Sequence alignment for CL0533

PF00156

PYRE_DEIRA/34-188QSTTLLQHPRALMELGGLMS-QKILD.....AGLKPD.....FIVGPAMGGVTLAYEVA----RQL----..........
Q3SMI9_THIDA/14-177SAEQLEA......IVRDMAR-QTVGL....LAGRSRV.....ALVGILRRGAPLAGRLH----AQL----RDN.....WG
PYRE_BIFLO/37-192NAGAFDDGKKIAALGAFYAE-KISQAIVHNTIPRNID.....TVFGPAYKGIPLAVSTA----IAL----TAG......H
A6GZJ5_FLAPJ/2-150SQNNILNHQEIEFKIKRIAY-QIYET....FIDENEI.....VIAGIEGNGSVFANKIA----TEL----KKI......S
PYRE_PROAC/43-197DNRVTLSDPQTRDLIADGLA-SLVRT.....NFHQVD.....VVAGTATAGIAHAALAA----DRL----..........
Q8EVI3_MYCPE/12-166SYEEIKD......VIKKLSF-ELNAYY..KSFENSDV.....VVIPILDSSVIFAGHLL----PLL----DFS.....TI
Q0CVT8_ASPTN/931-1096HILNIAQQPNGLALCASLLQ-SHFRG.....DWNNVD.....MIACCEAGGFVFAPVLA----SRV----..........
Q2YAL8_NITMU/16-212GGSMYFENRA...AAARKLA-EALSE.....YRGKNP.....LVLAIPRGAVPMAKIIA----DEL----..........
Q4XNN5_PLACH/73-239VSTGFLNNAISSNIVSFLIS-NLILS.....KNLSFD.....YLFGASYKGIPIVTLTS----HFL----LNT.....NK
Q1DDD8_MYXXD/86-239SWKEFDR......AVQQLAG-SIQET.......FEPQ.....VVVGVAHGGVFVGGALA----GAL----..........
Q6NF43_CORDI/11-164ETKEILTWEGFGIANRELAQ-QIVDS......NYTPD.....IIVAVARGGLVPAGALS----YSM----..........
KPRS_METS3/132-293FFDIPTTNISAMGAIAEYID-EKIDE.........KP.....LIVAPDKGAYPFAQEIA----EIL----..........
A5V979_SPHWW/2-156PTLTPVDQPEFLTAVHYVAA-RIRES......GWRPD.....VIIGIGRGGLIPAVYLS----HAT----..........
A7E5A9_SCLS1/57-218AVASLLINQASIDVVDELSS-FLSEK....VAPFNPD.....VIIGLPTLGLTLAPIVA----RKL----GL........
C1DM73_AZOVD/5-153SYAELSD......DIRSNLH-RLHDR........RID.....LVVGIPRSGMIPAYMIA----LYL----..........
A8LJR1_DINSH/150-296PVDNLYAAPIFALDVMHNFA-GRLDN..........V.....TVVSPDVGGVARARELA----QRI----..........
UPP_AQUAE/39-188VYEALKDILLEEKEVRTWIG-NKRFN....YLNEEEI.....VFVPILRAGLSFLEGAL----QVV----..........
Q8EUA5_MYCPE/11-161TTEEIQK......GIIEAAK-WVDKT.....YQNKEL.....VLVGLLKGCLPFFGQMI----SHI----T.........
Q0K973_CUPNH/14-164SWDEYHR......LIARLSL-NVHES......GWKFD.....KILCLARGGLRVGDQMS----RIF----..........
A4CGY8_ROBBH/133-287SLGEVYDIPNRVIHAADAIS-KYINE......NIHNP.....VLIGPDSESEQWVSDVA----KKA----..........
A3U7I6_CROAH/14-161GNDAINH......AINGIAV-KLNDE.....LKDKRP.....VFLTVLNGAFLFSAEII----KRF----N.........
A6QAE7_SULNB/5-148GYEQFVE......DVKKLVR-LTAEY........NPD.....TIIAIARGGWTLGHAYA----SAT----..........
Q2RSZ0_RHORT/17-167GWDQIGA......GIDGLEA-DLRRT......GTTPD.....AILGIARGGLVLATALA----NRF----..........
HPRT_MYCPN/9-158DQKQVEA......GCNAALK-WCNEH.....FAGKQV.....IVLGILKGCIPFLGKLI----SQF----T.........
O83317_TREPA/210-372HRTRLENLHASYQIIRELAK-IENLS..........DPDIPFVVVAPDSGAVERNKFYS----SGL----..........
PYRR2_LACPL/1-156MQKEVVDSMAMKRALTRITY-EIIEQ....NKGIKNV.....VLVGVKTRGVYIAQRIA----AQL----QQL......E
Q4DVM9_TRYCC/44-213DVSSITENPPLFRKVIHFLA-QRYRD....MGDAGPT.....HVLCVESRGYLVGSPLA----LEL----..........
PYRE_HYPNA/34-182QKALVFSRPDLSEKLCKALA-ARLAA.....DFGKID.....VVAGPAVGGIIPGYELA----RHL----..........
PURR_STRR6/106-265..SDLLSTPAILKNIGRIIA-KSFMD.......QKID.....AVMTVATKGVPLANAVA----NVL----..........
Q27375_TOXGO/94-256...ILLPGGLVKDRVEKLAY-DIHRT.....YFGEEL.....HIICILKGSRGFFNLLI----DYL----ATIQKYSGRE
XGPT_RHOS4/14-159SWDQIHR......DSRALAW-RLDGQG...PDNGSWR.....AVVGITRGGLVPAMIVS----REL----..........
Q4FP84_PELUB/15-165..DQYTK......IVEKLAI-EIHNN.......YKPT.....VLVGIMRGAAPILDILS----RIL----..........
Q5NI77_FRATT/16-164.........QLEQAVTRLAE-QINQD.....YSGQQV.....TLVCVLKGSFMFFADLV----RKL----R.........

PF15610

M2SQF2_COCSN/2-255VQDVFSLHSIVADDKLRFPF-SLKDYQRYIFGDGRLA-----HRFGTDLAKAYIPTLPG----PID----..........
C6XW67_PEDHD/2-266IPYTYSLHKIH..HSNNFGF-SADDYSRFKFGDDRVA-----KKFGKDLADGFIKGFLE----DNQ----I.........
H1Z8U3_MYROD/1-264MINRYSLHQIN..NSEAFTF-NPADYSVFKFGNIALA-----EQFAKELFQGFIAQYSD----TVL----..........
C7PNW9_CHIPD/2-265.KDVYALHSIV..DDAHFPF-DPAAYSCFKFGDGAVA-----EAFGTALATGFIATYGD----RLS----E.........
Q0UEK8_PHANO/2-265VCDVFSLHKISGGDGVKFPF-PVKDYQRYVFGDDKLA-----HLFGTDLAKAFIARTGA----AED----TSTGSNQELT
E3QYQ0_COLGM/52-331IKDTLVLYYIE..DEAKPGF-NKYDYSRFKYGDTRFA-----SQYGQEMANLAWKQLIK----PIL----DKDRASHRPL
E4ZIV8_LEPMJ/2-262VPEVCSLYQFAGEGNTPYPF-SIQDYQRYVYGDDKRA-----HQFGTDLAKAFIATRTS----NQS----FTH.......
R0KEE4_SETT2/2-259VRDVFALHAIVAGDDMRFPF-SLRDYQRYIFGDDRVA-----HRLGTDLAKAFIPTISS----PPL----..........
G2Z396_FLABF/1-265MNTRFSLHKII..DKDQYPF-DPKAYSWFKFGDKKYA-----QEFAYDLFQAFISNYKE----VLL----K.........
H1YCE2_9SPHI/3-265..ATYSLHHID..NANYFGF-NPDDYSRFKFGDEAVA-----KTYGTSLAEGFIQNCLV----RQS----I.........
B2WKS8_PYRTR/2-256IQNVVSLHNITGGDAVKFPF-SPADYQRYVFGDDRLA-----HRFGRELAKVFIPTICN----SRD----..........
G0JP06_9GAMM/87-357GSDATALAGI..........-....YSRAKYGGVHDI-----RYLARQLIDYLCGELDR----PDS----QWSYLFQNAK

PF11202

Q888S9_PSESM/14-255GSYLSDDVHFLLRSVDMQTT.S..VEEKERLIQTRQK-----HYSEMISEESAPSAAHQ----ALY----ELALSQNGAR
R5XB52_9CLOT/25-275STYKKDDVIFLLKDISDMIV.EEDNMTREKKIQSGT.-----HYSEMIPIEYQVSDEYL----NLY----RTKLKENKEK
Q7CKQ6_YERPE/9-249GSYLPDDIQFLLKPIQIEMT...PVEVKEKLIQSGAR-----HYSDMLSQEPAPTEHHL----TLF----ARALDQGATR
I0DSH9_PROSM/9-249GSYLPDDVHFLLQPVTIEMT...PVELKEQLIQSGAK-----HYSDMLSQEPEPTPWHL----DLF----AKALDSGAAR
STIP_ACIAD/20-273GSYQSEQVTFLLKRTHIEPT.D..TAEKERLIQSGEK-----HYSQMISLENAPTARHL----ELF----EQAMQQGQQR
W0ADD0_9SPHN/11-256GSYDPADVTFLMKPVALAPT.D..VDTKERLIQSGRR-----HYSEMLSAESLPDPIYI----ELY----QAALARNGMR
A1VWP9_POLNA/5-253GSYRPSDVTFLLKCLPQLPFVD..VAHKEKLIQTGVR-----HYSEMLSPEALPSPRYL----EVF----RSACVANQQQ
E4NAQ4_KITSK/21-265SSYPAADVTWLLKDLSDVHL.EAPTEEREEAVQSGGA-----HYAESLPVEYQPSADYQ----RLF----HTALDASTTR
D3VJW4_XENNA/9-249GSYASDDVQFLLKPIQIEMT...PVDVKERLIQSGAR-----HYSDMLSQEPEPTSYHL----ELF----EKALEQGAAR
D0L8D3_GORB4/17-267GSYRADEVTWLLKDLSAHAL.EGDLAERERRVQNGTA-----HYAESLPVEFQPGAEYQ----QLF----HTTLRQTAGR
C8W646_DESAS/34-283GSYSPDDVIFLLKDIGGLIE.EQDNEERERLVQNGC.-----HYSEMLPIEYRPNTEYI----ELF----YQSLKETSVR
X2GQ89_9BACI/11-261GSYSSEDVVFLLRDISNISL.EIDNEQRERLIQSGT.-----HYSEMLPVEYLPSEAYM----TLF----YQTLEDYAER
R5BVZ9_9FIRM/3-247TTYKKEDVELLLKDITGLVK.PQSTQEREQLIQQGR.-----HYCEMLPIEYSPSEAYM----EAY----ETALKVFADS
D5CKQ8_ENTCC/9-249GSYQPGDVEFLLKPVVIEMT...PVDQKEELIQSGKK-----HYSDMLSQEPAPTQWHL----DLF----HRALDRGAER
F8AVP2_FRADG/12-254GSYDPADVTFLLKDLSDIPL.ERPTEDREEDFSKGR.-----HYSEDLPVEYEPSQAYL----ALF----EDALARSAVR
J9STB4_9ACTO/17-267GSYAAEEVTWLLKDLSDVAL.EGELRERERRIQSGQA-----HYAESLPIEYQPGREYQ----ELF----HATLRSSARR
A8MM96_ALKOO/473-722GSYKKEDVIFLLKDVSQFIE.ETDTEDKEEAIQGGT.-----HYSEMLPVEYNPTESYI----RLF----HESLEESAQK
Q9RSA8_DEIRA/11-250HTLPPDDVTVQLRPAQARLV...SVAEKEALIRSGV.-----SYGELLTPEALPTAAQT----RAY----AGALSRNGAR
E3EE68_PAEPS/21-271GSYPASDVTFLLKDLSRVAL.EKGTEDREEAIQSGV.-----HYSEMLPVEYQPTAEYI----GLF----HETLAQSAQK
A8F9P7_BACP2/9-258GSYPEQDVTFLLKDLSSIEM.EKSTEERERSIQSGA.-----HYSEMLPIEYKPTESYM----DLF----YESLKESKEK
R7CDA0_9FIRM/3-247SSYSEEDVILLLKDITGLVE.PQPAKVREKLIQSGK.-----HYSEMLPVEYVPTDQYM----QVY----HNALKHYAKP
Q4FTP9_PSYA2/19-285GSYLASDVTVLLDIVDKDAVADVPVSHKEALIQSGQR-----HYSDMLTLEDAPSAMHE----QLY----IEALEQGKAK
D1BEJ8_SANKS/16-268GSYDSHEVAWLLSDLSGVEL.EAPTEEREEAIQSGGA-----HYAESLPVEYQPTPEYT----ALF----HDALRASSRR
J7INJ2_DESMD/17-266GCYSPKDVIFLLKNLNGLMA.ETDLETREQKIQSGG.-----HYSEMLPIEYEPTKDYL----DLF----HLTLQESARK
R4KIZ1_9FIRM/43-295GSYAARDVVFLLKDIGPYVV.EQGNEAREKAMQSGR.-----HYSEMLPIEYQPTREYI----DLF----HQSLQETGRR
U5NAN4_9BURK/5-254GSYRPQDVEFLLKPITMAMIDD..VADKERLIQSGAR-----HYSEMLSPERLPSTRYL----ELF----RAAHAMNREQ
E6UDF8_RUMA7/3-247GSYKNEDVTILLKDITGKVK.PQSTEEREKLIQGGR.-----HYCEMLPIEYEPSEQYM----KSF----YTALDMYSGI
S5UQG8_STRCU/450-701SSYPPEDVGWLLQDLSDVTL.EAPTEEREEAIQSGGA-----HYAESLPVEYQPSDQYQ----RLF----HTALDTSAAR
K8E7N2_CARML/7-270GSYSDEDVIFLLQDISPYVA.EIATPEREVLIQNGT.-----HYSEMLPVEYQPTAEYI----ALF----KETLQESADR
F2JGK7_CELLD/19-268GSYRKEDCIFLLKNINGLLE.EQNNLEREYAMQNGT.-----HYSEMLPIEYMPTKEYM----TLY----KNTLEETAEE
Q891X7_CLOTE/27-276GSYSQKDVTFVLKDISNMIE.EKSNEEREYIMQNGG.-----HYSEMLPIEYFPTEEYM----DVF----YKTLEETKEK
B1HUS6_LYSSC/12-262GSYAREDVIFLLRDIGNVFL.EMGNEKREQLIQAGT.-----HYSEMLPMEYQPSKTYM----KLF----YKTLDAFADR
I3YAV5_THIV6/12-259GSYRPEDVSILLKPIAMEPV.A..IAEKERLIQSGQR-----HYSEMLSPETLPSPHYM----DIF----HQAFAMNRQR
D1A9P2_THECD/16-266GSYPAEDVAWLLKDLSHVRL.EAPAEEREAAIQSGRA-----HYAESLPVEYRPSPQYQ----ELF----HRALQESATR
C8XAU5_NAKMY/29-279GSYRPDEVAWLLTDLSAADL.EADAALRESAIQAGRA-----HYAESLPVEYQPDPAYQ----ALF----DRILADTAAR
M1FGD7_9ALTE/15-262GSYLSTDVEFLLKPVALEPT.P..VEEKERRIQAGVT-----HYSEMISEERRPDARYL----SLF----EESCQLGVPR
R7IPS7_9FIRM/3-247SSYSKDDVTILLKDITGMVK.PQPTQEREKLIQSGR.-----HYSEMLPIEYVPTQKYM----EVY----EQALLQYAKP
L0H008_9GAMM/12-261GSYAADDCLFLLTPLPARFV.T..VAEKERLIQREGR-----HYSEMISRESAPEERYL----ELF----RALTMRYRER
A1SUD4_PSYIN/14-263GSYCAEDCLFLLKNIKPKFY.T..IEDKERLIQTGVM-----HYSEMVNQESAPSKEYL----DLF----LSLTKQYKKR
A8L405_FRASN/18-260GSYLPEDVTFLLTDLSAANL.ERPTEDREEGFQSGR.-----HYSEDLPIEYQPDAAYL----RIY----HQALERSARR
F8K488_STREN/11-259SSYAPDEVGWLLKDLTGVAL.EAPTEEREEAVQNGGA-----HYAESLPEELLPDDDYQ----ALF----RAALDTGADR
Q5NWT5_AROAE/5-254GSYRPSDVELLLKPITIDFMAD..LELKESLIQSGKR-----HYSEMLSPEKVPSERYL----GLF----HDAHQRNRAQ
A4J1D7_DESRM/40-292GSYSSQDVIFLLKDIGPYIQ.EQGNEAREKAIQSGK.-----HYSEMLPIEYEPTQEYI----DLF----HKSLKETGYR
R5GSI4_9FIRM/375-629SSYDRSDAELLLTDITGRMQ.PLSPAERERLIQSGR.-----HYSELLPEEYEPSPAYL----REY----ENGLAVWAKS
F4H5N6_CELFA/535-785GSYAADEVSWLLTDLSDVAL.EAPVEEREEAIQSGGA-----HYAESLPVEYQPSEAYG----RLF----DAALAEGARR
Q2RVZ5_RHORT/10-255GSYDPADVTFLLTPVVVDFV.D..VAAKEALIQSGRK-----HYSEMLAREKPPSPEYM----AVF----HQAFAANRDR
D3RPA4_ALLVD/12-259GSYRPGDVQFLLKPIEIDPI.D..VAEKERLIQSGRR-----HYSEMLSRESLPSARYL----EVF----ERALAMGLKP
E8U3T5_DEIML/6-240STYAPGDVTVLIADRPAPEV...TLHEKEARIAAGE.-----SYGHFLTPETPPSALQE----RTF----EDALARNGTR
F8A7B9_CELGA/486-735GSYPAQEVTWLLTDLSHVAL.EAPVEEREEAVQSGGA-----HYAESLPVEYLPSAAYT----ALF----DEALADSARR
I4D513_DESAJ/17-266GSYSPEDVIFLLKNLNGVIR.ETDLKTRESLIQSGG.-----HYSEMLPIEYQPSAEYL----RLF----HQSLQENANK
H6R9M2_NOCCG/535-790GSYAPDDVAWLLKDLSGVDL.EADVTEREQRIQAGIA-----HYAESLPIEYQPDAQYR----ELF----DQVLADSAQR
Q186J5_PEPD6/5-254STYSKDDVIFLLKDISNLIE.EEGNKERELKIQNGR.-----HYSEMIPIEYEVSEDYL----NLY----HEKLRENKDK
A5WBK3_PSYWF/17-290GSYLPSDVTLLLDIVDKSGVRDVPVAQKEALIQSGQQ-----HYSDMLTLEKAPSDAHE----QMY----QQALQQGKLR
L0A1Y2_DEIPD/15-266STYAPEDVTYLLREIQAQFV...SVEEKERLIQSGER-----HYGQLLSPEQPPRPEYQ----ALF----ERALHEGAPQ
N0AVA9_9BACI/12-261GTYQEEDVLFLLKDLSGIRL.EGPTNERENQIQLGQ.-----HYSETLPIETLPPKSYM----DLF----WSALEKSQQK
I5AXH0_EUBCE/3-247GTYKEDDVIVLLKDITGLVE.PQSTEEREREIQNGR.-----HYCEMLPIEYEPSEAYE----RAF----EDALRRYSAI
C0Z9Y7_BREBN/18-267GSYPAEDVTFLLKEISGLME.ETNTEDREELIQAGT.-----HYSEMLPVEYQPSAEYI----SLF----HQALQTTARK
A6WD80_KINRD/17-261SSYLPDEVSWLLSDLSGVEL.EAPAEEREEAIQSGGA-----HYAESLPVEYQPSAEYQ----RLF----ADALDRTARR
J7SKQ6_MORMO/9-249GSYLPDDVQFLLRPVTIDMT...PVELKEQLIQSGQK-----HYSDMLSQEPAPTDWHL----DLF----NRALKKGAPR
H8GG70_METAL/7-254GSYSADDVEFLLTPIEMEDT.P..VAVKEALIQSGRR-----HYSEMLTREALPTDAYV----QLF----HDALALNGRR
Q0SDY7_RHOSR/11-261GSYSTDEVGWLLKDLSHVDL.EADVAERERRIQSGES-----HYAETLPIEYQPDAEYR----ELF----EKVLQDSSIR
F4EXE7_SELS3/3-247STYKKDDVTILLKDITGKLD.PLPTAEREKLIQSGR.-----HYSEMLPLEYEPSEKYL----KAY----FDALSRYAEI
H6N264_GORPV/15-265GSYDPDEVTWLLKDLSHVAL.EGELAERERRIQSGAA-----HYAESLPIEYQPGTQYQ----ELF----HTALRESAAR
V4LJY0_9GAMM/11-261GSYLREDCQFLLKPLRMQSI.E..IGDKESLIQSGAR-----HYSELLTPERLPSARYM----ELF----LQLTEKYAMR
U5LCP5_9BACI/10-258GSYSTEDVIFLLKDLSAYEL.EGATENREKKIQSGQ.-----HYSETLPIEYIPPAHYL----ELF----WNTLEDYKEK
Q3JCD3_NITOC/20-269GSYRQDDCQFLLTPLQAEFF.S..IQEKERLIQSGEK-----HYSEMISFESPPSEAYL----TLF----RNLTQRHKGR
Q8KL02_RHIEC/15-256GSYAEYDVTLLLKRVDIQPT.D..TATREEAIQSGRR-----HYSEMISAEMAPTREYM----ELF----AKAMATGGPR

PF15609

D5BYR0_NITHN/23-215LN--------DLLDFASRAN-PKRGY----------------LFVSKVLGKHIPCKPST----MRD----IY--------
Q888T1_PSESM/34-221.D--------SLFGFAERRN-PKRAF----------------LFVSRVLGRHIPARPSV----MLK----SF--------
F2JGK6_CELLD/36-258LN--------HLFEVGVRKN-KKRIF----------------LFVSKVLGKHLAVNPYM----TRL----GG--------
F8A7B9_CELGA/28-256LE--------DLVGLAVRRN-PRRAH----------------LLVSTVLGKHVPTDPRI----VRG----AG--------
R4KD23_9FIRM/21-261..--------VVFSMAARNN-PKRSY----------------LFVSKLIGKHIPVRPGT----PFI----AG--------
L0H292_9GAMM/23-213LA--------QLIGFASRQN-PRRGF----------------LFVSRVLGKHVPCAPRA----MRD----TY--------
Q186J6_PEPD6/22-211LN--------DFLDVGIRNN-SKRRF----------------LFISKKLGKHLACKPSE----MDN----LG--------
F4H5N6_CELFA/44-294LA--------DLVGLAVRRN-PRRAH----------------LLVSRVLGKHVPTDPRV----VRG----AA--------
J9RTC8_9ACTO/32-225VH--------DLVSLGLRHN-RRRAH----------------LLVSTVLGKHIPTPPSI----VRG----AA--------
D3V2E0_XENBS/35-224LE--------TLFDIAERRN-PKRAF----------------LFVSKVLGRHIPVSPSI----MRS----VY--------
C0ZNQ4_RHOE4/33-221.P--------DLVIPGLRRN-PRRAH----------------LLVSTVLGKHVPTEPSV----VIG----AA--------
Q0RDF5_FRAAA/27-253LD--------ALVGLALRRN-PRRAH----------------LLVSRVLGKHLPVAPGA----GLA----AG--------
E8U3T7_DEIML/27-218.P--------DLLGFGLREN-PRRGF----------------LFVSRVLGKHLPVSPRV----IAD----SW--------
N0ATX4_9BACI/3-219IS--------QLFLMAGRIN-KKRSF----------------LFVSKLLGKHIPINPVK----GLV----VG--------
V4IMQ6_9ACTO/22-218LR--------GLLGLALRRN-PKRAH----------------LLVSGVLGKHVPQLPSV----VHG----HG--------
Q4FTP7_PSYA2/40-245LE--------DLLDFAQRIN-PKRAF----------------LFVSKVLGRHIPVAPST----MRD----AF--------
X2GSG0_9BACI/29-253IT--------DLFKMATRIN-KKRQF----------------LFVSTVLGKHLAVQPQV----PIL----TG--------
H6N263_GORPV/13-205.D--------DLVILGLRRN-RRRAH----------------LLVSTVLGKHIPTPPAR----VRG----AA--------
A6WD81_KINRD/34-260VH--------DLLGLALRRN-PRRAH----------------LLVSEVLGKHVPTDPRL----VRA----AG--------
L0A0T7_DEIPD/29-215.H--------ALFTLGLRQN-PRRGF----------------LFVSRVLGKHLPARPRD----MKR----SY--------
F8B557_FRADG/36-231LD--------AMVGLALRRN-PRRAH----------------LLVSRVLGKHLPVRPAR----SVS----AG--------
C8XAU6_NAKMY/29-253MV--------DLTRIALRRN-PKRAQ----------------LLVSTVLGKHLPVDPRV----VDG----AG--------
Q3JCD5_NITOC/23-215LH--------DLLDFASRIN-PKRGY----------------LFVSKVLGKHIPCQPSR----MRD----IY--------
B1HUS5_LYSSC/29-252LT--------DLFQMAARIN-KKRQF----------------LFISTVLGKHLAVRPQI----PLL----TG--------
Q9RSB1_DEIRA/35-218.A--------ELLDYAVRRN-PKRGF----------------LFVSRVLGKHIPIAPAT----AAR----TW--------
A5WBK1_PSYWF/41-238LD--------DLLGFAQRIN-PKRAF----------------LFVSKVLGRHIPVSPQI----MRQ----AF--------
Q0SDY6_RHOSR/33-221.P--------ELVEPGLRRN-PRRAH----------------LLVSTVLGKHVPTDPGA----VIG----AG--------
E2Q252_STRC2/22-213LH--------GLLGLALRRN-PKRAH----------------LLVSNVLGKHVPQSPAV----VYG----AG--------
A1SUD2_PSYIN/23-212VE--------ELLTFACRQN-PKRSF----------------MLVSKVLGRYVPTKPNV----MRE----VY--------
Q5NWT3_AROAE/14-205.A--------SLLDFAARAN-PKRAF----------------LFLSKVLGKHYPSIPSE----MVS----VH--------
M1F8F7_9ALTE/56-248..--------ELFQIAERIN-PKRSF----------------LFVSTVLGRHIPVRPRD----HFD----AV--------
V4JFE6_9GAMM/23-221LE--------TLIGFAARAN-PKRPF----------------LFVSRVLGRHIPVRPAT----MRQ----TY--------
D0L8D2_GORB4/36-225VS--------DLVILGLRRN-RRRAH----------------LLVSTVLGKHIPVPPSV----IRT----VA--------
H6R9M2_NOCCG/48-236IA--------SLIRPGLRRN-PKRAH----------------LLVSTVLGKHLPTDPRV----VLD----AG--------
H8GG72_METAL/25-219IR--------RLLGFASRIG-SQRKF----------------LLVSKVLGKHYPVSPLM----MSW----TY--------
U5LBE9_9BACI/23-240VD--------HFFTMAARIN-KKRSF----------------LFVSKLLGKHLPIHPEK----GLI----TG--------
F3ZD08_9ACTO/22-212IE--------DLLGLALRRN-PKRAH----------------LLVSHVLGKHVPRSPRV----VAE----TG--------
E3EE67_PAEPS/1-230MD--------KLFAMAARVN-KKRSF----------------LFVSKVLGKHIPVNPYT----SLL----SG--------
Q2RVZ3_RHORT/30-224LG--------ALCGFASRRN-PKRPF----------------LFVSKVLGRHLPVRPQV----MRM----VH--------
G2NBS3_9ACTO/22-216LR--------ELLGLALRRN-PKRAH----------------LLVSNVLGKHVPQRPSV----VHG----AG--------
C8W645_DESAS/19-238VS--------SVFSMAARNN-PKRSY----------------LFVSKLIGKHIPVRPIV----PFT----AG--------
Q7CKQ5_YERPE/29-218LD--------SLFDIAERRN-PKRAF----------------LFVSKVLGRHIPVSPAT----MRN----VY--------
W0LDC5_SERFO/29-220LD--------ELFDVAERRN-PKRAF----------------LFVSKVLGRHIPVKPAT----MRT----IY--------
Q2J6S1_FRASC/55-272LH--------ALVGLALRRN-PRRAH----------------LLVSRVLGKHLPVAPAE----ALA----AG--------
D5CKR0_ENTCC/30-220LD--------DLFDIAERRN-PKRAF----------------LFVSKVLGRHIPVPPSV----MRQ----AY--------
Q891X6_CLOTE/33-257LN--------KLFLMAARKN-PKRVF----------------LFVSTVLGKHIPVNPKK----SIL----IG--------
E3IYR1_FRASU/25-221LR--------GLVGLALRRN-PRRAH----------------LLVSRVLGKHLPVPPAV----ALE----AG--------
A1VWP7_POLNA/22-216LD--------DLIGFAARAN-TRRGF----------------LFLSKVLGKHWPVTPRL----MHA----IH--------
I0DSI1_PROSM/30-221LD--------ELFEIAERRN-PKRAF----------------LFVSKVLGRHIPVQPKL----MRK----TY--------
V6JVQ1_STRRC/37-226.P--------ALLGLALRRN-PRRAH----------------LLVSNVLGKHVPQSPTV----VYE----YG--------
A8F9P6_BACP2/17-239.E--------HLFDMAARVN-KKRAF----------------LFVSKVLGKHIPVHPVK----PLL----VS--------
M1SJV4_MORMO/30-220LN--------ALFGIAERRN-PKRAF----------------LFVSKVLGRHIPVEPEI----MRG----VY--------
U5N786_9BURK/38-230.Q--------RLFSFATRAN-PKRAF----------------LFLSHVLGKHLPVDVAT----MGD----VH--------
A4J1D6_DESRM/37-256ID--------SIFSMAARNN-PKRSF----------------LFVSKLIGKHIPVLPNV----PLI----TG--------
D1A9P3_THECD/28-256LR--------DLVGLAVRRN-PRRAH----------------LLVSAVLGKHVPTDPRL----VHG----AG--------
J7ISK8_DESMD/39-259..--------.LYSLAARQN-KKRGF----------------LFVSKVLGKHVPVDPFI----PLL----AG--------
C0Z9Y6_BREBN/39-262LE--------ALFQMAARIN-KKRSF----------------LFVSKVLGKHLPVRPSA----SVL----SG--------
A8L404_FRASN/37-236LR--------RLVGLALRRN-PLRAH----------------LLVSRVLGKHLPVPPVT----ALD----AA--------
B4EW77_PROMH/30-221LD--------ELFDIAERRN-PKRAF----------------LFVSKVLGRHIPVSPKK----MRE----TY--------
D1BEJ9_SANKS/28-275LP--------ALVGLALRRN-PRRAH----------------LLVSTVLGKHVPTDPRV----VQA----AG--------
C3ASF9_BACMY/11-231.D--------QLFQMAARMN-KRRGF----------------LFVSTILGKHLPVLPAI----SLA----GG--------
F8K489_STREN/28-217..--------GLVGLAVRDN-PRRAH----------------LLVSTVLGKHVPQHPKT----VRD----AG--------
D3RPA9_ALLVD/31-224LD--------ELCGFAARHN-RKRGF----------------LFLSKVLGKHWPVTPTR----MRE----IH--------
A8MM96_ALKOO/39-263LR--------NLFTMAARRN-PKRSF----------------LFVSKVLGKHIPINPHT----GLL----AN--------
D7C985_STRBB/21-212LR--------ELLGLALRRN-PKRAH----------------LLVSNVLGKHVPQRPSA----VHG----AG--------
K8EW86_CARML/29-250.D--------ALFQLAARIN-KKRSF----------------LFVSPVLGKHLPVNPGI----PLL----IG--------
I3YAV0_THIV6/25-218LD--------ELCGFAARNN-PKRGF----------------LFLSKVLGKHWPAAPSR----MLR----VH--------
R5X4A9_9CLOT/51-237..--------.YLDLAIRNN-KKRRF----------------LFVSKVLGKHLPCRACD----MDN----LG--------
W0AF65_9SPHN/32-217LE--------ALCDFAARDN-PRRAF----------------LVVSRLLGRHIPAKPST----MRA----ST--------
I4D512_DESAJ/37-259.E--------ALFSLALRKN-KRRRF----------------LFVSKVLGKHIPVEPLL----PLL----AG--------

PF14681

B9PK97_TOXGO/39-243MK.QTAQLRAMMTIIRDKET.PKEEF----------------VFYADRLIRLLIEEALN.E..LPF.E..KK..EVT...
E3L591_PUCGT/16-219IS.SHPVLKHKMSKIRDRDT.LPAEF----------------RKLLKDISFILAVEASR.D..LET.E..SV..QGL...
Q5AWP2_EMENI/470-667AT.DSHATKLLSTPMRDDSI.RGPSL----------------QEAHENAGRYLATRYLV.EL.IGT.E..VL..AIR...
E3FKH4_STIAD/10-212VV.DHPLVKHKLTLMRRVET.STASF----------------RALLQEISQLLAYEAMR.D..LKL.R..DE..TIQ...
B1XW63_LEPCP/8-210VV.GHPLVQHKLTLMRQKDL.STSSF----------------RRLLEEISLLMAYEVTR.D..MPT.R..LI..EIE...
A5FZR1_ACICJ/10-212VV.DHPLVAHKLTLLRAAAT.PTGDF----------------RRLVREISLLMGYEVLR.D..LPT.E..PV..HIE...
Q2RS40_RHORT/14-217VL.DHPLIQHKLTHMRRRET.STRTF----------------RMLLREIALLMGYEVTR.S..LPL.T..TE..SIE...
UPP1_SCHPO/12-217VLNQTNQLKGLFTIIRDKTK.PRSEF----------------IFYANRIIRLIVEEGLN.H..LPV.S..SA..KVT...
C5CEA9_KOSOT/6-207VV.NHPLIQHKLSILRNKDT.GPKEF----------------RELTREITLLLTYEATR.H..LPT.Y..ET..KIE...
F0XHJ4_GROCL/10-224VS.KHPCLAAKLSLLRSETT.SAKEV----------------QSLVHEISLFVACEALS.HA.LTA.T..PG.PKKV...
D5BUA7_PUNMI/7-209IL.EHPLATHKLAILRDKDT.PSALF----------------RTTLAELSWLLAYPAFA.A..LTL.T..PR..QIE...
E6ZJH4_SPORE/8-212VV.SHPLISHHLANLRLADT.SPKEF----------------RSLVSNISTVLCIEATR.S..LSV.K..QV..QGQ...
A2R643_ASPNC/9-224VS.SHPLLQAKLSQLRSAST.STRET----------------RSLVHEIATILGVEAFA.AG.WKV.K..KA.GMDT...
B0C7X6_ACAM1/9-216VP.PHPLIKHWLAVARDRNT.PGVMF----------------RTAMTELGRWLTYEAMR.EW.FPL.V..ET..TVE...
D1CCZ6_THET1/6-207VS.SHPLVAHKVTLLRDVNT.EPKRF----------------RELVDEITSLLLYEATL.D..FPL.R..EI..EVQ...
B6HJ77_PENCW/9-232VS.SHPCLQAKLSLIRSSST.TPRET----------------RGLVHDIANILGVEAFS.GL.KSV.K..TG..TDT...
B9GJS2_POPTR/275-479VIQSTFQIRGMHTLIRDKEI.SKHDF----------------VFYSDRLIRLVVEHGLG.H..LPF.T..EK..QVV...
UPP_BRADU/6-208IV.DHPLVQHKLTLVRDKSI.STKSF----------------RELIKEIGMLLCYEVTR.D..LPL.A..DT..VIE...
E2B6P7_HARSA/345-550LP.DTPQIKGLHTFIRNKET.YRDEF----------------IFYSKRLIRLVIEYALS..L.LPF.E..EV..TIE...
D2QZE9_PIRSD/6-207EV.SHPLILHHLSRLRDKAT.PPDEF----------------RTLIHRLAVLLAYEATQ.D..LLL.A..PK..TIE...
E3Q271_COLGM/16-231VS.QHPCLRAKLSQLRSQST.PAKYV----------------KTLVNEIALMVAYEALA.AS.TKA.T..DG.PKDA...
E0U7K3_CYAP2/9-216VP.DHPLIKHWLAIARDTNT.PSVLF----------------KTAITELGRWLTYEAVR.YW.LPT.I..DT..SIQ...
A5EVG4_DICNV/7-209EI.NHPLVQHKLTTLRRKET.HTMEF----------------RTITREIGLLLAYEATR.D..FPL.Q..DC..EIE...
F2UAE3_SALR5/11-216VLRRTPHLRHIMSILRSVDT.EPPKF----------------AATADLIARLVVAAALE.H..VEY.E..DL..KVT...
Q8DI28_THEEB/15-222VP.PHPLIQHWLTVARDRNT.PTPLF----------------RVAMTELGRWLAYEAVR.EW.LPT.V..ET..VVE...
Q2H9K6_CHAGB/10-227VS.QHPCLLAKLSQLRSQYT.PPRDV----------------KGLIHDISLIVACEAFA.KG.LTS.R..PG.STDQ...
B8HYJ3_CYAP4/9-216VP.PHPLIKHWLAVARDATT.PVPLF----------------RTAMQELGRWLTYEAAR.EW.LPT.L..DT..TVQ...
Q0TWS2_PHANO/12-227VS.VHPCLQAKLSQLRSAST.GSRDA----------------QTLVHEIALMVGYEALG.AS.LTA.Q..QQ.GTDK...
Q1AVG9_RUBXD/10-211LV.DGPLTRHKLAILRDERT.PTPIF----------------RQAMRELALIMVAEATR.N..MPT.R..KA..TIR...
D8TYT8_VOLCA/53-261SP.PHPLIKHWLAILRSEYT.PSPMF----------------RSACSELGRLLIYEAVR.EF.LPT.M..EQ..QVQ...
B0CYQ9_LACBS/7-210LL.SHPLINAELSKLRQAST.SSKEF----------------REGIQHISVLLGYEASR.N..LEE.E..SF..DDR...
E9QGS0_DANRE/320-526VMESTPQVRGMHTIIRNKET.SRDEF----------------IFYSKRLMRLLIEHALS..F.LPL.K..PV..TVE...
UPP_MYCA5/4-206LI.KHPLIEIKLTEMRAAET.SHKVF----------------RSNLDEIASLMVYEVMR.N..YQT.K..PK..KVI...
A7S545_NEMVE/352-557VE.GTPQVRGLHTIIRNKMT.TRDDF----------------IFYSKRLMRILIEHALS..L.LPF.K..TQ..NVV...
B1XP85_SYNP2/9-217VP.DHPLLKHWLAIARETNT.PTPLF----------------KTAMKELGKWLTYEACR.YW.LPT.L..DA..AVE...
F0XXG3_AURAN/8-217VL.DSLAMKALLTTIRRKST.PQRTY----------------VEHCDRLCAMLAEEALA.R..LPG.TAYDV..PVE...
C0NWK2_AJECG/11-260VS.QHPCLRAKLSQLRSNAT.SCKDT----------------NRLINDIAMIIGCEALG.AS.LQV.T..PS.GMGT...
B8BYV0_THAPS/18-231VM.KSKALAILFTKIRDEQT.NAADF----------------VNYSKRAMRLLAEETIS.Y..LPA.T..PH..TVT...
C3ZI77_BRAFL/271-477VLESTPQVRGMHTIIRNRET.NRDEF----------------IFYSKRLMRLLIEQAMA.M..LPF.K..TV..QVK...
B2AWA7_PODAN/10-225IS.THPCLQAKLSQLRSTST.TARDV----------------KTLINEITLILGTEALA.SA.LTS.S..PG.PTDT...
A8NXX8_COPC7/7-210IL.NHPLVNAELSKLRQTST.TSKEF----------------REGVHNISLFLGYEASR.G..FEE.A..TF..QGQ...
Q53LT4_ORYSJ/267-471VIQTTYQIRGMHTIIRDAAT.TTHDF----------------IFYADRLIRLVVEHGLG.H..LPF.K..EK..QVI...
E1ZQY9_CHLVA/5-212VP.PHPLVKHWLAVLRTKDT.PSSIF----------------RSAASELGRILVYEAAR.DW.LPT.I..DG..QVQ...
A5GTE0_SYNR3/9-216VP.PHPLVAHWLTVLRDKQT.PSPLF----------------ATAMKELGRWLTYEAAR.DW.LPQ.R..NI..TVE...
B3S289_TRIAD/277-481VE.KSPQVTGIHTKIRSKET.NRDDF----------------IFYSKRLMRLLFEYTLS..L.LPF.D..NI..TVQ...
C5KJG5_PERM5/30-243ILSPTLFLKSQMTILRDADTVKSAEF----------------RRAADRITRLLVEEVINLGW.IKCAE..DV..KVT...
A4HAL7_LEIBR/9-219LP.QTPQLHFLFTVIRNVET.PRTDF----------------VFYSERIMRLILEAALC.M..IPV.K..PF..NVI...
A4S9H3_OSTLU/196-418LP.PQFQIRGMHTIIRDRRV.NRSDF----------------VFYSDRIIRLVVEHGLG.H..LPF.S..EQ..VVL...
UPP2_SCHPO/13-219VLRQTMYLLSLMTILRDQQT.GHSEF----------------VRTANLIINMLMQEALS.A..LPY.K..KC..LIK...
B6K7J9_SCHJY/15-220VLDQTPFLLSQMTILRDSTS.SHAEF----------------VHAANHISRLIASSALS.H..VRT.T..KK..IVR...
C1E7B8_MICSR/254-468LP.PNFQIRGMHTIIRSASC.NRSDF----------------VFYSDRLIRLVVEHALG.H..LPF.R..NE..IVT...
B9S674_RICCO/251-459VIMSTFQIRGMHTLIRDVKT.RKHDF----------------VFYADRLIRLVVEHGLG.H..LPF.T..ER..QTR...
D2SG74_GEOOG/5-206VV.DHPLARARLTRMRDERT.DNAAF----------------RAALAELTQMLVYEATR.A..LPV.A..EE..RIT...
A2R0T1_ASPNC/17-223VLEQDRSLLNLMTIIRDVNT.NDRDF----------------SAAVEKVVRRLITSALG.H..VPA.E..EY..TVT...
E4X7A3_OIKDI/322-527LP.QTRQSMGIQTIIRDKKT.PRNEF----------------IFYSERLMRLVFEYALG..F.LPH.E..AH..TVS...
D8PR38_SCHCM/5-209VI.DHPIVRAELSKLRLTTT.SPKDF----------------REGIKQISFILGIEASR.S..LEE.A..TF..QGE...
D3BNE7_POLPA/239-442ILPPTNQVRALLSILRNKNT.DVGNF----------------VFYSDRLVNMIIEEALT.H..LPF.K..EK..TVV...
B8CAC1_THAPS/44-250VS.KHPVLAHKLSILRSSST.SPSSF----------------RSTLREITFHLGYEATS.T..LTT.R..DV..PLT...
D5GBY9_TUBMM/10-229VS.SHPCFISKLSRLRSAST.PPKET----------------KALVHELSLILATEALA.RA.LTA.E..KTGEKDV...
A0CZ39_PARTE/55-262IL.NRNQTEHILSLMREANT.DIVSF----------------RKNADRLIRILMEQALA.Q..LQK.K..NS..VKQ...
A1C4H4_ASPCL/15-220LP.QKGQLLTLMTIIRDVNT.TGTLF----------------TSTVQRVARQLLTLAVD.S..VPL.A..QE..FVE...
F0ZZY8_DICPU/270-473VLEETNQIKAMHSILRNKNT.KIGDF----------------VFYSDRLCALIIEEALT.Y..LPF.T..DK..TVI...
Q19583_CAEEL/298-503ILKETPQVKGLVTFVRDRET.SRDNH----------------IFYSDRLMRILIEECMN.H..MPY.K..DV..EIE...
D1C823_SPHTD/29-232VL.EHPLLATQVTLLRDIRT.PAPEF----------------TRAIEEVTRFLLWAALA.D..TAT.A..PM..PVP...
Q5CME0_CRYHO/242-456IIPSNCQIRHMHSIIRNKDT.SAVDF----------------VFWSDRLIRLVVENALG.H..LSF.T..GQ..TIE...
A8GCF9_SERP5/8-213LLAPSHYLTYLHTQIRNKQA.EHACF----------------EYYSDQLLRQLLVQVAA..L.LPY.E..KN..EVI...
A8P7X1_COPC7/39-231LP.QTAQLEALYTIIRDKET.SRGDF----------------LFYSDRIIRLLVEEGLN.H..LPV.V..KR..TVE...
B7FX04_PHATC/21-232IS.SHPVLSHKVTILRSSAT.TSHTF----------------RAVLREVTYHLGYEATS.R..LTT.Q..PV..AIT...
A8JC08_CHLRE/54-264SP.PHPLIKHWLAILRSNFT.PPPMF----------------RSACAELGRLLIYEAMR.EF.QPT.M..EQ..QVE...
A9URE0_MONBE/281-484VP.ASDQLHGLMTTIRDRDS.SRDDF----------------VFSTNRVLRLTVEHALS..L.CPF.E..DV..VVE...
B6AH00_CRYMR/25-230SN.QTPQLKGIITILRDVNT.NKEDF----------------MFYTDRVSRIVLEDALN..L.LPY.N..VK..TIK...
B6ABC4_CRYMR/233-447IIPSNCQIRHMHTIIRNKNT.SGIDF----------------VFWADRLIRIVVENALG.H..LPF.E..YQ..TVE...
E4X3J2_OIKDI/287-498VLPENNQIKAIQTLLRNLET.TRDDF----------------IFYAERLMRLSFEYALN..F.LPH.R..EV..EITLEP
A0CTP7_PARTE/56-263VL.DKFQVEHLLSVIRNQTT.HTKDF----------------RLYSDRLIRLLMEKAIS.EHSKKL.S..PQ..EGS...
F2UFG2_SALR5/279-483MP.SSRQLVSLMTSMRDRDT.DLDRF----------------VFASERVMKLLIEFALS..F.VPY.D..SV..QVT...
F0YEY4_AURAN/277-487MS.GHAVLAHKVTLLRDRRT.KPREF----------------RDILGELTHYVGYEATT.H..LDC.V..PR.HDCV...
Q0TVS3_PHANO/438-633AG.DRNAAKLLMTSMRDAAV.SGPEL----------------RKFHGRVGWYLATDLLA.QL.IGI.Q..EY..PIQ...
F2PL94_TRIEC/448-645AT.EKNAAKLLMTQMRNANV.AGPHL----------------CRAHMSVGKYLATEFLS.DV.IGV.E..EY..SIP...
B6GYG1_PENCW/502-699AT.DRPAAKLLMTPMRDASI.SGSAL----------------RKVHGRVGFYLATELCT.QI.MGL.E..AY..PIP...
E3QN18_COLGM/468-663AT.AKNAAKLLMTPTRDAAI.AGHSL----------------RAAHHQVGWYLATEFLT.SV.LGV.E..EY..PIA...
B2AP82_PODAN/589-789AT.GRAAAKLLTTATRDARV.SGPAL----------------REAHRLVGRYLATELLP.DV.VGT.E..EY..EIP...
D5GK17_TUBMM/495-691AT.DRGAARLLMTPMRDATV.AGPAL----------------REAHRRVGWYLATEFLT.EM.IGL.E..EY..QIP...
Q0CK66_ASPTN/515-712AT.DKSAAKLLMTPMRDAAL.AGPRL----------------REAHRQCGRYLALEYVS.DL.IGV.E..PC..DIL...
C4JD99_UNCRE/393-591GT.DRNAAKLLATQMRDAKV.AGPDL----------------REAHRRAGWYLATETLA.DI.LGV.E..EC..PIQ...
C7ZP62_NECH7/505-702AT.EKCAAKLLMSPMRDASV.SGPPL----------------RAAHQRVGLYLANEFVS.QL.IGV.E..EY..PIP...
Q2GUM1_CHAGB/474-672AT.DQNATKLLMTPTRDARV.FGPDL----------------RKAHRRVGWYLATLFLA.DI.VGL.E..QY..DIP...
E9F4S0_METAR/604-801AT.DRNAAKLLMSPTRDASV.AGPML----------------RKAHANVGLYLAWEFLS.EV.LGV.E..EY..AMR...
B1WT56_CYAA5/9-216VP.DHPLIKHWLGVARDVNT.PGVLF----------------KTAMSELGRWLTYEATR.YW.FPT.L..ET..TVN...
C5AAP9_BURGB/13-214.L.DHPLIQHKLTHMRDKDT.STRTF----------------RELLREITLLMGYEITR.N..LPI.T..TK..RVE...
D5A477_ARTPN/9-216VP.PHPLIKHWLAIARDVST.PPALF----------------RSAMTELGRWLTYEATR.DW.FTT.V..EA..TVQ...
E9C694_CAPO3/359-559.....SQVRAMHTIIRNRDT.PRDEF----------------IFYSQRLMRLLVEYALS..F.LPF.Q..ET..IVT...
G7Z3C1_AZOL4/35-237.L.DHPLIQHKLTHMRNKER.STGGF----------------RTLLREISLLMGYELTR.D..IPL.T..TE..RIE...
H3D4M3_TETNG/291-494...STPQVRGLHTIIRDRET.SRDEF----------------IFYSKRLMRLLIEHALT..F.LPS.Q..TW..VVQ...
Q4WZP7_ASPFU/9-223VS.SHPCLQAKLSQLRSHST.SPRET----------------RSLVHDIATILGVEAFA.AG.LKA.A..SG.GKDK...
Q5KGX1_CRYNJ/6-210IS.NHPLVLSKLTQLRLHDL.PPKDF----------------REGIRTIGSMLIYEAAR.D..LPL.R..DV.PDLR...
Q7UFD1_RHOBA/6-207VL.QHPLVSHHLCQLRDKRT.RPSEF----------------RSAVSRLAMLIGVRATD.D..LPT.Q..PI..TIP...
R7D7S5_9FIRM/7-208.M.DHPLIQHKISMLRNKNT.GTNEF----------------RKLIEEIAVLMGYEALR.D..LPL.E..DV..EIE...

PF14572

E9FWJ1_DAPPU/165-348------DFRNAVIVARDPGS-AKKAT----------------SYAERLRLGIAVIHGEQ----KEA----ES--------
KPRB_HUMAN/179-363------DYRNAVIVAKSPAS-AKRAQ----------------SFAERLRLGIAVIHGEA----QDA----ES--------
Q961V3_DROME/165-361------DYRNSVIVARNPGV-AKKAN----------------SYAERLRLGLAVIHGEQ----KET----DA--------
F1KVQ3_ASCSU/169-364------DYKNAVVVAKSPGV-MNKAT----------------SYADRLRLGVAVIHGEP----KEG----ES--------
Q6P8C3_XENTR/167-349------NYKNAVIVAKSPDA-AKRAQ----------------SYAERLRLGLAVIHGEP----QCA----EL--------
Q23166_CAEEL/167-347------DYKNAIIVAKSPGV-MNKAT----------------SYADRLRLGVAVIHGEQ----KDE----EE--------
A7T9J2_NEMVE/4-194------DCRNAVIVAKNPAS-AQRAT----------------SFAERLRLGIAVIHGEQ----KES----EG--------
F1L6K6_ASCSU/169-364------DYRNAVIVAKSPDV-MHKAT----------------SYADRLRLSVAVIHGEA----KQG----DC--------
B3S6Z0_TRIAD/157-339------DYKNAVVVAREPGS-TKRAT----------------SFAERLHLTLAVIHGES----KSD----YY--------

PF00156

PYRE_DEIRA/34-188..SE-T------..LP----------------------------------------------------------------
Q3SMI9_THIDA/14-177RADC-V------..RF----------------------------------------------------------------
PYRE_BIFLO/37-192NMTV-G------..YT----------------------------------------------------------------
A6GZJ5_FLAPJ/2-150PLEV-I------..LC----------------------------------------------------------------
PYRE_PROAC/43-197..GA-P------..MA----------------------------------------------------------------
Q8EVI3_MYCPE/12-166FKTV-K------..MT----------------------------------------------------------------
Q0CVT8_ASPTN/931-1096..DV-P------..LA----------------------------------------------------------------
Q2YAL8_NITMU/16-212..EG-E------..LD----------------------------------------------------------------
Q4XNN5_PLACH/73-239FHNV-F------..YL----------------------------------------------------------------
Q1DDD8_MYXXD/86-239..GC-P------..FF----------------------------------------------------------------
Q6NF43_CORDI/11-164..GI-K------..LS----------------------------------------------------------------
KPRS_METS3/132-293..DC-E------..CT----------------------------------------------------------------
A5V979_SPHWW/2-156..SI-P------..ML----------------------------------------------------------------
A7E5A9_SCLS1/57-218KRYI-P------..LG----------------------------------------------------------------
C1DM73_AZOVD/5-153..NL-G------..CL----------------------------------------------------------------
A8LJR1_DINSH/150-296..GC-G------..LA----------------------------------------------------------------
UPP_AQUAE/39-188..PN-A------..KV----------------------------------------------------------------
Q8EUA5_MYCPE/11-161.IDC-L------..VD----------------------------------------------------------------
Q0K973_CUPNH/14-164..DV-P------..LA----------------------------------------------------------------
A4CGY8_ROBBH/133-287..EV-P------..FT----------------------------------------------------------------
A3U7I6_CROAH/14-161.YEC-E------..LS----------------------------------------------------------------
A6QAE7_SULNB/5-148.DNR-Q------..LM----------------------------------------------------------------
Q2RSZ0_RHORT/17-167..AA-P------..RF----------------------------------------------------------------
HPRT_MYCPN/9-158.FDL-Q------..LD----------------------------------------------------------------
O83317_TREPA/210-372..KK-P------..LA----------------------------------------------------------------
PYRR2_LACPL/1-156GTAI-P------..VG----------------------------------------------------------------
Q4DVM9_TRYCC/44-213..GV-P------..LV----------------------------------------------------------------
PYRE_HYPNA/34-182..GA-R------..AI----------------------------------------------------------------
PURR_STRR6/106-265..NV-S------..FV----------------------------------------------------------------
Q27375_TOXGO/94-256SSV.-P------PFFE----------------------------------------------------------------
XGPT_RHOS4/14-159..DI-R------..TV----------------------------------------------------------------
Q4FP84_PELUB/15-165..KL-P------..IA----------------------------------------------------------------
Q5NI77_FRATT/16-164.IDL-R------..TQ----------------------------------------------------------------

PF15610

M2SQF2_COCSN/2-255..DF-A--------VA----------------------------------------------------------------
C6XW67_PEDHD/2-266..SE-Q--------IV----------------------------------------------------------------
H1Z8U3_MYROD/1-264..DE-E--------IY----------------------------------------------------------------
C7PNW9_CHIPD/2-265..NE-Q--------LV----------------------------------------------------------------
Q0UEK8_PHANO/2-265T.DV-V--------VA----------------------------------------------------------------
E3QYQ0_COLGM/52-331T.RF-A--------TM----------------------------------------------------------------
E4ZIV8_LEPMJ/2-262..DI-A--------VA----------------------------------------------------------------
R0KEE4_SETT2/2-259..DF-A--------VA----------------------------------------------------------------
G2Z396_FLABF/1-265..HD-E--------IV----------------------------------------------------------------
H1YCE2_9SPHI/3-265..EQ-Q--------IV----------------------------------------------------------------
B2WKS8_PYRTR/2-256..DF-A--------VA----------------------------------------------------------------
G0JP06_9GAMM/87-357VCGD-N--------VV----------------------------------------------------------------

PF11202

Q888S9_PSESM/14-255MAAD-V------QALA----------------------------------------------------------------
R5XB52_9CLOT/25-275LAFA-I------GVMS----------------------------------------------------------------
Q7CKQ6_YERPE/9-249MARE-V------VMLA----------------------------------------------------------------
I0DSH9_PROSM/9-249LASE-V------VMLA----------------------------------------------------------------
STIP_ACIAD/20-273LAQE-V------QQLA----------------------------------------------------------------
W0ADD0_9SPHN/11-256LAAD-V------AGLA----------------------------------------------------------------
A1VWP9_POLNA/5-253MARD-C------LTLA----------------------------------------------------------------
E4NAQ4_KITSK/21-265LATA-V------GTVA----------------------------------------------------------------
D3VJW4_XENNA/9-249LATE-V------VMLA----------------------------------------------------------------
D0L8D3_GORB4/17-267IADA-V------AVVG----------------------------------------------------------------
C8W646_DESAS/34-283IAHA-V------GLVA----------------------------------------------------------------
X2GQ89_9BACI/11-261IALA-V------GVVA----------------------------------------------------------------
R5BVZ9_9FIRM/3-247TSEA-V------GVLA----------------------------------------------------------------
D5CKQ8_ENTCC/9-249LAKE-V------TQLA----------------------------------------------------------------
F8AVP2_FRADG/12-254VATA-V------GVAT----------------------------------------------------------------
J9STB4_9ACTO/17-267LAEA-V------GVVS----------------------------------------------------------------
A8MM96_ALKOO/473-722IAVA-V------AVVS----------------------------------------------------------------
Q9RSA8_DEIRA/11-250VGEL-L------AALT----------------------------------------------------------------
E3EE68_PAEPS/21-271VALA-A------ASVA----------------------------------------------------------------
A8F9P7_BACP2/9-258VAEA-V------AVVA----------------------------------------------------------------
R7CDA0_9FIRM/3-247VANA-V------GMLA----------------------------------------------------------------
Q4FTP9_PSYA2/19-285AATD-I------ANLA----------------------------------------------------------------
D1BEJ8_SANKS/16-268LAHA-V------GVVT----------------------------------------------------------------
J7INJ2_DESMD/17-266VAKA-V------GIVA----------------------------------------------------------------
R4KIZ1_9FIRM/43-295LALA-A------AIVA----------------------------------------------------------------
U5NAN4_9BURK/5-254MARD-C------LLLA----------------------------------------------------------------
E6UDF8_RUMA7/3-247TAEA-V------GRLG----------------------------------------------------------------
S5UQG8_STRCU/450-701IAQA-V------GVVT----------------------------------------------------------------
K8E7N2_CARML/7-270IALS-V------GIVA----------------------------------------------------------------
F2JGK7_CELLD/19-268IAFY-T------GVVA----------------------------------------------------------------
Q891X7_CLOTE/27-276VARA-V------AIVS----------------------------------------------------------------
B1HUS6_LYSSC/12-262IAIA-V------GVVA----------------------------------------------------------------
I3YAV5_THIV6/12-259MAQG-L------LDLA----------------------------------------------------------------
D1A9P2_THECD/16-266LAYA-V------GLVA----------------------------------------------------------------
C8XAU5_NAKMY/29-279LAHA-V------GAVT----------------------------------------------------------------
M1FGD7_9ALTE/15-262LARD-I------RSLA----------------------------------------------------------------
R7IPS7_9FIRM/3-247VANA-V------GVLV----------------------------------------------------------------
L0H008_9GAMM/12-261LAQE-V------VALA----------------------------------------------------------------
A1SUD4_PSYIN/14-263LAVE-V------LQLA----------------------------------------------------------------
A8L405_FRASN/18-260VALA-T------GIVA----------------------------------------------------------------
F8K488_STREN/11-259LAHA-V------GVVT----------------------------------------------------------------
Q5NWT5_AROAE/5-254LSGD-C------LRLA----------------------------------------------------------------
A4J1D7_DESRM/40-292LALA-T------AIVA----------------------------------------------------------------
R5GSI4_9FIRM/375-629VADA-V------RTVA----------------------------------------------------------------
F4H5N6_CELFA/535-785MAHA-V------GVVA----------------------------------------------------------------
Q2RVZ5_RHORT/10-255VGRD-V------ARLA----------------------------------------------------------------
D3RPA4_ALLVD/12-259MAQG-V------LDLA----------------------------------------------------------------
E8U3T5_DEIML/6-240VAGD-V------RRLA----------------------------------------------------------------
F8A7B9_CELGA/486-735MALA-V------GVVT----------------------------------------------------------------
I4D513_DESAJ/17-266VAEA-A------GIVS----------------------------------------------------------------
H6R9M2_NOCCG/535-790LALA-V------GTVA----------------------------------------------------------------
Q186J5_PEPD6/5-254LAFS-I------GVMC----------------------------------------------------------------
A5WBK3_PSYWF/17-290LAQD-I------IRLS----------------------------------------------------------------
L0A1Y2_DEIPD/15-266LARH-V------AGLA----------------------------------------------------------------
N0AVA9_9BACI/12-261LALD-I------AVVA----------------------------------------------------------------
I5AXH0_EUBCE/3-247TAYA-V------GSVA----------------------------------------------------------------
C0Z9Y7_BREBN/18-267VALA-S------GVVA----------------------------------------------------------------
A6WD80_KINRD/17-261VALG-V------GVVA----------------------------------------------------------------
J7SKQ6_MORMO/9-249LARD-V------SALA----------------------------------------------------------------
H8GG70_METAL/7-254MAGH-L------LALA----------------------------------------------------------------
Q0SDY7_RHOSR/11-261LARA-V------GTVT----------------------------------------------------------------
F4EXE7_SELS3/3-247TAHA-A------ASLA----------------------------------------------------------------
H6N264_GORPV/15-265LAHA-T------AVVS----------------------------------------------------------------
V4LJY0_9GAMM/11-261MAAD-V------LTLA----------------------------------------------------------------
U5LCP5_9BACI/10-258VALC-T------AVTS----------------------------------------------------------------
Q3JCD3_NITOC/20-269LAAE-V------MRLA----------------------------------------------------------------
Q8KL02_RHIEC/15-256MGAE-T------ARLA----------------------------------------------------------------

PF15609

D5BYR0_NITHN/23-215--HR-L------ATPL----L...........................................................
Q888T1_PSESM/34-221--QD-L------AHKI----P...........................................................
F2JGK6_CELLD/36-258--TL-L------AEVY----YKKQVGKVLQED.......ELLELFNKKE.LPKEACEKVL....................
F8A7B9_CELGA/28-256--LL-L------GDLV----H.................AALMEPAPGDGLDDEARARGAVLRSAVHGEADDAALER....
R4KD23_9FIRM/21-261--FL-L------ASRL----AQTL...................GLPVVNHQISAFVDTLVLDRAGQLPAVNGPYQTFRSP
L0H292_9GAMM/23-213--ER-L------ARPL----G...........................................................
Q186J6_PEPD6/22-211--KL-M------ATIY----NEKNK.......................................................
F4H5N6_CELFA/44-294--LL-L------GSLV----R............DALADVDGGARADAGADPSTGVADQPPATDAATLHGRAGALLRDALA
J9RTC8_9ACTO/32-225--DD-L------GAAI----I.................AAIGANSARDA...............................
D3V2E0_XENBS/35-224--RQ-L------SEQF----P...........................................................
C0ZNQ4_RHOE4/33-221--DD-L------GDLV----R.................TTLGEGVDV.................................
Q0RDF5_FRAAA/27-253--AD-L------AALV----R.................ALPGFPEDGPGAAHAHDAGEAAAAGEA...............
E8U3T7_DEIML/27-218--TT-L------AGQL----P...........................................................
N0ATX4_9BACI/3-219--AI-L------ADRY----AKVVKG......E......NLGLDMMLKD.ALSAEVPPSF....................
V4IMQ6_9ACTO/22-218--VA-L------GRRV----R.................ALLGPEEAARA...............................
Q4FTP7_PSYA2/40-245--TD-L------ANLV----P...........................................................
X2GSG0_9BACI/29-253--AL-L------AMMY----YERLTGKEPLLVQ......SVVQAMQNRD.NVQEILQQVE....................
H6N263_GORPV/13-205--DT-L------GDAV----I.................DLVGADLAARA...............................
A6WD81_KINRD/34-260--AR-L------GGLV----ADVLGVPDAPGPDAGTWRAALAGDELATAAVAAGVQRAPARPDA................
L0A0T7_DEIPD/29-215--DI-L------AGRV----E...........................................................
F8B557_FRADG/36-231--HL-L------AAQV----R...........................................................
C8XAU6_NAKMY/29-253--RL-L------GALV----A.................RALADDGSPVPADWRDAARASVRGGDPDRLMALVAAERRAP.
Q3JCD5_NITOC/23-215--NR-L------ALSL----L...........................................................
B1HUS5_LYSSC/29-252--AL-L------AMMY----DQQGNNQKVNTIT......PVVQALKEGI.NLEE.LQNSM....................
Q9RSB1_DEIRA/35-218--RD-L------AASL----P...........................................................
A5WBK1_PSYWF/41-238--SH-L------AHTV----P...........................................................
Q0SDY6_RHOSR/33-221--DR-L------GDLV----A.................EVLGPDADP.................................
E2Q252_STRC2/22-213--HG-L------GERV----R.................ALLGDAEAGRA...............................
A1SUD2_PSYIN/23-212--DS-L------SESL----G...........................................................
Q5NWT3_AROAE/14-205--RQ-L------AATV----P...........................................................
M1F8F7_9ALTE/56-248--NG-I------VDQI----P...........................................................
V4JFE6_9GAMM/23-221--RM-L------AKSL----C...........................................................
D0L8D2_GORB4/36-225--DD-L------GDAV----I.................GVIGEAGNA.................................
H6R9M2_NOCCG/48-236--NR-L------GDLV----R.................GALGERDA..................................
H8GG72_METAL/25-219--RA-L------ARSV----L...........................................................
U5LBE9_9BACI/23-240--EL-L------AARY----AELKEGLPLPETE......ELLQAFLLDPGVSRP..........................
F3ZD08_9ACTO/22-212--RA-L------GREV----R.................VLLGPAADEA................................
E3EE67_PAEPS/1-230--AA-L------AILL----YKEL..VPQSGQQMDKLIREAVRGLLDSN.YAKEAYEKLM....................
Q2RVZ3_RHORT/30-224--RR-L------AAKL----P...........................................................
G2NBS3_9ACTO/22-216--HE-L------GERV----R.................DLLGETEARRA...............................
C8W645_DESAS/19-238--YL-L------ASRL----AEYM...................GLTVNRKKIKEAVSLLSCEQAGD..............
Q7CKQ5_YERPE/29-218--RQ-L------AERF----P...........................................................
W0LDC5_SERFO/29-220--QQ-L------AAQF----P...........................................................
Q2J6S1_FRASC/55-272--AG-V------AALV----R.................ALPGFEEAGKRVADPRVAD.......................
D5CKR0_ENTCC/30-220--RQ-L------ASQF----P...........................................................
Q891X6_CLOTE/33-257--AL-L------ANKM----VNNIDNGNLDTK.......LIVQALKDDK.YIQKAWEYIK....................
E3IYR1_FRASU/25-221--AA-L------AARA----R...........................................................
A1VWP7_POLNA/22-216--TE-L------AARV----P...........................................................
I0DSI1_PROSM/30-221--QQ-L------CQQF----P...........................................................
V6JVQ1_STRRC/37-226--HR-L------GRRV----A.................ELLGETEAGAA...............................
A8F9P6_BACP2/17-239--GL-L------AMAY----AKEQTGKTSPHQD......LLVEALKTDDHAVLSKAYEAL....................
M1SJV4_MORMO/30-220--RR-L------SEQF----P...........................................................
U5N786_9BURK/38-230--TR-I------AAHI----P...........................................................
A4J1D6_DESRM/37-256--FL-L------ASRL----AELW...................GLSVGKETIRHAVASLSAGVNNE..............
D1A9P3_THECD/28-256--LL-L------GRRI----A......GLPQPAADAAGAALRAALAAERNPPDGARPAARLRD.................
J7ISK8_DESMD/39-259--SS-L------AIQF----MAKIHGVNHADTP......AIVQALKTNE.DTRKVYEAVL....................
C0Z9Y6_BREBN/39-262--MA-L------AARL----LEEF..YSHEVSDLP....EIVQGIIQQE.KSEEILHKLL....................
A8L404_FRASN/37-236--AR-L------AERV----R...........................................................
B4EW77_PROMH/30-221--QQ-M------AKQF----P...........................................................
D1BEJ9_SANKS/28-275--TL-L------GLLV----A................DALGGATTVADAARTAQVGDALTAALAGGPGAAEHLLLVVDGL
C3ASF9_BACMY/11-231--CA-L------AARY----MEVLHRTNHPYQK......EILNLISSKD.STNNELEAIL....................
F8K489_STREN/28-217--LT-L------GHRV----R.................ALLGEEDAARA...............................
D3RPA9_ALLVD/31-224--AH-L------AGQL----D...........................................................
A8MM96_ALKOO/39-263--LL-L------ANRY----MEEFYHIHHK.....EVTKKLIRGFVEEE.NCQQVYKEKI....................
D7C985_STRBB/21-212--VR-L------GRRV----R.................ELLGDEAAARA...............................
K8EW86_CARML/29-250--RA-L------ALTY----ADKMDDQK...........ELIQATLNTEFGSQNFEFNLA....................
I3YAV0_THIV6/25-218--EY-L------ASAL----D...........................................................
R5X4A9_9CLOT/51-237--KD-I------VKVY----EKKQD.......................................................
W0AF65_9SPHN/32-217--RD-L------AGLL----E...........................................................
I4D512_DESAJ/37-259--AA-L------AVQY----ANSLSGITHPYTS......SLLQALRTKQ.KLQEVFAELV....................

PF14681

B9PK97_TOXGO/39-243..TP-L......DVSY....H-----------------------------------------------------------
E3L591_PUCGT/16-219..QS-P......IAPY....T-----------------------------------------------------------
Q5AWP2_EMENI/470-667..HP-Q......GNFV....A-----------------------------------------------------------
E3FKH4_STIAD/10-212..TP-L......ATME....A-----------------------------------------------------------
B1XW63_LEPCP/8-210..TP-L......ETMR....S-----------------------------------------------------------
A5FZR1_ACICJ/10-212..TP-L......EPMT....A-----------------------------------------------------------
Q2RS40_RHORT/14-217..TP-L......EAME....A-----------------------------------------------------------
UPP1_SCHPO/12-217..TA-Q......NAEY....E-----------------------------------------------------------
C5CEA9_KOSOT/6-207..TP-L......CATT....G-----------------------------------------------------------
F0XHJ4_GROCL/10-224..TN-L......GFEY....T-----------------------------------------------------------
D5BUA7_PUNMI/7-209..TP-L......EPMM....T-----------------------------------------------------------
E6ZJH4_SPORE/8-212..GP-L......ATFQ....G-----------------------------------------------------------
A2R643_ASPNC/9-224..TP-L......GTEY....V-----------------------------------------------------------
B0C7X6_ACAM1/9-216..TP-L......GPAA....A-----------------------------------------------------------
D1CCZ6_THET1/6-207..TP-L......ATTR....G-----------------------------------------------------------
B6HJ77_PENCW/9-232..TP-L......GIEY....E-----------------------------------------------------------
B9GJS2_POPTR/275-479..TP-T......GSVY....T-----------------------------------------------------------
UPP_BRADU/6-208..TP-L......ATMH....S-----------------------------------------------------------
E2B6P7_HARSA/345-550..TP-Q......GVLY....N-----------------------------------------------------------
D2QZE9_PIRSD/6-207..TP-L......VTMT....G-----------------------------------------------------------
E3Q271_COLGM/16-231..TP-L......GFEF....I-----------------------------------------------------------
E0U7K3_CYAP2/9-216..TP-L......SECA....A-----------------------------------------------------------
A5EVG4_DICNV/7-209..TP-L......EKIR....S-----------------------------------------------------------
F2UAE3_SALR5/11-216..TP-T......GTTY....D-----------------------------------------------------------
Q8DI28_THEEB/15-222..TP-L......APCG....A-----------------------------------------------------------
Q2H9K6_CHAGB/10-227..TP-L......GFDF....Q-----------------------------------------------------------
B8HYJ3_CYAP4/9-216..TP-L......ADCG....A-----------------------------------------------------------
Q0TWS2_PHANO/12-227..SP-L......GYSY....P-----------------------------------------------------------
Q1AVG9_RUBXD/10-211..TP-L......AETE....V-----------------------------------------------------------
D8TYT8_VOLCA/53-261..TP-L......GAVA....D-----------------------------------------------------------
B0CYQ9_LACBS/7-210..TP-V......GPFT....G-----------------------------------------------------------
E9QGS0_DANRE/320-526..TP-Q......GTVY....E-----------------------------------------------------------
UPP_MYCA5/4-206..TP-I......GVET....I-----------------------------------------------------------
A7S545_NEMVE/352-557..TS-R......GNTY....E-----------------------------------------------------------
B1XP85_SYNP2/9-217..TP-L......AQAP....A-----------------------------------------------------------
F0XXG3_AURAN/8-217..TP-C......GTLT....T-----------------------------------------------------------
C0NWK2_AJECG/11-260..TP-L......GYEY....S-----------------------------------------------------------
B8BYV0_THAPS/18-231..TP-T......NVPY....H-----------------------------------------------------------
C3ZI77_BRAFL/271-477..TP-Q......GSTY....E-----------------------------------------------------------
B2AWA7_PODAN/10-225..TP-L......GFTY....P-----------------------------------------------------------
A8NXX8_COPC7/7-210..SP-V......STFT....G-----------------------------------------------------------
Q53LT4_ORYSJ/267-471..TP-T......GSVY....T-----------------------------------------------------------
E1ZQY9_CHLVA/5-212..TP-L......GVAD....A-----------------------------------------------------------
A5GTE0_SYNR3/9-216..TP-L......ASCE....G-----------------------------------------------------------
B3S289_TRIAD/277-481..TP-Y......GTPY....V-----------------------------------------------------------
C5KJG5_PERM5/30-243..TP-T......EETV....K-----------------------------------------------------------
A4HAL7_LEIBR/9-219..TP-T......GAVY....K-----------------------------------------------------------
A4S9H3_OSTLU/196-418..TP-T......GDQY....K-----------------------------------------------------------
UPP2_SCHPO/13-219..TS-S......GGTY....T-----------------------------------------------------------
B6K7J9_SCHJY/15-220..TH-S......NETY....T-----------------------------------------------------------
C1E7B8_MICSR/254-468..TP-N......GDRY....N-----------------------------------------------------------
B9S674_RICCO/251-459..TP-T......GSIY....P-----------------------------------------------------------
D2SG74_GEOOG/5-206..TP-V......TATT....G-----------------------------------------------------------
A2R0T1_ASPNC/17-223..TP-I......NKPY....T-----------------------------------------------------------
E4X7A3_OIKDI/322-527..TP-Q......GLQY....D-----------------------------------------------------------
D8PR38_SCHCM/5-209..TP-I......SAFT....G-----------------------------------------------------------
D3BNE7_POLPA/239-442..TP-V......GTEY....K-----------------------------------------------------------
B8CAC1_THAPS/44-250..VP-G......TDHK....T-----------------------------------------------------------
D5GBY9_TUBMM/10-229..TP-L......GVAF....D-----------------------------------------------------------
A0CZ39_PARTE/55-262..SP-L......GFYT....A-----------------------------------------------------------
A1C4H4_ASPCL/15-220..TP-V......GKQY....A-----------------------------------------------------------
F0ZZY8_DICPU/270-473..TP-T......GAQY....H-----------------------------------------------------------
Q19583_CAEEL/298-503..MA-G......GRKT....I-----------------------------------------------------------
D1C823_SPHTD/29-232..GH-S......GTPV....P-----------------------------------------------------------
Q5CME0_CRYHO/242-456..TP-I......GELY....D-----------------------------------------------------------
A8GCF9_SERP5/8-213..TP-I......GETY....A-----------------------------------------------------------
A8P7X1_COPC7/39-231..TP-T......GATY....E-----------------------------------------------------------
B7FX04_PHATC/21-232..VP-VPPKEKGGKEE....H-----------------------------------------------------------
A8JC08_CHLRE/54-264..TP-L......GAIA....D-----------------------------------------------------------
A9URE0_MONBE/281-484..TA-V......GTYL....G-----------------------------------------------------------
B6AH00_CRYMR/25-230..SP-M......NVEY....N-----------------------------------------------------------
B6ABC4_CRYMR/233-447..TP-I......GVLY....D-----------------------------------------------------------
E4X3J2_OIKDI/287-498RDSQ-D......KIQY....H-----------------------------------------------------------
A0CTP7_PARTE/56-263..QA-Q......TPAQ.....-----------------------------------------------------------
F2UFG2_SALR5/279-483..MS-D......GSSV....T-----------------------------------------------------------
F0YEY4_AURAN/277-487..TP-L......GVHVPAGDG-----------------------------------------------------------
Q0TVS3_PHANO/438-633..HV-Q......GHTT....S-----------------------------------------------------------
F2PL94_TRIEC/448-645..HV-L......GHQT....S-----------------------------------------------------------
B6GYG1_PENCW/502-699..HV-Q......GHQA....D-----------------------------------------------------------
E3QN18_COLGM/468-663..HV-Q......GRTT....D-----------------------------------------------------------
B2AP82_PODAN/589-789..HV-Q......GHQT...LG-----------------------------------------------------------
D5GK17_TUBMM/495-691..HV-Q......GHPT....T-----------------------------------------------------------
Q0CK66_ASPTN/515-712..HV-Q......GHNT....T-----------------------------------------------------------
C4JD99_UNCRE/393-591..HV-L......GRPT....S-----------------------------------------------------------
C7ZP62_NECH7/505-702..HV-Q......GHQS....N-----------------------------------------------------------
Q2GUM1_CHAGB/474-672..HV-Q......SRST....E-----------------------------------------------------------
E9F4S0_METAR/604-801..HV-Q......GHHV...MG-----------------------------------------------------------
B1WT56_CYAA5/9-216..SP-L......APCN....A-----------------------------------------------------------
C5AAP9_BURGB/13-214..TP-L......VEID....A-----------------------------------------------------------
D5A477_ARTPN/9-216..TP-L......CECP....A-----------------------------------------------------------
E9C694_CAPO3/359-559..TP-S......NALF....Q-----------------------------------------------------------
G7Z3C1_AZOL4/35-237..TP-L......QPMD....A-----------------------------------------------------------
H3D4M3_TETNG/291-494..TP-Q......GEEY....E-----------------------------------------------------------
Q4WZP7_ASPFU/9-223..TP-L......GIEY....E-----------------------------------------------------------
Q5KGX1_CRYNJ/6-210..SP-I......APFT....G-----------------------------------------------------------
Q7UFD1_RHOBA/6-207..TP-V......ADAP....C-----------------------------------------------------------
R7D7S5_9FIRM/7-208..TP-I......EKCK....S-----------------------------------------------------------

PF14572

E9FWJ1_DAPPU/165-348--DM.V------DGRH----------------------------------------------------------------
KPRB_HUMAN/179-363--DL.V------DGRH----------------------------------------------------------------
Q961V3_DROME/165-361--DE.V------DGRY----------------------------------------------------------------
F1KVQ3_ASCSU/169-364--MI.E------DGRQ----------------------------------------------------------------
Q6P8C3_XENTR/167-349--DM.V------DGRH----------------------------------------------------------------
Q23166_CAEEL/167-347--SGLE------DGRQ----------------------------------------------------------------
A7T9J2_NEMVE/4-194--DQ.C------DGRQ----------------------------------------------------------------
F1L6K6_ASCSU/169-364--QAEE------DGRQ----------------------------------------------------------------
B3S6Z0_TRIAD/157-339--DE.D------GSGS----------------------------------------------------------------

PF00156

PYRE_DEIRA/34-188--------------.DVRAIF-----AEK------DGSGGMKLRE..--------------------------------.
Q3SMI9_THIDA/14-177--------------.DLQIKR-----YAD------DLTLLHPETQLT--------------------------------E
PYRE_BIFLO/37-192--------------.FDRKEK-----KDH------GDGGWMV.....--------------------------------.
A6GZJ5_FLAPJ/2-150--------------.DVNINK-----RNP------NSPITTSI....--------------------------------.
PYRE_PROAC/43-197--------------.YVRSVP-----KDH------GRGNQI......--------------------------------.
Q8EVI3_MYCPE/12-166--------------.FLGHKS-----VSK------NSNIKVIANF..--------------------------------.
Q0CVT8_ASPTN/931-1096--------------.LIREEG-----KLP------PPTVSVSRSASH--------------------------------I
Q2YAL8_NITMU/16-212--------------.VVLVRK-----VRA------PGNPEFAIGSVD--------------------------------E
Q4XNN5_PLACH/73-239--------------.YDRKEK-----KDY------GDASVIIGNLEE--------------------------------N
Q1DDD8_MYXXD/86-239--------------.PVRISR-----RSR------DRGSAAPRTSKS--------------------------------P
Q6NF43_CORDI/11-164--------------.DAINVE-----FYT------DVNETLPDPVLL--------------------------------E
KPRS_METS3/132-293--------------.YLSKVR-----LGP------DKVETRIVDVEG--------------------------------S
A5V979_SPHWW/2-156--------------.SVDHSS-----HLP------DFSAGLLAT...--------------------------------.
A7E5A9_SCLS1/57-218--------------.YSRKFW-----YDD------ALSAAVSSITSP--------------------------------E
C1DM73_AZOVD/5-153--------------.DLESFC-----RNE------SPANGGTRSPGK--------------------------------P
A8LJR1_DINSH/150-296--------------.IVDKRR-----SQP------GVVEEMT.....--------------------------------.
UPP_AQUAE/39-188--------------.GFLGIK-----RNE------ETLESH......--------------------------------.
Q8EUA5_MYCPE/11-161--------------.FMTVSS-----FQG------KTYGVTEPQISH--------------------------------N
Q0K973_CUPNH/14-164--------------.ILATSS-----YRE------AAGTQQGNLDIA--------------------------------Q
A4CGY8_ROBBH/133-287--------------.VLQKVR-----HGD------RDVEVSVP....--------------------------------.
A3U7I6_CROAH/14-161--------------.FIKVAS-----YEG------MQQGEITTVMG.--------------------------------.
A6QAE7_SULNB/5-148--------------.SINSIL-----YEG------DQKGKQCKVFN.--------------------------------.
Q2RSZ0_RHORT/17-167--------------.GIVSVI-----RNQ------TAGPFAHRGAPA--------------------------------I
HPRT_MYCPN/9-158--------------.FVAVAS-----YHG------GSRQQEAPKIVL--------------------------------D
O83317_TREPA/210-372--------------.MIYKVR-----DYS------VVAQNAKQSNIV--------------------------------E
PYRR2_LACPL/1-156--------------.ELDITA-----FRD------DQPLDQARLSTD--------------------------------Y
Q4DVM9_TRYCC/44-213--------------.LASATK-----RFP------STFLPEGQGPMV--------------------------------L
PYRE_HYPNA/34-182--------------.FAERVD-----GQL------QFRRGFS.....--------------------------------.
PURR_STRR6/106-265--------------.IVRRDL-----KIT------EGSTVSVNYVSG--------------------------------S
Q27375_TOXGO/94-256--------------HYVRLKS-----YQN------DNSTGQLTVLSD--------------------------------.
XGPT_RHOS4/14-159--------------.DTISVK-----SYN------WQEQQAPTVIKA--------------------------------P
Q4FP84_PELUB/15-165--------------.YIVIQS-----YSG------KGMEDKQGQLMF--------------------------------A
Q5NI77_FRATT/16-164--------------.FITASS-----YGS------STKSSGTVTLTE--------------------------------T

PF15610

M2SQF2_COCSN/2-255--------------VLSD...-----QVP------TATHSLRDHFVA--------------------------------Y
C6XW67_PEDHD/2-266--------------VISSPYC-----FIP------TATFAMKNYFVY--------------------------------Q
H1Z8U3_MYROD/1-264--------------IFPSPYM-----AIP------TASNYLCYYFKL--------------------------------E
C7PNW9_CHIPD/2-265--------------VLPSPYT-----TIP------TASYHMTTAFVK--------------------------------M
Q0UEK8_PHANO/2-265--------------VLSD...-----HVP------TATHNLREHFTA--------------------------------Y
E3QYQ0_COLGM/52-331--------------VSQG...-----SLP------TAATTFESAFCQ--------------------------------Y
E4ZIV8_LEPMJ/2-262--------------VLSD...-----SIP------TATHGLRRHFVA--------------------------------Y
R0KEE4_SETT2/2-259--------------VLSE...-----KVP------TATHSLRNHFVA--------------------------------Y
G2Z396_FLABF/1-265--------------ILPSPYL-----SIP------TASNFLCYYFKK--------------------------------E
H1YCE2_9SPHI/3-265--------------VISSPFS-----FIP------TATFALKTWFVC--------------------------------H
B2WKS8_PYRTR/2-256--------------VLSE...-----KVP------TATHSLRDHFVA--------------------------------Y
G0JP06_9GAMM/87-357--------------MMTTGWR-----NVP------STANVLYEFVVE--------------------------------E

PF11202

Q888S9_PSESM/14-255--------------HALEREC.....DGS......PIILVSFVRAGL--------------------------------P
R5XB52_9CLOT/25-275--------------EKILKRH.....D.E......NVVLVSLARAGT--------------------------------P
Q7CKQ6_YERPE/9-249--------------KALINRF.....GDT......PIVLASLVRAGV--------------------------------P
I0DSH9_PROSM/9-249--------------KALIQQF.....DKT......PIVLTSLVRAGV--------------------------------P
STIP_ACIAD/20-273--------------QTLVVEF.....N.E......PIVLVSFVRAGV--------------------------------P
W0ADD0_9SPHN/11-256--------------LALAERA.....G.PGR....EVVIVSLARAGT--------------------------------P
A1VWP9_POLNA/5-253--------------ALIAARR.....S.G......PITLVSLVRAGT--------------------------------P
E4NAQ4_KITSK/21-265--------------ETLLRER.....G.P......RLVLASLARAGT--------------------------------P
D3VJW4_XENNA/9-249--------------KALVSRV.....GDK......PIVLVSLVRAGV--------------------------------P
D0L8D3_GORB4/17-267--------------ELLVAER.....H.P......QPVLVSLARAGT--------------------------------P
C8W646_DESAS/34-283--------------MTLLKDP.....Y.K......KIVLVSLARAGT--------------------------------P
X2GQ89_9BACI/11-261--------------QQIVARQ.....GLE......HLVLVSLARAGT--------------------------------P
R5BVZ9_9FIRM/3-247--------------DKIMEEK.....G.R......SVVLVSLARAGT--------------------------------P
D5CKQ8_ENTCC/9-249--------------ISLAERF.....GDE......PIVLASLVRAGV--------------------------------P
F8AVP2_FRADG/12-254--------------ELVLAAR.....A........RPVIVSLARAGT--------------------------------P
J9STB4_9ACTO/17-267--------------ELILAER.....H.S......APTLVSLARAGT--------------------------------P
A8MM96_ALKOO/473-722--------------EKIIKNR.....G.K......NIVLVSLARAGT--------------------------------P
Q9RSA8_DEIRA/11-250--------------AAVLREY.....D........QPVLVSLARAGT--------------------------------P
E3EE68_PAEPS/21-271--------------EMIVRKR.....G.L......NTAIVSLARAGT--------------------------------P
A8F9P7_BACP2/9-258--------------EQIVKRR.....G.F......QTVLCSLARAGT--------------------------------P
R7CDA0_9FIRM/3-247--------------DKIIENK.....G.K......KIVLVSLARAGI--------------------------------P
Q4FTP9_PSYA2/19-285--------------YTLQQVF.....Q.PNVNNESPLILVSLVRAGL--------------------------------P
D1BEJ8_SANKS/16-268--------------ELVLAER.....G.D......KAVLVSLARAGT--------------------------------P
J7INJ2_DESMD/17-266--------------EQILQKK.....G.S......EMVLVSLARAGT--------------------------------P
R4KIZ1_9FIRM/43-295--------------EQIMRKR.....G.R......RVALVSLARAGT--------------------------------P
U5NAN4_9BURK/5-254--------------RAIVEQV.....G.T......APTIVSLARAGT--------------------------------P
E6UDF8_RUMA7/3-247--------------QLIFKDK.....G.E......NAVLVSLARAGT--------------------------------S
S5UQG8_STRCU/450-701--------------ETVLAER.....S.P......RPVLVSLARAGT--------------------------------P
K8E7N2_CARML/7-270--------------EQIIASKRKYYQG.DLGKTLENLVLVSLARAGT--------------------------------P
F2JGK7_CELLD/19-268--------------ELIYRKK.....G.K......DVVIVSLARAGT--------------------------------P
Q891X7_CLOTE/27-276--------------ELIYRKK.....G.E......NIVIVSLARAGT--------------------------------P
B1HUS6_LYSSC/12-262--------------ERIVKSR.....GLE......NLILVSLARAGT--------------------------------P
I3YAV5_THIV6/12-259--------------AIVAARR.....P.Y......DITLVSLARAGT--------------------------------P
D1A9P2_THECD/16-266--------------ELILAER.....G.P......GAVLVSLARAGT--------------------------------P
C8XAU5_NAKMY/29-279--------------ELVLAER.....G.P......DVVLASLARAGT--------------------------------P
M1FGD7_9ALTE/15-262--------------GQILELV.....Q.QGRLNR.EITLCSLVRAGV--------------------------------P
R7IPS7_9FIRM/3-247--------------DKIMQKR.....G.K......SVVLVSLARAGI--------------------------------P
L0H008_9GAMM/12-261--------------GHLARTR.....P.A......PLAIVSLARAGT--------------------------------P
A1SUD4_PSYIN/14-263--------------KKIVENR.....D.G......DICILSLVRAGT--------------------------------P
A8L405_FRASN/18-260--------------ELVRHTK.....P........APVIASIARAGT--------------------------------P
F8K488_STREN/11-259--------------ETVLAER.....G.P......APVLVSLARAGT--------------------------------P
Q5NWT5_AROAE/5-254--------------QLLYEKH.....G.S......DLALVSLARAGT--------------------------------P
A4J1D7_DESRM/40-292--------------ETILKKR.....G.K......NLVLVSLARAGT--------------------------------P
R5GSI4_9FIRM/375-629--------------EAIWAEK.....G.R......RAVLVSLARAGT--------------------------------P
F4H5N6_CELFA/535-785--------------EQVIAAR.....G.G......APTLVSLARAGT--------------------------------P
Q2RVZ5_RHORT/10-255--------------KALAARG.....EDG......EIVLVSLARAGT--------------------------------P
D3RPA4_ALLVD/12-259--------------AIIAARR.....P.D......EITLVSLARAGT--------------------------------P
E8U3T5_DEIML/6-240--------------DTLHAEL.....G.G......TLTLVSLARAGT--------------------------------P
F8A7B9_CELGA/486-735--------------ERALAAR.......T......EPVLVSLARAGT--------------------------------P
I4D513_DESAJ/17-266--------------EQILRRN.....G.S......RTVLVSLARAGT--------------------------------P
H6R9M2_NOCCG/535-790--------------ELVVAER.....G.T......DIVLVSLARAGT--------------------------------P
Q186J5_PEPD6/5-254--------------EKIIKKN.....G.N......DVVLVSLARAGT--------------------------------P
A5WBK3_PSYWF/17-290--------------TTLKSLF.....E.TQTNSRSPLILVSLVRAGL--------------------------------P
L0A1Y2_DEIPD/15-266--------------RVVHEEV.....R.IRRRVNSAIVLVSLARGGT--------------------------------P
N0AVA9_9BACI/12-261--------------EQIFHIK.....G.K......ETVLVSLARAGT--------------------------------P
I5AXH0_EUBCE/3-247--------------QTIWKKK.....G.K......KAVLVSLARAGT--------------------------------P
C0Z9Y7_BREBN/18-267--------------ESILARK.....G.K......GVVLASLARAGT--------------------------------P
A6WD80_KINRD/17-261--------------ELLRAER.....G.E......ELLLASLARAGT--------------------------------P
J7SKQ6_MORMO/9-249--------------RTLGDYF.....ADQ......PVVLVSLVRAGV--------------------------------P
H8GG70_METAL/7-254--------------ERIVRLR.....K.G......QIALVSLARAGT--------------------------------P
Q0SDY7_RHOSR/11-261--------------DLVLAER.....G.R......DVTLVSLARAGT--------------------------------P
F4EXE7_SELS3/3-247--------------EKIYEEK.....G.A......SAALVSLARAGT--------------------------------P
H6N264_GORPV/15-265--------------ELVVAER.....D.R......QPTLVSLARAGT--------------------------------P
V4LJY0_9GAMM/11-261--------------RRIAGAR.....S.G......PLTIVSLARAGT--------------------------------P
U5LCP5_9BACI/10-258--------------EKLLSRR.....G.D......KIVLVSLARAGT--------------------------------P
Q3JCD3_NITOC/20-269--------------QSIVNTR.....L.A......PITLVSLVRAGT--------------------------------P
Q8KL02_RHIEC/15-256--------------LAIVQSV.....E.G......PITLVSLVRAGV--------------------------------P

PF15609

D5BYR0_NITHN/23-215...................E------VPG------SVIFIGMAETAT--------------------------------G
Q888T1_PSESM/34-221..................VD------LPG------PVLVIGMAETAV--------------------------------G
F2JGK6_CELLD/36-258.............EVTYP..------LEQ------ETLFIGFAETAT--------------------------------G
F8A7B9_CELGA/28-256.............LTAARGR------PAV------DVTVLGYAETAT--------------------------------A
R4KD23_9FIRM/21-261NNVKK..HQPYKPYQP..YH------LPG------RALFIGFAETAT--------------------------------A
L0H292_9GAMM/23-213...................D------SPG------PVLALGLAETAT--------------------------------G
Q186J6_PEPD6/22-211....................------EES------NGTVIAFAETGT--------------------------------A
F4H5N6_CELFA/44-294GDPTA..PAALVAATTPAGT------RPL------DAVVLGYAETAT--------------------------------A
J9RTC8_9ACTO/32-225....................------...------..VVFGFAETAT--------------------------------G
D3V2E0_XENBS/35-224..................TH------IPG------PVLYIGMAETAV--------------------------------G
C0ZNQ4_RHOE4/33-221....................------...------..VVLGFAETAT--------------------------------G
Q0RDF5_FRAAA/27-253....A..AVGEAAAAGHRDG------ARP------GPLVIGYCETAT--------------------------------A
E8U3T7_DEIML/27-218..................PD------LPG------PVLFVGLAETAT--------------------------------A
N0ATX4_9BACI/3-219.............RSPFISE------HTN------PII.IGFAETAT--------------------------------G
V4IMQ6_9ACTO/22-218....................------...------..VVLGYAETAT--------------------------------A
Q4FTP7_PSYA2/40-245..................DD------LPE------PILVIGMAETAV--------------------------------G
X2GSG0_9BACI/29-253.............EQGLE..------LAE------DVLFIGFAETAT--------------------------------A
H6N263_GORPV/13-205....................------...------..TVLGFAETAT--------------------------------G
A6WD81_KINRD/34-260....................------...------..LVVGYAETAT--------------------------------G
L0A0T7_DEIPD/29-215....................------.PG------ATVWIGMAETAT--------------------------------A
F8B557_FRADG/36-231..........ADQRATGGDR------VTV------APLVLGYCETAT--------------------------------S
C8XAU6_NAKMY/29-253....A..PDV..........------...------..LTVGFAETAT--------------------------------S
Q3JCD5_NITOC/23-215...................E------IPG------PAIFIGMAETAT--------------------------------G
B1HUS5_LYSSC/29-252.............KGSVE..------LAH------KTLFIGFAETAT--------------------------------A
Q9RSB1_DEIRA/35-218...................P------LTA------P.HFIGLAETAT--------------------------------A
A5WBK1_PSYWF/41-238..................DN------LPE------PIVVVGMAETAV--------------------------------G
Q0SDY6_RHOSR/33-221....................------...------..VVLGFAETAT--------------------------------G
E2Q252_STRC2/22-213....................------...------..LVVGYAETAT--------------------------------G
A1SUD2_PSYIN/23-212....................------EDQ------LTYVVSLAEAAT--------------------------------G
Q5NWT3_AROAE/14-205...................D------AEG------PVVFIGMAETAT--------------------------------G
M1F8F7_9ALTE/56-248.................DAL------LGG------PLLVMGYAETAV--------------------------------G
V4JFE6_9GAMM/23-221...................D------LPG------PIWVIGMAETAT--------------------------------G
D0L8D2_GORB4/36-225....................------...------..TVVGFAETAT--------------------------------G
H6R9M2_NOCCG/48-236....................------...------..VVLGFAETAT--------------------------------G
H8GG72_METAL/25-219.................DSG------TGQ------RALWIGMAETAT--------------------------------G
U5LBE9_9BACI/23-240.............SIPFVDK------KYN------PVI.IGFAETAT--------------------------------A
F3ZD08_9ACTO/22-212....................------...------..VVLGYAETAT--------------------------------G
E3EE67_PAEPS/1-230.............DERLSFA------FPE------PIKFVGFAETAT--------------------------------A
Q2RVZ3_RHORT/30-224..................AN------LPG------PVVAIGMAETAI--------------------------------C
G2NBS3_9ACTO/22-216....................------...------..VVVGYAETAT--------------------------------G
C8W645_DESAS/19-238.............FQPVSYE------LSG------KSLFIGFAETAT--------------------------------A
Q7CKQ5_YERPE/29-218..................AD------LPG------PVLFIGMAETAV--------------------------------G
W0LDC5_SERFO/29-220..................AC------DTG------PVLFIGMAETAV--------------------------------G
Q2J6S1_FRASC/55-272.......PPVQGSSAEQPGG------PRT------GPIVIGYCETAT--------------------------------A
D5CKR0_ENTCC/30-220..................ST------LTG------PVLFIGMAETAV--------------------------------G
Q891X6_CLOTE/33-257.............DNPIM..------CNK------STLFIGFAETAT--------------------------------A
E3IYR1_FRASU/25-221.........AGSAAAQASLA------SGE------TVFVLGYCETAT--------------------------------A
A1VWP7_POLNA/22-216..................AN------LPG------PVIFIAMAETAI--------------------------------G
I0DSI1_PROSM/30-221..................ST------LEG------PVLFIGMAETAV--------------------------------G
V6JVQ1_STRRC/37-226....................------...------..VVLGYAETAT--------------------------------G
A8F9P6_BACP2/17-239.............KKEKLSV------GKQ------PIV.IGFAETAT--------------------------------A
M1SJV4_MORMO/30-220..................QD------LPQ------PLLVIGMAETAV--------------------------------G
U5N786_9BURK/38-230...................E------LPD------PIVFVGMAETAT--------------------------------C
A4J1D6_DESRM/37-256.............FHPPSYS------FPG------KALFIGFAETAT--------------------------------A
D1A9P3_THECD/28-256.............MLREAPA------APM------PALVIGYAETAT--------------------------------A
J7ISK8_DESMD/39-259.............SKPRF.V------LPQ------KTLFIGFAETAT--------------------------------G
C0Z9Y6_BREBN/39-262.............QHPLE..------LPE------PLLFIGFAETAT--------------------------------A
A8L404_FRASN/37-236....A..LPAPARWAGPGPG------AAE------VPIVIGYCETAT--------------------------------A
B4EW77_PROMH/30-221..................QS------LEG------PILFIGMAETAV--------------------------------G
D1BEJ9_SANKS/28-275HDAVTEIAEVGSERGAAAPG------SAG------TTVVVGYAETAT--------------------------------A
C3ASF9_BACMY/11-231.............QYQFP..------LEK------EVLFIGFAETAT--------------------------------A
F8K489_STREN/28-217....................------...------..LVLGYAETAT--------------------------------G
D3RPA9_ALLVD/31-224...................L------GAG------PCLFVAMAETAT--------------------------------G
A8MM96_ALKOO/39-263.............KTPNR..------LPE------PTLFIGFAETAT--------------------------------G
D7C985_STRBB/21-212....................------...------..VVLGYAETAT--------------------------------G
K8EW86_CARML/29-250.............QLPKV.E------LVK------PVTIIGFCETAT--------------------------------A
I3YAV0_THIV6/25-218...................L------GPG------PWAFMAMAETAT--------------------------------G
R5X4A9_9CLOT/51-237....................------YLN------SGVVISFAETGT--------------------------------A
W0AF65_9SPHN/32-217..................AD------LPG------PVLVVGLAETAV--------------------------------C
I4D512_DESAJ/37-259.............QKPLM.V------LPE------KTLFIGFAETAT--------------------------------A

PF14681

B9PK97_TOXGO/39-243-------------.G....V.S....FYS......KICGVSIVRAGE................................S
E3L591_PUCGT/16-219-------------.G....V.A....LEA......RIGISPILRAGI................................G
Q5AWP2_EMENI/470-667-------------.G...YR.L....LDE..E...QTLIVPLMRGGQ................................S
E3FKH4_STIAD/10-212-------------.P....V.L....DGK......KLVLVAILRAGQ................................G
B1XW63_LEPCP/8-210-------------.P....V.I....EGR......KTVFVVIMRAGS................................G
A5FZR1_ACICJ/10-212-------------.R....Q.V....SGK......KLCFISILRAGN................................G
Q2RS40_RHORT/14-217-------------.P....V.I....GGK......KLVVVPILRAGQ................................G
UPP1_SCHPO/12-217-------------.G....V.M....FDG......RICGVSIMRAGE................................S
C5CEA9_KOSOT/6-207-------------.K....M.I....EDK......KVTVVPILRAGL................................G
F0XHJ4_GROCL/10-224-------------.T....T.M....VHP..Q...KICLVPILRSGL................................G
D5BUA7_PUNMI/7-209-------------.A....S.L....ADP......APCLVSILRAGN................................G
E6ZJH4_SPORE/8-212-------------.E....Q.L....SE.......RIGLVPILRAGL................................G
A2R643_ASPNC/9-224-------------.T....H.D....IDP..S...DIALVPILRSGL................................G
B0C7X6_ACAM1/9-216-------------.A....V.I....NPE..L...PVAVVPILRAGL................................T
D1CCZ6_THET1/6-207-------------.Y....D.L....QW.......RIGFVPILRAGL................................G
B6HJ77_PENCW/9-232-------------.T....Q.G....IDP..A...DLALVPILRSGL................................G
B9GJS2_POPTR/275-479-------------.G....V.D....FCK......KLCGVSIVRSGE................................S
UPP_BRADU/6-208-------------.A....K.I....AGK......KLVFVPMLRAGT................................T
E2B6P7_HARSA/345-550-------------.G....K.R....GAT..D...KICGVSILRAGE................................T
D2QZE9_PIRSD/6-207-------------.S....T.L....AQ.......RIGLVPILRAGL................................G
E3Q271_COLGM/16-231-------------.S....T.E....ITP..G...SLCLVPILRSGL................................G
E0U7K3_CYAP2/9-216-------------.T....L.I....NPE..V...PIAVIPILRAGL................................A
A5EVG4_DICNV/7-209-------------.K....E.L....QGK......KTCIISILRAGN................................G
F2UAE3_SALR5/11-216-------------.G....T.R....PA...K...QICGVSILRAGE................................S
Q8DI28_THEEB/15-222-------------.M....V.V....NPQ..V...PLVVVPILRAGL................................A
Q2H9K6_CHAGB/10-227-------------.T....H.Q....LLP..A...TVSLIPILRSGL................................G
B8HYJ3_CYAP4/9-216-------------.T....M.I....NPE..A...AIAVVPILRAGL................................A
Q0TWS2_PHANO/12-227-------------.T....H.T....TSPSPS...SISLVPILRSGL................................S
Q1AVG9_RUBXD/10-211-------------.Q....E.I....SA.......PVCLVPVLRAGI................................G
D8TYT8_VOLCA/53-261-------------.A...TL.V....DPS..R...PVKVIPILRAGL................................V
B0CYQ9_LACBS/7-210-------------.T....K.I....KP.......RIGLTPILRAGL................................G
E9QGS0_DANRE/320-526-------------.G....K.R....LSG..K...RITGVSILRAGE................................T
UPP_MYCA5/4-206-------------.G....K.S....FDR......EVVIIPILRAGL................................G
A7S545_NEMVE/352-557-------------.G....K.K....FMG..K...RLCGVSILRAGE................................T
B1XP85_SYNP2/9-217-------------.T....L.I....HPQ..T...PIIAIPILRAGL................................S
F0XXG3_AURAN/8-217-------------.GS..AV.V....VPE..R...DICLVDIMRSGA................................I
C0NWK2_AJECG/11-260-------------.E....E.T....IIT..E...NIALVPILRSGLGMVQGLSPIVQLRQPFRAFSPVVCLPIQSPNFP
B8BYV0_THAPS/18-231-------------.G....Q.LSIVDTDP..D...KVCAVSIVRAGD................................S
C3ZI77_BRAFL/271-477-------------.G....M.R....FNW..R...RLCGVSILRAGE................................T
B2AWA7_PODAN/10-225-------------.T....T.H....LSP..S...TISLVPILRSGL................................S
A8NXX8_COPC7/7-210-------------.T....T.V....KP.......RLGLTPILRAGL................................G
Q53LT4_ORYSJ/267-471-------------.G....V.E....FSK......RLCGISVIRSGE................................S
E1ZQY9_CHLVA/5-212-------------.T....F.V....DPM..Q...PIKVVPILRAGL................................V
A5GTE0_SYNR3/9-216-------------.Q....V.M....DPT..T...PVLAIPILRAGL................................G
B3S289_TRIAD/277-481-------------.G....K.R....FNG......SICGVSILRAGE................................T
C5KJG5_PERM5/30-243-------------.G....V.R....LPE..D...HLMAVSIVRAGE................................S
A4HAL7_LEIBR/9-219-------------.G....V.R....PDD..R...GIIGVSIMRAGE................................S
A4S9H3_OSTLU/196-418-------------.G....V.T....FCS......KLCGVSIIRSGE................................A
UPP2_SCHPO/13-219-------------.G....V.Q.....PA..R...DICGVSILRAGE................................S
B6K7J9_SCHJY/15-220-------------.G....I.Q....FSQ......KVCCVSILRAGE................................S
C1E7B8_MICSR/254-468-------------.G....V.T....FSK......KICGVALIRSGE................................A
B9S674_RICCO/251-459-------------.G....V.V....FCK......RLCGVSVIRSGE................................S
D2SG74_GEOOG/5-206-------------.Y....R.L....AAP.......PLIVPVLRAGL................................G
A2R0T1_ASPNC/17-223-------------.G....I.R....FTK......GVCGVSILRAGA................................C
E4X7A3_OIKDI/322-527-------------.G....V.R....FSG..N...GLCGVSILRAGE................................T
D8PR38_SCHCM/5-209-------------.T....I.I....KP.......RVGLTPILRAGL................................G
D3BNE7_POLPA/239-442-------------.G....V.E....PD...Y...NLCALSVLRAGS................................C
B8CAC1_THAPS/44-250-------------.HIEATG.T....KLA..Q...KVALIPILRSGL................................G
D5GBY9_TUBMM/10-229-------------.V....E......KVT..K...SIALVPILRSGL................................G
A0CZ39_PARTE/55-262-------------NE....V.K....FSD..E...EICIVSILRSGN................................A
A1C4H4_ASPCL/15-220-------------.G....W.R....PD...Q...EICGVSILRAGA................................S
F0ZZY8_DICPU/270-473-------------.G....M.T....LNA......KVCALIVLRAGG................................C
Q19583_CAEEL/298-503-------------.G....K.R....KDA......QICGLPIMRAGE................................C
D1C823_SPHTD/29-232-------------.G....H.R....LAE......RVAALAILRAGL................................G
Q5CME0_CRYHO/242-456-------------.G...VQ.F....NYK..D...KLCAVSIVRGGE................................S
A8GCF9_SERP5/8-213-------------.G....L......KLA..R...GICGVSVIRAGE................................S
A8P7X1_COPC7/39-231-------------.G....V.G....FEG......KICGVSILRAGE................................A
B7FX04_PHATC/21-232-------------.V....E.Y....QGS..KLVEHVALIPILRSGL................................G
A8JC08_CHLRE/54-264-------------.A....TIC....DPD..Q...PIKVIPILRAGL................................V
A9URE0_MONBE/281-484-------------.R....R.R....TH.......QITGVSIVRAGM................................S
B6AH00_CRYMR/25-230-------------.G....I.T....FNT......PICGVSVLRSGE................................A
B6ABC4_CRYMR/233-447-------------.G....VTC....NFK..D...KLCAVSIVRGGE................................S
E4X3J2_OIKDI/287-498-------------.G....K.R....FSG..Q...GLCGISILRAGE................................T
A0CTP7_PARTE/56-263-------------.E....I.Q....FEN..K...QFCVVVMVRSGN................................A
F2UFG2_SALR5/279-483-------------.G....K.R....VTK......QLVGVAIVRAGL................................P
F0YEY4_AURAN/277-487-------------.A....A.T....RLA..A...RVCLIPIMRAGL................................G
Q0TVS3_PHANO/438-633-------------.G...FR.L....LHE..G...QTLIVALMRGGE................................P
F2PL94_TRIEC/448-645-------------.G...HQ.L....YHE..S...QTLIVAVMRAGE................................P
B6GYG1_PENCW/502-699-------------.G...YR.L....LHE..E...ATLIVPLMRGGE................................P
E3QN18_COLGM/468-663-------------.G...YR.L....LDE..D...STVIVALMRGGE................................P
B2AP82_PODAN/589-789-------------.H....R.V....KNE..K...KTAIVALMRGGE................................P
D5GK17_TUBMM/495-691-------------.G...YR.L....CRE..E...NTSIVALMRGGE................................A
Q0CK66_ASPTN/515-712-------------.G...FR.L....ARE..E...RTLIVALMRGGE................................P
C4JD99_UNCRE/393-591-------------.G...YR.L....LNE..S...QTLIVALMRGGE................................P
C7ZP62_NECH7/505-702-------------.G...YR.L....RHE..Q...QTSIVALMRGGE................................P
Q2GUM1_CHAGB/474-672-------------.G...YR.V....RHE..N...RTTIVALMRGGE................................P
E9F4S0_METAR/604-801-------------.H....R.V....RHE..R...ETTIVALMRGGE................................P
B1WT56_CYAA5/9-216-------------.T....L.I....NPE..I...PIAVIPILRAGL................................S
C5AAP9_BURGB/13-214-------------.P....V.I....AGK......KVAIVPVLRAGI................................G
D5A477_ARTPN/9-216-------------.T....Y.I....NPE..A...PMVVIPILRAGL................................A
E9C694_CAPO3/359-559-------------.G....Q.R....FNG......TLIGVSIVRAGV................................T
G7Z3C1_AZOL4/35-237-------------.P....V.I....LGK......KLAVVPVLRAGL................................G
H3D4M3_TETNG/291-494-------------.G....R.R....YRG..K...GITGVSVLRAGE................................T
Q4WZP7_ASPFU/9-223-------------.T....T.T....IDP..A...NVALVPILRSGL................................G
Q5KGX1_CRYNJ/6-210-------------.Q....T......IPL......RIGLSPILRAGI................................G
Q7UFD1_RHOBA/6-207-------------.H....E.L....AT.......DIGIVPVLRAGL................................G
R7D7S5_9FIRM/7-208-------------.P....M.I....AGK......KLAVVPVLRAGL................................G

PF14572

E9FWJ1_DAPPU/165-348--------------------------SPPTLRS.............R--------------------------------T
KPRB_HUMAN/179-363--------------------------SPPMVRS............VA--------------------------------A
Q961V3_DROME/165-361--------------------------SPPPTRNSTPQHAPTSSARQR--------------------------------T
F1KVQ3_ASCSU/169-364--------------------------SPPLSTQLPEGDR.RESLGAA--------------------------------A
Q6P8C3_XENTR/167-349--------------------------SPPTVKN.............T--------------------------------.
Q23166_CAEEL/167-347--------------------------SPPPN................--------------------------------.
A7T9J2_NEMVE/4-194--------------------------SPPPKPENSI......GFNFV--------------------------------P
F1L6K6_ASCSU/169-364--------------------------SPPPENYPADGL..QQETSAS--------------------------------A
B3S6Z0_TRIAD/157-339--------------------------PPPEYDD.............S--------------------------------S

PF00156

PYRE_DEIRA/34-188........................-----..------------------................AFAV--R--------
Q3SMI9_THIDA/14-177NP......................-----..------------------..............AHAAID--L--------
PYRE_BIFLO/37-192........................-----..------------------................GTPL--T--------
A6GZJ5_FLAPJ/2-150........................-----..------------------................AKKD--Y--------
PYRE_PROAC/43-197........................-----..------------------................EGRI--P--------
Q8EVI3_MYCPE/12-166........................-----..------------------................DPLE--I--------
Q0CVT8_ASPTN/931-1096SASATASKL...............-----..------------------.......SKRTRIEISSETI--P--------
Q2YAL8_NITMU/16-212TGWVYLTSHARDVGADENYIKDEV-----SA------------------QLETIRQRRAQYTPVRPSID--P--------
Q4XNN5_PLACH/73-239HIG.....................-----..------------------.............SAQVEKK--T--------
Q1DDD8_MYXXD/86-239QLA.....................-----..------------------..............GEMPAE--L--------
Q6NF43_CORDI/11-164PL......................-----..------------------...............LDTNS--I--------
KPRS_METS3/132-293SDE.....................-----..------------------..............TVNVDS--V--------
A5V979_SPHWW/2-156........................-----..------------------................LAGM--S--------
A7E5A9_SCLS1/57-218LGLKNT..................-----..------------------...........YLDPHLLPL--L--------
C1DM73_AZOVD/5-153........................-----..------------------................LARA--W--------
A8LJR1_DINSH/150-296........................-----..------------------................VIGE--V--------
UPP_AQUAE/39-188.IY.....................-----..------------------..............YSRLPE--L--------
Q8EUA5_MYCPE/11-161........................-----..------------------................ISEN--I--------
Q0K973_CUPNH/14-164YI......................-----..------------------...............TMTRG--E--------
A4CGY8_ROBBH/133-287........................-----..------------------................NVAK--Y--------
A3U7I6_CROAH/14-161........................-----..------------------................AEPS--L--------
A6QAE7_SULNB/5-148........................-----..------------------................IPEL--D--------
Q2RSZ0_RHORT/17-167AWV.....................-----..------------------..............APGLEL--Y--------
HPRT_MYCPN/9-158........................-----..------------------................MSHD--P--------
O83317_TREPA/210-372I.......................-----..------------------...............NLLGD--V--------
PYRR2_LACPL/1-156Q.......................-----..------------------................LTFS--V--------
Q4DVM9_TRYCC/44-213PKSY....................-----..------------------.............SVRNGSI--S--------
PYRE_HYPNA/34-182........................-----..------------------...................I--A--------
PURR_STRR6/106-265SGDRIE..................-----..------------------...........KMFLSKRSL--K--------
Q27375_TOXGO/94-256........................-----..------------------................DLSI--F--------
XGPT_RHOS4/14-159Q.......................-----..------------------................AELM--G--------
Q4FP84_PELUB/15-165REI.....................-----..------------------..............SSLAEN--K--------
Q5NI77_FRATT/16-164S.......................-----..------------------...............LKEEY--V--------

PF15610

M2SQF2_COCSN/2-255LNRHLVANNATPALKLDFHHAGLS-----AE------------------LARVGPPASTI.........--YHIDTKRL.
C6XW67_PEDHD/2-266LNHWLVENGRMVVQEAKVHR..TI-----TY------------------KDDYGALSAEDRIKLIGNDS--FHIDKDFL.
H1Z8U3_MYROD/1-264LDRYLYLKQRPSSKLGKIHR..NQ-----TY------------------TVDYGNLSFEDRKKLIANDT--YYIDKELL.
C7PNW9_CHIPD/2-265LNRYLCMRGYNPADTAKIHR..YK-----TY------------------SIDYGALDMESRKALIINDK--YHLDKEFL.
Q0UEK8_PHANO/2-265LNRHLVSEKQRPAHKIDLIRVTAR-----DD------------------.......PHTSRTST.....--YHVDLACL.
E3QYQ0_COLGM/52-331LNRYLAAEGAYAVLSVPILKATSA-----SQ------------------SGDYATMSDADRENLMNNEH--FTFDRQAI.
E4ZIV8_LEPMJ/2-262LNRHLISLNARPVLTIDVFSVG..-----..------------------.QDAGVLQDVTKENS..KDL--YHIDVTRL.
R0KEE4_SETT2/2-259LNRHLIANNAAPALKLDFHHVGAS-----AK------------------KARGGPPPATATAAV.....--YHIDTQRL.
G2Z396_FLABF/1-265LNQFLFHHHKKASLESKIYR..NQ-----TY------------------VTDYGNLNFEDRVQLISNDT--YYVDSNFI.
H1YCE2_9SPHI/3-265LNRWLARHGYQVVQETKVHR..TV-----TY------------------KEDYGELDAEQRISLIGNDL--FHIDKDFL.
B2WKS8_PYRTR/2-256LNRHLIANNASPALKIDFHHVGSN-----TK------------------LRNG...PSTSKRNA.....--YHIDTERL.
G0JP06_9GAMM/87-357VNVKLAHMALPTIINVKLPR..IA-----PP------------------CEDYASLSTEERERVNLVQD--HVIPAENFY

PF11202

Q888S9_PSESM/14-255LGVLLRRALID.LD.....RETHH-----YG------------------ISIVRDRGIDTVALEAIIEA..H--------
R5XB52_9CLOT/25-275IGILAKRYIKQRYN.....LDLPH-----YT------------------ISIIRDRGIDINAIKYIINK..H--------
Q7CKQ6_YERPE/9-249LGVMLHHTLRA.LG.....KTSFH-----YG------------------ISIIRDRGIDEVALSYIEQK..H--------
I0DSH9_PROSM/9-249LGVMLQQTLRA.MG.....KESYH-----YG------------------ISIIRDRGIDTTALEWIERR..H--------
STIP_ACIAD/20-273LGVLLYHAIQD.LG.....RDCVH-----YG------------------ISIIRDRGIDFAALETIIAR..H--------
W0ADD0_9SPHN/11-256IGALLARALRR.QG.....RSAPH-----YS------------------VSIIRDRGIDRVALEHIASR..H--------
A1VWP9_POLNA/5-253VGVILKHLLGQVMG.....REAAH-----YS------------------VSIVRDRGIDAVALGHILKQ.GH--------
E4NAQ4_KITSK/21-265VGILIRRWLAHAHG.....LDVPH-----YT------------------VSIVRGCGIDPVALRHLAAH..H--------
D3VJW4_XENNA/9-249LGVMLHQILRK.MG.....KCSYH-----YG------------------ISIIRDRGIDNTALSYIEQQ..H--------
D0L8D3_GORB4/17-267VGILIRRWVEFAHG.....IALPH-----YA------------------VSIVRDRGIDANALRYIVGE..H--------
C8W646_DESAS/34-283AGILIKRYIKLVSG.....INLPH-----YS------------------ISIIRDKGIDENALLYILRK..H--------
X2GQ89_9BACI/11-261IGILIKRYIKMYYN.....VSVPH-----YT------------------ISILRGRGIDETAIRYIFTQ..H--------
R5BVZ9_9FIRM/3-247VGILLKRYLRWKYG.....ITVPH-----YS------------------ISIIRGRGIDQNAMRYLLCR..Y--------
D5CKQ8_ENTCC/9-249LGVMLHQALRD.MG.....KTSWH-----YG------------------ISIIRDRGIDGAALDVIEER..H--------
F8AVP2_FRADG/12-254AGILMRRWARWRHG.....LDLPH-----YS------------------VSIIKDRGLDENAMRWILAR..H--------
J9STB4_9ACTO/17-267VGILIRRWMLAVHG.....VDPRH-----YT------------------ISIVRGRGIDTVALDHIVER..H--------
A8MM96_ALKOO/473-722IGILVKRYLEEKYH.....MKVPH-----YS------------------VSIIRGKGIDENAIAYILQH..H--------
Q9RSA8_DEIRA/11-250VGCAMRR.LARRWAADFGTPELPH-----HT------------------LSIIRGQGIDRAALGRVRAA..H--------
E3EE68_PAEPS/21-271IGILIKRYIDWKYG.....VSLPH-----YS------------------ISIIRGKGIDRNAILYILQQ..H--------
A8F9P7_BACP2/9-258IGVLIKRYIRKTYG.....LELPH-----YS------------------ISIIRDRGIDENALHYMLKE..H--------
R7CDA0_9FIRM/3-247IGILVKRYIKFKYG.....INVPH-----YS------------------ISIIRGRGIDDNAMKYLLEK..Y--------
Q4FTP9_PSYA2/19-285IGVLLQHALADTNS..SYALPSIH-----YG------------------VSIIRDRGLDPVALQMILNN..H--------
D1BEJ8_SANKS/16-268IGVLMRRWASYAHG.....LVLPH-----YA------------------VSIVRGRGIDQLALAYLAQH..H--------
J7INJ2_DESMD/17-266IGILIKRYLLEKHD.....LDLPH-----YS------------------ISIIRGRGIDENALLYILQN..H--------
R4KIZ1_9FIRM/43-295AGVLIKRYLRCFYG.....LDAPH-----YS------------------ISIIRDRGIDVNAIIYILQR..H--------
U5NAN4_9BURK/5-254IGVILGHTLQHLTG.....RAVPH-----YS------------------ISIIRDRGIDTNALDAILDR.GA--------
E6UDF8_RUMA7/3-247IGVLLKHYMDRKYG.....INVAH-----YT------------------ISIIRGRGIDKNAMNYILER..H--------
S5UQG8_STRCU/450-701VGVLMRRWAHHRHG.....LDLPH-----YA------------------VSIVRGRGIDANALRWLAAH..H--------
K8E7N2_CARML/7-270IGVLIKRYLKLVYQ.....VDVPH-----YS------------------ISIIRGRGIDEVALDYIYRQ..S--------
F2JGK7_CELLD/19-268IGVLIKRYLAYKYQ.....VNVPH-----YS------------------VSIIRDKGIDENALLYILKE..H--------
Q891X7_CLOTE/27-276IGILIKRYLEEKYK.....KTFKH-----YS------------------ISIIRGRGIDENAIKYILNN..H--------
B1HUS6_LYSSC/12-262IGILIKRYISMNYK.....VDVPH-----YS------------------ISILRGRGFDEAAIRYILSE..H--------
I3YAV5_THIV6/12-259VGVALKHVLTDILD.....RPATH-----YS------------------LSIIRDRGIDQNALRFILNDEAR--------
D1A9P2_THECD/16-266IGVLIRRWARAIHG.....LELPH-----YA------------------MSIVRGRGIDRVALRYLARH..H--------
C8XAU5_NAKMY/29-279IGILMRRWAQRFHG.....LDLPH-----YA------------------VSIVRARGIDEVALRYLATR..H--------
M1FGD7_9ALTE/15-262YGVLLKRDLAR.LG.....ADVTH-----FG------------------ISIIRDRGLDEAAMGDVLAR..R--------
R7IPS7_9FIRM/3-247VGILLKRYIRYKYK.....QDVPH-----YA------------------VSIIRGRGIDKNAMNYLLER..Y--------
L0H008_9GAMM/12-261FGALLRRALTERFA.....VPAAH-----FS------------------ISIVRDRGIDENALRWLLRERRY--------
A1SUD4_PSYIN/14-263IGVLLNRAINEYAG.....VNSQH-----YS------------------ISIIRDKGIDENALDHLIFNQKI--------
A8L405_FRASN/18-260IGILMRRWYAFRHG.....LDVPH-----YA------------------ISVIKDRGVDMNALRHITDR..H--------
F8K488_STREN/11-259VGILMRRWAAWAHG.....AELPH-----YA------------------VSIVRGRGIDTTALRWLAAH..H--------
Q5NWT5_AROAE/5-254IGAVLRHLVARISG.....THPAH-----YS------------------ISIIRDRGIDTAALGEILSR.GH--------
A4J1D7_DESRM/40-292IGVLIKRYIQQFHG.....VKAPH-----YS------------------ISIIRDKGIDKNALIYILQQ..H--------
R5GSI4_9FIRM/375-629VGVLIKRYIRAKYG.....VSLPH-----YS------------------VSIIIDRGIDRRAMEYILAR..H--------
F4H5N6_CELFA/535-785VGILVRRWAQLVHG.....VDLPH-----YA------------------VSIVRGRGIDDVALRYLAAH..H--------
Q2RVZ5_RHORT/10-255IGVLLRRALVA.LG.....RMAVH-----YS------------------VSIIRDRGIDPLAMAAILAR..H--------
D3RPA4_ALLVD/12-259VGVALKHVLREVFG.....RAPEH-----YS------------------ISIIRDRGIDRNALRFILDRAGR--------
E8U3T5_DEIML/6-240VGAVLHRELTRRGA......DVTH-----AT------------------LSVIRGVGLDLPALARATAH..R--------
F8A7B9_CELGA/486-735VGALMRRWAARVHG.....VDVPH-----YT------------------ASIVRGRGIDHLALQHVAAH..H--------
I4D513_DESAJ/17-266IGVLLKRYLLEKRG.....LNLPH-----YS------------------ISIIRGKGMDENAILYILQH..H--------
H6R9M2_NOCCG/535-790VGVLMRRWLRDGRGAGLPSLDIPH-----YA------------------VSIVRDRGIDALALDYLARH..H--------
Q186J5_PEPD6/5-254IGILAKRYIRSKYN.....ISLPH-----YT------------------ISIIRDKGIDMNAIEYIVKN..H--------
A5WBK3_PSYWF/17-290IGVLLQRALSDGSA..PYHLPSQH-----YG------------------VSIIRDRGLDPVAVTKILSA..H--------
L0A1Y2_DEIPD/15-266IGVLVTRALRSLYG.....EEVHH-----YG------------------VSIVRDHGIDGVALDFIRAR..H--------
N0AVA9_9BACI/12-261IGILIKRYLLQRYQ.....VSLPH-----YS------------------ISIIRGRGVDDLALQHIVQT..H--------
I5AXH0_EUBCE/3-247VGILIKRYIRMKYG.....VDVPH-----YT------------------ISIIRGRGIDQNAIRYILSR..H--------
C0Z9Y7_BREBN/18-267IGVLIRRYLRQIHQ.....LDTPH-----YS------------------ISIIRGKGIDENALRYILEH..H--------
A6WD80_KINRD/17-261VGILLRRWGLRA.G.....LHWPH-----VA------------------VSIVRGRGIDEVALRWIAAH..H--------
J7SKQ6_MORMO/9-249LGVMLHQALRD.AG.....KISHH-----YG------------------ISIIRDRGIDTAALEWIEHH..H--------
H8GG70_METAL/7-254VGVLLKHVLQRHFA.....RKAAH-----YS------------------LSILRDKGIDRNALRHILQR..H--------
Q0SDY7_RHOSR/11-261VGVLMRRWARDVHG.....LTLPH-----YA------------------VSIVRDRGIDAVALDYLARH..H--------
F4EXE7_SELS3/3-247IGILLKRYIKRRFG.....ADVAH-----YT------------------ISIIRGRGIDKNAMAYILAR..H--------
H6N264_GORPV/15-265VGILMRRWIRFAHG.....LDAPH-----YT------------------ISIVRDRGIDTVALDHITAR..H--------
V4LJY0_9GAMM/11-261VGALLTRALRMCCQ.....REARH-----YS------------------ISIIRDRGIDENALHYILRDAHC--------
U5LCP5_9BACI/10-258VGILMKRYIKQIYG.....TTLPH-----YS------------------ISIVRDRGIDENALKYIIEK..H--------
Q3JCD3_NITOC/20-269IGALLQRALSRHLQ.....VDSRH-----YS------------------ISIIRDRGIDEQALKFLLREHRR--------
Q8KL02_RHIEC/15-256FGILLKRAIAL.LG.....RDVGH-----YG------------------LSIIRDKGVDDEAMRHILAR..R--------

PF15609

D5BYR0_NITHN/23-215LGAGVADS-LAR-KAKRRDVIFQH-----TT------------------RHRL..P....VSEWVCFDE--V--------
Q888T1_PSESM/34-221LGAGVHRA-YSE-THS..DALYLV-----ST------------------RHPT..G....TELFARFEE--E--------
F2JGK6_CELLD/36-258LGHSMFSA-F.D-D....KATFIH-----TT------------------REPI.IS....EVPTFTFQE--E--------
F8A7B9_CELGA/28-256LGAQVAEA-L..-.....GATYLH-----ST------------------RRHV.PG....VAVAGRFEE--A--------
R4KD23_9FIRM/21-261LGHAVFSC-F.A-G....RHRYLH-----TT------------------RENL.AG....SYDTLFFTE--A--------
L0H292_9GAMM/23-213LGGGIADS-LAR-GED..DVLFQH-----TT------------------RHRL..D....VPVLLRFDE--V--------
Q186J6_PEPD6/22-211VGHSFFDY-L.C-G....DYEFIH-----TT------------------REQF..D....ELENLEFLE--E--------
F4H5N6_CELFA/44-294LGHGVADA-L..-G....GAPYLH-----ST------------------RRPV.AG....VPSVGGFEE--E--------
J9RTC8_9ACTO/32-225LGHCVAER-I..-S....ASRYLH-----ST------------------RRRR.PG....VTVSSTFEE--G--------
D3V2E0_XENBS/35-224LAAGVFQE-TRK-QAE..APVFLT-----ST------------------RHPV..E....GDLLCEFKE--N--------
C0ZNQ4_RHOE4/33-221LGHCVAAR-L..-R....AHCYLH-----ST------------------RRDV.PG....ATTLAGFEE--G--------
Q0RDF5_FRAAA/27-253LGHAVADG-L..-A....GSHYLH-----TT------------------RRDL.PG....VPPVLEFTE--S--------
E8U3T7_DEIML/27-218LGEGVARA-YAA-RTGRLDWTFLH-----ST------------------RYAT..R....HPVAVRFEE--P--------
N0ATX4_9BACI/3-219LGHSFYEC-F.K-S.....ADFFH-----TT------------------REEM.LS....LTPVISFEE--E--------
V4IMQ6_9ACTO/22-218LGHAVADG-L..-E....SAPYLH-----ST------------------RRPV.AS....VPSAGGFEE--S--------
Q4FTP7_PSYA2/40-245LSAGVHQA-LQT-RYP..QALLLN-----ST------------------RHAQ.HDNDNTNNLLTTFSE--D--------
X2GSG0_9BACI/29-253LGHAVFNV-F.K-S....NATYIH-----TT------------------RELV.PE....LEPFVTFEE--E--------
H6N263_GORPV/13-205LGHCVAHR-C..-S....ARLYLH-----ST------------------RRHI.AG....VRVSGTFEE--G--------
A6WD81_KINRD/34-260LGQTVADA-L..-.....GCAGLH-----ST------------------RRAV.PG....ALDYAGFEE--E--------
L0A0T7_DEIPD/29-215LGRGVFEA-YAA-RIGT.PCLFVT-----TT------------------RYRQ.......PGEALTFEE--P--------
F8B557_FRADG/36-231LGHTVADG-L..-D....DCDYLH-----TT------------------RRAV.PG....ATTLLDFDE--A--------
C8XAU6_NAKMY/29-253LGHLVADQ-L..-G....SG.YLH-----ST------------------RRPD.GP....VPVAADFVE--S--------
Q3JCD5_NITOC/23-215LGAGVADS-LVR-RTQRCDIVFQH-----TT------------------RHSL..P....VSEWMRFDE--A--------
B1HUS5_LYSSC/29-252LGHAVFNA-F.Q-S....NAMYIH-----TT------------------REVI.PH....IEPFVTFEE--E--------
Q9RSB1_DEIRA/35-218LGEGVYRA-WRQ-QTGQ.AATFQH-----TT------------------RYVT..D....RPVLLRFDE--P--------
A5WBK1_PSYWF/41-238LSAGVHQA-LQA-RYP..NALLLN-----ST------------------RHAQ.QQ....ASLLTTFSE--D--------
Q0SDY6_RHOSR/33-221LGHCVAAR-L..-R....ARCYLH-----ST------------------RRDV.PE....IGTSAGFEE--G--------
E2Q252_STRC2/22-213LGHAVADG-V..-A....LAPYLH-----ST------------------RRPV.AG....VPRAGGFEE--S--------
A1SUD2_PSYIN/23-212LGGGVADS-LAR-AQQE.NVYFQH-----TT------------------RHKL..N....RPLWFSLDE--A--------
Q5NWT3_AROAE/14-205LGQGVFEA-WAH-AHPGSNPLYLQ-----ST------------------RYRV..P....GAEWLGFDE--S--------
M1F8F7_9ALTE/56-248VGAAAARR-LRE-RRPEADLLYLS-----TT------------------RHPV..A....GREWVSFSE--G--------
V4JFE6_9GAMM/23-221LGLGVADS-LAE-IGLRDDVYAQH-----TT------------------RFDG..D....SPPMLRFRE--S--------
D0L8D2_GORB4/36-225LGHAVADR-I..-A....AAVYLH-----ST------------------RRAA.LD....VAVHGTFEE--G--------
H6R9M2_NOCCG/48-236LGHCVADR-I..-G....ATCYLH-----ST------------------RRPV.PL....AETLTGFEE--G--------
H8GG72_METAL/25-219LGYGVFEA-ACR-EGAG.NGLFMQ-----TT------------------RYHL..E....GMPRLEFDE--A--------
U5LBE9_9BACI/23-240LGHSFYNA-F.K-A.....AGYFH-----TT------------------RETL.PE....AVSIIDFEE--E--------
F3ZD08_9ACTO/22-212LGQCVADG-I..-G....TAAYLH-----ST------------------RRPV.PG....VTPVGGFEE--A--------
E3EE67_PAEPS/1-230LGHSMYRL-F.D-N....GATYIH-----TT------------------REDI.PG....LRPIIRFEE--E--------
Q2RVZ3_RHORT/30-224LGQGVFEA-WRG-GSGREDGLFIH-----ST------------------RYRL..R....QGLLSTFEE--S--------
G2NBS3_9ACTO/22-216LGHAVADG-L..-G....VAPYLH-----ST------------------RRPV.EG....VAQAGGFEE--A--------
C8W645_DESAS/19-238LGHAVYDC-F.K-G....NACYLH-----TT------------------REDL.RG....TVDTIFFTE--A--------
Q7CKQ5_YERPE/29-218LAAGVFQE-LRG-TVA..EPVFLT-----ST------------------RHPV..D....GDLLCEFKE--N--------
W0LDC5_SERFO/29-220LGAGVFDE-MRH-HLS..ESVYLT-----ST------------------RHPV.AG....GKLLCEFKE--N--------
Q2J6S1_FRASC/55-272LGHAVADG-L..-P....ASHYLH-----TT------------------RRPL.PG....VTPILEFVE--S--------
D5CKR0_ENTCC/30-220LGAGVFDE-VRH-QHR..ESVYLT-----ST------------------RHPV..D....GTLLCEFKE--E--------
Q891X6_CLOTE/33-257LGNSVFAT-FLG-E....NIKYIH-----TT------------------RDML.KE....CRSVFSFDE--E--------
E3IYR1_FRASU/25-221LGHAVADG-M..-P....GADYLH-----TT------------------RRAV.AG....MRSELELAE--A--------
A1VWP7_POLNA/22-216LGQGVFEA-YKT-MHPQREALFLH-----TT------------------RYHV..G....GMPIIEFEE--A--------
I0DSI1_PROSM/30-221LGAGVFDE-ARK-HYK..DSVYLT-----ST------------------RHPV.EG....GELLCEFKE--N--------
V6JVQ1_STRRC/37-226LGHAVADG-L..-G....TAPYLH-----ST------------------RRSV.AG....VARAGGFEE--S--------
A8F9P6_BACP2/17-239LGHGVYDV-L.E-G.....ASYIH-----TT------------------REQL.LD....LDPSLVFEE--E--------
M1SJV4_MORMO/30-220LGAGVYSE-IRR-QYP..ESLYLS-----ST------------------RHPA..D....GELLCEFKE--N--------
U5N786_9BURK/38-230LGQGVFEA-WLR-EHPQREALFLH-----TT------------------RYHV..G....GAHRVSFEE--A--------
A4J1D6_DESRM/37-256LGHAVFSS-C.T-G....NINFLH-----TT------------------RENL.EG....NHDTIYFTE--D--------
D1A9P3_THECD/28-256LGHSVADA-L..-G....GAVYLH-----ST------------------RRPV.PG....VPPYGGFEE--E--------
J7ISK8_DESMD/39-259LGQATFSS-F.D-N.....AHYLH-----TT------------------RDQI.PL....LPAVLDFKE--D--------
C0Z9Y6_BREBN/39-262LGHSMFSA-F.G-T....KAEYIH-----TT------------------RELI.KE....VPSTIDFEE--E--------
A8L404_FRASN/37-236LGHAVADG-L..-P....NSHYLH-----TT------------------RRRV.PG....STPVLEFVE--S--------
B4EW77_PROMH/30-221LGAGIFDE-VRD-RYP..QALYLT-----ST------------------RHPI.AD....GELFCKFKE--N--------
D1BEJ9_SANKS/28-275LGHCVGAA-L..-.....GVPSLH-----ST------------------RRPV.AG....VVPAAGFAE--E--------
C3ASF9_BACMY/11-231LGHSMFQC-F.Q-N.....AKYVH-----TT------------------REMI.SQ....IDPIITFEE--E--------
F8K489_STREN/28-217LGHCVADG-L..-G....AARCLH-----ST------------------RRRV.PG....MPDAGGFEE--E--------
D3RPA9_ALLVD/31-224LGQGVFES-RLE-QRPETEALFIH-----ST------------------RYRV..D....GRAALDFQE--A--------
A8MM96_ALKOO/39-263IGQGVFSA-F.T-G....EGYYTH-----TT------------------REIV.LD....CDFNVEFEE--E--------
D7C985_STRBB/21-212LGHSVADG-L..-G....LAPYLH-----ST------------------RRPV.AG....VAPVGGFEE--E--------
K8EW86_CARML/29-250LGQAFYAS-F.S-S....PAEYIH-----TT------------------REILGAD....ITPLLAFEE--E--------
I3YAV0_THIV6/25-218LGQGVFEA-ALT-QRSEADALFLH-----ST------------------RYRV..A....GRPFLEFQE--P--------
R5X4A9_9CLOT/51-237LGHSVFNY-I.N-A....DYEFIH-----TT------------------REKI..Q....NKKSLDFLE--E--------
W0AF65_9SPHN/32-217LGQSVHED-YGR-LTGRSDVAFIH-----ST------------------RQEL..D....HPLLCRFEE--P--------
I4D512_DESAJ/37-259LGQSVFGL-F.E-N.....AGYLH-----TT------------------REDI.PC....LKSELEFRE--E--------

PF14681

B9PK97_TOXGO/39-243MESGLRAV.CRG.C.RIGKILIQR.DE..TT..................AEPK-------....LIYEK--L--------
E3L591_PUCGT/16-219MTDAFLDI.FPE.A.SVFYLGLFR.DK..TL..................LQPV-------....EYYQK--L--------
Q5AWP2_EMENI/470-667MASGIFKV.FPK.A.RLHDA...K.EP..TD..................VK..-------.........--.--------
E3FKH4_STIAD/10-212ILDGMLQL.VPS.A.RIGHIGMYR.DP..ET..................LMAV-------....EYYYK--V--------
B1XW63_LEPCP/8-210FLDGMLQV.VPG.A.RVGHIGLYR.DP..KS..................LIAV-------....EYYFK--M--------
A5FZR1_ACICJ/10-212ILDGMVDL.VPS.A.RIGHVGLYR.DP..LS..................HEPI-------....EYYFK--V--------
Q2RS40_RHORT/14-217MADGLLEL.VPS.A.RVGHIGLYR.DE..VT..................RQPV-------....EYLVK--L--------
UPP1_SCHPO/12-217MEQGLREC.CRS.V.RIGKILIQR.DE..ET..................HKPV-------....LHYIK--L--------
C5CEA9_KOSOT/6-207MVEGVLSL.MPN.A.SVGFVGLYR.DP..QT..................IRPV-------....EYYCK--L--------
F0XHJ4_GROCL/10-224MVDALQTL.LPE.PVPVHHLGLYR.EP..ST..................LEPV-------....EYYNN--L--------
D5BUA7_PUNMI/7-209LVDGFSQL.CPE.A.SIAHLGLYR.DE..DT..................LQPV-------....SYYTS--V--------
E6ZJH4_SPORE/8-212MTEACLEL.LPE.NTSVLHIGLFR.EK..VS..................LQPV-------....EYYNK--L--------
A2R643_ASPNC/9-224MIEAINNL.LPT.SIPIYHLGLFR.ER..LT..................LQPV-------....EYYNN--L--------
B0C7X6_ACAM1/9-216LLEGAQSV.IPR.A.ATYHLGLAR.DE..ET..................LQPH-------....CYLNK--L--------
D1CCZ6_THET1/6-207MVPAALRL.MPF.A.EVWHLGIYR.EH..DT..................LRPV-------....EYYNK--L--------
B6HJ77_PENCW/9-232MVDALNDL.LPT.PVPVYHLGLFR.EK..VS..................LQPV-------....EYYNN--L--------
B9GJS2_POPTR/275-479MENALRAC.CKG.I.KIGKILIHR.DG..DN..................GK.Q-------....LIYEK--L--------
UPP_BRADU/6-208FVDGMMDL.VPT.A.RVAHIGLYR.EP..HS..................FAAV-------....EYFFK--S--------
E2B6P7_HARSA/345-550MEQAVRDV.CKD.I.RIGKILIQT.NQ..QT..................GEPE-------....LYYLR--L--------
D2QZE9_PIRSD/6-207MIDPVLNL.IPT.A.EVWHLGLYR.DE..AT..................AQPV-------....EYYSK--L--------
E3Q271_COLGM/16-231MVEAVQTV.LPN.PVPVHHLGLYR.EP..ST..................LEPV-------....EYYNN--L--------
E0U7K3_CYAP2/9-216LLDGAQTL.LPL.A.STYHLGLAR.NE..ET..................LEAS-------....CYLNK--L--------
A5EVG4_DICNV/7-209LLDGVLEL.LPA.A.KVGYIGMER.DE..VT..................HKPR-------....AYYCK--L--------
F2UAE3_SALR5/11-216MEHILREW.MPS.V.VIGKVLIQR.DE..ET..................ALPK-------....FVFDK--L--------
Q8DI28_THEEB/15-222LLDGAQGV.LPT.A.TTYHLGIVR.DE..TT..................LEPS-------....CYLNK--L--------
Q2H9K6_CHAGB/10-227MVEAIQTL.LPH.PVPVHHLGLYR.EP..AT..................LHPV-------....EYYNN--L--------
B8HYJ3_CYAP4/9-216MLEGAQTV.LPL.A.KTYHLGIVR.DE..ET..................LNPS-------....CYLNK--L--------
Q0TWS2_PHANO/12-227MTTALSSL.LPA.PVPIHHLGLYR.EK..ST..................LQPV-------....EYYNN--L--------
Q1AVG9_RUBXD/10-211MLDGALAL.LPT.A.TVGFMGLFR.DE..AT..................AEPV-------....EYYVN--L--------
D8TYT8_VOLCA/53-261LLEQSSQV.IPF.Q.ETYHVGYVR.DP..AT..................LQAT-------....SYLNK--L--------
B0CYQ9_LACBS/7-210MTDALLTL.FPA.A.PVYHLGLFR.EK..VT..................LQPV-------....EYYSK--L--------
E9QGS0_DANRE/320-526MEQALMAV.CKD.I.RLGKILIQT.NH..DT..................GEPE-------....LHYLR--L--------
UPP_MYCA5/4-206MMQGILAM.VPE.A.RVGHIGIYR.DE..KT..................FQPI-------....DYFFK--I--------
A7S545_NEMVE/352-557LEPALASV.CKE.I.RIGKILIQT.ND..ET..................DEPE-------....LHYLR--L--------
B1XP85_SYNP2/9-217LMEGAQEV.IPN.IAATYHLGYKR.DE..AT..................LEVA-------....CYLNN--L--------
F0XXG3_AURAN/8-217LQEAVRRV.VPG.A.KTAKILIQR.DE..ET..................AQPV-------....LMYSK--L--------
C0NWK2_AJECG/11-260HHPAIQDL.LPS.PVAVHHLGLFR.EP..TT..................LHPV-------....EYYNN--L--------
B8BYV0_THAPS/18-231LLESFREI.IPG.L.RVGKLWIQR.NESSTT..................KEAV-------....HSCTK--L--------
C3ZI77_BRAFL/271-477MEPALCAV.CKD.I.RLGKILIQT.NL..ST..................GEPE-------....LHYLR--L--------
B2AWA7_PODAN/10-225MVDPLSSL.LPH.PPPIHHLGLFR.EP..ST..................LLPV-------....EYYNN--L--------
A8NXX8_COPC7/7-210MTDALLTL.FPS.A.PVYHLGIYR.EK..VT..................LQPV-------....EYYSK--L--------
Q53LT4_ORYSJ/267-471MENALRAC.CKG.I.KIGKILIHR.EG..DN..................GK.Q-------....LIYHN--V--------
E1ZQY9_CHLVA/5-212LLEQTATL.LPV.T.QTYHVGYVR.ND..DT..................LEAS-------....CYLNK--L--------
A5GTE0_SYNR3/9-216LWAGGQDV.LPH.A.RVAHMGVVR.DE..AT..................AQAS-------....SYLDR--M--------
B3S289_TRIAD/277-481MEAALCSI.CKD.V.RVGKILIQT.NE..ET..................DEPE-------....LHYLQ--L--------
C5KJG5_PERM5/30-243MEAPVQEV.FPE.A.RIGKVLIQR.DE..ET..................AMPK-------....LFYIK--L--------
A4HAL7_LEIBR/9-219MERVLREM.CRG.V.RIGKILVQR.DE..AS..................AEKV-------PDARFSYTK--V--------
A4S9H3_OSTLU/196-418MENALRAC.CKG.I.KIGKLLIER.RD..KDGMIARQASASGDLSSPVMYNSR-------....IHYEK--L--------
UPP2_SCHPO/13-219MEYGLAAA.CNYSV.PVGKLLVQR.DE..TT..................FEAK-------....LMFCK--L--------
B6K7J9_SCHJY/15-220MESAVRET.YGP.L.PVGKLLIQR.DE..VT..................SKAE-------....LFYCK--I--------
C1E7B8_MICSR/254-468MENALRAC.CKG.I.KIGKILVAR.RD..NDGLPSA........LSGHRLSSA-------....VVYEK--L--------
B9S674_RICCO/251-459MENALRAC.CKG.I.KLGKILIHR.EG..NN..................GR.Q-------....LIYEK--L--------
D2SG74_GEOOG/5-206MADTAHGM.LPE.S.QMGFVGLAR.NE..ET..................FQPE-------....AYMAS--L--------
A2R0T1_ASPNC/17-223MEQALRDT.WTG.PLSFGKLLIQR.DE..ET..................SIAK-------....IYYSK--L--------
E4X7A3_OIKDI/322-527MEKALMKV.TKD.I.RLGKILIQN.NP..DT..................KNPE-------....LYFLR--L--------
D8PR38_SCHCM/5-209MSDALANSGLSD.A.PVYHLGIFR.EK..VT..................LQPV-------....EYYSK--L--------
D3BNE7_POLPA/239-442MEQPLRSI.CKG.I.KTGKVLIQS.DE...N..................KQPH-------....LFYER--L--------
B8CAC1_THAPS/44-250MVDSMLEL.ISS.A.EVHHIGMYR.SK...S..................LMPV-------....QYYNR--L--------
D5GBY9_TUBMM/10-229MLEAFQTL.LPE.PTPVHHLGLFR.EK..VT..................LQPV-------....EYYNN--L--------
A0CZ39_PARTE/55-262FLNEGLRV.IQG.A.SIGQILIQR.NE..ET..................SMPK-------....YFFEK--L--------
A1C4H4_ASPCL/15-220MEQALRDT.WVG.PLSFGNILIQR.DE..ET..................FLPQ-------....YLYCK--L--------
F0ZZY8_DICPU/270-473MEQPLRNI.CKG.I.PTGKVLIQS.DE...K..................KKPQ-------....LFYEK--L--------
Q19583_CAEEL/298-503METALRSI.VKD.C.VIGKILIQT.NE..TT..................FDPE-------....LHYIR--L--------
D1C823_SPHTD/29-232MLEPIRNL.LPS.A.PLYQIGVRR.DE..AT..................LQPS-------....VYYTN--L--------
Q5CME0_CRYHO/242-456MEIGLSAV.CKD.I.PIGKILLEFQNP..KTELD............AQFDKPR-------....IIYCK--L--------
A8GCF9_SERP5/8-213FEGEYRRM.FSG.Q.PIGKILIQR.NP..QS..................KLPK-------....YFYSH--F--------
A8P7X1_COPC7/39-231MEAGLREV.CRS.V.RIGKILIQR.NM..DW..................IG..-------.........--.--------
B7FX04_PHATC/21-232MVDSMLEL.LPN.A.AIHHIGMYK.VL...G..................QNPV-------....QYFNR--L--------
A8JC08_CHLRE/54-264LLEQAQQV.LPF.H.QTYHVGYVR.DP..AT..................LQVG-------....VWVNF--L--------
A9URE0_MONBE/281-484FEEPLRQC.VRD.V.NIGQILIQT.NL..TT..................GQPE-------....FFHKV--L--------
B6AH00_CRYMR/25-230LENALRAV.CRG.C.RIGKVLVEK.GI..SS..................NSEV-------...ISSYVR--L--------
B6ABC4_CRYMR/233-447MELGISAI.CRD.I.PIGKLLMEFQDP..NTELD............ASFEKTK-------....ILYCK--L--------
E4X3J2_OIKDI/287-498MEKALMKV.TKD.I.RIGKLLIQN.DE...F..................GSPC-------....LHYCR--I--------
A0CTP7_PARTE/56-263FLGEALKV.LPG.A.SVGFILVQE.HP..QT..................KDPQ-------....LIYCK--F--------
F2UFG2_SALR5/279-483LEKVLRDM.VRD.I.AVGQLLIQT.NP..SS..................GQPE-------....FFHQS--L--------
F0YEY4_AURAN/277-487MVDAMLNV.LPN.A.AVFQIGMFK.RQ..GS..................DRPI-------....EYYSR--L--------
Q0TVS3_PHANO/438-633MAFGVNEA.FPR.A.MFLHARCPG.DV..........................-------.........--L--------
F2PL94_TRIEC/448-645MARGVWES.FPK.A.SFLHVKSPE.DV.......................K..-------.........--.--------
B6GYG1_PENCW/502-699MAFGVNEA.FPL.A.MFHHAKVPC.DL..QH......................-------.......E.--.--------
E3QN18_COLGM/468-663MALGVSEA.FPK.A.MFLHAGSPK.DL..NS......................-------.......EN--L--------
B2AP82_PODAN/589-789MAFGISDV.LPL.A.IFLHA..KR.PE..D...................VE..-------......A..--.--------
D5GK17_TUBMM/495-691MALGVNDA.FPR.A.MFVHA..KR.PE...D..................IE..-------.........--.--------
Q0CK66_ASPTN/515-712MAFGINDA.FPR.A.MFLHASTPD.NV..QS......................-------.........--.--------
C4JD99_UNCRE/393-591MAFGVNDA.FPL.A.MFLHA...R.SP..DD..................I...-------.....KQEH--L--------
C7ZP62_NECH7/505-702MACGVSEA.FPT.A.MFIHAASAS.DI..KD......................-------.........--.--------
Q2GUM1_CHAGB/474-672MAVGVNDA.LPG.A.MFLHAK....QP..DE..................LR..-------.........--.--------
E9F4S0_METAR/604-801LALGLNEA.LPL.A.MFVHAASPD.DI..R.......................-------.........--.--------
B1WT56_CYAA5/9-216LLDGAQTL.LPV.A.SIYHLGLVR.DE..ET..................LENT-------....CYLNK--L--------
C5AAP9_BURGB/13-214MSDGLLDL.VPS.A.RVGHIGVYR.AD...D..................HRPV-------....EYLVR--L--------
D5A477_ARTPN/9-216LMEGIQSV.VPL.T.SVYHLGMVR.DE..ET..................LQVS-------....CYLNK--L--------
E9C694_CAPO3/359-559MEGSLRDV.CKD.I.RLGKILIQT.DE..ET..................GEPQ-------....LHYCK--L--------
G7Z3C1_AZOL4/35-237MSAGLLEL.VPS.A.REGHIGLYR.DH..ET..................KQPH-------....EYLVK--L--------
H3D4M3_TETNG/291-494MEPALRAV.CKD.V.RIGKILIQT.NV..DS..................GEPE-------....LHYLR--L--------
Q4WZP7_ASPFU/9-223MIEAINDL.LPT.TVPIYHLGLFR.DK..FT..................LQPV-------....EYYNN--L--------
Q5KGX1_CRYNJ/6-210LTDAALES.FPE.A.TVLHLGLFR.DK..VS..................LQAI-------....EYYSK--L--------
Q7UFD1_RHOBA/6-207MVDPLLDL.IPD.A.SVWHLGLYR.NE..QT..................AEPV-------....GYYDK--L--------
R7D7S5_9FIRM/7-208MVNGITTL.VPS.A.KIGHIGLYR.DP..ET..................HEPH-------....EYYCK--L--------

PF14572

E9FWJ1_DAPPU/165-348MDAARG..-MPV---------MTA-----KE------------------KPPI-----------NVVGD--V--------
KPRB_HUMAN/179-363IHPSLE..-IPM---------LIP-----KE------------------KPPI-----------TVVGD--V--------
Q961V3_DROME/165-361TSVSVG..-VPE---------HIV-----KV------------------KPPL-----------TIVGD--V--------
F1KVQ3_ASCSU/169-364MAPYEL..-FPQ---------QAA-----KE------------------KPPL-----------TVVGD--V--------
Q6P8C3_XENTR/167-349VHKGLE..-IPL---------MMP-----KE------------------KPPI-----------SLVGD--V--------
Q23166_CAEEL/167-347VTSYDF..-LPA---------QES-----KQ------------------KPPL-----------TVVGD--V--------
A7T9J2_NEMVE/4-194LENELN..-VPG---------FLP-----KE------------------KPPM-----------NVVGD--V--------
F1L6K6_ASCSU/169-364LAKYEL..-FPR---------QTV-----KE------------------KPPL-----------TVVGD--V--------
B3S6Z0_TRIAD/157-339VSRVLPSV-LPE---------IAP-----KE------------------KPPM-----------TLVGD--V--------

PF00156

PYRE_DEIRA/34-188--P-GET--------------------------------------FVAVED---VLTTGGSLLRAVR.AV-EGQGGQ...
Q3SMI9_THIDA/14-177--R-GLS--------------------------------------VVIVDD---VMYHGNSMLRAVE.YL-ARREPA...
PYRE_BIFLO/37-192--D-GMK--------------------------------------VLLVDD---VMTAGTAVREVIPKLK-AEANVE...
A6GZJ5_FLAPJ/2-150--E-NKG--------------------------------------LVLVDD---VLNSGTTLIYGVR.HF-LDVDLK...
PYRE_PROAC/43-197--A-HSK--------------------------------------VIMVED---LISTGGSVLKAAQ.AV-EREGST...
Q8EVI3_MYCPE/12-166--K-GHK--------------------------------------ILILDT---IIDTGVRLQKVCD.FI-KNCDVE...
Q0CVT8_ASPTN/931-1096--R-GAS--------------------------------------VVIVDD---VLATGNTLLAILR.LL-EKVGVCT..
Q2YAL8_NITMU/16-212--A-GRI--------------------------------------VIVVDD---GLATGSTMIAALH.AL-RAKKPE...
Q4XNN5_PLACH/73-239--D-KKK--------------------------------------VIVIDD---VFSYGTALTDIFNKIK-AFDYLE...
Q1DDD8_MYXXD/86-239--K-GRR--------------------------------------VLIVDD---VASSGDTLELATA.LA-REAGAK...
Q6NF43_CORDI/11-164--R-GKK--------------------------------------VLVVDD---VADSGRTLDLVLK.LL-ENHGAE...
KPRS_METS3/132-293--K-GKK--------------------------------------AFIIDD---IIATGGTIVNAVK.IL-KEYGAK...
A5V979_SPHWW/2-156--V-AQR--------------------------------------LLFVDD---INDSGTTITHIKA.AL-RDAGGAI..
A7E5A9_SCLS1/57-218--I-GKK--------------------------------------CVIIDD---AVSSGTTLKTTWD.LL-ERIGCE...
C1DM73_AZOVD/5-153--D-ART--------------------------------------VLLVDD---SIASGKSMRAAVE.RL-PEAFAG...
A8LJR1_DINSH/150-296--E-GQT--------------------------------------CIIVDD---ICDTAGTLCKAAD.LL-ISEGAS...
UPP_AQUAE/39-188--K-GKI--------------------------------------VVILDP---MLATGGTLEVALR.EI-LKHSPL...
Q8EUA5_MYCPE/11-161--T-NKH--------------------------------------VLLVDE---IIDSALTLKYVKEYLM-NNFNPA...
Q0K973_CUPNH/14-164--L-TGR--------------------------------------VLLVDD---LVDSGITLERVGR.HL-KERYPAV..
A4CGY8_ROBBH/133-287--K-VST--------------------------------------PVLVDD---IISTAQTMIETTE.HL-KNAGMKP..
A3U7I6_CROAH/14-161--K-GRT--------------------------------------VVVVED---IVDSGNTIEAIMQ.IL-DNEGAE...
A6QAE7_SULNB/5-148--K-AKK--------------------------------------VLLMDD---IVDSGETMKEVLN.HL-KNKFPH...
Q2RSZ0_RHORT/17-167--A-DQV--------------------------------------VVVCDD---IAGDGGTLRAVAA.AL-APVRPR...
HPRT_MYCPN/9-158--K-GKD--------------------------------------ILLIED---IVDSGRSIKLVLD.LL-HTRKAK...
O83317_TREPA/210-372--E-GKT--------------------------------------AFIADD---MLGSGGTMLKAME.FL-KSRGAK...
PYRR2_LACPL/1-156--A-DKR--------------------------------------VILVDD---VLFTGRTIRAALDALM-GGGRPQ...
Q4DVM9_TRYCC/44-213--S-DSR--------------------------------------VLIVDD---FIATGRSLVSVLR.LM-AIVGAK...
PYRE_HYPNA/34-182--A-GER--------------------------------------VLIAED---IVTTGLSFRETVE.AL-AKLPGE...
PURR_STRR6/106-265--A-GSR--------------------------------------VLIVDD---FLKGGGTVNGMIS.LL-REFDSE...
Q27375_TOXGO/94-256--R-DKH--------------------------------------VLIVED---IVDTGFTLTEFGE.RL-KAVGPK...
XGPT_RHOS4/14-159--D-GHG--------------------------------------ILIVDD---LVDSGKTLE.....LV-RTLYP....
Q4FP84_PELUB/15-165--D-FNK--------------------------------------VLLVDD---LSDTGLTLNKSIE.WL-KNYEPTKDY
Q5NI77_FRATT/16-164--K-DKN--------------------------------------IIIIED---IVDTGHTYHKLIE.GI-GKYNPK...

PF15610

M2SQF2_COCSN/2-255..Q-NRT--------------------------------------LIVLAD---IRTSQDREDEIRR-SF-AVQGI....
C6XW67_PEDHD/2-266..R-DKV--------------------------------------LFFLDD---IKITGSHEKMILK-MV-KEYELKN..
H1Z8U3_MYROD/1-264..K-DKL--------------------------------------CIFLDD---IKITGSHEYTVKK-IL-DTYKVEG..
C7PNW9_CHIPD/2-265..A-GKT--------------------------------------LIFTDD---IRITGSHELIIRN-LL-KKFGLSN..
Q0UEK8_PHANO/2-265..G-SRA--------------------------------------LIILGD---IRMSTEQEEAISN-SF-KSKKIEN..
E3QYQ0_COLGM/52-331..E-GMV--------------------------------------VLNLDD---IYITGGHERAIRR-TF-QEEAAAGRH
E4ZIV8_LEPMJ/2-262..A-GRS--------------------------------------LIVLGD---IRTAHTREDHMTQ-SL-RNLNLDN..
R0KEE4_SETT2/2-259..Q-NRT--------------------------------------LIVLAD---IRTGQDREDRIRA-SF-AVQGI....
G2Z396_FLABF/1-265..K-NKL--------------------------------------CLFLDD---IKITGSHEHTVNK-IL-NQYQVKG..
H1YCE2_9SPHI/3-265..T-NKT--------------------------------------LIFLDD---IKITGSHERMIMK-MV-GNYQLDN..
B2WKS8_PYRTR/2-256..Q-DRT--------------------------------------LIVLAD---FRTGQAWEDLVRS-SF-GARGV....
G0JP06_9GAMM/87-357RWS-GVH--------------------------------------LIFGDD---VLVTGSTADKVL.-..-.YESMRNGA

PF11202

Q888S9_PSESM/14-255--G.AQN--------------------------------------IVFVDG---WTGKGAISGEIRR-SL-A........
R5XB52_9CLOT/25-275--KDSSK--------------------------------------IQFIDG---WTGKGTIANELKK-AC-DELEGIFNM
Q7CKQ6_YERPE/9-249--G.TEG--------------------------------------LVFVDG---WTGKGAITGELTR-SL-Q........
I0DSH9_PROSM/9-249--G.TEG--------------------------------------IVFVDG---WTGKGAITGELVR-SL-T........
STIP_ACIAD/20-273--G.HAS--------------------------------------IVFVDG---WTGKGAIRQELQR-SL-G........
W0ADD0_9SPHN/11-256--D.PKD--------------------------------------IVFVDG---WTGKGAISTELQA-CL-A........
A1VWP9_POLNA/5-253--A.PES--------------------------------------IVFVDG---WTGKGVISRVLEQ-AM-EDFN.....
E4NAQ4_KITSK/21-265--R.PAD--------------------------------------VVFVDG---WTGKGAITRELDQ-AL-AGT......
D3VJW4_XENNA/9-249--G.TDS--------------------------------------VVFVDG---WTGKGAITTELSR-AL-A........
D0L8D3_GORB4/17-267--D.PES--------------------------------------VVFVDG---WTGKGAIQRELTA-AL-REFEQSGGP
C8W646_DESAS/34-283--P.ECK--------------------------------------LQFIDG---WTGKGVIAGELRA-SL-KAFREKYAI
X2GQ89_9BACI/11-261--P.HAR--------------------------------------IQFIDG---WTGKGAITRELQQ-AC-ASYNEQNIQ
R5BVZ9_9FIRM/3-247--R.PED--------------------------------------MLFVDG---WIGKGAILSELRK-AV-ADFP.....
D5CKQ8_ENTCC/9-249--G.TSG--------------------------------------IVFVDG---WTGKGAITGELVR-AL-K........
F8AVP2_FRADG/12-254--D.RRS--------------------------------------LQFVDG---WTGKGAILKVLEA-AA-DGL......
J9STB4_9ACTO/17-267--P.AES--------------------------------------VVFIDG---WTGKGAIQRELTA-AV-GEYARAGRP
A8MM96_ALKOO/473-722--P.GKD--------------------------------------LQFVDG---WTGKGAITEVLME-SC-KNMNQRWGT
Q9RSA8_DEIRA/11-250--P.QAP--------------------------------------LVFVDG---WTGKGSINETLSS-SL-P........
E3EE68_PAEPS/21-271--GLGIE--------------------------------------LQFVDG---WTGKGAIRQVLIE-AC-REMNADYGL
A8F9P7_BACP2/9-258--P.GYE--------------------------------------IAFIDG---WTGKGAISRELQQ-AV-IDFERKYGI
R7CDA0_9FIRM/3-247--R.PQQ--------------------------------------ILFVDG---WIGKGAILNELKK-DI-SAYE.....
Q4FTP9_PSYA2/19-285--P.HSP--------------------------------------IVFVDG---WTGKGAIYQELAH-SL-EAFADPNHP
D1BEJ8_SANKS/16-268--R.PGD--------------------------------------VMFVDG---WTGKGAISRELAA-AV-EEANTALGL
J7INJ2_DESMD/17-266--S.PAK--------------------------------------IQFIDG---WTGKGAITQVLNQ-AC-LEFNAKYNW
R4KIZ1_9FIRM/43-295--P.GCS--------------------------------------IQFIDG---WTGKGAITRELIK-AV-EDFEHKFGI
U5NAN4_9BURK/5-254--D.PAS--------------------------------------IVFVDG---WTGKGVITEELHK-AV-TAYN.....
E6UDF8_RUMA7/3-247--R.PQD--------------------------------------IQFIDG---WTGKGAITRQLEE-AM-KDYP.....
S5UQG8_STRCU/450-701--D.PRD--------------------------------------VVFIDG---WTGKGAITRELAQ-AV-EDFERKEGI
K8E7N2_CARML/7-270--E.QAD--------------------------------------IQFIDG---WTGKGAITKELTE-AC-VKYNQEHPK
F2JGK7_CELLD/19-268--P.AED--------------------------------------IQFVDG---WTGKGVISHTLEK-AC-KHFKNKYEV
Q891X7_CLOTE/27-276--N.EEY--------------------------------------IQFVDG---WTGKGAINRVLKK-AV-EDFYEKYNI
B1HUS6_LYSSC/12-262--P.QGC--------------------------------------LQFIDG---WTGKGAITKELIQ-SC-QTFNEQYQT
I3YAV5_THIV6/12-259--E.AAG--------------------------------------IVFVDG---WTGKGVIARELKA-SV-ESFD.....
D1A9P2_THECD/16-266--D.PAA--------------------------------------VMFVDG---WTGKGAIASELAA-AL-DAHAREEGV
C8XAU5_NAKMY/29-279--D.AAS--------------------------------------VVFVDG---WTGKGAIARELSE-AL-AGVRAAGGP
M1FGD7_9ALTE/15-262--P.VDG--------------------------------------VIFVDG---WTGKGAITAELTE-SW-RALTDREP.
R7IPS7_9FIRM/3-247--E.PSR--------------------------------------LLFVDG---WIGKGAILRELEK-DL-EEYE.....
L0H008_9GAMM/12-261--D.PAS--------------------------------------IVFVDA---WTAKGVITRELKG-TI-VAWN.....
A1SUD4_PSYIN/14-263--K.PES--------------------------------------IVFVDG---WTAKGVMTEELKK-AV-QHYN.....
A8L405_FRASN/18-260--D.RAA--------------------------------------IQFVDG---WTGKGVMTRVLAE-AV-RGL......
F8K488_STREN/11-259--D.PAA--------------------------------------VVFVDG---WTGKGAITRELAR-AV-AEFTGRA..
Q5NWT5_AROAE/5-254--R.PES--------------------------------------IAFIDG---WTGKGVISRELTK-AI-TQYN.....
A4J1D7_DESRM/40-292--P.GCE--------------------------------------VQFLDG---WTGKGAITMELIK-SV-SEFEKEFKM
R5GSI4_9FIRM/375-629--S.ADG--------------------------------------IQFIDG---WTGKGMITRTLRK-AL-EAFPLYEYG
F4H5N6_CELFA/535-785--D.PAS--------------------------------------VVFVDG---WTGKGAIARELDA-AL-ADHEARTGV
Q2RVZ5_RHORT/10-255--D.PAS--------------------------------------IVFVDG---WTGKGAIGGELAR-AM-A........
D3RPA4_ALLVD/12-259--D.PAG--------------------------------------LVFVDG---WTGKGVIARELRR-AL-AGFE.....
E8U3T5_DEIML/6-240--P.AGS--------------------------------------VVFVDG---WTGKGSITQELQR-SL-A........
F8A7B9_CELGA/486-735--D.PRG--------------------------------------VLFVDG---WTGKGAIARELAA-AL-VEHEAITGV
I4D513_DESAJ/17-266--P.EYK--------------------------------------LQFIDG---WTGKGAITMTLRD-AC-LKFQATYGY
H6R9M2_NOCCG/535-790--D.PAS--------------------------------------IVFVDG---WTGKGAITRELSD-AL-DAYHAAGGA
Q186J5_PEPD6/5-254--P.SSK--------------------------------------IQFLDG---WTGKGTISKELEK-AC-NELNVKFKK
A5WBK3_PSYWF/17-290--P.TSP--------------------------------------IVFVDG---WTGKGAIYGELSR-SL-KAYLDKHWT
L0A1Y2_DEIPD/15-266--T.DGS--------------------------------------VIFLDG---WTGKGVIAAELRR-SV-KTYNATRGS
N0AVA9_9BACI/12-261--P.GMK--------------------------------------IQFVDG---WTGKGAISIELTT-SC-QRFFERTNI
I5AXH0_EUBCE/3-247--E.GKD--------------------------------------IQFVDG---WTGKGAIQNELNK-AM-EDFP.....
C0Z9Y7_BREBN/18-267--Q.GKG--------------------------------------IQFVDG---WTGKGAITSVLHE-SI-SRFNQKFHT
A6WD80_KINRD/17-261--D.PSA--------------------------------------VVFVDG---WTGKGAIVRELSA-AL-ARFP.....
J7SKQ6_MORMO/9-249--G.TAG--------------------------------------IVFVDG---WTGKGAITGELIR-SL-K........
H8GG70_METAL/7-254--P.PES--------------------------------------LVFVDG---WTGKGVIAGELAA-SL-EDFA.....
Q0SDY7_RHOSR/11-261--D.SKN--------------------------------------VVFVDG---WTGKGAIARELSQ-AL-AEYREAGGA
F4EXE7_SELS3/3-247--A.PEA--------------------------------------LQFVDG---WTGKGAIARELAN-DA-AEFR.....
H6N264_GORPV/15-265--R.PES--------------------------------------VVFVDG---WTGKGAIARELTD-AL-DAYARAGGA
V4LJY0_9GAMM/11-261--P.AAG--------------------------------------VVFVDG---WTAKGVIKRELDQ-AI-GGWNA....
U5LCP5_9BACI/10-258--P.GCK--------------------------------------IQFVDG---WTGKGAISIELTK-AC-SSMNEKYGW
Q3JCD3_NITOC/20-269--P.AAG--------------------------------------VVFVDA---WTAKGVITEELKR-AI-AHWN.....
Q8KL02_RHIEC/15-256--P.VES--------------------------------------IVFVDS---WTGKGAIANQLEK-SF-KDYSDRPA.

PF15609

D5BYR0_NITHN/23-215--H-SHA--------PDHILYRPL.PAFQQRFA.EA....QT...LVLVDD---EVSTGRTLAQLGY-KL-SQK-..LSN
Q888T1_PSESM/34-221--H-SHA--------SAHLIHLPADPALRDMML.GA....RS...LVLVDD---EASTGKTFINLHQ-AL-VEA-G.LSK
F2JGK6_CELLD/36-258--H-SHA--------TGHECY....TKDPLFFK.RF....SH...IVLVDD---EITTGNTALNLIE-AL-HEK-..SGA
F8A7B9_CELGA/28-256--H-SHA--------TSHLLL....PADPDLLT.GD....EP...LVLVDD---ELSTGRTALATIE-AL-HAV-..HPR
R4KD23_9FIRM/21-261--H-CHA--------PEQRCL....ISDASLVE.GN....DL...LVLIDD---EITSGNTCLDIIK-TI-QGK-..YPQ
L0H292_9GAMM/23-213--H-SHA--------PDHILYTPD.STLAARYR.DT....AT...LALIDD---EITTGRTLTRLAE-AL-ARH-..LPA
Q186J6_PEPD6/22-211--H-SHA--------TDQNLY....FGMLNNFK.FG....DE...IILVDD---EITTANTCMNIIR-KI-QSI-..YPK
F4H5N6_CELFA/44-294--H-SHA--------TSHLLL....PADPAVLA.SA....AP...LVLVDD---ELSTGTTALHTIE-AV-HRL-..GAR
J9RTC8_9ACTO/32-225--H-SHA--------TTHLLQ....PSDPTFLD.AA....SPNEVLIMVDD---EVSTGKTALGAIE-AI-VAE-..RPR
D3V2E0_XENBS/35-224--H-SHA--------TDHLIYWPEENRLRQRVV.NA....RT...LVLIDD---EATTGNTFLNLLN-AL-SHA-G.LNQ
C0ZNQ4_RHOE4/33-221--H-SHA--------TSHLMQ....PTSAELFE.ND....LP...LVLVDD---EISTGATAIDAIR-AL-HGQ-..CPR
Q0RDF5_FRAAA/27-253--H-SHA--------SHHWLV....PEDPAILR.GG....EP...IVLVDD---ELSTGRTALGTIR-IL-HAH-..APR
E8U3T7_DEIML/27-218--H-SHA--------TAHLIHTPHAEVGAAHFA.GA....RT...LVLIDD---ELSTGTTLTNLGR-AY-LDL-..NPG
N0ATX4_9BACI/3-219--H-SHA--------TSHRCY.....VDNLLLQ.NN....RE...IILVDD---ELTTGKTAINIIR-SL-HLK-..FPR
V4IMQ6_9ACTO/22-218--H-SHA--------TSHLLL....PEDPSFFDRGGEAGRGP...LVLVDD---EFSTGNTVLNTLR-DL-HAR-..HPR
Q4FTP7_PSYA2/40-245--H-SHA--------SQHLIYQSADKVTQAQLL.AS....KT...LIMVDD---EASTGNTCVNVVT-AL-RNA-G.LMQ
X2GSG0_9BACI/29-253--H-SHA--------TSHRVY....CEQPEKLL.QA....KQ...IVLIDD---EITTGNTVVNIIE-TL-QRK-..FPH
H6N263_GORPV/13-205--H-SHA--------TTHLLQ....PSSRELLSLDPA...AP...VILVDD---EISTGSTALRAIT-AL-QQI-..TPR
A6WD81_KINRD/34-260--H-SHA--------TGHRLL....PRDPAVLA.ALADPTAP...VVLVDD---ELSTGRTVANTLR-AL-HAR-..SPH
L0A0T7_DEIPD/29-215--H-SHA--------TTQWLHVPLDEHKRARFL.GA....RH...VVIVDD---EISTGVTAVNLVR-CL-AGR-..LPA
F8B557_FRADG/36-231--H-SHA--------TFHWLM....PGDPELVR.AP....RP...LVLVDD---ELSTGRTALGTIR-AL-HAF-..APR
C8XAU6_NAKMY/29-253--H-SHA--------TDHLLR....PGPAVSLA.GA....GP...VVLVDD---ELSTGRTALNVIE-SL-HAT-..HPR
Q3JCD5_NITOC/23-215--H-SHA--------PEHILYLPL.PVFRERFS.QA....QT...LVLVDD---EISTGRTLRELSY-RV-IQA-..LPH
B1HUS5_LYSSC/29-252--H-SHA--------TSHRIY....TEEPNVLQ.QA....KR...IVLIDD---EITTGNTVINIIE-TL-KKK-..FPD
Q9RSB1_DEIRA/35-218--H-SHA--------PAHLLYDPGPAAR......AA....RE...LVLVDD---EVSTGTTLENLAL-EW-LAR-..HPH
A5WBK1_PSYWF/41-238--H-SHA--------STHLIYQSDEPHIQAQLM.AS....KT...LIMVDD---EASTGNTCVNVVS-AL-REA-G.LTE
Q0SDY6_RHOSR/33-221--H-SHA--------TSHQLQ....PTSVELFT.GD....RP...LVLVDD---EISTGATAVDAIR-AL-HRQ-..NPR
E2Q252_STRC2/22-213--H-SHA--------TSHLLL....PEDPALLS.RP....GP...LILVDD---EFSTGNTVLNTLA-EL-HRH-..RRR
A1SUD2_PSYIN/23-212--H-SHA--------VNHMFYAPKTALLEGIIQ.SK....R....LVIVDD---EITTGRTIKLLIS-GL-LKY-..LMN
Q5NWT3_AROAE/14-205--H-SHA--------PRLFLHLPQRDVDRATLA.AA....TQ...VVLVDD---ELSTGNTFVNLVA-AL-RRV-..MPA
M1F8F7_9ALTE/56-248--H-SHA--------TAHHVMAPTSCELLSG...PA....KT...LVLVDD---ETTTGNTFAALFK-AV-HDG-..GVD
V4JFE6_9GAMM/23-221--H-SHA--------PMHLVQQPR.PRLRGAFD.AA....RS...LVIVDD---EVSTGRSVAALAN-SI-MAQ-..MPS
D0L8D2_GORB4/36-225--H-SHA--------TTHLLQ....PSSPDLLR.SP....GP...LVLVDD---EISTGKTALEAID-AL-HRL-..APR
H6R9M2_NOCCG/48-236--H-SHA--------TSHLLQ....PAPADIFV.ND....LP...LVLVDD---EISTGDTAMDAVR-AL-HAF-..APR
H8GG72_METAL/25-219--H-SHA--------TDFFLYFPAEAQAQELFR.RA....EI...LVLIDD---EISTGRTFLRLIQ-AY-QAV-..NPG
U5LBE9_9BACI/23-240--H-SHA--------TSHRCY.....ADRELLD.NQ....RE...VILVDD---EMTTGKTAVNIIR-SI-QAE-..FPR
F3ZD08_9ACTO/22-212--H-SHA--------TSHLLL....PADPALLT.AP....GP...LVLVDD---EFSTGSTVINTLR-EL-HAL-..RPR
E3EE67_PAEPS/1-230--H-SHA--------VDHRCY....ALNEDAFA.GD....GP...IVLVDD---EITTGKTTLNIIR-DI-QEH-..FPR
Q2RVZ3_RHORT/30-224--H-SHA--------TSHLIHQPAAALDRALCA.AC....RT...LVLVDD---EASTGATFVALVE-AN-RAA-..MPN
G2NBS3_9ACTO/22-216--H-SHA--------TSHLLL....PERPDLLS.APDRG.AP...LVLVDD---EFSTGNTVLNTIR-AL-HER-..YPR
C8W645_DESAS/19-238--H-CHA--------PEQRCL....VCDASLFT.NN....DL...LVLIDD---EITTGNTCLNFIK-TI-QEK-..YPQ
Q7CKQ5_YERPE/29-218--H-SHA--------TDHLLYLPSDPVLRARLQ.RA....RS...VVLIDD---EATTGNTFINLLQ-AL-RDA-N.LNG
W0LDC5_SERFO/29-220--H-SHA--------TDHLIYLPHDAELRRRVL.EA....KT...LVLIDD---EATTGNTFINLLQ-AL-QQE-AGLRH
Q2J6S1_FRASC/55-272--H-SHA--------THHWLM....PEDREILR.CG....AP...IVLVDD---ELSTGRTALGTIR-IL-QAH-..APR
D5CKR0_ENTCC/30-220--H-SHA--------TDHLIYLPDDEEKRRRVT.NA....RT...LVLIDD---EATTGNTFINLLS-AL-RNT-GKLQH
Q891X6_CLOTE/33-257--H-SHA--------VEHFCY....PIGYENFI.NEF...ER...IVLVDD---EITTGNTVLNLIK-SI-NSK-..YPG
E3IYR1_FRASU/25-221--H-SHA--------VHHWLL....PADRRLLT.DP....RP...LLLVDD---ELSTGNTAIGTIR-AL-HAL-..APR
A1VWP7_POLNA/22-216--H-SHA--------PRQFLHRPGDVGLQHILL.SA....RA...LVLVDD---EASTGNTFLNLSA-AC-RAL-..NPA
I0DSI1_PROSM/30-221--H-SHA--------TDHLLYLPHDPELRRRVL.HA....QT...VVLVDD---EATTGNTFINLLC-AL-RDA-GGLTE
V6JVQ1_STRRC/37-226--H-SHA--------TSHLLL....PEDPALLA.GD....GP...LVLVDD---EFSTGNTVLNTIR-DL-HER-..YPR
A8F9P6_BACP2/17-239--H-SHA--------TDQLCY.....ADVSLLR.TA....RP...IVLVDD---EVTTGRTNINIIR-DL-HAK-..HPR
M1SJV4_MORMO/30-220--H-SHA--------TDHLLYFPADPQLKTRLQ.QA....KT...LVLADD---EATTGNTFTNLLT-AL-HES-GQLPD
U5N786_9BURK/38-230--H-SHA--------PQQWFFLPPDPHRRALLH.HA....RS...LVLIDD---EISTGDTLVNLVG-AM-QSC-..SPA
A4J1D6_DESRM/37-256--H-CHA--------PDQRCL....ICQGSIMK.DN....DL...LVLVDD---EITTGNTCLNIIE-TL-QQK-..YPQ
D1A9P3_THECD/28-256--H-SHA--------TSHLLL....PADPALME.TA....GP...VVLVDD---ELSTGTTALNTIR-AL-HAA-..HPR
J7ISK8_DESMD/39-259--H-SHA--------VNHRCY....SVDPELLR.NP....ET...IVLVDD---EITTGNTALNIIK-AI-HAK-..FPK
C0Z9Y6_BREBN/39-262--H-SHA--------VAHHFY....PLDKNLLH.SA....CP...IVLVDD---EITTGKTALNIIR-EI-QQH-..FPR
A8L404_FRASN/37-236--H-SHA--------THHWLM....PADPGVLE.IP....GR...LLLVDD---ELSTGRTAMGTIR-IL-HAF-..APR
B4EW77_PROMH/30-221--H-SHA--------TDHLLYLPHNLEQRQWIQ.QA....KT...IVLIDD---EATTGNTFLNLLS-AL-REE-GKLTQ
D1BEJ9_SANKS/28-275--H-SHA--------TEHLLL....PHDPRFLA.DA....GT...VVLVDD---EISTGKTALNTVR-AL-HAD-..RPR
C3ASF9_BACMY/11-231--H-SHA--------TSHRCY.....VDKSYFQ.NE....QP...IVLVDD---EMTTGKTALNIIR-SI-QEK-..FPR
F8K489_STREN/28-217--H-SHA--------TSHRLL....PADPGWLT.DG....AP...LVLVDD---ELSTGRTIRNTVE-AL-HRR-..APR
D3RPA9_ALLVD/31-224--H-CHA--------PDQLLYAPIQPEQRRRFE.SA....RE...LVLIDD---EISTGNTLCNLVE-SY-RRL-..NPG
A8MM96_ALKOO/39-263--H-SHA--------KDHNCY....GLNQDLLA.SD....MP...IVFIDD---ELTTGKTILNIIQ-AL-HGK-..YPR
D7C985_STRBB/21-212--H-SHA--------TSHLLL....PEDPALLA.TD....GP...LVLVDD---EFSTGRTVLNTIA-AL-HRR-..FPR
K8EW86_CARML/29-250--H-SHA--------TSHKVY....AENQDFFQ.NE....NE...IILVDD---EVTTGKTNLNIIR-DI-IKE-..FPH
I3YAV0_THIV6/25-218--H-CHA--------PDQMLYEPLNARHRELFQ.TA....RE...LIVVDD---EISTGSTLCNLVA-AY-RTR-..NPR
R5X4A9_9CLOT/51-237--H-SHA--------TNHNLY....YEDLKYLE.NK....DE...IILVDD---EITTGNTCINLIK-KV-NEL-..YPK
W0AF65_9SPHN/32-217--H-SHA--------STHLIYAPDWGEGLTARF.......RS...LILVDD---EVSTGTTLVNLAT-AL-AGK-..LPA
I4D512_DESAJ/37-259--H-SHA--------INHRCY....LNNNDDLH.TA....KT...IVFVDD---ELTTGNTVLNLIR-AI-HHQ-..YPK

PF14681

B9PK97_TOXGO/39-243--P-ADI........RDRW..............-..----..---VMLLDP...MCATAGSVCKAIE-VL.LRL...GVK
E3L591_PUCGT/16-219--P-AVP........QVDT..............-..----..---VFLLDP...ILATGGTAIAACN-ML.VNA...GIP
Q5AWP2_EMENI/470-667--E-EHL.......KGIVN..............-..----..---VILVDS...VINSGESMAQFVQ-RI.REV...DGA
E3FKH4_STIAD/10-212--P-GQL........TDRD..............-..----..---VIVCDP...MLATGNSAIAALS-RI.KN.....SK
B1XW63_LEPCP/8-210--P-HDM........PERD..............-..----..---AIVLDP...MLATGNSAVAAVE-RL.KE.....TR
A5FZR1_ACICJ/10-212--P-DDM........DQRL..............-..----..---TVVVDP...MLATGHSAAAAVT-RL.KRA...GA.
Q2RS40_RHORT/14-217--P-ET.........TERT..............-..----..---FILVDP...MLATGHSGAHAAT-VL.LRH...GVP
UPP1_SCHPO/12-217--P-EDI........SKRY..............-..----..---VLLLDP...MLATGGSAICAME-IL.INM...GCK
C5CEA9_KOSOT/6-207--P-KL.........NDNE..............-..----..---IFVLDP...MLATGFSSAVAID-MV.KKA...GG.
F0XHJ4_GROCL/10-224--P-NHIGDQ.DDPESGKL..............-..----..---AIILDP...VIATGGTCAAAIQ-SL.RE.....WG
D5BUA7_PUNMI/7-209--P-HDI........ATRQ..............-..----..---VILADP...MLATGGSAILGMQ-KL.VEM...G..
E6ZJH4_SPORE/8-212--P-VSP........TVDQ..............-..----..---VIILDP...LIATGGTAVACIQ-MI.LDW...GVP
A2R643_ASPNC/9-224--P-FQPDSSSTNTAAAAT..............-..----..---AILLDP...VIATGATAEAAIQ-LL.RE.....WG
B0C7X6_ACAM1/9-216--P-DQF.......LPQTR..............-..----..---ILITEP...MLATGGSIMTTMQ-EL.TQR...QAN
D1CCZ6_THET1/6-207--P-QDM........KIDV..............-..----..---ALVLDP...MLATGGSAVAAVD-VL.KLR...N..
B6HJ77_PENCW/9-232--P-FHR........SQLSPASPASLNPTTNTA-AA----SL---AVLLDP...VIATGATAEAAIQ-LL.RD.....WG
B9GJS2_POPTR/275-479--P-KDI........SERH..............-..----..---VLLLDP...VLATGNSANQAIE-LL.IQK...GVP
UPP_BRADU/6-208--P-SDL........GERL..............-..----..---AIVVTP...VVATANTAVAAID-RL.KER...GA.
E2B6P7_HARSA/345-550--P-KDI........KDYK..............-..----..---VILMDA...TVATGAAAIMAIR-VL.LDH...DVA
D2QZE9_PIRSD/6-207--P-QTQ........PVDV..............-..----..---ALVLDP...MLATGGSAHLAIE-TL.QR.....WG
E3Q271_COLGM/16-231--P-NQL.......VADGSNAG...........-AS----DL---AIILDP...VIATGGTCAAAIQ-TL.RE.....WG
E0U7K3_CYAP2/9-216--P-PLF.......APDTR..............-..----..---VIILEP...MLATGGSIMTAME-EV.TKR...GAD
A5EVG4_DICNV/7-209--P-KAM........DERI..............-..----..---TLVVDP...MLATGFSAIESIY-KV.KAL...G..
F2UAE3_SALR5/11-216--P-SKI........CNCQ..............-..----..---VILLDP...MLATGGSAMKAIE-VL.HSH...GVP
Q8DI28_THEEB/15-222--P-PRL.......DPQTR..............-..----..---VLISEP...MLATGGSIMTAMQ-EL.VQR...GID
Q2H9K6_CHAGB/10-227--P-NHL.......ASGGGTAGG.........S-AS----EL---AIILDP...VIATGGTCAAAIQ-TL.RE.....WG
B8HYJ3_CYAP4/9-216--P-EQL.......DPQTR..............-..----..---ILVSEP...MLATGGSILTAMA-EL.TQR...GAD
Q0TWS2_PHANO/12-227--P-YHT.......ATSNTPI............-.P----DL---AIICDP...IIATGATCCAAID-TL.KD.....WG
Q1AVG9_RUBXD/10-211--P-RNL........ADYL..............-..----..---VLVLDP...MLATGGSLSATLG-KL.KEE...GA.
D8TYT8_VOLCA/53-261--P-PQL.......SPDDL..............-..----..---FLITDP...MLATGGTIVKVVD-DI.VSR...GGR
B0CYQ9_LACBS/7-210--P-PSP........ALDN..............-..----..---VFLLDP...LIATGGTACAALA-MI.VDW...GIP
E9QGS0_DANRE/320-526--P-KDI........SEDY..............-..----..---VILMDS...TVSTGAAALMAVR-VL.LDH...DVQ
UPP_MYCA5/4-206--P-DV........PKDSY..............-..----..---IMVVDP...MLATGVSANDAIN-KL.VNL...GF.
A7S545_NEMVE/352-557--P-KDI........SDDH..............-..----..---VILMDA...TVATGAAALMAIR-VL.LDH...EVK
B1XP85_SYNP2/9-217--P-AQF.......APETR..............-..----..---LLLLDP...MLATGGTITAAMA-EV.TKR...GIA
F0XXG3_AURAN/8-217--P-PKI........EAMN..............-..----..---VLLCDP...MLATGGSALTAIK-VL.KDA...GVP
C0NWK2_AJECG/11-260--P-FKP.......LAENPQKNA.........A-AV----SL---AIIVDP...IIATGATCAAAIQ-TL.KE.....WG
B8BYV0_THAPS/18-231--P-KGM.......SEMTS..............-..----..---VILCDP...MLATGGSSITALD-ILVKEH...GVQ
C3ZI77_BRAFL/271-477--P-KNI........SEDH..............-..----..---VFLMDA...TVSTGAAAIMAIR-VL.LDH...DVQ
B2AWA7_PODAN/10-225--P-NHL.......SSSSSSEK...........-TP----DL---TIVLDP...VIATGGTSAAAIQ-TL.KE.....WG
A8NXX8_COPC7/7-210--P-PSP........PIDN..............-..----..---VFLLDP...LIATGGTVCAAIG-ML.TEW...GIP
Q53LT4_ORYSJ/267-471--P-KDI........ANRH..............-..----..---VLLLDP...ILGTGNSAVQAIS-LL.LKK...GVQ
E1ZQY9_CHLVA/5-212--P-PSF.......GPEDR..............-..----..---ILVSDP...MLATGGTLAQVVE-DV.VGR...GAS
A5GTE0_SYNR3/9-216--P-KRI.......GERVG..............-..----..---VMVFDP...MVATGGSLAMVLR-QL.KEL...GVH
B3S289_TRIAD/277-481--P-KNI........DRDY..............-..----..---VILMDA...TLATGAAALMAIR-VL.LDH...EVQ
C5KJG5_PERM5/30-243--P-EF........KSSPH..............-..----..---VLLLDP...MLATGGSCIMAIK-SL.LEDPNCHIV
A4HAL7_LEIBR/9-219--P-KDV........ASRR..............-..----..---VLLLDP...MCATGGSVIKATE-IL.INE..YGVD
A4S9H3_OSTLU/196-418--P-HDI........ADRY..............-..----..---VLLLDP...ILATGVSAQSAID-LL.LER...GVQ
UPP2_SCHPO/13-219--P-KDA........QDRL..............-..----..---VLLLDP...LLATGNSVILAIQ-TL.INK...GIP
B6K7J9_SCHJY/15-220--P-GDA........PERV..............-..----..---VLLLDP...MLATGGSVMLAIQ-AL.IDR...NVD
C1E7B8_MICSR/254-468--P-ADI........SDRY..............-..----..---VLLLDP...ILATGVSSMAAID-RL.IKA...GVR
B9S674_RICCO/251-459--P-ADI........SSRH..............-..----..---VLLLDP...VLASGYCAVKAIS-LL.LSK...GVP
D2SG74_GEOOG/5-206--P-ASL........VDRE..............-..----..---VFVLDP...MLATGGSLVHCCG-LL.TGR...GA.
A2R0T1_ASPNC/17-223--P-AGI........TDDI..............-..----..---VLLLEP...MLATGGSVIKAVE-NL.TSN...GVP
E4X7A3_OIKDI/322-527--P-RGI........ANDH..............-..----..---CVLMDA...SIATGAAAMMAIR-VL.LDH...DVR
D8PR38_SCHCM/5-209--P-SKP........NVDL..............-..----..---VYLLDP...LIATGGTANAALS-ML.LDW...GIP
D3BNE7_POLPA/239-442--P-D.L........TDSH..............-..----..---VLVLDP...TIASGASSQMAIR-IL.LDH...GVP
B8CAC1_THAPS/44-250--P-KKC........DVDV..............-..----..---AYVLDP...LIATSATIISVAG-IL.KK.....WG
D5GBY9_TUBMM/10-229--P-TRA.......DSSKDEKST..........-PC----DI---AIVLDP...VIATGGTAEAAIQ-TL.REW...GVP
A0CZ39_PARTE/55-262--P-ENI........HEQQ..............-..----..---IILVDP...MLGTGGSASMALK-IL.QNY...GVK
A1C4H4_ASPCL/15-220--P-SQI........PQCR..............-..----..---VLLLEP...MLATGGSVIKAVE-LL.IEK...GVP
F0ZZY8_DICPU/270-473--P-D.L........TDSH..............-..----..---VLVLDP...TIATGASSEMAIR-VL.LDH...GVP
Q19583_CAEEL/298-503--P-PHI........TRYK..............-..----..---VIIMDA...TVTTGSAAMMAIR-VL.LDH...DVK
D1C823_SPHTD/29-232--P-ESY.......AEIDH..............-..----..---LLLLDP...MLATGGSLRAALE-IV.RE.....GY
Q5CME0_CRYHO/242-456--P-DDI........ASRN..............-..----..---VFILDP...ILGNGFGVFSAIK-YL.LSK...GVL
A8GCF9_SERP5/8-213--P-DDI........AERA..............-..----..---VLLFEP...MLATGGSLIMAIE-TL.LEQ...GVP
A8P7X1_COPC7/39-231--.-RRN........DPTK..............-..----..---TLLL......QATGGSAIKAVE-VL.IEH...GVP
B7FX04_PHATC/21-232--P-RTC........HADV..............-..----..---AYILDP...VIATSSTVMSLIS-IL.KKW...GVP
A8JC08_CHLRE/54-264--G-WEP........ASHK..............-..----..---VPVVDPTPPVQACRGTEGTVIE-DI.VAR...GGR
A9URE0_MONBE/281-484--P-NGI........SNHK..............-..----..---VMLMDA...TLATGASAMMAIR-VL.MDH...HVP
B6AH00_CRYMR/25-230--P-TDV........SNRV..............-..----..---VILMYP...VMETGKSICRVIQ-IL.TEH...HVE
B6ABC4_CRYMR/233-447--P-SDI........NSRY..............-..----..---VFILDP...VLGNGFAVSSAIK-YL.IDR...GVL
E4X3J2_OIKDI/287-498--P-QSS........RKNF..............-..----..---VILMDP...TISTGHAAMMAIR-VL.LDH...DFQ
A0CTP7_PARTE/56-263--P-EDI........DQKQ..............-..----..---VILTDA...MITTGGRISTAIK-AL.QSN...GVN
F2UFG2_SALR5/279-483--P-KQI........HKST..............-..----..---VLLLDA...SIATGQAAIMAIR-VL.LDH...GVA
F0YEY4_AURAN/277-487--P-VSGG......SECDV..............-..----..---AFILDP...VIATSRTMQPVVS-KL.KA.....WG
Q0TVS3_PHANO/438-633--Q-DHV.......KGKVT..............-..----..---VILVDS...VVNSGKTVVDFVQ-HI.RDI...HAT
F2PL94_TRIEC/448-645--P-HHV.......QGKVT..............-..----..---IILVDS...VINSGKTVAEFLG-HI.QIL...HST
B6GYG1_PENCW/502-699--.-.HL.......KDMAT..............-..----..---IILVDS...VVNTGRSVLEFVE-HI.RSL...NAA
E3QN18_COLGM/468-663--A-GK...........QT..............-..----..---VLLVDS...VVNSGKTIVEFVE-QI.RKL...D.T
B2AP82_PODAN/589-789--.-RHL.......LGLET..............-..----..---VLLVDS...VVNTGKSIVEFVR-HI.RGL...NSR
D5GK17_TUBMM/495-691--P-NHL........RQHT..............-..----..---VVLVDS...VVNSGKTVVNFVK-HI.RSL...HAT
Q0CK66_ASPTN/515-712--.-HHL.......LGLSA..............-..----..---VVLVDS...VVNNGKTVVSFVR-HI.RSL...DAN
C4JD99_UNCRE/393-591--Q-GRL...........T..............-..----..---VLLVDS...VVNSGKTVIEFLH-HV.RRL...HG.
C7ZP62_NECH7/505-702--.-HHL.......KNQRT..............-..----..---VILVDS...VVNSGKSITEFVM-RI.RNS....HP
Q2GUM1_CHAGB/474-672--P-GHI.......KGQCT..............-..----..---VVLVDS...VVNSGKSIVDFAQ-RI.RSF...DAT
E9F4S0_METAR/604-801--K-DHV.......EKQKT..............-..----..---VVLVDS...VINSGTTLIEFIE-RT.RKL....CK
B1WT56_CYAA5/9-216--P-EKF.......APNTQ..............-..----..---IIILEP...MLATGGSIMTAMQ-EI.AQR...EAD
C5AAP9_BURGB/13-214--P-D.L........EDRT..............-..----..---FILCDP...MIATGYSAVHAVD-VL.KRR...QVP
D5A477_ARTPN/9-216--P-DGF.......DPQTR..............-..----..---LIVSEP...MLATGGTIMATMA-EL.TKR...GID
E9C694_CAPO3/359-559--P-KRL........AGAH..............-..----..---ILLVDA...TIATGAAAMMAIR-VL.LDH...DIP
G7Z3C1_AZOL4/35-237--P-PA.........EGRL..............-..----..---FIVVDP...MLATGNSAAHACD-VL.NRH...GVD
H3D4M3_TETNG/291-494--P-KDI........SEDH..............-..----..---IILMDS...TVSTGAAAMMAVR-VL.LDH...EVR
Q4WZP7_ASPFU/9-223--P-FLR........PDSPTNST..........-AA----TL---AILLDP...IIATGATAEAAIQ-LL.RE.....WG
Q5KGX1_CRYNJ/6-210--P-SQV........TADL..............-..----..---VFLLDP...LIATGGTAIAALN-ML.TEW...GLE
Q7UFD1_RHOBA/6-207--P-KKG........APNV..............-..----..---ALILDP...MLATGGSIDMVVR-RL.MR.....WG
R7D7S5_9FIRM/7-208--P-DPI........EQRL..............-..----..---IVLTDP...MLATGGSAVDAVR-MI.KQH...GG.

PF14572

E9FWJ1_DAPPU/165-348--G-GRI--------------------------------------AIMVDD---MIDDVRSFVAAAE-VL-KDR---GAY
KPRB_HUMAN/179-363--G-GRI--------------------------------------AIIVDD---IIDDVDSFLAAAE-TL-KER---GAY
Q961V3_DROME/165-361--S-GRI--------------------------------------AIMVDD---LIDDVQAFVAAAE-ML-KEN---GAC
F1KVQ3_ASCSU/169-364--G-GRI--------------------------------------AIIVDD---IIDEAQSFVAAAE-VL-KAR---GAY
Q6P8C3_XENTR/167-349--H-GKI--------------------------------------AIIVDD---IIDEVESFVAAAD-IL-KER---GAF
Q23166_CAEEL/167-347--G-GRI--------------------------------------AIMVDD---IIDDAQSFVAAAE-VL-KAR---GAY
A7T9J2_NEMVE/4-194--G-GKI--------------------------------------AIIVDD---MIDDATTFVDAAR-LL-RDR---GAY
F1L6K6_ASCSU/169-364--G-GRI--------------------------------------AIIVDD---IIDEAQSFVDAAE-VL-KAR---GAY
B3S6Z0_TRIAD/157-339--T-GKI--------------------------------------AIIIDD---MIDNLDLLLKAAE-LL-EER---GAY

PF00156

PYRE_DEIRA/34-188..CI------------GLCCI-----------------------------I------....DRRQ------------QTG
Q3SMI9_THIDA/14-177..EI------------RTAVL-----------------------------V------....DRGV------------TTL
PYRE_BIFLO/37-192..VV------------GLVLS-----------------------------V------....DRME------------KTK
A6GZJ5_FLAPJ/2-150..KF------------KTAVL-----------------------------I------....DRNH------------KKY
PYRE_PROAC/43-197..VV------------GVLAL-----------------------------F------SYELEKGH------------RAF
Q8EVI3_MYCPE/12-166..EI------------KTCTL-----------------------------F------....NKIS------------DYK
Q0CVT8_ASPTN/931-1096.DRI------------RIIVV-----------------------------A------E.FPDHHG------------RGL
Q2YAL8_NITMU/16-212..EL------------ICAVP-----------------------------V------....APPD------------TVE
Q4XNN5_PLACH/73-239..IV------------ACIVI-----------------------------L------....NRNE------------HEI
Q1DDD8_MYXXD/86-239..KV------------ATACL-----------------------------M------.....TKP------------GGF
Q6NF43_CORDI/11-164...V------------RSAVI-----------------------------Y------....AKSR------------SIV
KPRS_METS3/132-293..SV------------DVCCV-----------------------------H------P.ILVNGA------------TMR
A5V979_SPHWW/2-156.DNV------------RFATL-----------------------------I------....DNVV------------SAE
A7E5A9_SCLS1/57-218..IV------------GCGVV-----------------------------M------....RQGE------------KWM
C1DM73_AZOVD/5-153..KV------------IRMAV-----------------------------Y------....SSSM------------APA
A8LJR1_DINSH/150-296..EV------------HSYIT-----------------------------H------....GVLS------------GPA
UPP_AQUAE/39-188..KV------------KSVHA-----------------------------I------....AAPE------------GLK
Q8EUA5_MYCPE/11-161..SV------------EIITL-----------------------------L------....DKPA------------GRK
Q0K973_CUPNH/14-164.TEV------------RSAVL-----------------------------W------....YKAC------------SKV
A4CGY8_ROBBH/133-287AICI------------GIHAV-----------------------------F------....SGNA------------YQD
A3U7I6_CROAH/14-161..II------------KIATL-----------------------------C------....YKPS------------AYG
A6QAE7_SULNB/5-148.IEF------------RIASI-----------------------------Y------....YKKT------------AVI
Q2RSZ0_RHORT/17-167..RI------------ISAVL-----------------------------A------....RNRA------------CAE
HPRT_MYCPN/9-158..SV------------ILVSF-----------------------------I------....EKLK------------PRE
O83317_TREPA/210-372..QV------------IAAVS-----------------------------L------P.FFTGNA------------LEL
PYRR2_LACPL/1-156..SI------------ALAVL-----------------------------V------....DRGH------------REL
Q4DVM9_TRYCC/44-213..VI------------EAVAL-----------------------------C------NVPSLDGI------------GAI
PYRE_HYPNA/34-182..VV------------GGACI-----------------------------I------....DRSG------------GRA
PURR_STRR6/106-265..LA------------GVAVF-----------------------------A------....DNAQ------------EER
Q27375_TOXGO/94-256..SM------------RIATL-----------------------------V------....EKRT------------DRS
XGPT_RHOS4/14-159..RA------------HFATV-----------------------------Y------....AKPS------------GRP
Q4FP84_PELUB/15-165INEV------------KTACL-----------------------------W------....KKKS------------STF
Q5NI77_FRATT/16-164..TL------------KFATL-----------------------------L------....FKPA------------RLE

PF15610

M2SQF2_COCSN/2-255.TTV------------FAYLAALSDSAT..TVALSNLLSSVISPSMKD..I------EAITQRPH------------FFM
C6XW67_PEDHD/2-266.DIY------------MLYFAELANHDI..HPNIENHLNYHKVRSVFD..L------DEIIKSGN------------FCF
H1Z8U3_MYROD/1-264.TFL------------FLYYAEVVNLAI..DPKIENFFNYYTISDANA..L------VELINSEA------------FKF
C7PNW9_CHIPD/2-265.DAY------------YLYYAQLQNQDI..HPNIENKLNYYSVHSLQS..L------EAVIGSSS------------FRF
Q0UEK8_PHANO/2-265.TIV------------FAYLATLDESVN..TSALSSTLSSIVSPSIKD..I------DSLAHSRY------------FSM
E3QYQ0_COLGM/52-331HDVY------------YLYIAKLANPKI..DPAIETRLNEVAVPQFKD..F------KSIIEGPM------------FII
E4ZIV8_LEPMJ/2-262.PIV------------FAYIAAVEGLQH..TAGLTSLMALIVGPTIKD..I------ETIAQAAN------------FTM
R0KEE4_SETT2/2-259.TTV------------FAYLAALDDAAA..TPQLSTFLSSVVSPSIKD..I------ESIAQGPS------------FVM
G2Z396_FLABF/1-265.DFI------------FIYFAELINKEI..HPKIENFYNYYAVQNLHD..I------INIINRPT------------FQY
H1YCE2_9SPHI/3-265.DIY------------MLYFAELVNKAI..HPNIENYLNYHQVKSIFE..L------DPIIKSGS------------FAI
B2WKS8_PYRTR/2-256.TTI------------FAYLASLDQSTT..TTALTKFLSSVISPSMKE..I------QNISQPPN------------FVM
G0JP06_9GAMM/87-357KSFR------------AIYPVAIDPRVALGDASVEDRLNSVVVEQRLDDTV------AELLSARD------------YQP

PF11202

Q888S9_PSESM/14-255......GDTRFPQDP.RLVVLADPCG------------------------S------AWLAASAE------------DWV
R5XB52_9CLOT/25-275....KFDS........SLAVLADPCG------------------------Y------SNVYGIRE------------DFL
Q7CKQ6_YERPE/9-249......GRPGYPELP.RLVVLADPCG------------------------C------SWLSATDD------------DWL
I0DSH9_PROSM/9-249......GREGYPAQP.RLVVLADPCG------------------------C------AWLSASHD------------DWL
STIP_ACIAD/20-273......NDTRFIGKPLPLVVLSDIAG------------------------C------AWLAASGD------------DWL
W0ADD0_9SPHN/11-256.......DRPFGVAP.FLTVIADPAG------------------------R------ADLAATED------------DYL
A1VWP9_POLNA/5-253......RQHEVSIDA.GLYVLSDLAG------------------------T------AACAASSL------------DYL
E4NAQ4_KITSK/21-265....GFDP........ELAVLADPGG------------------------C------VRTYGTRD------------DFL
D3VJW4_XENNA/9-249......GRAGYAGIP.RLVVLADPCG------------------------C------SWLAASDD------------DWL
D0L8D3_GORB4/17-267....RLHD........GLAVLADTGY------------------------C------TGTFGTRD------------DFL
C8W646_DESAS/34-283....EINS........SLAVLADPGY------------------------C------AAIFGTRE------------DFL
X2GQ89_9BACI/11-261....QLDA........TLAVLADPGH------------------------C------AAIYGTRA------------DFL
R5BVZ9_9FIRM/3-247....GVSP........ELAVLADPAN------------------------V------TKLCGTHE------------DIL
D5CKQ8_ENTCC/9-249......DRPGYPEQP.RLVVLADPCG------------------------C------SWLAASDD------------DWL
F8AVP2_FRADG/12-254....GLDA........SMAVISDPGH------------------------C------TPLHGTRD------------DFL
J9STB4_9ACTO/17-267....QLHD........ELAVLADPGS------------------------A------TTLFGTRD------------DFL
A8MM96_ALKOO/473-722....HLSS........DLAVLADPGH------------------------C------SATFGTRE------------DFL
Q9RSA8_DEIRA/11-250..........EDVPP.HLAVLSDPAG------------------------V------ARHAATHD------------DLL
E3EE68_PAEPS/21-271....RLND........DLAVLADPGS------------------------C------SETFGTRE------------DYL
A8F9P7_BACP2/9-258....RLSS........ELAVLADPGY------------------------C------TQVYGTRE------------DFL
R7CDA0_9FIRM/3-247....GVSA........DIAVVADPAN------------------------V------TELCGTHE------------DIL
Q4FTP9_PSYA2/19-285N...FANIFHQGMDVIPLLTLADPAG------------------------V------AWLAASEE------------DWL
D1BEJ8_SANKS/16-268VE..GFSA........DLAVLADPGH------------------------C------AELFGTRD------------DYL
J7INJ2_DESMD/17-266....ELDD........DLAVLADPGH------------------------C------VKTFGTRE------------DFL
R4KIZ1_9FIRM/43-295NSG.TLIK........DIAVLADPGH------------------------C------ANIFGTRD------------DFL
U5NAN4_9BURK/5-254......HARGTAIAQ.HLYVLSDLAG------------------------C------AHCAASTE------------DYL
E6UDF8_RUMA7/3-247....EVSP........GLGVLSDPAF------------------------I------SEKCGTHD------------DFL
S5UQG8_STRCU/450-701T...GFDP........EIAVLADPGS------------------------C------VRTYGTRE------------DFL
K8E7N2_CARML/7-270LVV.PLSD........SLAVLADTGY------------------------C------TTLYGTRE------------DFL
F2JGK7_CELLD/19-268....DLDD........TLAVLCDPGE------------------------C------TSLYGTRA------------DFL
Q891X7_CLOTE/27-276....RLDS........ELAVLSDPSK------------------------C------VSLYGTRE------------DFL
B1HUS6_LYSSC/12-262....QLKA........DLAVLADPGH------------------------C------ATIFGTRE------------DFL
I3YAV5_THIV6/12-259......RTHGIRLDT.TLFALTDLAG------------------------V------G.IAPTDA------------DYL
D1A9P2_THECD/16-266....RFPG........ELAVLADPGR------------------------C------AEIFGTRD------------DFL
C8XAU5_NAKMY/29-279....AFSD........DLAVLADPGH------------------------C------VRTFGTRD------------DFL
M1FGD7_9ALTE/15-262................MLAVIADPCG------------------------R------ANLCGSRE------------DWL
R7IPS7_9FIRM/3-247....GVSK........ELAVLADPAN------------------------A------SDLCGTHE------------DIL
L0H008_9GAMM/12-261......RREREQLDP.RLYVISDVGG------------------------S------ADAAATYD------------DYA
A1SUD4_PSYIN/14-263......TRRNLNLSE.QLFVISDIGG------------------------T------ADFSATFD------------DYA
A8L405_FRASN/18-260....GVDD........TLAVLADPAR------------------------C------VPLFGTRD------------DFL
F8K488_STREN/11-259....RFDP........RLAVLADPAG------------------------C------AWAYGTRE------------DFL
Q5NWT5_AROAE/5-254......RSHGTAIDP.GLNVLTDLAG------------------------S------AALAASSE------------DYL
A4J1D7_DESRM/40-292PPD.TISK........DMAVLADPGY------------------------C------ANIFGTRD------------DFL
R5GSI4_9FIRM/375-629VGRDKLDRMC......EIAVLADPAG------------------------L------CRLCGTHD------------DIL
F4H5N6_CELFA/535-785....AFPR........ELAVLADPGR------------------------C------VRLAGTRD------------DFL
Q2RVZ5_RHORT/10-255......GDFPQLTGA.PLCVLSDLAG------------------------V------ATLAAGDE------------DYV
D3RPA4_ALLVD/12-259......HDHGVRLDA.DLHALTDLAG------------------------V------G.IAPSDT------------DYL
E8U3T5_DEIML/6-240.........GHAVAP.RLAVLSDPAG------------------------V------ATFTATHD------------DYL
F8A7B9_CELGA/486-735....AFPS........ELAVLADPGW------------------------C------VDLFGTRD------------DFL
I4D513_DESAJ/17-266....ELDS........DLAVLTDPGH------------------------C------VNTFGTRE------------DFL
H6R9M2_NOCCG/535-790....RFND........DLAVLADPGQ------------------------C------VRTYGTRD------------DFL
Q186J5_PEPD6/5-254....HFDS........TLAVLADPAG------------------------Y------SGLYGIRE------------DFL
A5WBK3_PSYWF/17-290ADASFSNVFHQGRGVVPLLTLADPAG------------------------V------AWLSASNE------------DWL
L0A1Y2_DEIPD/15-266....ALQG........ELFVVSDPGG------------------------A------AARCATRL------------DYL
N0AVA9_9BACI/12-261....KLDD........TLAVVADPGN------------------------C------TNLYGTRE------------DYL
I5AXH0_EUBCE/3-247....KIDP........GLAVLSDPAY------------------------I------AGICGTHD------------DFL
C0Z9Y7_BREBN/18-267....RLDA........DLAVLADPGH------------------------C------VQTFGTRE------------DFL
A6WD80_KINRD/17-261....GFSD........DLAVLADPGH------------------------C------VRTFGTRE------------DYL
J7SKQ6_MORMO/9-249......DRPGYPVDP.RLVVLADPAG------------------------C------AWLSAADD------------DWL
H8GG70_METAL/7-254......ASAGIRIAA.DLFVLADLSG------------------------S------AAVAASHE------------DYL
Q0SDY7_RHOSR/11-261....DFDD........DLAVLADPGH------------------------C------ARTFGTRD------------DFL
F4EXE7_SELS3/3-247....GVSA........GLAVLSDPAY------------------------V------AEKCGTHE------------DFL
H6N264_GORPV/15-265....RLAD........ELAVLADPGS------------------------C------TRTYGTRD------------DFL
V4LJY0_9GAMM/11-261......RHPDMPLDG.ALHVLCDIGG------------------------V------AEVAASRD------------DYA
U5LCP5_9BACI/10-258....NLDD........TLAVLADPGY------------------------C------TSLYGTRE------------DFL
Q3JCD3_NITOC/20-269......ARHQEQLKD.TLYVISDIGG------------------------V------ADIAATYE------------DYV
Q8KL02_RHIEC/15-256................RLVVLADPCG------------------------C------AWLAASGD------------DWL

PF15609

D5BYR0_NITHN/23-215IRQV------------ILVSI-----------------------------V--------------------------DWL
Q888T1_PSESM/34-221IERV------------VTCVL-----------------------------T--------------------------DWS
F2JGK6_CELLD/36-258.KAY------------SVVAL-----------------------------L--------------------------DWR
F8A7B9_CELGA/28-256.ARY------------VVAAL-----------------------------I--------------------------DLR
R4KD23_9FIRM/21-261.KKY------------VVLTI-----------------------------L--------------------------DWR
L0H292_9GAMM/23-213LREI------------VFVSL-----------------------------V--------------------------NWL
Q186J6_PEPD6/22-211.KKY------------TICSI-----------------------------L--------------------------NWV
F4H5N6_CELFA/44-294.DRY------------VVATL-----------------------------V--------------------------DLR
J9RTC8_9ACTO/32-225.TRF------------VVASL-----------------------------V--------------------------DMR
D3V2E0_XENBS/35-224IEHI------------VTVTL-----------------------------T--------------------------DWS
C0ZNQ4_RHOE4/33-221.SRY------------VVASL-----------------------------V--------------------------DMR
Q0RDF5_FRAAA/27-253.GRY------------VVATL-----------------------------V--------------------------DAR
E8U3T7_DEIML/27-218VERV------------VLVSL-----------------------------T--------------------------DWC
N0ATX4_9BACI/3-219.KTY------------TVVSI-----------------------------L--------------------------DWR
V4IMQ6_9ACTO/22-218.DQY------------VIVAL-----------------------------V--------------------------DMR
Q4FTP7_PSYA2/40-245LQQV------------HLTTL-----------------------------V--------------------------DWS
X2GSG0_9BACI/29-253VQRY------------SVLSI-----------------------------L--------------------------DWR
H6N263_GORPV/13-205.DRY------------VVASL-----------------------------V--------------------------DMR
A6WD81_KINRD/34-260.RHY------------VVAGL-----------------------------V--------------------------DVR
L0A0T7_DEIPD/29-215LERV------------TVVSL-----------------------------Q--------------------------DFA
F8B557_FRADG/36-231.PSY------------TVATL-----------------------------F--------------------------DAR
C8XAU6_NAKMY/29-253.DRY------------VLAGL-----------------------------V--------------------------DAR
Q3JCD5_NITOC/23-215IRQI------------MLVSI-----------------------------V--------------------------NWL
B1HUS5_LYSSC/29-252VKQY------------VVLSI-----------------------------L--------------------------DWR
Q9RSB1_DEIRA/35-218VTRV------------VLVSL-----------------------------T--------------------------DWC
A5WBK1_PSYWF/41-238LEQV------------HLVTL-----------------------------V--------------------------DWS
Q0SDY6_RHOSR/33-221.SRY------------VVASL-----------------------------V--------------------------DMC
E2Q252_STRC2/22-213.ERY------------VIVAL-----------------------------V--------------------------DMR
A1SUD2_PSYIN/23-212IEEI------------VIISL-----------------------------V--------------------------NLV
Q5NWT3_AROAE/14-205LSRV------------HIATI-----------------------------A--------------------------DFT
M1F8F7_9ALTE/56-248VKRV------------LLLTL-----------------------------T--------------------------DWS
V4JFE6_9GAMM/23-221VEVV------------AFVNL-----------------------------V--------------------------DWL
D0L8D2_GORB4/36-225.EHY------------VIAAL-----------------------------V--------------------------DMR
H6R9M2_NOCCG/48-236.SHY------------VLASL-----------------------------V--------------------------DMR
H8GG72_METAL/25-219LRKV------------YIVSL-----------------------------V--------------------------NFA
U5LBE9_9BACI/23-240.SEY------------TVASI-----------------------------L--------------------------DWR
F3ZD08_9ACTO/22-212.TRY------------VVVAL-----------------------------T--------------------------DMR
E3EE67_PAEPS/1-230.KQY------------VIASL-----------------------------L--------------------------DWR
Q2RVZ3_RHORT/30-224LARI------------VCVTI-----------------------------T--------------------------DWM
G2NBS3_9ACTO/22-216.DRY------------VIVAL-----------------------------V--------------------------DMR
C8W645_DESAS/19-238.KHY------------IILTI-----------------------------L--------------------------DWR
Q7CKQ5_YERPE/29-218LEKV------------VAVTL-----------------------------T--------------------------DWS
W0LDC5_SERFO/29-220IAQV------------ITVTL-----------------------------T--------------------------DWS
Q2J6S1_FRASC/55-272.EHY------------VVATL-----------------------------L--------------------------DAR
D5CKR0_ENTCC/30-220IEQV------------IAVTL-----------------------------T--------------------------DWS
Q891X6_CLOTE/33-257.KEY------------VVISI-----------------------------L--------------------------DWR
E3IYR1_FRASU/25-221.PAY------------TVAAL-----------------------------L--------------------------DAR
A1VWP7_POLNA/22-216IEHI------------HLAAI-----------------------------T--------------------------NFM
I0DSI1_PROSM/30-221IKQV------------IAVTL-----------------------------T--------------------------DWS
V6JVQ1_STRRC/37-226.RRY------------VVVAL-----------------------------V--------------------------DMR
A8F9P6_BACP2/17-239.HSY------------TILSI-----------------------------L--------------------------DWR
M1SJV4_MORMO/30-220LQQV------------VTVTL-----------------------------T--------------------------DWR
U5N786_9BURK/38-230LAHL------------HLAAI-----------------------------T--------------------------DWM
A4J1D6_DESRM/37-256.KRY------------VILTI-----------------------------L--------------------------DWR
D1A9P3_THECD/28-256.DHY------------VLASL-----------------------------V--------------------------DVR
J7ISK8_DESMD/39-259.KNY------------VVLSL-----------------------------L--------------------------DWR
C0Z9Y6_BREBN/39-262.KQY------------IVASL-----------------------------L--------------------------DWR
A8L404_FRASN/37-236.TDY------------AVAAL-----------------------------V--------------------------DAR
B4EW77_PROMH/30-221IKQI------------IAVTL-----------------------------T--------------------------DWS
D1BEJ9_SANKS/28-275.DRY------------VVAAL-----------------------------V--------------------------DLR
C3ASF9_BACMY/11-231.KEY------------IIASL-----------------------------L--------------------------DWR
F8K489_STREN/28-217.ERY------------VVAAL-----------------------------V--------------------------DVR
D3RPA9_ALLVD/31-224IERV------------HFVAI-----------------------------T--------------------------QFG
A8MM96_ALKOO/39-263.KRY------------AVLSI-----------------------------L--------------------------DWR
D7C985_STRBB/21-212.ERY------------VVVAL-----------------------------V--------------------------DMR
K8EW86_CARML/29-250KKEF------------TIVSI-----------------------------L--------------------------DWR
I3YAV0_THIV6/25-218LERV------------HFVAI-----------------------------T--------------------------NFS
R5X4A9_9CLOT/51-237.KRY------------TICSI-----------------------------L--------------------------NWM
W0AF65_9SPHN/32-217LEAV------------RVATL-----------------------------A--------------------------DWT
I4D512_DESAJ/37-259.KNY------------VTLSL-----------------------------L--------------------------DWR

PF14681

B9PK97_TOXGO/39-243EERI------------IFVNI-----------------------------L......A....APQ....GI......ERV
E3L591_PUCGT/16-219MERI------------KLITI-----------------------------L......A....SMP....GL......QAV
Q5AWP2_EMENI/470-667VRII------------IVAGV-----------------------------IQ....DQ....AVK....GC......SQL
E3FKH4_STIAD/10-212PGSL------------RFVCL-----------------------------L......A....CPE....GL......ANL
B1XW63_LEPCP/8-210PRSI------------RFVSL-----------------------------L......S....APE....GL......AHF
A5FZR1_ACICJ/10-212.GAI------------KFVCL-----------------------------I......A....APE....GI......AAL
Q2RS40_RHORT/14-217AERI------------RFMAL-----------------------------V......A....APE....GV......RTF
UPP1_SCHPO/12-217QEQI------------IFLNV-----------------------------I......A....SPE....GL......KNV
C5CEA9_KOSOT/6-207.KRI------------SLMCL-----------------------------I......A....APE....GV......KEI
F0XHJ4_GROCL/10-224VSRI------------LVLSV-----------------------------V......A....ALP....GV......QRA
D5BUA7_PUNMI/7-209VKDI------------VFACL-----------------------------V......A....SPE....GV......AAV
E6ZJH4_SPORE/8-212VEKI------------KFLCV-----------------------------L......A....SQK....GL......EHV
A2R643_ASPNC/9-224VQRV------------VMLSV-----------------------------L......G....SEA....GV......LRA
B0C7X6_ACAM1/9-216PELV------------RIISV-----------------------------V......A....APP....AL......KEL
D1CCZ6_THET1/6-207LSAV------------RFVGL-----------------------------I......A....APE....GI......EAL
B6HJ77_PENCW/9-232VKKV------------IMLSL-----------------------------L......A....SEE....GV......KRA
B9GJS2_POPTR/275-479ESHI------------IFLNL-----------------------------I......S....APE....GI......HCV
UPP_BRADU/6-208.KDI------------RLACL-----------------------------I......A....APE....GL......ERL
E2B6P7_HARSA/345-550EENV------------LLVSL-----------------------------L......M....AES....GV......HSI
D2QZE9_PIRSD/6-207VSNI------------KVLSV-----------------------------I......A....SRT....GI......ELI
E3Q271_COLGM/16-231VKRI------------LVLAV-----------------------------I......G....AAE....GV......RRA
E0U7K3_CYAP2/9-216PASM------------RVISV-----------------------------V......A....APP....AL......QKL
A5EVG4_DICNV/7-209AIDI------------RFLCL-----------------------------L......S....APE....GL......KAM
F2UAE3_SALR5/11-216LANI------------VFCNI-----------------------------I......A....SPE....GI......DTL
Q8DI28_THEEB/15-222PALV------------RIISV-----------------------------V......T....APP....AL......QKL
Q2H9K6_CHAGB/10-227AQRI------------IVLSV-----------------------------L......G....AAS....GV......KAA
B8HYJ3_CYAP4/9-216PALV------------RIISA-----------------------------V......T....APP....AL......QKL
Q0TWS2_PHANO/12-227VKRI------------LVVSV-----------------------------L......A....AVE....GL......RKA
Q1AVG9_RUBXD/10-211.RWI------------SCIHA-----------------------------V......A....AVP....GV......ERV
D8TYT8_VOLCA/53-261PENV------------RVVAV-----------------------------V......V....APP....AL......KKL
B0CYQ9_LACBS/7-210VKDI------------KLLCI-----------------------------L......A....SQD....GL......NHV
E9QGS0_DANRE/320-526EDKI------------FLLSL-----------------------------L......M....AEM....GV......HSV
UPP_MYCA5/4-206.SNI------------KLICL-----------------------------V......G....VQK....GI......DLI
A7S545_NEMVE/352-557EENI------------LFVSL-----------------------------I......A....AKS....GV......HTI
B1XP85_SYNP2/9-217MENV------------RIISV-----------------------------V......A....APP....AL......QKL
F0XXG3_AURAN/8-217EERI------------TFANV-----------------------------V......S....CPE....GL......ANL
C0NWK2_AJECG/11-260VSKI------------LVLSV-----------------------------L......A....SEC....GA......KRA
B8BYV0_THAPS/18-231PEKI------------VFANV-----------------------------I......C....CPE....GL......EAL
C3ZI77_BRAFL/271-477EENI------------FFLSM-----------------------------L......M....AES....GV......QSV
B2AWA7_PODAN/10-225TKRI------------LVLSI-----------------------------L......G....AKP....GV......ELA
A8NXX8_COPC7/7-210IKNI------------KLLCV-----------------------------L......A....SRD....GL......NHV
Q53LT4_ORYSJ/267-471ETNI------------IFLNL-----------------------------I......S....APQ....GV......HVV
E1ZQY9_CHLVA/5-212PSMI------------RVVSI-----------------------------V......C....APP....AL......KLL
A5GTE0_SYNR3/9-216GSRL------------RVITA-----------------------------L......A....SSP....GL......KSL
B3S289_TRIAD/277-481EEKI------------FFVSM-----------------------------I......A....AES....GT......HTI
C5KJG5_PERM5/30-243ESDI------------IFLNL-----------------------------I......S....CPE....GI......ENL
A4HAL7_LEIBR/9-219EENI------------IFLNV-----------------------------I......S....APA....GL......RKY
A4S9H3_OSTLU/196-418EEKI------------LFLTV-----------------------------I......A....STQ....GV......HHL
UPP2_SCHPO/13-219EENI------------VFVNL-----------------------------I......A....CNE....GI......TNV
B6K7J9_SCHJY/15-220ESNI------------VYLSF-----------------------------I......S....SRA....GI......DRL
C1E7B8_MICSR/254-468QDRI------------MFVTI-----------------------------I......A....ASQ....GI......HSL
B9S674_RICCO/251-459ESNI------------IFLNL-----------------------------I......AHHAQAPQ....GI......HAV
D2SG74_GEOOG/5-206.TSI------------TVLCA-----------------------------L......A....APE....GI......RRL
A2R0T1_ASPNC/17-223EESI------------VLVNV-----------------------------V......S....SQK....GL......DVI
E4X7A3_OIKDI/322-527EDNI------------LLVSL-----------------------------L......M....AAP....GV......HAI
D8PR38_SCHCM/5-209VKNI------------KLLCV-----------------------------L......A....SKA....GL......DNV
D3BNE7_POLPA/239-442ENKI------------IFVTV-----------------------------V......S....SLK....GA......LTL
B8CAC1_THAPS/44-250VSEI------------HVVSV-----------------------------I......A....SKQ....GL......SEL
D5GBY9_TUBMM/10-229..KI------------LVVSI-----------------------------L......G....SVE....GV......TRA
A0CZ39_PARTE/55-262EENI------------MFLTL-----------------------------V......S....CEQ....GL......SKV
A1C4H4_ASPCL/15-220ENQI------------ILCNV-----------------------------I......A....SKQ....GL......EKV
F0ZZY8_DICPU/270-473ENKI------------IFVSV-----------------------------I......T....SLK....GI......LYL
Q19583_CAEEL/298-503EEDI------------FVASL-----------------------------L......M....GQQ....GA......HAL
D1C823_SPHTD/29-232HGRV------------SALGI-----------------------------I......G....APL....GV......QTM
Q5CME0_CRYHO/242-456QRKI------------IVLSL-----------------------------I......V....AHN....AI......HRI
A8GCF9_SERP5/8-213LENI------------YVVNV-----------------------------L......A....SPV....GV......ERL
A8P7X1_COPC7/39-231EERI------------IFINL-----------------------------I......S....SPE....GL......TAF
B7FX04_PHATC/21-232..QI------------NIISV-----------------------------M......A....SRA....GL......QQL
A8JC08_CHLRE/54-264AENI------------RVVAV-----------------------------V......V....APP....AL......KKL
A9URE0_MONBE/281-484EENI------------ILVVL-----------------------------M......A....ASM....GV......AQV
B6AH00_CRYMR/25-230TKNI------------ICMVL-----------------------------F......A....SKQ....GI......ETI
B6ABC4_CRYMR/233-447QHKI------------LILSL-----------------------------L......A....APN....AI......HRI
E4X3J2_OIKDI/287-498EENI------------ILVSL-----------------------------L......M....ANC....GA......QAI
A0CTP7_PARTE/56-263QENI------------AAVNI-----------------------------V......S....CEK....GL......SKV
F2UFG2_SALR5/279-483EENI------------VLVTL-----------------------------L......A....SKM....GV......CSV
F0YEY4_AURAN/277-487ARRI------------VVVSV-----------------------------L......A....SAA....GL......DAL
Q0TVS3_PHANO/438-633VHLV------------VVAGV-----------------------------I......Q....AECM.TGGL......QSL
F2PL94_TRIEC/448-645V.RI------------VVVAG-----------------------------V......V....QAE....CIS....RRAL
B6GYG1_PENCW/502-699IYIV------------VVAGV-----------------------------I......H....SQTVSTSRI......ARA
E3QN18_COLGM/468-663IKRI------------VVVAG-----------------------------V......V....QEK....AV......SGV
B2AP82_PODAN/589-789VGIV------------VMAGV-----------------------------IQAKAVAA....GPE....GV.....LHQL
D5GK17_TUBMM/495-691IRIV------------VVAGV-----------------------------L......Q....AQS....VSEG..SPAHA
Q0CK66_ASPTN/515-712VR.I------------IVAAG-----------------------------V......V....QAQ....AVSS.YSAIQA
C4JD99_UNCRE/393-591SIRI------------MVVAG-----------------------------V......A....QSQ....SLSKGSDLTRA
C7ZP62_NECH7/505-702SIRI------------VVVAG-----------------------------V......V....QAE....VV......AKS
Q2GUM1_CHAGB/474-672ISIV------------VVAGV-----------------------------I......Q....TQS...LDV......AGL
E9F4S0_METAR/604-801DIRI------------VVVAG-----------------------------V......V....QTD....AVM...QGHAL
B1WT56_CYAA5/9-216ISLV------------RIISV-----------------------------V......A....APP....AL......QQL
C5AAP9_BURGB/13-214GERL------------LFLAL-----------------------------V......A....APE....GI......QVF
D5A477_ARTPN/9-216PGLM------------RIISV-----------------------------V......A....APQ....AL......QSL
E9C694_CAPO3/359-559EENI------------MFLSL-----------------------------I......A....APS....GI......HNL
G7Z3C1_AZOL4/35-237DHNI------------RFMAL-----------------------------V......A....APE....GV......RRF
H3D4M3_TETNG/291-494EDQI------------VLVSL-----------------------------L......M....AEL....GV......HSV
Q4WZP7_ASPFU/9-223VQRV------------IMLSV-----------------------------L......G....SKP....GL......RRA
Q5KGX1_CRYNJ/6-210QSQI------------KVVSV-----------------------------L......G....SKL....GV......KNV
Q7UFD1_RHOBA/6-207VEDI------------RVLSI-----------------------------I......A....SQA....GL......DRV
R7D7S5_9FIRM/7-208.KNI------------KCMFV-----------------------------I......A....APE....GL......ERL

PF14572

E9FWJ1_DAPPU/165-348KIYV------------MATHG-----------------------------L------LSSDAPRLIEDSPIDEVVVTNTI
KPRB_HUMAN/179-363KIFV------------MATHG-----------------------------L------LSSDAPRRIEESAIDEVVVTNTI
Q961V3_DROME/165-361KIYV------------LATHG-----------------------------L------LSSDAPRQLDESPIDEIVVTNTI
F1KVQ3_ASCSU/169-364KIYV------------IATHG-----------------------------L------LSADAPALLEESAIDQVVVTNSV
Q6P8C3_XENTR/167-349KVYA------------MATHG-----------------------------I------LSSDAPRLLELSAIDEVVVTNTI
Q23166_CAEEL/167-347KIYV------------IATHG-----------------------------V------LSSDAPALLEASPITEVIVTNTV
A7T9J2_NEMVE/4-194KIYV------------MVTHG-----------------------------L------LSGSAPELIEGSEIDEVVVTNTV
F1L6K6_ASCSU/169-364KICV------------VATHG-----------------------------L------LSAAAPAVLEDSPIDQVVVTNSV
B3S6Z0_TRIAD/157-339KIYA------------LATHG-----------------------------Q------FTQSDAAKLDASCLEEIVVTNTI

PF00156

PYRE_DEIRA/34-188PLSGYPLMSLKELYFDTYASHE-------------------------------VPGWLAE
Q3SMI9_THIDA/14-177PVRSDVVGVRLDVAPSDIIECN-------------------------------VPPYEAD
PYRE_BIFLO/37-192DSDMSAV........KAVEAEF-------------------------------GFPVLSI
A6GZJ5_FLAPJ/2-150PIKA...........DFKGISL-------------------------------STSLLEH
PYRE_PROAC/43-197EKAGVPLYTLSNYPILIEVAAE-------------------------------SGRITSE
Q8EVI3_MYCPE/12-166DKYKPDWIGTNIP....NEWVA-------------------------------GFGLDSR
Q0CVT8_ASPTN/931-1096LR...............KHGFG-------------------------------RVDIQSL
Q2YAL8_NITMU/16-212KVRNNADRVVCLSSPINFYAVA-------------------------------QFYMDFP
Q4XNN5_PLACH/73-239NEKNEKIYFK.....DKFEQKH-------------------------------NIPVYSV
Q1DDD8_MYXXD/86-239SPDYSALSTASLMVFPWDYEPS-------------------------------TGDARFD
Q6NF43_CORDI/11-164APNYIWKRTD.....EWIVFPW-------------------------------SAEPPVT
KPRS_METS3/132-293IYAAGANSLISTNSLSADSSRV-------------------------------SLAKSIA
A5V979_SPHWW/2-156RVDYRFRTIDRTANKDWFVFPW-------------------------------EQVSPVD
A7E5A9_SCLS1/57-218EK............IGWERVGK-------------------------------LVHVLES
C1DM73_AZOVD/5-153EVDLHFRHLGWPRLFEWNIYHH-------------------------------GILVRTC
A8LJR1_DINSH/150-296VERITKSNMKSLVITDSIGATD-------------------------------AVKAAPN
UPP_AQUAE/39-188RIEEKFKEV......EIFVGNV-------------------------------DERLNDK
Q8EUA5_MYCPE/11-161VDLKPAYRCFEIE....NKFVV-------------------------------GYGCDYE
Q0K973_CUPNH/14-164EPDYHVTFLP.....SNPWIHQ-------------------------------PFEEYDT
A4CGY8_ROBBH/133-287LWDAHVKDIITCNTIPHQSNGI-------------------------------DLSDVIA
A3U7I6_CROAH/14-161KHYKLDYVGLEID....NTFIV-------------------------------GYGLDYK
A6QAE7_SULNB/5-148QPDYVLYKTD.....EWIEFFW-------------------------------EKDYLSD
Q2RSZ0_RHORT/17-167PPDHWAITVD.....DWVLFPW-------------------------------EPPSAER
HPRT_MYCPN/9-158ADIKVDYSCFKNQ....DEFLV-------------------------------GFGLDYQ
O83317_TREPA/210-372FDEAYEKRYFSRIIGTNAVFHT-------------------------------QLSHKQW
PYRR2_LACPL/1-156PIRA...........DFIGRNI-------------------------------PTARQER
Q4DVM9_TRYCC/44-213HKSDGCRFGQTPIFTLMQLKAS-------------------------------QETVKEQ
PYRE_HYPNA/34-182DVGCKLISLAQVNFPDYAPDDL-------------------------------PPELQKI
PURR_STRR6/106-265EKQFDYKSLLKVTNIDVKNQAI-------------------------------DV.....
Q27375_TOXGO/94-256NSLKGDFVGFSIE....DVWIV-------------------------------GCCYDF.
XGPT_RHOS4/14-159MVDTYITEVS..Q.DTWIFFPW-------------------------------DMALQY.
Q4FP84_PELUB/15-165EPDFCPVKLD.....SDPWIVQ-------------------------------PTEHY..
Q5NI77_FRATT/16-164RDVKLDYVCFEIE....DKFIV-------------------------------GYGLDFD

PF15610

M2SQF2_COCSN/2-255NQCFVKFILER.DNVDFCQFIR..RQDDHFVRLL---LDHAIYSNYYN.DEEHTDNIRFL
C6XW67_PEDHD/2-266NTRIVKYILNC.DFNSFSIFLE..RQTEDFIYNL---YNLSLGNSYHT.IDCYSGNLNFL
H1Z8U3_MYROD/1-264NTRVIKYILNL.DHSSFKNVVT..LLPEPKKQEL---FDLAISNDYHL.IEEYQSNLNKL
C7PNW9_CHIPD/2-265NTRVVKFILNA.PFAEYEKLLM..KQTHGFLQEL---ADCCIGNNYHQ.MEEYRNNANFL
Q0UEK8_PHANO/2-265TEAFARFVLSR.DYAEFCRFLR..GQDDFLARKL---LDYAIGGDHLE.DELYKNNLRFL
E3QYQ0_COLGM/52-331ENRFVKRMLKA.GSAELKGLLSSLNQGKDFAGRL---YDAAIMNDFHMGGNAYKPNLKLV
E4ZIV8_LEPMJ/2-262NQSFVHYLLGR.DYAGFCSFVR..RQDDFFARLL---LDYAIAGLYYN.DEDYRQNFDFL
R0KEE4_SETT2/2-259NECFVKFILER.DDVEFCQFIR..RQDDHFARLL---LDHAINSHYHD.DDEHKGNVRFL
G2Z396_FLABF/1-265NTRIVKYILNL.NQDSFQTLIN..AIGENQKKEL---FHLAISNNYHQ.ITDYKTNIQSI
H1YCE2_9SPHI/3-265NTRIVKYILNY.DFDSFRIFIE..NQTSAFVDLL---YDMALGNGYHT.IEAYAKNLNFI
B2WKS8_PYRTR/2-256NECFVKFILGR.EYSEFCPFIR..RQDDHFVRLL---LDHAINGHYHD.DQEHAHNVQFL
G0JP06_9GAMM/87-357ILRTLRLLFGEGNRESLAAFLP..KVPAPTWLRL---YKAALGNEFLS.QPQCAPSLVLL

PF11202

Q888S9_PSESM/14-255IPSGILGATVSGLVSRSIWPTDG.........GL...HGCVVYEHLQAHDVTRGFIEQID
R5XB52_9CLOT/25-275IPSACLNSTVSGLVSRTVLRDDLIGKD.....DF...HGAKFYKELKYVDESNNYLDTIS
Q7CKQ6_YERPE/9-249IPFGIMGAPVSGLVSRSLWSEK..........GL...HGCVHCEHLQEFECSQLLVNTVA
I0DSH9_PROSM/9-249IPFGIMGAPVSGLISRSIWTES..........GF...HGCVKCDHLSQFECSRLLVDTVA
STIP_ACIAD/20-273IPSGILGSTISGLISRSICEGETLSADEITAENIDQWHRCIEYHHLKEFDISQQFIQRIN
W0ADD0_9SPHN/11-256IASGLLNSIVSGLVSRSILNDTVVGPG.....DF...HACVTYPQFAAHDVTRAFVETID
A1VWP9_POLNA/5-253IPSSILNATISGLVSRSVLNDSI.GAS.....DF...HGCVYYDAFEAHDLSREFADGL.
E4NAQ4_KITSK/21-265IPSACLNSTVSGLVSRTVLRADLTGPD.....EF...HGAKFYRELAGADVSRLFVDTVA
D3VJW4_XENNA/9-249IPFGIMGAPVSGLISRSIWHEE..........GL...HGCVKCDHLIAYECSRLLVDTVA
D0L8D3_GORB4/17-267IASACLNSTVSGLVSRTVLNRDYIGPD.....DF...HGAKFYRELAPHDVSGLLLDTIT
C8W646_DESAS/34-283IPSACLNATVSGLVSRTVFRKDLIGDT.....DF...HGAKFYAEMADEDLSNYFIDAVS
X2GQ89_9BACI/11-261IPSACLNSTVSGLVSRTVWNEQFMDGT.....DF...HGAKYYKELQDADVSNFYIDRIS
R5BVZ9_9FIRM/3-247IPSSCLNCTVSGLVSRTFLRDDIIGET.....DF...HGAVYYGELEAQDLSYAFISEIQ
D5CKQ8_ENTCC/9-249IPFGIMGAPVSGLISRSVWSSE..........GL...HGCMVCEHLSEFECSRMLVDTVA
F8AVP2_FRADG/12-254IPHSCLNSTVSGLVSRTVLNRSLIGPA.....DF...HGAKYYRHLADRDYSRRYVETVV
J9STB4_9ACTO/17-267IASACLNSTVSGLVSRTVLNADHIGPG.....EF...HGAKFYRHLSDFDVSGVFLDTVS
A8MM96_ALKOO/473-722IASACLNSTVSGLISRTVHREDLIGPK.....DF...HGVKFYKELQGADVSNLFVDRIA
Q9RSA8_DEIRA/11-250LPHAVLNATVCGLLSRTFVT....APG.....TL...HAARVETELRGEDRTGEYLNALD
E3EE68_PAEPS/21-271IPSACLNSTVSGLMSRTVLRDDLIGAD.....DF...HGAKFYESWRSVDQSNTFVDTVS
A8F9P7_BACP2/9-258IPSACLNSTVSGLVSRTVLNNRWINAD.....DF...HGAKYYEELLDEDVSNLYVDTIE
R7CDA0_9FIRM/3-247IPSSCLNSTVSGLISRTFLRDDIIGRD.....DF...HGAVYYGELTDSDLSYDFIETIE
Q4FTP9_PSYA2/19-285IPSGLLNSTVSGLISRSLYT....EPE....LGL...HRSVFYDNLIEADHSLAFIDCID
D1BEJ8_SANKS/16-268IPSACLNSTVSGLVSRTVLNDALITPG.....MY...HGAKFYSELADVDVSGEFLDRVS
J7INJ2_DESMD/17-266IPSACLNSTVSGLVSRTVLRQDLIGDK.....EF...HGARFYEELLKVEVSNLFIDTIS
R4KIZ1_9FIRM/43-295IPSACLNATVSGLMSRTVLRDDLIGPL.....DF...HGAKFYRNLARDDLSNYFVDTVA
U5NAN4_9BURK/5-254IPSSILNATISGLVSRSVLNDAI.GPQ.....DF...HGCVVYEEFAPHDLSVWFVEDIL
E6UDF8_RUMA7/3-247IASSCLNSTVSGLLSRTFLRSDIIGEK.....DF...HGAVYYKELAHKDLTYKFIDTVE
S5UQG8_STRCU/450-701IPSACLNSTVSGLISRTVLRADLVGPD.....DF...HGAKYYRELTGADVSVTFLDAVC
K8E7N2_CARML/7-270IPSACLNSTVSGLVSRTVLNEQFIKPG.....EV...HGAKYYKEFESLDLSNEYIETIM
F2JGK7_CELLD/19-268VPSACLNATVSGLMSRTFLRNDLIGPY.....DF...HGSKFYKEWEEIDVSNDFVDTIA
Q891X7_CLOTE/27-276IPSACLNSTVSGLISRTVLRDDIIGKN.....DF...HGGKFYSEWKDKDVSNLFIDTIT
B1HUS6_LYSSC/12-262IPSACLNSTVSGLVSRTVLNLQFMDKD.....DF...HGAKYYKELEDMDVSNLYINRIV
I3YAV5_THIV6/12-259IPSSILNATMSGLISRSILNERI.GPD.....DF...HGCVYYREFASEDRSRWFVDEL.
D1A9P2_THECD/16-266IPSACLNSTVSGLVSRTVLNDELIGPG.....DF...HGAKFYAELAAGDVSGLFIDTVC
C8XAU5_NAKMY/29-279IASACLNSTVSGLVSRTVLNRDLIGPD.....DF...HGARFYAEFADRDVSGVFLDAVA
M1FGD7_9ALTE/15-262IPSGILGGNVSGLISRSILRSDLIGPG.....DY...HGCIVLDHLADIDLSRSFVDRVD
R7IPS7_9FIRM/3-247IPSSCLNSTVSGLISRTFLRSDIIGEK.....DF...HGAVYYEELKDSDLSYEFIRTIE
L0H008_9GAMM/12-261IPSGILNATVSGLVSRTILNEEI.GPG.....QF...HGCVLYEDLAAFDHTNWFLDEIT
A1SUD4_PSYIN/14-263IPSALMNSTVSGLISRSVLNDQI.NAD.....DF...HGCISYSHLENDDRSNWFVNQIS
A8L405_FRASN/18-260IPSACLNSTVSGLVSRTVLNAEHIGPD.....DF...HGAKFYRELLPHDLSRHFIDTIV
F8K488_STREN/11-259IPSACLNSTVSGLVSRTVLRADLIGPD.....DF...HGAKFYRRLAAADVSRLFLDAVA
Q5NWT5_AROAE/5-254ISSSILNSTISGLVSRSILNEAI.QPG.....EY...HGCVFFEEFAEHDLSQWFVDDVM
A4J1D7_DESRM/40-292IPSACLNSTVSGLMSRTVCREDLLGPL.....DY...HGVKFYRQLQIKDLSNYFVDVVS
R5GSI4_9FIRM/375-629IPSACLNSVVSGLFSRTVLN.ELIAPE.....DF...HGAAHFANLEGSDRTLDLVSAIE
F4H5N6_CELFA/535-785VPSACLNSTVSGLVSRTVLNRDLLTPD.....QF...HGAKFYADLAPVDVSGRFLDAVA
Q2RVZ5_RHORT/10-255IPSAILNGIISGLISRTVLSDDLIAPG.....NF...HGCMLLDDLADLDLSRWYVDEQM
D3RPA4_ALLVD/12-259IPSSILNATMSGLVSRSILNEHI.GPD.....DF...HGCVYYHEFTPADRSVWFIEEL.
E8U3T5_DEIML/6-240LPHAALNATVSGLLSRTYL......HG.....DA...HAATRLTHLAPFDRTRAYVDALD
F8A7B9_CELGA/486-735IPSACLNSTVSGLVSRTVLNPRILRED.....QF...HGAKFYAELAPSDVSLQFLDAVS
I4D513_DESAJ/17-266IPSACLNSTVSGLISRTVLRKDLIGEQ.....DF...HGARYYQELEAENVSGLFVDTIS
H6R9M2_NOCCG/535-790IASACLNSTVSGLVSRTVLNDDLIGPG.....EF...HGAKFYRELAADDVSGRLIDTVT
Q186J5_PEPD6/5-254IPSACLNSTVSGLVSRTVLREDLIGKN.....DF...HGAKFYRHLKDKDESMNYIETIE
A5WBK3_PSYWF/17-290IPSGLLGSTVSGLISRTLYS....APNHDLTSGL...HQSVIYHDLAHKDHSLSFIEAIE
L0A1Y2_DEIPD/15-266VPNAMLGATVAGLVSRTVLP....GPA....GDL...HGSAFLAQLAAHDVTRHFVDTVS
N0AVA9_9BACI/12-261IPNACLNSTVSGLISRTVLNDALIGPD.....DF...HGAKFYREFMHEDVSNTFIHFVA
I5AXH0_EUBCE/3-247IASSCLNSTVSGLLSRTFLRSDIIGDD.....DY...HGAVFYKELMDRDKTYHFIEAVQ
C0Z9Y7_BREBN/18-267IPSACLNSTVSGLISRTVHRDDLIAAG.....EF...HGAKFYREWADEDVSNLFVNTIS
A6WD80_KINRD/17-261IPSACLNSTVSGLVSRTVLNERLLAPG.....RF...HGAKFYADLAPVDASNRFLDVVS
J7SKQ6_MORMO/9-249IPSGIMGAPVSGLISRSVWSYT..........GP...HGCVHCEHLQPYECSRTLTDTVA
H8GG70_METAL/7-254IPSCVLNSTVSGLISRSVWRQGIGGPA.....AF...HGCLYYKEFEPHDLSRFFVDAM.
Q0SDY7_RHOSR/11-261IASACLNSTVSGLVSRTVLNDTLIGPG.....DF...HGAKFYAHLAGEDVSNHLLDSVS
F4EXE7_SELS3/3-247IASSCLNSTVSGLLSRTVLRDDLIGEA.....DF...HGAAFYEELREKDLTYDFIEAVE
H6N264_GORPV/15-265IASACLNSTVSGLVSRTVLNADHIGPG.....EF...HGAKFYQHLREFDVSNLFLDTVS
V4LJY0_9GAMM/11-261IPSGVLNATVSGLVSRSILNDQI.LST.....DF...HGCVFYPEFIVEDRSNWFLDRIS
U5LCP5_9BACI/10-258IPSACLNSTVSGLVSRTVLN.DLIGPE.....DF...HGAKYYRSLAEADVSNEYISIIE
Q3JCD3_NITOC/20-269IPSGILNAPVSGLISRSLLNRQI.QPG.....QF...HGCTLYEHLQQYDVSHWFLDEIE
Q8KL02_RHIEC/15-256IPSGMLGCTVSGLISRSILNAALVGPG.....DF...HACVQWDNLAEHDISRSFVDGM.

PF15609

D5BYR0_NITHN/23-215SPE..--....-.QKQAVQEKI-----------------G......RP.V-SFISLLEGT
Q888T1_PSESM/34-221