C5LYL7_PERM5/137-253-----------------------------------------------------------------------Q........
E0VEI2_PEDHC/13-127-----------------------------------------------------------------------.........
E9GSG1_DAPPU/115-230-----------------------------------------------------------------------E........
B7QBV7_IXOSC/96-214-----------------------------------------------------------------------D........
B7QN21_IXOSC/94-212-----------------------------------------------------------------------D........
B7PD65_IXOSC/108-226-----------------------------------------------------------------------D........
B7PS20_IXOSC/108-226-----------------------------------------------------------------------D........
B7PXF9_IXOSC/95-213-----------------------------------------------------------------------V........
C5K8V2_PERM5/55-185-----------------------------------------------------------------------D........
B4HD52_DROPE/236-352-----------------------------------------------------------------------G........
E2AWP2_CAMFO/83-203-----------------------------------------------------------------------ES.......
E2B1G0_CAMFO/3-123-----------------------------------------------------------------------ES.......
E2B0F5_CAMFO/1-121-----------------------------------------------------------------------AS.......
E2BFV3_HARSA/10-133-----------------------------------------------------------------------LE.......
E2AA34_CAMFO/86-207-----------------------------------------------------------------------RD.......

PF03372

APEA_DICDI/108-351VNTYIP....................................................................NAGTRG
C0W5Q6_9ACTO/5-307RLHTATARCQLAAT....................................................LAVPGWHAPLTVST
Q9ZBN3_STRCO/24-259VTLKVRGVPVQ...........................................................VFVTHLDYRA
A7T3Q8_NEMVE/115-319III..........................................................................AGV
B3SRB8_ASCTA/220-428NE..............................................................................
B8MHG3_TALSN/453-675................................................................................
Q1QVQ0_CHRSD/109-317RFHAVH.....................................................................PRPPA
A0M2U8_GRAFK/107-314RFHCLH.....................................................................PMPPS
A6CGC2_9PLAN/130-329PAVF.........................................................................LVD
INP5K_MOUSE/37-330................................................................................
RRP1_DROME/430-670INVYV......................................................................PNSGR
C7QE92_CATAD/155-383SGTFGGLLRFTLDLDQ................................................SRQVTVYAVHLPQPSL
C0W5C1_9ACTO/126-340HARPTI....................................................................LGVHTI
A9DSA8_9FLAO/61-246................................................................................
A3ITE0_9CYAN/5-368ESYYSEEELNNFRLSSKSHWDLPLLINGETV...................HFLVSHPTPPVFDGEEDRNGRRNHDEIRFW
C7ZMD9_NECH7/94-389................................................................................
I5P2_CAEEL/8-272................................................................................
C1A7M1_GEMAT/266-540................................................................................
Q9RZQ3_DEIRA/490-782TGGVFSVIANHLKSK..................................................GSCPTSGDVDTGQGC
O27012_METTH/6-222CRIEIGGN.................................................................SLSLFSI
Q08525_CHICK/66-271QLV..........................................................................IGV
Q0CY83_ASPTN/48-313DKRLPVERVFRVPYAASRMQRDALFVD...........................IALNPNAPLRLCNTHLESLVSVPPRR
C2Q910_BACCE/40-333ALNNNAKGELPDSNGNLVQFLERDAILIHKNHKLDIIGKQEANFQTNLTIPLAGQPFTILRGWSSIDVKIDEQIFRMINT
O15921_TRYCR/109-396EGRVLTTYFGTQGKGSETFALALV.................................NTYIPNSGMSLERLPYRCQKFDL
A3ZS40_9PLAN/129-366................................................................................
Q11NA1_CHESB/104-316TLIVYAV...................................................................HPQTPR
Q0URF7_PHANO/122-382VDRRLTIKNVFRVPWVSKFDRDGLSV.............................DIALSSAQSGNGNREVLRLCNTHLE
Q0FLB9_PELBH/11-291QRLSSDAHWVIGIEGGP..............................................SLLAWNATPPVFDGPED
Q9ZVF0_ARATH/390-645FVY............................................................................A
Q9RS34_DEIRA/101-311................................................................................
C4FH07_9BIFI/165-380FGS..........................................................................VHP
B7S366_9GAMM/60-266RDDRLL....................................................................AINLHA
M6BNC3_LEPBO/89-364DKNGRKFHIIGT.........................................................HVQAQDSGCAN
YAFD_ECOLI/47-252TRLLMV.....................................................................VNIHA
Q9F2J2_STRCO/121-324AHP...........................................................................MP
Q7USG9_RHOBA/118-325RVIGVH.....................................................................PRPPE
A3SVB7_SULSN/110-316RLYIV.......................................................................HPEP
A5FED8_FLAJ1/31-384DWYSKKAWKEFPLSSKSHWDVPVEVGNKTV....................HVLVSHPTPPTFDGEEDRNGKRNHDEIRFW
DNAS1_BOVIN/26-274KFSSHSTKVK.............................................................EFAIVALHS
Q54E13_DICDI/8-231ILGIYAP..................................................................ASNNTIK
D3R3H2_BIFAB/133-356TFASAHPKSPQ...........................................................RSCKDWSAGI
Q0PC57_CAMJE/24-257................................................................................
Q1MZ88_9GAMM/34-259V...............................................................................
Q9VXE7_DROME/36-332................................................................................
DNSL2_HUMAN/25-288GTGERAPPLPSRRALTP..............................................PPLPAAAQNLVLIPLHA
Q9U4W1_AEDAE/10-212................................................................................
O15922_LEIMA/133-437VLVEGAGDEEGRVLTTFLSPDPDSASSSSRIA.................LVNTYVANSGMGLTRLPYRVQSFDPSMREYL
Q2PWA8_MONPI/4-202................................................................................
V9FYL2_PHYPR/6-366TLFVGTSHLESLPQFAG..............................................PRVSQLKESLTLLRDRV
Q9SN65_ARATH/347-583................................................................................
Q985E5_RHILO/120-323AA.............................................................................I
SMASE_MYCTU/228-473................................................................................
CDTB_ECOLX/26-261................................................................................
Q9PTX0_XENLA/23-272RFTSLTTVVK.............................................................DFALISIHT
C4RQR9_9ACTN/168-411YYRHKVLRTDLRVDGQVLSVY.......................................NVHVPVQLDISMDPTESEFT
Q9YI04_XENLA/21-271FQAPSTEVK..............................................................EFVIVPQHT
Q3JBC2_NITOC/104-311RMHCLH.....................................................................PEPPS
O34095_LEPIR/84-361NKHGRKYHIIG...........................................................TDVQNTSCSD
Q315C8_DESAG/101-322AGPVAFFAVHLPSPRYG...............................................LQHLLDRRKLINPEKA
O77366_PLAF7/563-897NLSKELDDIIKEIKTVFQIGIYMHK...............................NTNSIFLISNTHFYFHSLAQHIRA
A6GK21_9DELT/6-259................................................................................
D5UUF8_TSUPD/40-343EYRWYATYLPRGYGAGVPSGE......................................FSEFGWNKIPGGPVTDVAAVQ
B1LXH2_METRJ/33-216V...............................................................................
O46184_DROSU/14-220S...............................................................................
A6VUZ0_MARMS/30-246ESPIEQS..................................................................LLVINTH
Q8I3R5_PLAF7/2121-2476KNPSLVKRLLKDNVALVILLECIQQYSKIY.....................DKSEEKQNKKLLIVANTHIVANPEANYVK
O22148_ARATH/4-222................................................................................
P96273_MYCTU/27-281GATCGGIRVWSL.........................................................YVPNGRALDDP
APEX2_HUMAN/5-304FTQEELRALDSEGRALLTQHKIR..................................TWEGKEKTLTLINVYCPHADPGR
Q9RKB3_STRCO/12-265ASLYLPSG.................................................................EVGTERQ
Q63291_RAT/38-257IL..............................................................................
INP5E_RAT/307-587................................................................................
A5V5B1_SPHWW/53-337VAVPGAPGPIAVVN.....................................................LHLNSKRASGVAI
Q281W3_PHACH/39-344................................................................................
B2B0A0_PODAN/123-383YGTCILVPKVLPIKAVFRVYYPNSS...............................MQRDALFVDIAIPRDKVLRVCSTH
DNAS1_CHICK/24-272KFSSPTTQLD.............................................................EFVIVPLHA
C5C387_BEUC1/53-411EPADWFTPEELDVVRLSSKSHWDVPVRVGRDT................VHVLASHPTPPTFDGPEDRNGLRNHDEIRFWA
SHIP1_RAT/411-703................................................................................
EXOA_BACSU/4-243MTVYT......................................................................PNSRR
IP5PC_ARATH/581-914................................................................................
H2PHM7_PONAB/192-531VMTKDNIGVAVLLELRKESIEMPSGKPHLG....................TEKQLILVANAHMHWDPEYSDVKLVQTMMF
INP52_YEAST/596-874................................................................................
IP5PD_ARATH/576-908................................................................................
RTJK_DROME/9-214V...............................................................................
B9J7A5_AGRRK/98-299NFV..........................................................................SAH
O86610_STRCO/4-250VRVWSVYV.................................................................PNGREVD
A3VZN2_9RHOB/19-338FPSEAAQAVQRLSSNGHWIVPVML.................................ASGPMLVMTFHATPPVFDGPEDL
H2R3J5_PANTR/15-385FPQDYFPECKWSRKGFIRTRWCIAD...............................CAFDLVNIHLFHDASNLVAWETSP
EXOA_STRR6/4-266DAFFVTQV.................................................................YTPNAGD
PI5PA_HUMAN/428-721................................................................................
D1AXA7_STRM9/113-329IIGL.........................................................................HTA
Q1GKT6_RUEST/32-332LYPDAETAARLRLSSTNHWAVPVTL...............................ENGQFLWILSFHAAPPVFDGAEDR
Q2H5K7_CHAGB/308-508................................................................................
A1SIW4_NOCSJ/70-299FATWVMLRRADGSVVSVV............................................STHHMTNPHRWPKQHGNP
Q9ZDR5_RICPR/4-252YVPAGGD...................................................................IPDVEV
D7WDI6_9CORY/121-321TTWGSLAFRIAA.........................................................GPTIVAVHTTA
Q07995_CHITU/11-220HIL..........................................................................SVY
Q9S2L9_STRCO/24-240GGARI.......................................................................GVLS
NSMA_CAEEL/42-318GLTEIEIDGDLRVN....................................................FYTTHLHAEYDREN
O93520_ORYLA/9-231L...............................................................................
Q5LX09_RUEPO/24-347FPSEAAQAAQRLSSTGHWLVPIDT.................................DMGRMVLLTYQAGPPVFDGPEDR
NSMA_DROME/9-264GLCRILVGGQMVHL.....................................................YNAHLHAEYDNAN
Q9SIQ5_ARATH/113-377................................................................................
Q83GA3_TROWT/91-308RMYVVS.....................................................................LRKNQ
Q2C5E7_9GAMM/445-703FSILHP.....................................................................SSTNT
A1RCE7_ARTAT/41-258GGLGSVWVLN............................................................THNPAGAVGG
D2B0I5_STRRD/117-322VVD...........................................................................VH
Q15NA1_PSEA6/104-315RCHFVHPA.................................................................PPSPTEN
Q9P8H7_CANAX/14-261TNEDITL...................................................................INNYLH
Q9VTW2_DROME/396-695................................................................................
A6W517_KINRD/120-329LAA..........................................................................AHT
A5C0G0_VITVI/310-530F...............................................................................
A7T4C3_NEMVE/164-372VLF..........................................................................NGL
CCR4_SCHPO/339-664YNRVMTKDNISVITLLENKENGSRLIVANC.....................HIHWDPQFRDVKVIQVAMLMDEIAQVATK
D2B2Z6_STRRD/114-320VHP...........................................................................CA
SYJ1_SCHPO/563-839................................................................................
Q1D7J7_MYXXD/85-296GGTLVQ....................................................................TASVHN
C0X2X7_ENTFL/9-266SKGTLT....................................................................VVSGHF
Q2UNN7_ASPOR/69-326VGKHLPITSVFRVHYSHTRMDRD..................................ALFVDVSTELEEKRIRLCNTHLE
TYDP2_CAEEL/123-353LKVFLLN..................................................................THLESTR
C2L0P4_9FIRM/115-330IIG..........................................................................LHT
Q9SA95_ARATH/176-431PLVFATSH................................................................LESPCPGP
Q50321_MYCPL/166-460DFTFV.......................................................................FDHF
B0WQS5_CULQU/1836-2048GDICAAKVMVM...........................................................GAELLLVSVY
A0JXK8_ARTS2/115-328LEVT........................................................................NVHA
Q24335_DROME/7-215T...............................................................................
O83555_TREPA/304-613KDFVVVTNHFSSKRG...................................................DDPVWGSTQPAQEH
E8RN27_ASTEC/87-283SHL..........................................................................TRP
D0KX69_HALNC/290-639SYYTPAELDVFRLSSKSHWDVPVYVNGKTLHILA............SHPTPPVFDDGTLGVDKDVVDWNGTRNHDEIRLW
Q5L902_BACFN/414-668CWLRYAYRPEYTSG.....................................................YAEKGLDPSVWVA
Q1CXT2_MYXXD/230-492IQRGGASVDVT...........................................................ALVIHMKAFA
EEPD1_XENLA/257-520................................................................................
A4A5W6_9GAMM/35-389NELWYPEAVQKVLRLSSKSHWDVPVRINGNV..................LHVLASHPTPPVFDGPEDRNGRRNHDEIRFW
D9QM28_BRESC/100-303VHL...........................................................................TR
O05382_AGGAC/4-259QLTVINGYF...............................................................PQGESREH
YNTB_SCHPO/124-492CVRLERVDDPSRG......................................................LFLATTHLFWHPY
NGL1_YEAST/30-353KKVTLTDGASNVIGEDSLLDVLKGKNQVCLF...................VSLRHKETGTIFVVLNTHLYWKYDEVKLTQ
NGL3_YEAST/112-485IALIISLYFKGITDSSS..............................................RGIIVANTHLFWHPFGV
APN2_YEAST/20-354HSAISYRNDVNQGIGGYDSLDPDLDEKSALE...................LDSEGRCVMVELACGIVIISVYCPANSNSS
SYNJ1_RAT/538-859................................................................................
A7T299_NEMVE/40-247LFVGI......................................................................YRSPN
O68855_9STAP/43-321KDGKNFHVIGTH.........................................................TQAEDSRCGAG
O13348_MAGGR/17-223................................................................................
Q9Y026_TRYCR/56-263RDL...........................................................................IV
D2AT04_STRRD/93-301SV.............................................................................H
Q9Y1H3_DICDI/7-211LLI............................................................................Y
C5BVQ8_BEUC1/110-317LAV...........................................................................HP
P74492_SYNY3/14-266VYDGVRIVNL............................................................YVPNGSALDS
A4EK32_9RHOB/102-307NFIGL.......................................................................HPRP
C7PRF4_CHIPD/618-892IRFVLLHAK...............................................................ANTGTASD
TYDP2_HUMAN/117-351GNELCLM...................................................................TSHLES
A3TK42_9MICO/109-315RAMH........................................................................PYPP
DNAS1_HUMAN/26-274RFFSRFTEVR.............................................................EFAIVPLHA
Q9NAL5_CAEEL/311-526DYPGA.......................................................................SFNL
A7C3D0_9GAMM/108-325................................................................................
NSMA_HUMAN/12-272GLLVLHLSGMVLNA.....................................................YVTHLHAEYNRQK
O65598_ARATH/3-223VVY............................................................................A
C5NNP0_ORYSI/360-581MA..............................................................................
Q9ZQF8_ARATH/4-230................................................................................
Q17003_ANOGA/83-316VMVVY.......................................................................IPPQ
LIN1_NYCCO/10-229II..............................................................................
O97240_PLAF7/281-607................................................................................
A1U6L7_MARHV/41-269LVL............................................................................V
Q5QUK7_IDILO/105-312KAHFVH.....................................................................PAPPS
A1T8I1_MYCVP/118-329YAL...........................................................................HP
B1KQZ4_SHEWM/42-455DDKNPIPTGMKCGDEWYTAEAWAEKPLSSKNHVDAPIL....IPTADGEKVVHLLLSHPTPPVFDTVTENNKLLNRAEIA
A3XAE4_9RHOB/4-211SLHCLH.....................................................................PAPPS
A8M5G8_SALAI/105-315VRVES.......................................................................VHPA
Q2SQK9_HAHCH/44-408APADWFSAEELEVVRLSSKSHWDAPINIRGRR................IHALVSHPTPPVFDGPEDRNGTRNHDEIRFWA
Q1JZE6_DESAC/7-207YNV..........................................................................CLH
O42110_9SAUR/47-252DVV..........................................................................VGV
OCRL_HUMAN/245-524................................................................................
O44201_BOMMO/8-204................................................................................
A4BGZ7_9GAMM/1324-1668ESWYTEEELDVFRLSSKSHWDIPVKVGKHTL..................HVLASHPTPPVFDGDEDRNGLRNHDETRFWR
C2G3V9_9SPHI/103-310QIYALH.....................................................................PTPPV
YBHP_ECOLI/13-244GKAIH......................................................................VMCVH
G3XDB0_PSEAE/4-246ATLLLP.....................................................................SGQSG
Q04135_DROME/7-214L...............................................................................
Q9XAL0_STRCO/104-321RALRTTVATERGPL....................................................VVYVAHLGSVRLNP
Q9ZAB7_AGGAC/30-274................................................................................
Q9YGS2_TAKRU/70-277KPLLF.......................................................................VVVY
Q7UV93_RHOBA/76-326................................................................................
PHL3_BACCE/40-305KNDRFVHVIGTH.........................................................LQAEDSMCGKT
Q868R2_ANOGA/5-211GGTT........................................................................IVSC
Q9X9W4_STRCO/312-604VVANHFNSKGGDQ.......................................................GLTAQYQPPSRG
A4ESR5_9RHOB/34-347EYFSKEALDILRLATTAHWVIPINLT............................NGQVLQLLCFQAGTPLFDGVEDRNGL
C6RT65_ACIRA/105-312QLFCLH.....................................................................PKPPS
APE2_ARATH/4-324KSETSTVAEGLEEYEKEELLMIDQE..............................GRCVITDHGHFVVFNVYGPRAVADD
APN2_SCHPO/4-295HEKIGFFPKDIDRKTANWIDSEG..................................RCILLDFQMFILIGVYCPVNSGE
A6ENA6_9BACT/100-307HFCFLH.....................................................................PAPPS
DNAS1_OREMO/30-276MFSSKNTAVR.............................................................DFTLIPQHT
SYJ2_SCHPO/573-851................................................................................
Q9SIS9_ARATH/366-584................................................................................
A3SUZ8_SULSN/8-305FPSAAAQEVQRLASHGAWVVPLDI................................PDQAPLTLLTFYATPPVFDGPEDR
C3JMR5_RHOER/45-349AYTSYATYLPRGYGAGVPKPGE.....................................FSEFGWNKMPSGPVTDPETVQ
B8K751_9VIBR/38-447DKYNKIPQGMKCGDPWYSDEEWQQVRLSSKNHVDAPI......IIPTDKGDQVVHLLMSHPTPPVFDTGKNQMQNAAEVA
CCR4_YEAST/508-818NRAMNKDNVALFLKLQHIPSGDT...................................IWAVTTHLHWDPKFNDVKTFQV
ANGE1_HUMAN/248-656LLQPLVPEGLGQVSVA................................................PLCVANTHILYNPRRG
T0PZ96_9STRA/35-481QDNIALFVALQPWETCA...............................................FPSPLCIVNVQLASHR
O46094_DROME/190-469................................................................................
Q86GH0_DROAE/65-291LVA...........................................................................PI
Q6MMC5_BDEBA/32-239GEKKAL.....................................................................FVCTH
A0Y1P5_9GAMM/101-305TFIA........................................................................HPPS
Q9TZX4_CAEEL/118-349VIQV.........................................................................YAP
A1SIW4_NOCSJ/519-746TTGQVIWVW..............................................................SIHNPANTQ
O96546_LYMDI/17-226TLV............................................................................S
D0LKU2_HALO1/119-323VLAV........................................................................HPPA
INP51_YEAST/532-813................................................................................
Q1QA26_PSYCK/112-319WLYCLH.....................................................................PMPPS
DNSL1_HUMAN/22-265SNVLPSL..................................................................VLVPLHT
Q9RFY5_HELHT/24-265................................................................................
A0A023EDJ4_AERSA/37-444NPKAPIPAGRQCGDAWYDAAAWQAFPLSSKNHADVPVR....IKRGNKEEVIHFLVSHPTPPIFGNAARHNVKHNRAEVA
Q93137_BOMMO/15-220V...............................................................................
D0LNM2_HALO1/11-267GARGALLRIYDT.........................................................HLSNRDGRDLL
A6WD12_KINRD/15-239VVVRVPLAGGWSR......................................................EVLVRSVHLGLDP
A5P939_9SPHN/105-310EFIGL.......................................................................HPKP
C0DYX5_EIKCO/70-259PP..............................................................................
IP5P8_ARATH/88-411................................................................................
YTX2_XENLA/6-230LMN...........................................................................VY
ANGEL_DROME/71-344RFRFKKQQEQQK.........................................................EFVVATTHLLF
SHIP2_HUMAN/429-718................................................................................
I5P2_MOUSE/350-629................................................................................
D2T850_ERWP6/102-309RLHCVH.....................................................................PMPPS
A0YXL3_LYNSP/4-376NDWYSTEELAVLPLSSKSHWDIPLEVDGEIIHV...............LASHPTPPTFDGEEDRNGRRNHDEIRFWADYV
SYNJ2_MOUSE/535-855................................................................................
C5BJD9_TERTT/346-705FYSAAEWEAFRLSSKTHMDVPVTIGGKTIH....................ILGSHPTPPTFDAEEDRNGKRNADEIRLWA
C6WGJ0_ACTMD/106-312VSV..........................................................................HPM
Q6LKH0_PHOPR/93-303LYTAHPP..................................................................SPRNAQL
A0Y3X6_9GAMM/104-311QGHFIH.....................................................................PAPPS
Q7M558_DANRE/2777-2983IY..............................................................................
D2B8I2_STRRD/121-420................................................................................
C7NG46_KYTSD/144-354LGVH........................................................................YAPP
B5GR87_STRC2/14-301YPGDPDCFRELTFTA...................................................AHHSYASPPARALE
C5C297_BEUC1/17-258EPRVALAAVLD...........................................................VAGGPVSIAT
Q1I8E8_PSEE4/192-431................................................................................
D0LH64_HALO1/68-276LELR........................................................................LIDV
B7QXZ5_9RHOB/33-347PFPSAEAQGAQRLSSKGHWVVPIQL...............................RDDVTLTLMAFQATTPLFDGEEDR
C0W4G5_9ACTO/4-304EYEYYTPFLYRGYGGSTRYLP.......................................SGRWGWGPMPSPVLDEDDLK
O29675_ARCFU/5-248NTYVPQ.....................................................................GFKID
G1UB84_HAEDU/4-259ILTVLNGYF...............................................................PQGENRQH
D4BMH5_BIFBR/190-433PPASTSTNGTTIRIAANPSTT.......................................TQAHPDRTITFCSAHPKSPM
Q8PBH9_XANCP/68-425RPFYNDAVWAQLRLSSKSHWDVPVRTPLGVVH.................ALVSHPTPPVFDGAEKRNAARNHDELQLWRA
CCR4_CANAL/459-769NRFMNKDNIALISYLQHKESGEK...................................IAVVNTHLHWDPAFNDVKALQV
F2G584_ALTMD/107-313LYFLH......................................................................PKPPS
E7KT29_YEASL/115-504GLVLALKFSEKVLSNLGKKSSKKCG...............................ILIGTTHLFWHPFGTYERTRQCYI
DNSL3_RAT/29-279FQAPFTAAK..............................................................DFVIVPLHT
D1NTE5_9BIFI/129-340FVSVT......................................................................TEPMT
Q95041_RHOPR/31-304................................................................................
B9NTP9_9RHOB/22-326FPSAIAQAAQRLSSTAHWVIPIEA.................................PGGPVNLMTFHASPPVFDGPEDR
Q5QWX6_IDILO/38-393EQPTDEQWYSDEIMAQYPLSSKSHWDVPVQVGD..............KVIHLLAAHPVPPAFDGPENSNGMRNYDEIRLL
APEX1_RAT/64-308VTAYV......................................................................PNAGR
D2S515_GEOOG/4-252WWWFPDEPRAAV.........................................................AARLGSLTVVA
Q24690_DROTE/6-206................................................................................
Q9ZCP7_RICPR/4-250YSNIISLY................................................................APNGSFVG
O62658_CANLF/11-230IL..............................................................................
O17590_CAEEL/100-403................................................................................
PHLC_LISIV/48-325KNGKPYHIIGTH.........................................................TPADDSLISKD
O64428_CHLVU/12-249TVA............................................................................S
Q9RXF9_DEIRA/38-271VSVYLP.....................................................................SGSSG
EX3_ECOLI/4-259NVTVINGYF...............................................................PQGESRDH
O26314_METTH/7-248YNIYFP.....................................................................NGKMS
B4WAV6_9CAUL/100-305GVHL.........................................................................TRP
D0LI27_HALO1/46-296PGVDIELDLGRGADGTPRRL.........................................RLLALHLKSGCFDDSLRKR
A7A3N5_BIFAD/144-355TFVSA.......................................................................HPKS
O01419_BOMMO/9-206................................................................................
O18005_CAEEL/310-619SKERFSTRPTVLQIVVLKDSRT.....................................GKLLVCGNTHLHHNPIDEHVK
B5GU93_STRC2/121-326VHP...........................................................................LP
Q9S1Z5_STRCO/42-270KKVE.........................................................................FYN
B1MNW1_MYCA9/96-305LVAAH.......................................................................TRPP
Q2C775_9GAMM/365-634IHPSSSANYNSWDAA...................................................VTQAFNNELWTNIQ
Q6UE72_TETTH/99-328................................................................................
O83162_TREPA/8-255SAYFP......................................................................NAQEG
D2PNL1_KRIFD/62-287VLACS.......................................................................THID
A1R797_ARTAT/136-351ATLNL......................................................................TNVHA
D0NNT3_PHYIT/6-323LKTV.........................................................................DGA
A5LH53_9CAUD/25-260................................................................................
D4DUX1_NEIEG/102-289P...............................................................................
O76745_CIMLE/32-291................................................................................
Q094F5_STIAD/52-257WIARVDVQLNNH........................................................RWLRAASLHMPP
B6QFL9_TALMQ/445-668SPDLTAAILQLPDR.....................................................AVLVVSVYVEGNN
Q1YK76_AURMS/120-327FIGIH.......................................................................PRPP
D0L3V4_GORB4/96-309YVL...........................................................................HP
A3SLI1_ROSNI/16-332PAAVLRDLRLASVAQWRVEVTAPQG...............................RITLFAFHAGPPVFDGPEDRNGRR
CSS1_SCHPO/12-289ATASLQHPSGRIIS....................................................LFNTHLHAPYGKGA
D1BKV9_SANKS/134-342HPT...........................................................................SL
B5ZY66_RHILW/98-299NFL..........................................................................AAH
PHLC_STAA8/46-322KNGKNVHVIGTH.........................................................TQSEDSRCGAG
INP54_YEAST/11-313................................................................................
RTJK_DROFU/9-214L...............................................................................
D0Z4R5_PHODD/38-450DPKNAIPAGMSCGDNWYTPEEWDQVLLSSKNHVDAPVI....VQTPNGEETIHILMSHPTPPVFDTVTQNNKMKNRDEIQ
ARP_ARATH/279-527INTYVP.....................................................................NSGDG
IP5PF_ARATH/543-875................................................................................
B1C336_9FIRM/825-1040KTIAI.......................................................................YSTH
Q26816_9TRYP/95-297................................................................................
A6BZ11_9PLAN/4-223VCIPWNAA.................................................................HVSSGRK
A4FQX0_SACEN/43-251FSQF........................................................................AACT
P72938_SYNY3/1331-1646TVAQTFRDLVTGETFTAVVNHFKS................................KGASGLTAGDAGNPDSDQNDGQGF
A1K8S1_AZOSB/38-302IFDRRAVGFQGMAAVAVPPRVKVGGEYLIQDR.................FWWRLPYMASFCAGSFEFILIAAHIRWGNGD
B0X3H8_CULQU/1636-1848DVCAATVDVM............................................................GTEVLLFSVY
C8N9G3_9GAMM/89-278PP..............................................................................
Q9A7Y4_CAUCR/110-315GPYLSAAWATLAD.......................................................AKGPFTVIGVHY
Q01375_NEUCS/7-217................................................................................
A9DTY1_9RHOB/15-313FAGAKAHATQRLSSNSHWSLPIEL.................................PDGSITLLTYHATPPVFDGPEDR
YE8A_SCHPO/794-1114................................................................................
Q2UFE1_ASPOR/75-351DRRCHVQRVFRVPYSTSRMQRDGLFVDL........................DCQEGGETGGTLRLCNTHLESLLSNPPI
Q09BG4_STIAD/252-512VTRGNTSLEMF..........................................................AIILHMKAQTG
Q44070_AERHY/480-826IRQGMRDSLLQRFTSPKGDVPLTLV...............................VNHLKSKGSACYEDYPDYVTADPL
I9U9G4_HELPX/4-242VNVYT......................................................................PNSQQ
A5VCJ2_SPHWW/55-332LHMPGVPVPIELYD.....................................................THMNSQGASRAPK
Q9RWN4_DEIRA/100-318EAGPVTFPHSPHALLWMRVRWDGQVL.............................NIYNVHLTTNGLLPSRSDTRLGRTL
Q55DR4_DICDI/251-565NFKKKQQQQF............................................................EISKKINIFT
INP53_YEAST/571-849................................................................................
C9P6A0_VIBME/38-446GSQKIPQGMVCGDAWYSDAEWQQVRLSSKNHVDAPIV.......IPTADGEQVIHLLMSHPTPPVFDPGKNQQQNAAEVQ
B4R9Q2_PHEZH/109-311AVIG.........................................................................VHY
O51484_BORBU/4-243NGYFP......................................................................NSQVL
IP5P9_ARATH/63-371................................................................................
D2R9U6_GARV4/132-368KVLVKFASAHPKSPMR................................................GCAAWSNGIRALATID
P91740_HYDVU/57-349EPQSQAIEPISEKLTRLLHDATGKSFRR.........................PMKMVTRKRFVYSWKKFYVATTKISNK
NOCT_MOUSE/144-412CKESGRQFCI.............................................................AVTHLKART
A5ZI49_9BACE/408-663CWLRYAYRPEYTCY.....................................................YANYGMDTHRWAA

PF14529

D7EM17_TRICA/220-332......PILEEDLQTLFDGNT.....PTIA--------------------------------------------------
D8Q682_SCHCM/470-595...PATQQASHLLQSITLPTDH....PVIV--------------------------------------------------
A7ENE7_SCLS1/419-538.....AKEKGFTIERCLYDISIT..QETIL--------------------------------------------------
A7EV44_SCLS1/169-288.....AKEKGHTIERCLYNTPLT..HHTIL--------------------------------------------------
B7Q7X7_IXOSC/39-155....QSREVTALLESTTQLAKKG...QLVI--------------------------------------------------
E9HS52_DAPPU/293-409......SCRRGNIEAILNAPRN....TTII--------------------------------------------------
E9H8A1_DAPPU/103-219......QCNDQEINLLFNTPRN....KAII--------------------------------------------------
E9HMD6_DAPPU/94-210......ANTKQDITDILNTTTN....SYVI--------------------------------------------------
E9H5U8_DAPPU/53-167.......CETEEIEAMLDRSN.....PYLL--------------------------------------------------
B7PJV5_IXOSC/324-438.....GANNADWINRLVEPKR.....HTIL--------------------------------------------------
E6ZRW9_SPORE/1185-1312....PRQQYESHLLELSQRVGHPIPSRILV--------------------------------------------------
E9H822_DAPPU/420-535......LNLSSTLLPLLDQAP.....PTLV--------------------------------------------------
E9HYG6_DAPPU/19-132......PDFSAAVTLIFEAVSSP...FVII--------------------------------------------------
E9HDY2_DAPPU/149-262......YNFSTTITPILEAIAAP...FTII--------------------------------------------------
E9HRI7_DAPPU/460-571......VDSSAEFRSVFHSLLSP...LTVI--------------------------------------------------
E9HZZ2_DAPPU/118-231......VNFSDSLNELFTELASP...CSIF--------------------------------------------------
E9HRK8_DAPPU/106-221......PIIPSSFNSLLSELCANT.RHSVF--------------------------------------------------
E9HSQ7_DAPPU/121-236......RNQEKLIKMVINRLGRQL.PNSIL--------------------------------------------------
E9HE10_DAPPU/492-604........SLDYFLNLIKTGPDL..ERSVI--------------------------------------------------
E2C5Q1_HARSA/10-124......NIKKDQFEKILLKLGS....RFII--------------------------------------------------
B0W1L0_CULQU/467-584.RDGSAAKLKSDIQKLTRRSA.....KYII--------------------------------------------------
D7GXY3_TRICA/106-218.......CLSNELMQYAASLP.....KAII--------------------------------------------------
D2A4F4_TRICA/101-212.......TVNAQLLDYTSTFT.....HAVI--------------------------------------------------
E2AVN7_CAMFO/107-222....SPSFTWENLFDSIPSPG.....HIVI--------------------------------------------------
B6QWM9_TALMQ/555-687ALRDTCNHLREAITKVRRSTGTV..VEITI--------------------------------------------------
A2QSQ0_ASPNC/504-636ALDDTCKYLINAITKVRRDTGAV..VEILI--------------------------------------------------
Q2HHJ7_CHAGB/475-603ALRETCDNLHKTIMGARRDAGTT..VDVVI--------------------------------------------------
Q2H3B9_CHAGB/415-543ALKDTCENLRRVVAKAKRGVGTT..VDIVV--------------------------------------------------
Q2GZF1_CHAGB/632-760ALEDAMREIDRLIRRFRNGTGTR..TDIIL--------------------------------------------------
E9FE00_METRA/199-327PLVSTLATLHDVIQRFRDRRGRR..TDVVL--------------------------------------------------
B6QNK9_TALMQ/286-414ALISTTRLLHDLVVDIRGRDGIR..TDVLI--------------------------------------------------
B6H8V5_PENRW/395-529SALPALTAIQSSIAAATQNEHRS..TSIIV--------------------------------------------------
Q2U1R5_ASPOR/105-240SIQAMLEEIETCIQQAIETTDKP..TTIIM--------------------------------------------------
A2QZW2_ASPNC/91-226SAQEILEEIQKIIQEHTEQNSRT..TKLIL--------------------------------------------------
Q2TX40_ASPOR/104-239SAQQILEEIQTSIRQHAEGNNRV..TKLIL--------------------------------------------------
B8MUV7_TALSN/118-253STKSALKEIENTIEQHTRESNKS..TRLIL--------------------------------------------------
A6R6U1_AJECN/368-494.ADNPIHQTLNEISRTIRLSPAT...MLII--------------------------------------------------
A7S3V7_NEMVE/68-188..SDAIDNLNESIRRVFNKVKNF..PNIII--------------------------------------------------
A7S2X0_NEMVE/168-291..PESIYYLDSTLNKITSSPCLP...NVLV--------------------------------------------------
C3YN84_BRAFL/1345-1466.HSEQLDELEKSIKHIRNLTKNNPGSTIIL--------------------------------------------------
D6WYM2_TRICA/271-393NNQENDKNLFNTIQSTFNQYP.....NLII--------------------------------------------------
A7S0T7_NEMVE/341-458.PYVWLEKFNNYLDYACDSFD.....TMLI--------------------------------------------------
E3N7S5_CAERE/136-251..NIQTHNLVDQLNTLMACPKM....SYVL--------------------------------------------------
E3MXD9_CAERE/375-485..RSQNAALIAHLDQFLPLN......CCLL--------------------------------------------------
E3MA06_CAERE/30-140..SAQSLALIDHLDEYLPLK......SCIL--------------------------------------------------
E3LJB4_CAERE/350-458...SDIGPIIEALEFLLSTHK.....QTII--------------------------------------------------
E3N681_CAERE/36-144...DDMSLLIEALKYLLSSHT.....NVFL--------------------------------------------------
E3ND32_CAERE/223-331...SKLDGMISCLEFLLSTRK.....NCVI--------------------------------------------------
E3MKX6_CAERE/106-217....SHRNSLSLLNKISDLTDHP..GQVIV--------------------------------------------------
C5KXY0_PERM5/413-539RSKQELEDFADSLSSVISEVSQR..DLLIV--------------------------------------------------
A6RES2_AJECN/586-706.......DTLSTMAEAIRALNSP..EDIIV--------------------------------------------------
B6QF01_TALMQ/823-943.......PTFNLLDRELGRLGRSPTVEHLI--------------------------------------------------
B8MCU2_TALSN/715-835...SNEESVISALQTAMAPRA.....QHIV--------------------------------------------------
A6QSA7_AJECN/584-704....TGNSTIPLLRRTITEANSE...KQIV--------------------------------------------------
Q0TWS8_PHANO/49-171..........ADIDELIEACRDKT.YAHII--------------------------------------------------
B7PHI8_IXOSC/55-177.....GKTTTCEFFWMKTLRDAYLTDHTVF--------------------------------------------------
C5LYL7_PERM5/137-253......GPNPPQLQLELPAA......NCIV--------------------------------------------------
E0VEI2_PEDHC/13-127........FEDLLRAIARELDRFGNSRPIL--------------------------------------------------
E9GSG1_DAPPU/115-230.......NDVQVFENILRDLPPD..STPFL--------------------------------------------------
B7QBV7_IXOSC/96-214....DIDPTLTTLRELVSEYSPI...PVLI--------------------------------------------------
B7QN21_IXOSC/94-212....DLNTTLTTLTDICTKFHPT...PILI--------------------------------------------------
B7PD65_IXOSC/108-226....NINSELTTLTDICTKFHRT...PILF--------------------------------------------------
B7PS20_IXOSC/108-226....DIEIILDQLEEIVTTYDPL...PTVI--------------------------------------------------
B7PXF9_IXOSC/95-213....DLNDTLVELDGVIRQCQNK...SVIL--------------------------------------------------
C5K8V2_PERM5/55-185..MPRRELALSELDQVLSTWPVS..VPLYI--------------------------------------------------
B4HD52_DROPE/236-352....GRRVALRALITDCEAKDT....GLIV--------------------------------------------------
E2AWP2_CAMFO/83-203..AQAFELMLNEIRLLVTQEKNN....TII--------------------------------------------------
E2B1G0_CAMFO/3-123..MQVFDQMLDEIRFVVTQEKNN....IVI--------------------------------------------------
E2B0F5_CAMFO/1-121..LKEFQDMLNEISLIILKEKSN....IIL--------------------------------------------------
E2BFV3_HARSA/10-133..IDEYDVALGELADCVRSCSGS...PIVV--------------------------------------------------
E2AA34_CAMFO/86-207..QAEFRAYLDRVATAIRRQLPG...PVLV--------------------------------------------------

PF03372

APEA_DICDI/108-351LQRLDYRIKEWDVDFQAYLEKLNATKPIIW..................................................
C0W5Q6_9ACTO/5-307THLATRSDVAARQLAAAWAALAARPGAHLL..................................................
Q9ZBN3_STRCO/24-259DPAVRRAQVADTRRIMARERAELPGAHQFL..................................................
A7T3Q8_NEMVE/115-319YRVPDSTAEMDAKLEGLIEKMYITNKEALL..................................................
B3SRB8_ASCTA/220-428TSSAAIKTQFYVQLNQAVSEGRKTYGSVIV..................................................
B8MHG3_TALSN/453-675...........................TIL..................................................
Q1QVQ0_CHRSD/109-317PGESDESLWRDAELLLVGQTIRDSGLPTLV..................................................
A0M2U8_GRAFK/107-314PTESDTSTNRDAELLMLGRDVDVEKDSILV..................................................
A6CGC2_9PLAN/130-329IYSKVLKSRKAALEELADQASQLNQQPVLV..................................................
INP5K_MOUSE/37-330...........................SIINCHLPPHMYNNDQRLEHFDRI.............................
RRP1_DROME/430-670KLVNLEPRMRWEKLFQAYVKKLDALKPVVI..................................................
C7QE92_CATAD/155-383SHSGFGVARDEALEQLVSDVQAEKSPNLVV..................................................
C0W5C1_9ACTO/126-340APLPSTMELWRQSVEKVVERCQSPQAGLVV..................................................
A9DSA8_9FLAO/61-246..ISANVRFFRKPVPNYIASNIKTEQKTVI..................................................
A3ITE0_9CYAN/5-368ADYITPGEGSYIYDDLGNFGGLKVGEKFVI..................................................
C7ZMD9_NECH7/94-389...................FRQLAALSALLKSELVQG...........................................
I5P2_CAEEL/8-272...........................VFVDSHFIHGPENYGKRVEQY................................
C1A7M1_GEMAT/266-540...........................LVV..................................................
Q9RZQ3_DEIRA/490-782WNQLRVRQAQALLGFVDTVKQKSGDQDVLL..................................................
O27012_METTH/6-222YNYIGPADSDFSEFLDLLYNYIEEGEDLII..................................................
Q08525_CHICK/66-271YYRPPDQGEAVDEAFLLQMWEASCSQALVL..................................................
Q0CY83_ASPTN/48-313PVQLRRAADFMHGTADGGEVSLPTPHGAIL..................................................
C2Q910_BACCE/40-333RLDPSVEAIRNAQALEILQGPANTPLPVII..................................................
O15921_TRYCR/109-396RIRQHLCTLGRSCNHDKEEGDAPSLAGFIW..................................................
A3ZS40_9PLAN/129-366...........................VIL..................................................
Q11NA1_CHESB/104-316SPRMWRERSAYLRDLAQALRSEPHDTPVVV..................................................
Q0URF7_PHANO/122-382SLVADPPVRPLQLAAASKILKETGVASALI..................................................
Q0FLB9_PELBH/11-291RNGRRNADEAALWRRYLDGAFGVPPDLPVL..................................................
Q9ZVF0_ARATH/390-645SNFAEERKILWNDLRDHMDSPIIRDKPWII..................................................
Q9RS34_DEIRA/101-311.........................GPVLL..................................................
C4FH07_9BIFI/165-380FSPRPSNQGLWSKGLSAIGQLQGSKGKYVL..................................................
B7S366_9GAMM/60-266VNFTFGLEDLQEQLRPLVELLITHRGPAIL..................................................
M6BNC3_LEPBO/89-364LGVVSRVNQFNEIRDFIDSKKIPKNEMVLI..................................................
YAFD_ECOLI/47-252VNFSLGVDVYSKQLLPIGDQIAHHSGPVIM..................................................
Q9F2J2_STRCO/121-324PLADRVDLWREELAALRDAAAGDRGTPTVL..................................................
Q7USG9_RHOBA/118-325PIRDNDATARDAELVIWGKELAEDDRPIVI..................................................
A3SVB7_SULSN/110-316PVPYHDTKGRDGEIALVGIEASKDDLPAIV..................................................
A5FED8_FLAJ1/31-384RDYISDNSASYIYDDKGVKGGLSPDSRFVI..................................................
DNAS1_BOVIN/26-274APSDAVAEINSLYDVYLDVQQKWHLNDVML..................................................
Q54E13_DICDI/8-231KNSYATSLQTLLHNHSTNPIPNQSQHVSII..................................................
D3R3H2_BIFAB/133-356IGLGALAKSANKDRDRNADDSCNNREIAVL..................................................
Q0PC57_CAMJE/24-257...........................IVLPPPTTVSRPIIGIRNGNDAFFNIHALA...................NGGT
Q1MZ88_9GAMM/34-259VMHLALSRRTQQRQLAFVQTLIETYPQVVL..................................................
Q9VXE7_DROME/36-332...........................AFVVAHLTAHDHMMDERIEDYKQI.............................
DNSL2_HUMAN/25-288APHQAVAEIDALYDVYLDVIDKWGTDDMLF..................................................
Q9U4W1_AEDAE/10-212...YLPNGNIPDLKLRLFNALQSLSSPILV..................................................
O15922_LEIMA/133-437HRLDTWATENAAVPSAAAMGSGSSPHGFIW..................................................
Q2PWA8_MONPI/4-202...........................TII..................................................
V9FYL2_PHYPR/6-366NNAESDDMVAIGDKRRADGNPKNVCLGAIF..................................................
Q9SN65_ARATH/347-583.YGHPCQSERHSLWTHFENLSKTRNDPWIL..................................................
Q985E5_RHILO/120-323HLSWPWPKEQYWQIGELAQTLAGLGQTAIM..................................................
SMASE_MYCTU/228-473...........................VIV..................................................
CDTB_ECOLX/26-261...........................FVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMR..............NNDAPAL
Q9PTX0_XENLA/23-272SPDYAIMEVDALYDAWVDAKQRLKMENILI..................................................
C4RQR9_9ACTN/168-411AFMQAQQDRRQAHYRALRADLASNPHGQLV..................................................
Q9YI04_XENLA/21-271TPEAAVREIDELYDVYLDVKQKWNSENFIF..................................................
Q3JBC2_NITOC/104-311PTEADTSVNRDAELLIVGREVKNSEQPVIV..................................................
O34095_LEPIR/84-361LGQNARKHQFVEIKNFINLKQVPKNETIFL..................................................
Q315C8_DESAG/101-322GMLEAQTGAREEASMLARAMVDRAVLPVIV..................................................
O77366_PLAF7/563-897LQSYTILHILQTLKKKYQLTYPEKEVYIIL..................................................
A6GK21_9DELT/6-259.......ATIAKVYSLERALTKQGNPRLIA..................................................
D5UUF8_TSUPD/40-343RCNDASGRPGVIDRFLADAEAERARGRMVL..................................................
B1LXH2_METRJ/33-216.ANVHLSHGQMLNRRQLRCIVSELPPRAAV..................................................
O46184_DROSU/14-220SYMAHEESDPPSDLVRKIVSDSERSDTSLL..................................................
A6VUZ0_MARMS/30-246MINFVSFEKFRAHLDQAFQALEHHSGPILL..................................................
Q8I3R5_PLAF7/2121-2476IWQTQILVKVIEYLKINFIKKYETIPSLII..................................................
O22148_ARATH/4-222.YGEPVQAERGELWERLTRLGLSRSGPWML..................................................
P96273_MYCTU/27-281HYTYKLDWLAALRDTAEGWLRDDPAAPIAL..................................................
APEX2_HUMAN/5-304PERLVFKMRFYRLLQIRAEALLAAGSHVII..................................................
Q9RKB3_STRCO/12-265DEKVRFMGEFLAYLKELRERAAAQGREVVV..................................................
Q63291_RAT/38-257NIYAPNTRAPTYVKETLLKLKTHIAPHTII..................................................
INP5E_RAT/307-587...........................LFITSHFTSGDGKVAERLLDYNRTIQALA....................LPRN
A5V5B1_SPHWW/53-337ERADAAFRQQVAALDRFLAANHVPGMPMIV..................................................
Q281W3_PHACH/39-344.......................QGGPVIV..................................................
B2B0A0_PODAN/123-383LESLVARPPKRPAQLATAARFLHQAHVGIL..................................................
DNAS1_CHICK/24-272EPSSAPAEINALTDVYTDVINKWETNNIFF..................................................
C5C387_BEUC1/53-411DYVTPGRASRYIVDDDGERGGLSRNASFVV..................................................
SHIP1_RAT/411-703...........................GFVNSHLTSGSEKKLRRNQNYMNILR...........................
EXOA_BACSU/4-243GLERIDYRMQWEEALLSYILELDQKKPVIL..................................................
IP5PC_ARATH/581-914...........................CFINCHLAAHLEAVNRRNADFDHIYKTMSFTRSSNAHNAPAAGVSTGSHTTKS
H2PHM7_PONAB/192-531LSEVKNIIDKASRNLKSSVLGEFGTIPLVL..................................................
INP52_YEAST/596-874...........................CFVNTHLSAGASNIDERRNDYNN..............................
IP5PD_ARATH/576-908...........................CFVNCHLAAHLEAVNRRNADFNHIFRLMVFSRGQNLSNAAAAGVSTSAYTTKS
RTJK_DROME/9-214.AAVYLPPAERWIVDDFKSMFAALGNKFIA..................................................
B9J7A5_AGRRK/98-299LSKPYFDEFHADELSILGPILKGIQGPLIL..................................................
O86610_STRCO/4-250HPHYAYKLQWFEALRAAVEGDAAGGRPFAV..................................................
A3VZN2_9RHOB/19-338NGRRNHDEIRFWQLYFDGVFGPPPQGRFVL..................................................
H2R3J5_PANTR/15-385SVYSGIRHKALGYVLDRIIDQRFEKVSYFV..................................................
EXOA_STRR6/4-266GLKRLEERQVWDAKYAEYLAELDKEKPVLA..................................................
PI5PA_HUMAN/428-721...........................CFLNCHLPAHMDKAEQRKDNFQTI.............................
D1AXA7_STRM9/113-329PPLLGLMSNWNRDLNVISSNIVESNPKAII..................................................
Q1GKT6_RUEST/32-332NGRRNADEILIWTYLLDGTLDAQIPDPFVL..................................................
Q2H5K7_CHAGB/308-508...........................VVL..................................................
A1SIW4_NOCSJ/70-299PLTRPQQYGAGMDILLQLRNSLAAHGPVLI..................................................
Q9ZDR5_RICPR/4-252NFKFKHKLEYVRLMREWFTANRTKNDKIII..................................................
D7WDI6_9CORY/121-321PLPSIMDQWRGDLHSIAGWVDVNVDEKAII..................................................
Q07995_CHITU/11-220LPRGSKGGEIDLHLRDDINKITNLRGNYYI..................................................
Q9S2L9_STRCO/24-240SHLSLDADERHEQAGLLLDHLAALGVKHAV..................................................
NSMA_CAEEL/42-318DLYLPHRTAQAFELAQFVRHTARGADVVIV..................................................
O93520_ORYLA/9-231LNVYVPPGSDWSFYRHIFEIISTKSQGTLI..................................................
Q5LX09_RUEPO/24-347NGLRNRDETRFWQLLLDGVVGAMPDLPFVL..................................................
NSMA_DROME/9-264DEYKTHRVIQAFDTAQFIEATRGNSALQIL..................................................
Q9SIQ5_ARATH/113-377.YGHPTQSERHQLWQTLEHISDNRNAEWLL..................................................
Q83GA3_TROWT/91-308LDRLAQDEYEGMIKDLSVYLSQENSEKLIV..................................................
Q2C5E7_9GAMM/445-703GEKLVWDNTKTDDECIEAERSSRIDDLQLVMNILDSQ...........................................
A1RCE7_ARTAT/41-258TNAMRDAAVRAEAQALQRLQADEPSTPLFL..................................................
D2B0I5_STRRD/117-322PYPPLEEHVREWTEALEAFPPAVPDRIRIL..................................................
Q15NA1_PSEA6/104-315EEATERDRELLGLAKEIANTDSENALPVIV..................................................
Q9P8H7_CANAX/14-261SGNMDAQMTLLKAFIKYIANLKKHTNHNII..................................................
Q9VTW2_DROME/396-695...........................LFVTSHLTAHQQKVKERVSDVKRIINAL.......................DL
A6W517_KINRD/120-329AAPVPDLLEPWAVEVRAVADWCAATPGAIV..................................................
A5C0G0_VITVI/310-530.YGFPDRSQRHLSWNLLRSLYSASSLPWCC..................................................
A7T4C3_NEMVE/164-372YRPPSYCKEDDIALENNVESAYLLNFETII..................................................
CCR4_SCHPO/339-664FRNMPSKIPSDQLKDERPTYPEYLKIPILI..................................................
D2B2Z6_STRRD/114-320PRFDYKAACWAQGLRALPRAGTGAEPYRIL..................................................
SYJ1_SCHPO/563-839...........................CFITSHLAAGYTNYDERDHDYRT..............................
Q1D7J7_MYXXD/85-296ATPIVGLGGRLDQAETIIDAMEGTGPVQVI..................................................
C0X2X7_ENTFL/9-266SWWETPCTGFAYEWLQLEKYLATGQQPLVI..................................................
Q2UNN7_ASPOR/69-326SMALDPPYRPPQMQLVAQYMHHDGVHAALV..................................................
TYDP2_CAEEL/123-353EHRPQRCAQFGFCMDKVREIIAQNPGALVF..................................................
C2L0P4_9FIRM/115-330APPLIGLMGMWQRDLNLIEEIANHNKDSII..................................................
Q9SA95_ARATH/176-431PKWDQMFSRERVEQAKEAIEILRPNANVIF..................................................
Q50321_MYCPL/166-460DSPGGSKGEGTTSGVGNQELAEARQLANVLDHFDEID...........................................
B0WQS5_CULQU/1836-2048ISPGTTTKQKLWFLSRHLGPIAELDTPMVV..................................................
A0JXK8_ARTS2/115-328LPPVDVRVDQWRSDLAALARLSVRPGNRLL..................................................
Q24335_DROME/7-215LAAVYCPPRFTVLEAQFLDFFQALGPHFIA..................................................
O83555_TREPA/304-613SKRKRIQQAAQVAAFVAALRRERADLPVVV..................................................
E8RN27_ASTEC/87-283WPFSAPGNQPRQLERLRADLRDERPERTVL..................................................
D0KX69_HALNC/290-639ADYIDPAKSGYIVDDKGGKGGLSANARFVI..................................................
Q5L902_BACFN/414-668EDSILALPDIRNIYTKDIAPNLETDMPVIV..................................................
Q1CXT2_MYXXD/230-492GPDEYARRLSASGWIKDYVDLRLPTQRAMV..................................................
EEPD1_XENLA/257-520...HQNDTYKSAVFGQALQETLKNERDVII..................................................
A4A5W6_9GAMM/35-389VDYIEGGEQADYIYDDRDQPGGLKDERFVI..................................................
D9QM28_BRESC/100-303PWPYQYQWGQIIQARGLANWRKAYSGPMIF..................................................
O05382_AGGAC/4-259PTKFPAKQKFYADLQRYLEQDHNAQNPVII..................................................
YNTB_SCHPO/124-492GSYERLRQGAILVKEVNKMAQSHPSWPVFI..................................................
NGL1_YEAST/30-353CMIIMRELSKIIKQLLPGDVKGQERVKILF..................................................
NGL3_YEAST/112-485FERLRQSYLVLQKIQEIKACSKYNGWHSLL..................................................
APN2_YEAST/20-354EEGEMFRLRFLKVLLRRVRNLDKIGKKIVL..................................................
SYNJ1_RAT/538-859...........................CFVCSHFAAGQSQVKERNEDFVE..............................
A7T299_NEMVE/40-247PTGTDYYRKLEEELHAVCMWASMECNTLVL..................................................
O68855_9STAP/43-321YDREIRAEQMREISTFVKNKNIPKDEVVYI..................................................
O13348_MAGGR/17-223...........................TVL..................................................
Q9Y026_TRYCR/56-263ASAYMRPPPQVTQSFRRLVNCLPASSPLLL..................................................
D2AT04_STRRD/93-301PCAPSDESGLPCWADGLAALPRPGGAVQVL..................................................
Q9Y1H3_DICDI/7-211APATISERNTFIINSKSLFKKYNSINHQII..................................................
C5BVQ8_BEUC1/110-317TAPLRARMHQWSADLGAVTDACRATPGVIV..................................................
P74492_SYNY3/14-266EKYLYKLRWLNLLQTYLEQLRRSDTPEFLV..................................................
A4EK32_9RHOB/102-307PVPGNDTETRDRQIKNAALMTSSMDRPTIC..................................................
C7PRF4_CHIPD/618-892KIESWNRRRNGALELKDSLDVQYPTANLVI..................................................
TYDP2_HUMAN/117-351TRGHAAERMNQLKMVLKKMQEAPESATVIF..................................................
A3TK42_9MICO/109-315TAKLVRGWHRQLGQAADWVSEQPEQTPLVL..................................................
DNAS1_HUMAN/26-274APGDAVAEIDALYDVYLDVQEKWGLEDVML..................................................
Q9NAL5_CAEEL/311-526VVVYRPPINGKISQLIAHLSSFLPSSEYVL..................................................
A7C3D0_9GAMM/108-325........LLTDIIKAVIDSDRQGQPIDMI..................................................
NSMA_HUMAN/12-272DIYLAHRVAQAWELAQFIHHTSKKADVVLL..................................................
O65598_ARATH/3-223ANEDDKRKELWREITALVASPVTFNRPWIL..................................................
C5NNP0_ORYSI/360-581VYGPAQDEFKSSFLAELVRACQQNPHPKLI..................................................
Q9ZQF8_ARATH/4-230.YGDPVVQYRELVWKRLTRIGIVRSEPWFM..................................................
Q17003_ANOGA/83-316LSSEISTLRSLHDCISSFTLRLKPSDLLFV..................................................
LIN1_NYCCO/10-229NIYAPNHNAPQFIRETLTDMSNLISSTSIV..................................................
O97240_PLAF7/281-607.......LFDEQLQKFVTILRNEKQKPLVW..................................................
A1U6L7_MARHV/41-269LMHLSLSKSAQQKQLGFIREQIASYRHVVL..................................................
Q5QUK7_IDILO/105-312PSENEESAERDAELVLVARRVEPEKYPTIV..................................................
A1T8I1_MYCVP/118-329EPPYPLPSWRWALELDRISATLAAEPLPLI..................................................
B1KQZ4_SHEWM/42-455FWNDYVAGADYIYDDAGNKGGLGLDASFVV..................................................
A3XAE4_9RHOB/4-211PTENETSVERDGELLLVAKTLDPQAQSVVL..................................................
A8M5G8_SALAI/105-315APYAIDQIGHWRRDLAAQPSATPDGQLRIL..................................................
Q2SQK9_HAHCH/44-408DYISGCRISRYIVDDEGRRGGLGDRESFVI..................................................
Q1JZE6_DESAC/7-207GGVYKRWVQIRRLHGPDLLNHHQLSLPTIV..................................................
O42110_9SAUR/47-252CYRXPDQEDEVDEAFFSQLGKVSSSQDLIL..................................................
OCRL_HUMAN/245-524...........................CIVNSHLAAHVEDFERRNQDYKDICA..........................R
O44201_BOMMO/8-204...........................VIV..................................................
A4BGZ7_9GAMM/1324-1668DYVDPARSSYIYDDNGNIGGMKGERHHFVI..................................................
C2G3V9_9SPHI/103-310PNENPRSTERDKELLLVADMARKSRLPVIV..................................................
YBHP_ECOLI/13-244LGLREAHRQAQLAMLAEWVNELPDGEPVLV..................................................
G3XDB0_PSEAE/4-246DESLNQKFKFMDDFTHYLSKQRRKRREYIY..................................................
Q04135_DROME/7-214.AAVYCPPRFPISEDQFMEFFNTLGDRFIA..................................................
Q9XAL0_STRCO/104-321RAGFWTDSRDRNAWALGEALAADRSERIAL..................................................
Q9ZAB7_AGGAC/30-274...........................FIVHSDSSVLQSRPAVGIRIGTDVFFTVHALATG...........GSDAVSLI
Q9YGS2_TAKRU/70-277RPPAGPHSEFLSEFSDFLSDLVLRTDKVII..................................................
Q7UV93_RHOBA/76-326...........................FIL..................................................
PHL3_BACCE/40-305SPASVRTNQLKEIQDFIKNKNIPNNEYVLI..................................................
Q868R2_ANOGA/5-211YVSPQTGVPEFRSIMEKIDLIVRGCSRVLL..................................................
Q9X9W4_STRCO/312-604SETQRHAQAKVVNTFVKEILAAQKNADVVA..................................................
A4ESR5_9RHOB/34-347RNRDEIRLWQVFLDGALPGLPSPPDSQFVL..................................................
C6RT65_ACIRA/105-312PTEAKDSTLRDAELLIVGDQIKDMDKSCIV..................................................
APE2_ARATH/4-324ADRIEFKHRFYGVLERRWECLLRQGRRVFV..................................................
APN2_SCHPO/4-295NRLEYRRAFYKALRERIERLIKEGNRKIIL..................................................
A6ENA6_9BACT/100-307PTENETSIERDAELMLTAKTIRNLNKPIVV..................................................
DNAS1_OREMO/30-276SPDLAVRELNALYDVVLDVRARWNTNDIVL..................................................
SYJ2_SCHPO/573-851...........................CFVSSHFAPKVNNISERNMEYTS..............................
Q9SIS9_ARATH/366-584.YGHPIPSERHHLWEKLQRVSAHRSGPWMM..................................................
A3SUZ8_SULSN/8-305NGKRNHDEVLFWDHYLAGSFDPPPTDRFIL..................................................
C3JMR5_RHOER/45-349RVNVNSGRPKAISTFVDDAAKERAKGRSVI..................................................
B8K751_9VIBR/38-447FWHQYIQGKPYFYDDAGNTGGLEQGKHFVI..................................................
CCR4_YEAST/508-818GVLLDHLETLLKEETSHNFRQDIKKFPVLI..................................................
ANGE1_HUMAN/248-656DVKLAQMAILLAEVDKVARLSDGSHCPIIL..................................................
T0PZ96_9STRA/35-481DHDVVRDLQLRYLLPQVEAFNADFQMPIVV..................................................
O46094_DROME/190-469...........................CFVNSHLAAHMGYVEERNQDYNA..............................
Q86GH0_DROAE/65-291YCPPQYKWTSENFGKLLSHIDSLSPQGFII..................................................
Q6MMC5_BDEBA/32-239VLNFVTLKAFTSSLYEIAEKISHFDGPVVL..................................................
A0Y1P5_9GAMM/101-305PRSKRHWQNRNTLLAALKLSTQNEKGAWLV..................................................
Q9TZX4_CAEEL/118-349TADSDLEEICDFYDSVEDVFRECRSKYKLV..................................................
A1SIW4_NOCSJ/519-746GSAAGHRQEALRRQLATMTELAGTGTPAVI..................................................
O96546_LYMDI/17-226AYLSPNREHSKQLVEKDLKALLELGGAVII..................................................
D0LKU2_HALO1/119-323PLGAELAAERDAQLAAAAEWVAGQTRPSVV..................................................
INP51_YEAST/532-813...........................CVLVSHLAAGLENVEQRHNDYKT..............................
Q1QA26_PSYCK/112-319PTEADKSTTRDAELLMVGKHIKDNKQTAIL..................................................
DNSL1_HUMAN/22-265TPKAVEKELNALYDVFLEVSQHWQSKDVIL..................................................
Q9RFY5_HELHT/24-265...........................LVVHQNVVATEASRPAIGIRIGNDVFFDIHA................LASGGG
A0A023EDJ4_AERSA/37-444FWQDYVETASYMVDDAGKAGGLAEGAKFVI..................................................
Q93137_BOMMO/15-220.IASVYLPPDKIVLSSDIEALLGMGSSVIL..................................................
D0LNM2_HALO1/11-267PLAGRRAQIDVILAHAAALEDAHPGAPCVL..................................................
A6WD12_KINRD/15-239AERSGQVARVLPGTPLPGPCGPWFDAPAVL..................................................
A5P939_9SPHN/105-310PLPGWDTGERDRNIVDAGAKTPDNLPNAVT..................................................
C0DYX5_EIKCO/70-259PPISSELAGARQHYLAETARALAAEPRALA..................................................
IP5P8_ARATH/88-411...........................CFVCTHLTSGEKEGDELRRNLDVTEIF........................KR
YTX2_XENLA/6-230APTTGPERARFFESLSAYMETIDSDEALII..................................................
ANGEL_DROME/71-344NTKRSDVRCAQVERILEELQSFSTDTPIVL..................................................
SHIP2_HUMAN/429-718...........................GFVNCHLTSGNEKTARRNQNYLDILR...........................
I5P2_MOUSE/350-629...........................CVVNSHLAAHTEEYERRNQDYRDICS..........................R
D2T850_ERWP6/102-309PTESDESTDRDAELVMVGKSVASAAQPVIV..................................................
A0YXL3_LYNSP/4-376TPGEGDYIYDDNGNSEAPTGGLPADAAFVI..................................................
SYNJ2_MOUSE/535-855...........................CFVCSHLTAGQSQVKERNEDYRE..............................
C5BJD9_TERTT/346-705DYIDPAKGGYLYDDNNSAGVTLNDGDMFII..................................................
C6WGJ0_ACTMD/106-312PPVEPQGPAQWRRDLAALPPRNADGPIRVL..................................................
Q6LKH0_PHOPR/93-303WAERNVLLMTLNNLVEDYLDTDSASPAQLI..................................................
A0Y3X6_9GAMM/104-311PTEEDSSRPRDSELIMVAKAVKNPTRPTIV..................................................
Q7M558_DANRE/2777-2983RPPTYPMSLFKENLGKLLDFLELINSTIVV..................................................
D2B8I2_STRRD/121-420........................DAPVLM..................................................
C7NG46_KYTSD/144-354LPGFMSLWRDDLSRSVAEAEAAAQDGPVVL..................................................
B5GR87_STRC2/14-301AQELTRLADRRDPRDRTARYPNGRPREALL..................................................
C5C297_BEUC1/17-258THLSTFPATATGQLRRVVRLVRGMPGPRLV..................................................
Q1I8E8_PSEE4/192-431...........................SVIADGVGSPSGGRMPRPILGLRIRIPGLREAIT...........VYTFHALS
D0LH64_HALO1/68-276HAEYVPETNTDNLARLAELIGPVGDQPIAV..................................................
B7QXZ5_9RHOB/33-347NGLRNRDEIRLWQVLLDGDLGPMPTPPFVI..................................................
C0W4G5_9ACTO/4-304RVNVESRRPAVGATVAAMMRADTTAGRAPV..................................................
O29675_ARCFU/5-248SEKYQYKLQWLERLYHYLQKTVDFRSF