Sequence alignment for CL0534

PF14588

Q13J52_BURXL/18-164ETRLMALGLMLPKPP--AAVGAYEPWARY---ANFITTSFQLPFDGETLRHVGLLGDTVSTQDGI---------------
Q8EFL1_SHEON/6-153ESRLVAAGLELPEVA--AALGNYEPYSIV---GSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGY---------------

PF01042

UK114_MOUSE/11-129----------TTKAP..AAIGPYSQ.AVQ..VDRTIYISGQVGLDP....SSGQLV.PGGVVEEA---------------
RIDA_BACSU/7-124----------TKHAP..AAIGPYSQ.GII..VNNMFYSSGQIPLTP.....SGEMV.NGDIKEQT---------------
MMF1_YEAST/26-143----------TKLAP..PAAASYSQ.AMK..ANNFVYVSGQIPYTP.....DNKPV.QGSISEKA---------------
Y364_AQUAE/6-125----------TPKAP..VPVGPYSQ.AVE..VNGFLFISGQIGINP....ETGKLV.EGFK.EQV---------------
Y322_HAEDU/1-114----------MITRI..DVTNRFSEVAIY...NGIAYFAGQVPTDE...........SKDAYQQT---------------
Y1627_HAEIN/2-116----------TIQRI..LPSARLSEVSIH...NNLAYFAGQVP..........ELTIEQNAYEQT---------------
Q9ZBJ6_STRCO/11-130----------EGVAP....AAQYTHVVLG..TGRFVAVSGQLALD.....EDGKVVGEGDPAAQA---------------
O86529_STRCO/11-131----------FGDRL......AYNRAVLVEQPRRWLVVAGHEARD.....DEGGIAAVDDVRGQL---------------
YJGH_ECOLI/11-128----------GRHSL..YAEHRYSA.AIR..SGDLLFVSGQVGSRE....DGTP...EPDFQQQV---------------
Q55925_SYNY3/86-202----------MLNEL......HYSQ.AVK..IGDRVETSGQGGWD.......DNLQIPELLADEI---------------
YSD2_CAEEL/46-163----------SANAP..GAIGPYSQ.AVR..AGNTIYLSGSLGLDP....KTGDL..KEGVVEQT---------------
Y709_SYNY3/8-128----------TAQAP..APVGPYNQ.AIA..ANGFLFTAGQIALDP....QTMTIMGEGNVEVQA---------------
RUTC_ECOLI/10-126----------GSSAP....LAPFVP.GTL..ADGVVYVSGTLAFDQ....HNNVLF.ADDPKAQT---------------
ALDR_LACLA/6-124----------TLDAP..AAIGPYVQ.GKI..VNGLLYASGQIPLNP....LNGEIV.GDSIETQT---------------
HMF1_YEAST/10-127----------CESAP..AAAASYSH.AMK..VNNLIFLSGQIPVTP.....DNKLV.EGSIADKA---------------
Y4SK_SINFN/7-125----------TNDAP..GAVGPYSQ.AIK..VGDLLFVSGQLPIDP....ATGEFN.SANAVEQA---------------
MMF1_SCHPO/41-162----------PINSPKLSSAGPYNQ.AIK..ANGVIYCSGQIPVA......NGKVI.EGTVGDQT---------------
C1DI43_AZOVD/9-125----------.DKAP..AAIGTYSQ.AIR..AGDTVYLSGQIPLDP....GTMELV.EGDFEAQT---------------
I6YA21_MYCTU/12-121----------..SEF..ESAVGYSR.AVR..IGPLVVVAGTTGS.............GDDIAAQT---------------
I6YGW9_MYCTU/18-150----------..AAP....LAAYVP.AVR..TGNLVYTAGQLPLEAGKLVRTGKLGADVNPEEGK---------------
Y944_HELPY/8-124----------.TLAP..KAIGPYSQ.AIA..TNDLVFVSGQLGIDV....STGEFK.GADIHSQT---------------
YOAB_ECOLI/3-114----------.IVRI..DAEARWSD.VVI..HNNTLYYTG.VPEN.........L..DADAFEQT---------------
RIDA_ECOLI/7-126----------TENAP..AAIGPYVQ.GVD..LGNMIITSGQIPVNP....KTGEV..PADVAAQA---------------
TDCF_ECOLI/7-126----------TQRAP..GAIGPYVQ.GVD..LGSMVFTSGQIPVCP....QTGEI..PADVQDQA---------------
Q03UU6_LEUMM/8-129----------TTTAP..KALGPYSQ.AIL..NDNTLYISGQIGIDP....ETDEFA.GATTAEQA---------------
Q1D7G7_MYXXD/12-130----------.DQAP..KAIGPYSQ.AVQVDAGKMTFLSGQIPLDP....ATMEMV.QGDVVAQA---------------
Q4CQG3_TRYCC/82-215----------..AA....PATNYVS.YVC..SGMQLHVSGQLPKNDVGGCMTGQLGASLTVTEGQ---------------
RIDA_PYRFU/8-124----------.ENAP..KPIGPYSQ.AIK..AGNFLFIAGQIPIDP....KTGEIV.KGDIKAQT---------------
Q8YYS9_NOSS1/63-181----------.......ATRNGYSHIAVTPARTRTVYISGQFGSDL.....YGRLV.STEFEPQL---------------

PF07736

R6P3Z3_9CLOT/4-119------------------------.RGIR----------GAITIE------------EDNQEMLE---------------
K9RYI1_SYNP3/10-126------------------------VRAIR----------GATTAA------------SNTIPAIR---------------
F5YHG3_TREPZ/9-121------------------------..ALR----------GATQC.------------VNQGDDIV---------------
C5D3D9_GEOSW/2-118------------------------IRGIR----------GAITVE------------RNEAEEIV---------------
G2TM72_BACCO/2-118------------------------IRGIR----------GATTVE------------RDHESEVL---------------
A8FEK3_BACP2/4-119------------------------.RGIR----------GATTVT------------EDTETEVL---------------
I0I4N0_CALAS/2-117------------------------CRGVR----------GATTVM------------HNEKEEIL---------------
K9SJW3_9CYAN/5-121------------------------VRGVR----------GATTVD------------ANTPEAVQ---------------
L0KAH2_HALHC/3-118------------------------VRGIR----------GAITVE------------KNSSEQIL---------------
K9TY01_9CYAN/6-121------------------------.KAIR----------GATTVT------------ENTVQAID---------------
A9WFT7_CHLAA/5-120------------------------CRGVR----------GATTCS------------ENTREAIL---------------
H6RWG6_BLASD/3-118------------------------VRAVR----------GATQVE------------ADDRNQVL---------------
D7CQ58_TRURR/6-122------------------------VRGIR----------GATTVE------------RDEPELIL---------------
K9UWV8_9CYAN/7-122------------------------MRAIR----------GATTVR------------ENTVEAMR---------------
Q9KCB5_BACHD/3-119------------------------VRGVR----------GATTVK------------ANQEKEIL---------------
F6CMM4_DESK7/6-122------------------------VRGIR----------GAITVE------------RNTAEDII---------------
Q5SJY4_THET8/2-118------------------------VRGIR----------GAITVE------------EDTPEAIH---------------
F2NYA7_TRES6/6-122------------------------.FGIR----------GAVCA.------------ENTPESIK---------------
A5GN07_SYNPW/7-122------------------------LRGLR----------GATTSS------------DNTAASIS---------------
K9T1A7_9CYAN/5-121------------------------VRAIR----------GATTAS------------ENTVEAIR---------------
Q65I30_BACLD/3-119------------------------MRGIR----------GATTID------------RDTEKDIT---------------
F6B991_DESCC/5-120------------------------VRGIR----------GATTVE------------RNEAQEIF---------------
K9YGC3_HALP7/6-122------------------------VRAIR----------GATTAS------------ANTVEAIR---------------
I0GSI6_SELRL/1-117------------------------MRGIR----------GAIVVG------------ENKKEEIW---------------
F4LMP6_TREBD/21-137------------------------.FGIR----------GAVCC.------------ENSEIEIE---------------
F5YDH5_TREAZ/9-121------------------------..GLR----------GACQC.------------LNEEKDIS---------------
A3DDB7_CLOTH/3-117------------------------.WAIR----------GATTVS------------DNTADEIV---------------
K9SUH2_9SYNE/5-121------------------------VRGVR----------GATTVE------------ANTVEAVS---------------
B8I2T8_CLOCE/3-118------------------------VRAVR----------GAITVP------------ENTKESIW---------------
B0TFN2_HELMI/6-121------------------------VRGIR----------GAVTVE------------ENTKEAIQ---------------
K9UI88_9CYAN/1-117------------------------MRAIR----------GATTAS------------ENTEVAIS---------------
E6SM18_THEM7/1-116------------------------MRGIR----------GAVVAE------------DNSPEAIR---------------
J7LAI2_NOCAA/3-118------------------------VRAIR----------GAVQVD------------ANERDQVL---------------
F0SQI8_RUBBR/3-119------------------------VRGIR----------GAISAE------------ENTREAIL---------------
B1WYV6_CYAA5/21-137------------------------VRGIR----------GATTVT------------ENSQEAIG---------------
K9Z285_CYAAP/18-134------------------------VRAIR----------GATTAD------------ANTIESMR---------------
Q895G0_CLOTE/2-115------------------------.YAIR----------GAISID------------ENSVEEIR---------------
D7BFZ6_MEISD/2-118------------------------VRGIR----------GAITVE------------EDTREAIL---------------
D7B205_NOCDD/5-118------------------------LRAVR----------GGTGVA------------GDTREAIA---------------
A5GRN7_SYNR3/13-128------------------------MRALR----------GATTAS------------ANTAAAMT---------------
A4XKN8_CALS8/3-116------------------------.FAIR----------GATTVD------------TDSKEDII---------------
C6CUD2_PAESJ/3-119------------------------VRGIR----------GAITVD------------VNEKEPIL---------------
D3E7K4_GEOS4/4-119------------------------.RGIR----------GATTVT------------RNDEQEIV---------------
I4D4R7_DESAJ/2-117------------------------VRGIR----------GATTVL------------HNDAGEIR---------------
E4U7S7_OCEP5/5-121------------------------VRGIR----------GAITVE------------QDTPEEIH---------------
Q5NGK3_FRATT/3-117------------------------.RSIR----------GATTVD------------KDSKENVI---------------
AROH_BACSU/3-119------------------------IRGIR----------GATTVE------------RDTEEEIL---------------
D5X790_THEPJ/8-123------------------------VRGIR----------GAITVK------------ENSAREIF---------------
K9RJZ8_9CYAN/1-116------------------------MQAIR----------GATTVS------------ENTVEAMQ---------------
L0EDU0_THECK/3-119------------------------VRGIR----------GATTVE------------ANEEQFIL---------------
D9S3D8_THEOJ/14-129------------------------VRGVR----------GAITVE------------ENTAAAVK---------------
Q3AEV3_CARHZ/7-121------------------------VKGIR----------GAITVP------------ENSPEAIE---------------
Q7V615_PROMM/13-127------------------------.HGLR----------GATTSS------------ANTTKAIE---------------
B2A4P0_NATTJ/8-121------------------------..AVR----------GATTTE------------RNTEQEIL---------------
B8CWX1_HALOH/1-116------------------------MRGIR----------GAITVD------------TNTAEDII---------------
E3DQW0_HALPG/2-116------------------------.YAIR----------GAISVS------------ANNKTDIL---------------
R4KN13_9FIRM/1-117------------------------MRGIR----------GAITAG------------GNTEEAIG---------------
K9XR21_STAC7/5-121------------------------VQGIR----------GATTVT------------ENSLDAIA---------------
Q55869_SYNY3/6-122------------------------VRAIR----------GATTVS------------ENSSEAIR---------------
D9QPW2_ACEAZ/5-120------------------------VVAIR----------GAITVD------------KNTKEDIL---------------
A0ZE51_NODSP/5-120------------------------MRAIR----------GATTVS------------ENTIAAIT---------------
L0F7F4_DESDL/4-119------------------------MRGIR----------GAITIQ------------ENDAEQIR---------------
B8HM50_CYAP4/10-126------------------------VRAIR----------GATTVS------------ENSIPAIR---------------
C0ZCE0_BREBN/4-121------------------------.RGIR----------GAVTVE------------VDMREEIV---------------
S5ZXS0_9SPIO/7-116------------------------.KAVR----------GAVTC.------------ENSTESIQ---------------
R6QFW9_9FIRM/4-117------------------------..CIR----------GAITIN------------ENTKEDVY---------------
Q46JN7_PROMT/12-125------------------------..ALR----------GATTCE------------NNSVESIT---------------
Q2IMD0_ANADE/1-113------------------------MRGLR----------GATQCS------------ANTVEAIE---------------
F8F3G9_TRECH/9-121------------------------..ALR----------GATGC.------------TNTEQDIQ---------------
A5I2T1_CLOBH/1-119------------------------MQSIR----------GAITIE------------KNEVKYIK---------------
D7B1Z6_NOCDD/4-118------------------------.CAVR----------GAVQLD------------RDEREHLL---------------
N0AVJ3_9BACI/2-118------------------------IRGVR----------GAITVK------------EDNDGEIV---------------
C7PVY7_CATAD/3-118------------------------VRAVR----------GAIQLD------------LDDRDHLL---------------
D2R2P9_PIRSD/3-118------------------------CRGVR----------GATTTD------------ANSRDEIL---------------
B9KXC3_THERP/4-118------------------------CRGIR----------GATTVE------------ANTAEAIV---------------
K9S6J5_9CYAN/5-121------------------------VRAIR----------GATTVS------------ENSVEAIR---------------
C8WX62_ALIAD/3-119------------------------VRGLR----------GATTVA------------RNDRDEIL---------------
Q8DHZ0_THEEB/10-126------------------------VRAIR----------GATTAT------------ENSIPAIR---------------
R5SBB9_9GAMM/4-116------------------------.KGIR----------GAITVE------------ENSPEAIG---------------
Q31LX4_SYNE7/5-121------------------------VKAIR----------GATTVR------------ENTAEAMR---------------
F0RVW8_SPHGB/7-120------------------------.CAIR----------GAICVE------------RDEPALIE---------------
H2J7F9_MARPK/3-112------------------------.VGIR----------GATSIE------------NNTKEEII---------------
F8I591_SULAT/2-117------------------------IRGIR----------GATTVT------------QDDADEIL---------------
C9R7W9_AMMDK/6-121------------------------VRGIR----------GAITVK------------ENTREAIL---------------
G8LU69_CLOCD/2-117------------------------VRAIR----------GATTVE------------NNDAVEIL---------------
Q7U527_SYNPX/9-123------------------------V.GLR----------GATTCS------------ANTTTDIR---------------
Q5WGS6_BACSK/2-118------------------------IRGVR----------GATTVT------------KNEAQEIE---------------
Q0AX52_SYNWW/3-118------------------------LRGIR----------GATTVN------------EDRPEEIL---------------
Q111X4_TRIEI/5-122------------------------VQAIR----------GATTVS------------ENSVEAIR---------------
D1BHJ1_SANKS/3-118------------------------VRAIR----------GATQLE------------VDDREHLF---------------
F4CLD4_PSEUX/3-118------------------------VRAVR----------GAIQVD------------SDSRDDIL---------------
K9P5T4_CYAGP/7-122------------------------LRALR----------GATTAS------------ANTGEAIA---------------
F2JS36_CELLD/4-119------------------------.VSIR----------GAITVE------------ENTREAIL---------------
B1I403_DESAP/4-119------------------------VRGIR----------GANTVE------------ENTQAAIF---------------
R5HIX2_9SPIR/3-116------------------------VKGIR----------GAITVE------------ENTASAIK---------------
B1XKN9_SYNP2/5-121------------------------VRAIR----------GAITAT------------ANTKEAIA---------------
U5QIX8_9CYAN/5-122------------------------IRGIR----------GATTVE------------ENSAAAIE---------------
A8MFE5_ALKOO/4-119------------------------.IGIR----------GAITVN------------ENSTVAID---------------
H9UJ60_SPIAZ/18-131------------------------IHAVR----------GAVQLP------------KDSIMAMR---------------
A4J3M7_DESRM/4-119------------------------VRGIR----------GAVTVE------------RNDTQEIL---------------
R6H0E7_9FIRM/1-112------------------------MKAIR----------GAVNFL------------KDEPQEVY---------------
R7JF35_9FUSO/4-115------------------------.KGIR----------GAITVD------------ENSVEAIK---------------
B7JUB1_CYAP8/5-121------------------------VRGIR----------GATTAS------------DNTEQAIG---------------
Q7V0S3_PROMP/13-126------------------------I..IR----------GATNAK------------DNSVKEIE---------------
J7IMU5_DESMD/2-117------------------------VRGIR----------GATTVE------------HNDAAEIR---------------
E8MZ77_ANATU/3-119------------------------IRGIR----------GATTVD------------ENTAEAIL---------------
D1A6X0_THECD/3-118------------------------VRAIR----------GATQVE------------ADDREQIL---------------
F6DT67_DESRL/5-120------------------------VRGIR----------GAITVE------------RNESQQIL---------------
D1C4Y7_SPHTD/4-119------------------------CRGIR----------GATTAD------------RNTAEDIL---------------
D2Q4I1_KRIFD/3-118------------------------VRAIR----------GATQLE------------ADEREHLL---------------
D6XV93_BACIE/3-119------------------------VRGIR----------GATTVE------------QNDADEIV---------------
G2P0K8_STRVO/3-118------------------------VRAVR----------GAVQLE------------RDEPEHMH---------------
B1W219_STRGG/3-118------------------------VRAVR----------GAVQLD------------RDEAGHMA---------------
Q2JA61_FRASC/1-116------------------------MRAIR----------GATQVG------------ANAREDIF---------------
A9AX92_HERA2/4-119------------------------CRGVR----------GATVAV------------ENSSEAVL---------------
M1E6Z4_9FIRM/12-124------------------------..AIR----------GATTLL------------KDDPKELR---------------
E3E4U5_PAEPS/4-119------------------------.RGIR----------GATTVA------------NNEANEIL---------------
K9VZM5_9CYAN/5-121------------------------VRAIR----------GATTAS------------ENTIEAIA---------------
A5UVT5_ROSS1/5-120------------------------CRGIR----------GATTCD------------ENTREAIL---------------
Q7UMM1_RHOBA/20-135------------------------CRGVR----------GATTVE------------QDDREEIL---------------
D7CP86_SYNLT/4-119------------------------VRGIR----------GATTVE------------RDCPEDIT---------------
F2F6T7_SOLSS/2-118------------------------IRGIR----------GAITIV------------EDKAEYVW---------------
Q7NH32_GLOVI/5-122------------------------VRGIR----------GATTVE------------ENSKAAIE---------------
F0SYU7_SYNGF/1-118------------------------MRGIR----------GATTVE------------ENTSAAIR---------------
X5A2M2_9BACL/4-119------------------------.RGIR----------GATTVT------------SNEEQEIL---------------
R7K6Y0_9FIRM/1-115------------------------MTAIR----------GATTVS------------VNAAEEIE---------------
K9XQ97_STAC7/22-138------------------------VRGLR----------GATTVT------------ENSSVAIA---------------
U5LCX2_9BACI/2-118------------------------IRGVR----------GAITVQ------------SNTEKEIA---------------
B0JXC5_MICAN/8-124------------------------VRAIR----------GATTVT------------ANTIEAIR---------------
W0RHY8_9BACT/15-129------------------------MRGVR----------GATTVA------------FDAPEAVD---------------
R7XX76_9ACTN/4-118------------------------.RAIR----------GATQLD------------ADTREHML---------------
D5SYS0_PLAL2/3-119------------------------VRGIR----------GATCVD------------CDNPELLL---------------
D4ZWJ7_ARTPN/5-121------------------------VRAIR----------GATTVR------------ENSIDAIR---------------
K0J2K9_AMPXN/4-120------------------------IRGIR----------GATTVT------------ENNELEII---------------
E6TZG3_BACCJ/3-119------------------------VRGIR----------GAITVE------------ENDRKEII---------------
Q2RIT3_MOOTA/23-135------------------------VRGLR----------GAVDVE------------ENTAPAII---------------
K9XAN9_9CHRO/5-121------------------------VRAIR----------GATTVS------------ENTYEAIR---------------
A5D1S9_PELTS/6-121------------------------LRGIR----------GATTAE------------QNTAREII---------------
W5WDH3_9PSEU/3-118------------------------VRAVR----------GATQIE------------ADEREQVL---------------
C7LZX3_ACIFD/3-118------------------------LRGLR----------GATTLD------------EDTPEAMR---------------
B7KJL4_CYAP7/5-121------------------------VRAIR----------GATTAK------------ANTIEAIR---------------
D3F1J6_CONWI/5-117------------------------..ALR----------GATTVE------------DNDAEAIL---------------
Q73MK6_TREDE/7-119------------------------LRALR----------GAVCC.------------EDSEESIS---------------
R5WFK2_9DELT/1-111------------------------MKVIR----------GAICA.------------QNTAESIS---------------
Q3AAT3_CARHZ/3-116------------------------.KGIR----------GAITIE------------RDQPEEVA---------------
V5WHX3_9SPIO/12-129------------------------.VSVR----------GAVALS------------NRDPDQMI---------------
I0JNA3_HALH3/2-118------------------------IRGIR----------GATTVS------------VNRSEEII---------------
C9LUS3_SELS3/1-117------------------------MRGIR----------GAITVE------------KDTKDEIF---------------
B0C4Y7_ACAM1/10-126------------------------VRAIR----------GATTAT------------ENSVAAIR---------------
Q8Y5X7_LISMO/1-118------------------------MRAIR----------GATTIE------------TNIPEEIY---------------
K4LIL4_THEPS/9-124------------------------VRGIR----------GAVTVA------------ENTPEAII---------------
R7MA55_9CLOT/4-117------------------------.KGIR----------GAITVD------------SNTEEAIE---------------
B7GHQ4_ANOFW/20-136------------------------IRAIR----------GATTVN------------DNDEQEII---------------
I2F6C9_9BACT/1-111------------------------MKAIR----------GATSIE------------ADCPEEIR---------------
G8QW62_SPHPG/6-120------------------------IHAIR----------GAICVQ------------EDTKEAID---------------
K9YKF5_CYASC/7-123------------------------VRAIR----------GATTAE------------NNSLEAMR---------------
E4RLQ8_HALHG/2-116------------------------.YALR----------GAISVE------------ENTETAII---------------
F4GK06_SPHCD/7-122------------------------.TALR----------GAIQVE------------HDVPEDVD---------------
R6MS35_9FIRM/2-117------------------------VRAIR----------GATTVE------------NNDREEII---------------
H6NAH5_9BACL/3-119------------------------VRGIR----------GAITVE------------HNEENEIL---------------
F3ZZ30_MAHA5/3-118------------------------IRSVR----------GAITID------------ADGPDDVR---------------
W0E964_9FIRM/2-117------------------------VRGIR----------GAITVD------------ENSAEQID---------------
Q2JKJ5_SYNJB/5-121------------------------VRAIR----------GAITVP------------TNSAEAIG---------------
K9TFG9_9CYAN/5-121------------------------VKAIR----------GAITAS------------DNTIEAIR---------------
Q8EQB8_OCEIH/3-119------------------------.RGVR----------GATTIQ------------ENNAEEIV---------------
K8GP50_9CYAN/5-121------------------------VRAIR----------GATTVP------------ENSVQAIR---------------
A6WCP4_KINRD/9-124------------------------VRAVR----------GAVQVD------------VDEREEVL---------------
Q7VB04_PROMA/3-118------------------------IRAIR----------GATTCL------------SNTSDAIE---------------
K9VM04_9CYAN/10-125------------------------VRGIR----------GATTAS------------ENSVAAIR---------------

PF09663

C1E9U0_MICCC/10-395----------.VAVV--DTAHPGDTGPLE----------RWMDAN------------PL..ADILCVLGKTEGNGCVNDF
J9SHA9_9ACTN/6-341----------.LLTV--PTTGPDDTDALD----------TLSGNG------------.YSADDVLAVVGKTEGNGCVNDF
B9K1J2_AGRVS/8-348----------SVYRV--AASAPDDISGVE----------ALIGSG------------.LNPHSIVAVLGKTEGNGCVNDF
A8IKD2_AZOC5/5-352----------KVHRI--ATASPDDVSGLA----------AAIATG------------AIAPAGILAIFGKTEGNGCVNDF
B0UET5_METS4/6-361----------EILRL--PMAAPDDVSAIA----------ASLRDG------------RLDPGDVVAVFAKTEGNGCVNDF
F8I3U1_SULAT/1-336----------.....--.MQDPADFSELT----------GWIREG------------RLNPRDILAILGKTEGNGGQNDF
C0ZV96_RHOE4/6-366----------EVRKV--PLHSVSDASELA----------KLIDDG------------VLEADRVIAVIGKTEGNGGVNDY
F4CUJ4_PSEUX/5-341----------DIVKR--TTSSPDDTALVK----------TLADAG------------.YSTADVVALVAKTEGNGCVNDF
E3JD18_FRASU/20-386----------.MHVV--PMLAPNDTAAFR----------ALFASG------------AVDPASVVALIAKSEGSGLHNDH
A4Z1C9_BRASO/9-368----------HVHRL--PMRSPDDVGALE----------AAIVSG------------AIDPAGIVAILGKTEGNGCVNDF
M2ZZ64_PSEFD/32-379----------TLIKF--PTSSPADSSPLL----------QLSKTS------------DFKTDDILGIVGKTEGNGCVNDF
D6Y348_THEBD/6-366----------EVRKV--PIESVTDASGLA----------KLIDEG------------IIEADRVLAVIGKTEGNGGVNDY
K9XGJ2_9CHRO/4-340----------EVYKI--PQNSPDDLSQLD----------ALIHSG------------KIDPHKIVAILGKTEGNGCVNDF
B1M816_METRJ/6-365----------.VFRV--PAQHPADVSGVM----------DLVTSG------------TVGAPEIVAIFGKTEGNGCVNDF
A8ICF8_AZOC5/4-365----------GVHKL--AMSAPGDVSELA----------ALIETG------------AVNPREIVALVGKTEGNGGANDF
Q89E06_BRADU/7-367----------GVFKI--VTKGPGDVSGLM----------AMIGSG------------AIDPKSILAVLGKTEGNGGVNDF
A1SPN2_NOCSJ/6-368----------EVRKV--PIEHVSDAAGLA----------DLIDAG------------VFSADDVIAVVGKTEGNGGVNDY
Q2RGM7_MOOTA/5-366----------EVFRI--PTASPDDISGLA----------TLIDSG------------KINPAEIVAILGKTEGNGCVNDF
C6D0D9_PAESJ/5-353----------SVIKV--PARSPNDTAALQ----------RYIDES------------LINPKDVVAVLGKTEGNGCVNDF
F9ZUK7_ACICS/4-358----------QVHRF--FSSNPADVSGLA----------VAIAAG------------NVHPQRIVAIIGKTEGNGAINDF
K0CBY7_ALCDB/4-356----------RVHRF--ATAAPDDVSPLR----------RALGEG------------EVNADKVIAVLGKTEGNGCVNDF
K9XGD2_9CHRO/13-373----------GVFRL--PMSAPEDVSSLQ----------HLLETQ------------QIQAADIVAIIAQTEGTG....Y

PF14588

Q13J52_BURXL/18-164--------------------------------------------------------------------------------
Q8EFL1_SHEON/6-153--------------------------------------------------------------------------------

PF01042

UK114_MOUSE/11-129--------------------------------------------------------------------------------
RIDA_BACSU/7-124--------------------------------------------------------------------------------
MMF1_YEAST/26-143--------------------------------------------------------------------------------
Y364_AQUAE/6-125--------------------------------------------------------------------------------
Y322_HAEDU/1-114--------------------------------------------------------------------------------
Y1627_HAEIN/2-116--------------------------------------------------------------------------------
Q9ZBJ6_STRCO/11-130--------------------------------------------------------------------------------
O86529_STRCO/11-131--------------------------------------------------------------------------------
YJGH_ECOLI/11-128--------------------------------------------------------------------------------
Q55925_SYNY3/86-202--------------------------------------------------------------------------------
YSD2_CAEEL/46-163--------------------------------------------------------------------------------
Y709_SYNY3/8-128--------------------------------------------------------------------------------
RUTC_ECOLI/10-126--------------------------------------------------------------------------------
ALDR_LACLA/6-124--------------------------------------------------------------------------------
HMF1_YEAST/10-127--------------------------------------------------------------------------------
Y4SK_SINFN/7-125--------------------------------------------------------------------------------
MMF1_SCHPO/41-162--------------------------------------------------------------------------------
C1DI43_AZOVD/9-125--------------------------------------------------------------------------------
I6YA21_MYCTU/12-121--------------------------------------------------------------------------------
I6YGW9_MYCTU/18-150--------------------------------------------------------------------------------
Y944_HELPY/8-124--------------------------------------------------------------------------------
YOAB_ECOLI/3-114--------------------------------------------------------------------------------
RIDA_ECOLI/7-126--------------------------------------------------------------------------------
TDCF_ECOLI/7-126--------------------------------------------------------------------------------
Q03UU6_LEUMM/8-129--------------------------------------------------------------------------------
Q1D7G7_MYXXD/12-130--------------------------------------------------------------------------------
Q4CQG3_TRYCC/82-215--------------------------------------------------------------------------------
RIDA_PYRFU/8-124--------------------------------------------------------------------------------
Q8YYS9_NOSS1/63-181--------------------------------------------------------------------------------

PF07736

R6P3Z3_9CLOT/4-119--------------------------------------------------------------------------------
K9RYI1_SYNP3/10-126--------------------------------------------------------------------------------
F5YHG3_TREPZ/9-121--------------------------------------------------------------------------------
C5D3D9_GEOSW/2-118--------------------------------------------------------------------------------
G2TM72_BACCO/2-118--------------------------------------------------------------------------------
A8FEK3_BACP2/4-119--------------------------------------------------------------------------------
I0I4N0_CALAS/2-117--------------------------------------------------------------------------------
K9SJW3_9CYAN/5-121--------------------------------------------------------------------------------
L0KAH2_HALHC/3-118--------------------------------------------------------------------------------
K9TY01_9CYAN/6-121--------------------------------------------------------------------------------
A9WFT7_CHLAA/5-120--------------------------------------------------------------------------------
H6RWG6_BLASD/3-118--------------------------------------------------------------------------------
D7CQ58_TRURR/6-122--------------------------------------------------------------------------------
K9UWV8_9CYAN/7-122--------------------------------------------------------------------------------
Q9KCB5_BACHD/3-119--------------------------------------------------------------------------------
F6CMM4_DESK7/6-122--------------------------------------------------------------------------------
Q5SJY4_THET8/2-118--------------------------------------------------------------------------------
F2NYA7_TRES6/6-122--------------------------------------------------------------------------------
A5GN07_SYNPW/7-122--------------------------------------------------------------------------------
K9T1A7_9CYAN/5-121--------------------------------------------------------------------------------
Q65I30_BACLD/3-119--------------------------------------------------------------------------------
F6B991_DESCC/5-120--------------------------------------------------------------------------------
K9YGC3_HALP7/6-122--------------------------------------------------------------------------------
I0GSI6_SELRL/1-117--------------------------------------------------------------------------------
F4LMP6_TREBD/21-137--------------------------------------------------------------------------------
F5YDH5_TREAZ/9-121--------------------------------------------------------------------------------
A3DDB7_CLOTH/3-117--------------------------------------------------------------------------------
K9SUH2_9SYNE/5-121--------------------------------------------------------------------------------
B8I2T8_CLOCE/3-118--------------------------------------------------------------------------------
B0TFN2_HELMI/6-121--------------------------------------------------------------------------------
K9UI88_9CYAN/1-117--------------------------------------------------------------------------------
E6SM18_THEM7/1-116--------------------------------------------------------------------------------
J7LAI2_NOCAA/3-118--------------------------------------------------------------------------------
F0SQI8_RUBBR/3-119--------------------------------------------------------------------------------
B1WYV6_CYAA5/21-137--------------------------------------------------------------------------------
K9Z285_CYAAP/18-134--------------------------------------------------------------------------------
Q895G0_CLOTE/2-115--------------------------------------------------------------------------------
D7BFZ6_MEISD/2-118--------------------------------------------------------------------------------
D7B205_NOCDD/5-118--------------------------------------------------------------------------------
A5GRN7_SYNR3/13-128--------------------------------------------------------------------------------
A4XKN8_CALS8/3-116--------------------------------------------------------------------------------
C6CUD2_PAESJ/3-119--------------------------------------------------------------------------------
D3E7K4_GEOS4/4-119--------------------------------------------------------------------------------
I4D4R7_DESAJ/2-117--------------------------------------------------------------------------------
E4U7S7_OCEP5/5-121--------------------------------------------------------------------------------
Q5NGK3_FRATT/3-117--------------------------------------------------------------------------------
AROH_BACSU/3-119--------------------------------------------------------------------------------
D5X790_THEPJ/8-123--------------------------------------------------------------------------------
K9RJZ8_9CYAN/1-116--------------------------------------------------------------------------------
L0EDU0_THECK/3-119--------------------------------------------------------------------------------
D9S3D8_THEOJ/14-129--------------------------------------------------------------------------------
Q3AEV3_CARHZ/7-121--------------------------------------------------------------------------------
Q7V615_PROMM/13-127--------------------------------------------------------------------------------
B2A4P0_NATTJ/8-121--------------------------------------------------------------------------------
B8CWX1_HALOH/1-116--------------------------------------------------------------------------------
E3DQW0_HALPG/2-116--------------------------------------------------------------------------------
R4KN13_9FIRM/1-117--------------------------------------------------------------------------------
K9XR21_STAC7/5-121--------------------------------------------------------------------------------
Q55869_SYNY3/6-122--------------------------------------------------------------------------------
D9QPW2_ACEAZ/5-120--------------------------------------------------------------------------------
A0ZE51_NODSP/5-120--------------------------------------------------------------------------------
L0F7F4_DESDL/4-119--------------------------------------------------------------------------------
B8HM50_CYAP4/10-126--------------------------------------------------------------------------------
C0ZCE0_BREBN/4-121--------------------------------------------------------------------------------
S5ZXS0_9SPIO/7-116--------------------------------------------------------------------------------
R6QFW9_9FIRM/4-117--------------------------------------------------------------------------------
Q46JN7_PROMT/12-125--------------------------------------------------------------------------------
Q2IMD0_ANADE/1-113--------------------------------------------------------------------------------
F8F3G9_TRECH/9-121--------------------------------------------------------------------------------
A5I2T1_CLOBH/1-119--------------------------------------------------------------------------------
D7B1Z6_NOCDD/4-118--------------------------------------------------------------------------------
N0AVJ3_9BACI/2-118--------------------------------------------------------------------------------
C7PVY7_CATAD/3-118--------------------------------------------------------------------------------
D2R2P9_PIRSD/3-118--------------------------------------------------------------------------------
B9KXC3_THERP/4-118--------------------------------------------------------------------------------
K9S6J5_9CYAN/5-121--------------------------------------------------------------------------------
C8WX62_ALIAD/3-119--------------------------------------------------------------------------------
Q8DHZ0_THEEB/10-126--------------------------------------------------------------------------------
R5SBB9_9GAMM/4-116--------------------------------------------------------------------------------
Q31LX4_SYNE7/5-121--------------------------------------------------------------------------------
F0RVW8_SPHGB/7-120--------------------------------------------------------------------------------
H2J7F9_MARPK/3-112--------------------------------------------------------------------------------
F8I591_SULAT/2-117--------------------------------------------------------------------------------
C9R7W9_AMMDK/6-121--------------------------------------------------------------------------------
G8LU69_CLOCD/2-117--------------------------------------------------------------------------------
Q7U527_SYNPX/9-123--------------------------------------------------------------------------------
Q5WGS6_BACSK/2-118--------------------------------------------------------------------------------
Q0AX52_SYNWW/3-118--------------------------------------------------------------------------------
Q111X4_TRIEI/5-122--------------------------------------------------------------------------------
D1BHJ1_SANKS/3-118--------------------------------------------------------------------------------
F4CLD4_PSEUX/3-118--------------------------------------------------------------------------------
K9P5T4_CYAGP/7-122--------------------------------------------------------------------------------
F2JS36_CELLD/4-119--------------------------------------------------------------------------------
B1I403_DESAP/4-119--------------------------------------------------------------------------------
R5HIX2_9SPIR/3-116--------------------------------------------------------------------------------
B1XKN9_SYNP2/5-121--------------------------------------------------------------------------------
U5QIX8_9CYAN/5-122--------------------------------------------------------------------------------
A8MFE5_ALKOO/4-119--------------------------------------------------------------------------------
H9UJ60_SPIAZ/18-131--------------------------------------------------------------------------------
A4J3M7_DESRM/4-119--------------------------------------------------------------------------------
R6H0E7_9FIRM/1-112--------------------------------------------------------------------------------
R7JF35_9FUSO/4-115--------------------------------------------------------------------------------
B7JUB1_CYAP8/5-121--------------------------------------------------------------------------------
Q7V0S3_PROMP/13-126--------------------------------------------------------------------------------
J7IMU5_DESMD/2-117--------------------------------------------------------------------------------
E8MZ77_ANATU/3-119--------------------------------------------------------------------------------
D1A6X0_THECD/3-118--------------------------------------------------------------------------------
F6DT67_DESRL/5-120--------------------------------------------------------------------------------
D1C4Y7_SPHTD/4-119--------------------------------------------------------------------------------
D2Q4I1_KRIFD/3-118--------------------------------------------------------------------------------
D6XV93_BACIE/3-119--------------------------------------------------------------------------------
G2P0K8_STRVO/3-118--------------------------------------------------------------------------------
B1W219_STRGG/3-118--------------------------------------------------------------------------------
Q2JA61_FRASC/1-116--------------------------------------------------------------------------------
A9AX92_HERA2/4-119--------------------------------------------------------------------------------
M1E6Z4_9FIRM/12-124--------------------------------------------------------------------------------
E3E4U5_PAEPS/4-119--------------------------------------------------------------------------------
K9VZM5_9CYAN/5-121--------------------------------------------------------------------------------
A5UVT5_ROSS1/5-120--------------------------------------------------------------------------------
Q7UMM1_RHOBA/20-135--------------------------------------------------------------------------------
D7CP86_SYNLT/4-119--------------------------------------------------------------------------------
F2F6T7_SOLSS/2-118--------------------------------------------------------------------------------
Q7NH32_GLOVI/5-122--------------------------------------------------------------------------------
F0SYU7_SYNGF/1-118--------------------------------------------------------------------------------
X5A2M2_9BACL/4-119--------------------------------------------------------------------------------
R7K6Y0_9FIRM/1-115--------------------------------------------------------------------------------
K9XQ97_STAC7/22-138--------------------------------------------------------------------------------
U5LCX2_9BACI/2-118--------------------------------------------------------------------------------
B0JXC5_MICAN/8-124--------------------------------------------------------------------------------
W0RHY8_9BACT/15-129--------------------------------------------------------------------------------
R7XX76_9ACTN/4-118--------------------------------------------------------------------------------
D5SYS0_PLAL2/3-119--------------------------------------------------------------------------------
D4ZWJ7_ARTPN/5-121--------------------------------------------------------------------------------
K0J2K9_AMPXN/4-120--------------------------------------------------------------------------------
E6TZG3_BACCJ/3-119--------------------------------------------------------------------------------
Q2RIT3_MOOTA/23-135--------------------------------------------------------------------------------
K9XAN9_9CHRO/5-121--------------------------------------------------------------------------------
A5D1S9_PELTS/6-121--------------------------------------------------------------------------------
W5WDH3_9PSEU/3-118--------------------------------------------------------------------------------
C7LZX3_ACIFD/3-118--------------------------------------------------------------------------------
B7KJL4_CYAP7/5-121--------------------------------------------------------------------------------
D3F1J6_CONWI/5-117--------------------------------------------------------------------------------
Q73MK6_TREDE/7-119--------------------------------------------------------------------------------
R5WFK2_9DELT/1-111--------------------------------------------------------------------------------
Q3AAT3_CARHZ/3-116--------------------------------------------------------------------------------
V5WHX3_9SPIO/12-129--------------------------------------------------------------------------------
I0JNA3_HALH3/2-118--------------------------------------------------------------------------------
C9LUS3_SELS3/1-117--------------------------------------------------------------------------------
B0C4Y7_ACAM1/10-126--------------------------------------------------------------------------------
Q8Y5X7_LISMO/1-118--------------------------------------------------------------------------------
K4LIL4_THEPS/9-124--------------------------------------------------------------------------------
R7MA55_9CLOT/4-117--------------------------------------------------------------------------------
B7GHQ4_ANOFW/20-136--------------------------------------------------------------------------------
I2F6C9_9BACT/1-111--------------------------------------------------------------------------------
G8QW62_SPHPG/6-120--------------------------------------------------------------------------------
K9YKF5_CYASC/7-123--------------------------------------------------------------------------------
E4RLQ8_HALHG/2-116--------------------------------------------------------------------------------
F4GK06_SPHCD/7-122--------------------------------------------------------------------------------
R6MS35_9FIRM/2-117--------------------------------------------------------------------------------
H6NAH5_9BACL/3-119--------------------------------------------------------------------------------
F3ZZ30_MAHA5/3-118--------------------------------------------------------------------------------
W0E964_9FIRM/2-117--------------------------------------------------------------------------------
Q2JKJ5_SYNJB/5-121--------------------------------------------------------------------------------
K9TFG9_9CYAN/5-121--------------------------------------------------------------------------------
Q8EQB8_OCEIH/3-119--------------------------------------------------------------------------------
K8GP50_9CYAN/5-121--------------------------------------------------------------------------------
A6WCP4_KINRD/9-124--------------------------------------------------------------------------------
Q7VB04_PROMA/3-118--------------------------------------------------------------------------------
K9VM04_9CYAN/10-125--------------------------------------------------------------------------------

PF09663

C1E9U0_MICCC/10-395TRGYATSAIQAALGRVRSRRMGATANDDERNRQSSFTADPAIIMSGGTEGVLCPHFIVFANSWDEADADENHDDDDDDDA
J9SHA9_9ACTN/6-341SRTLAAAAWEPRIG.......................PDAVTVFSGGTEGVLAPHVNLLIAD...DTHDPR......HDR
B9K1J2_AGRVS/8-348TRGFATATFEQLFARL.......CV............TGVSIVMSGGTEGALSPHWTIFARE....RVEAA......PNR
A8IKD2_AZOC5/5-352SRGFAVQSLQMLLRGHMGA....AA............DEVCLVMSGGTEGGMSPHFLVFERA...EGNAPE......AAP
B0UET5_METS4/6-361TRPLAVQALRGLFGPLIGE...AAL............GRIAMVMSGGTEGGLSPHWLVIAAR.....EAAG......PGP
F8I3U1_SULAT/1-336TRELATVACRQALAENSSE..................ADVMLSFSGGTEGVITPHYWVFSHH.GSWPLNPN......PEK
C0ZV96_RHOE4/6-366TRIIADRAFREVLSAKGNRSPEEV.............AEVPIVWSGGTDGVISPHATIFATV.PADKVTKT......DEP
F4CUJ4_PSEUX/5-341SRTLADHTWDAVLP.......................ADAVTVFSGGTEGVLSPHASAFVGT....DRPAA......PEG
E3JD18_FRASU/20-386ARVFADVSLRTALAEARGCPVEDLA............DSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGL......PGV
A4Z1C9_BRASO/9-368TRAFAVRSLETLLGRHLQA...DAV............RQIAMVMSGGTEGALSPHMIVFEAR.TGDDGPRA......FGT
M2ZZ64_PSEFD/32-379SRTLSSHVWDEIIPSTGIS.......................VFSGGTEGVLSPHVAFILES........K......QQT
D6Y348_THEBD/6-366TRILADRAFRDVLVQKGTRTPEEV.............AQVPLVWSGGTDGVLSPHATIFATV.DPAKAPKT......DEP
K9XGJ2_9CHRO/4-340TRGFAIQTLKTYLREKANL...EVA............QRIIYVMSGGTEGVLSPHLNIFTRD....EQEGV......QRW
B1M816_METRJ/6-365TRQLAVMALETALATALGCTPAEAG............ARIALVMSGGTEGGLSPHFLILARR...EGPAAP......ERK
A8ICF8_AZOC5/4-365TRGLATLSYQLLLARHLGLSPEEVG............QRIAFVWSGGTEGVLSPHATLFTRA..PDDGPMP......AEP
Q89E06_BRADU/7-367TREYAVAALCTALAPQLGLSPEEVE............QRIAFVMSGGTEGVLSPHITVFTRREVERRPAGL......SGK
A1SPN2_NOCSJ/6-368TRIISTHAYRAVLEEKGTRSKEEV.............AQVPLVWSGGTDGVISPHATIFAYA.PEGRYLPT......DEP
Q2RGM7_MOOTA/5-366TRGFATQSLAMYLAEKLGISREEVV............KKVAFIMSGGTEGVMTPHITVFVRK..DVQEPAK......PGK
C6D0D9_PAESJ/5-353TRGFAVLALKNLFAS....YKEATA............EPVSYIMSGGTEGILSPHFSVISRSESLDDAIKR......EQS
F9ZUK7_ACICS/4-358SRGLAIMALGRLLGPFLDCSAEEIE............DRIFLSLSGGTEGVTCPHYLVFTVD...ETPASS......EKK
K0CBY7_ALCDB/4-356TRALSTLALTRLFSEVLGLSDEAVA............ERIALVMSGGTEGGLSPHILVFEVM...DEPALS......TSP
K9XGD2_9CHRO/13-373ARGYASLCLQLLLSQYLQISVEDVF............HRIPMMMIGLCGGLMSPHYTIFTRKAVAAPSTPP......QEK

PF14588

Q13J52_BURXL/18-164-----------------------AAARLCALNGLAQLAEAA-GSLANV.RLIRLDG------------------------
Q8EFL1_SHEON/6-153-----------------------AACRLATLNAIAQLKQAC-GELSRIKQIYRLEG------------------------

PF01042

UK114_MOUSE/11-129-----------------------KQALKNLGEILKAAGCDF-NN......VVKTTV------------------------
RIDA_BACSU/7-124-----------------------HQVFSNLKAVLEEAGASF-ET......VVKATV------------------------
MMF1_YEAST/26-143-----------------------EQVFQNVKNILAESNSSL-DN......IVKVNV------------------------
Y364_AQUAE/6-125-----------------------IQIFKNVDAILEEAGLKR-EN......IVKVTI------------------------
Y322_HAEDU/1-114-----------------------QQVLSEIDKYLAKSNTDK-SR......ILMATV------------------------
Y1627_HAEIN/2-116-----------------------KEVLGLIDKLLAKIGSNK-SN......ILTAQI------------------------
Q9ZBJ6_STRCO/11-130-----------------------RQVFENLRRCLASAGAAF-DD......VVKLTF------------------------
O86529_STRCO/11-131-----------------------RLTFRRLAETLDKAGFAL-SD......LVQIRI------------------------
YJGH_ECOLI/11-128-----------------------RLAFDNLHATLAAAGCTF-DD......IIDVTS------------------------
Q55925_SYNY3/86-202-----------------------AQAFQNIERTLAAAGAGW-EH......VVHVNS------------------------
YSD2_CAEEL/46-163-----------------------HQSLKNLGEVLKAAGADY-GN......VVKTTV------------------------
Y709_SYNY3/8-128-----------------------KQVLTNLGAVLQEAGCGW-EN......VVKTTV------------------------
RUTC_ECOLI/10-126-----------------------RHVLETIRKVIETAGGTM-AD......VTFNSI------------------------
ALDR_LACLA/6-124-----------------------EQVMKNISAILKEAHSDF-DL......VIKTTC------------------------
HMF1_YEAST/10-127-----------------------EQVIQNIKNVLEASNSSL-DR......VVKVNI------------------------
Y4SK_SINFN/7-125-----------------------EQCLKNLQAIARAAGTDL-SK......TVKTTV------------------------
MMF1_SCHPO/41-162-----------------------RQCLLNLQEVLTEAGSSL-NK......IVKVNI------------------------
C1DI43_AZOVD/9-125-----------------------VRVFENLKAVVEAAGGSF-AD......IVKLNI------------------------
I6YA21_MYCTU/12-121-----------------------RDALRRIEIALGQAGATL-AD......VVRTRI------------------------
I6YGW9_MYCTU/18-150-----------------------TLARICALNALAAVD.SL-VDLDAVTRVVKVVG------------------------
Y944_HELPY/8-124-----------------------TQSMENIKAILKEAGLGM-DS......VVKTTI------------------------
YOAB_ECOLI/3-114-----------------------ANTLAQIDAVLEKQGSNK-SS......ILDATI------------------------
RIDA_ECOLI/7-126-----------------------RQSLDNVKAIVEAAGLKV-GD......IVKTTV------------------------
TDCF_ECOLI/7-126-----------------------RLSLENVKAIVVAAGLSV-GD......IIKMTV------------------------
Q03UU6_LEUMM/8-129-----------------------HQIFDNIDNILHEAEFSR-ND......IVKAAL------------------------
Q1D7G7_MYXXD/12-130-----------------------ERVMENLKAVLAASGLDF-SH......VVRCTI------------------------
Q4CQG3_TRYCC/82-215-----------------------AAARACALQVVSQMQAAL-GDLDRVKRVVKLNV------------------------
RIDA_PYRFU/8-124-----------------------RQVLENIKAILEAAGYSL-TD......VVKVTV------------------------
Q8YYS9_NOSS1/63-181-----------------------VRAFQNLRFALDAVGAKP-SD......VVKTTV------------------------

PF07736

R6P3Z3_9CLOT/4-119-----------------------QATIELYSKMIDLNGIKT.ED------ISHIIFT-----------------------
K9RYI1_SYNP3/10-126-----------------------EAVQELLDEIEAHNQLDL.ME------VISVTFS-----------------------
F5YHG3_TREPZ/9-121-----------------------AQVGALYEGLLSENKLQE.QD------IVSIIFS-----------------------
C5D3D9_GEOSW/2-118-----------------------DATETLLKEMIRANDVTA.SD------VSFVLIS-----------------------
G2TM72_BACCO/2-118-----------------------AATSELMNALIEKNGIKP.DR------VASLLFS-----------------------
A8FEK3_BACP2/4-119-----------------------NKTKQLLEAIISRNEVDP.ER------VVQILIS-----------------------
I0I4N0_CALAS/2-117-----------------------KATRELLALMIHLNGIRS.ED------VASAIFT-----------------------
K9SJW3_9CYAN/5-121-----------------------VAVLEMLTAIADRNNIDP.EN------IVSVTFS-----------------------
L0KAH2_HALHC/3-118-----------------------SATQELLQELEETNDLKE.DN------VASVIFS-----------------------
K9TY01_9CYAN/6-121-----------------------EAVTEMLDELEMKNQLDP.TQ------IVSVTFT-----------------------
A9WFT7_CHLAA/5-120-----------------------SATHELLTLLIEANDIKP.ED------IASAIFT-----------------------
H6RWG6_BLASD/3-118-----------------------EATRELVHAVMARNDLRS.ED------LISILFT-----------------------
D7CQ58_TRURR/6-122-----------------------EATCELLEAMLRENDITDFEV------IAAIFFT-----------------------
K9UWV8_9CYAN/7-122-----------------------EAVTELLDELQTRNCLHP.NE------ILSVTFS-----------------------
Q9KCB5_BACHD/3-119-----------------------DATEGLMRTICEENEIDP.EN------VAQVILT-----------------------
F6CMM4_DESK7/6-122-----------------------QATGELLQAIMAENDLDP.ED------IASAFFT-----------------------
Q5SJY4_THET8/2-118-----------------------QATRELLLKMLEANGIQSYEE------LAAVIFT-----------------------
F2NYA7_TRES6/6-122-----------------------ENVGEMCRLIFKENNLQP.YD------IVSVHFT-----------------------
A5GN07_SYNPW/7-122-----------------------DAVAELVDALMEQNQLQP.DQ------LVSVTFS-----------------------
K9T1A7_9CYAN/5-121-----------------------EVVTELLDEIETHNQLDP.ED------IISVIFT-----------------------
Q65I30_BACLD/3-119-----------------------ERTKQLIGKMIDENRLKP.EQ------VVQILIS-----------------------
F6B991_DESCC/5-120-----------------------DATQELLRSILEQNQINI.ED------ICSVFFT-----------------------
K9YGC3_HALP7/6-122-----------------------EAVTELLDELEARNHLDP.SD------IISAVFT-----------------------
I0GSI6_SELRL/1-117-----------------------QAAKMLLSQILRRNKVKP.ED------IGACIFG-----------------------
F4LMP6_TREBD/21-137-----------------------RAVSSLCAAVFAENKLTE.DD------FVSIQFT-----------------------
F5YDH5_TREAZ/9-121-----------------------RQVVELYDELLRRNQLPE.AD------IVSIIFS-----------------------
A3DDB7_CLOTH/3-117-----------------------AETQKLLKEMAEKNGLEE.DD------IISIIFT-----------------------
K9SUH2_9SYNE/5-121-----------------------AAVLELMTAIEEKNQIDP.KE------IVSVTFS-----------------------
B8I2T8_CLOCE/3-118-----------------------EGTKELLVEIVNRNSLKN.AD------IISAIFT-----------------------
B0TFN2_HELMI/6-121-----------------------QATKELLREIVEANRLRL.ED------IASAIFT-----------------------
K9UI88_9CYAN/1-117-----------------------VAVAELLQELEYRNRIDP.DR------IVSVIFT-----------------------
E6SM18_THEM7/1-116-----------------------RATRELLQAMVALNEASV.DD------IVAVFFT-----------------------
J7LAI2_NOCAA/3-118-----------------------EATAELVSEVMERNGLTT.DD------VISVLFT-----------------------
F0SQI8_RUBBR/3-119-----------------------GATRELLEEILRVNELSHYED------LVSAIFT-----------------------
B1WYV6_CYAA5/21-137-----------------------EAVSELLDVIENQNQLNP.ED------IVSVTFT-----------------------
K9Z285_CYAAP/18-134-----------------------EAVAELLTEIETRNQLDY.EE------IISVIFT-----------------------
Q895G0_CLOTE/2-115-----------------------GKTLELFESILKENKINK.ED------IVSILFS-----------------------
D7BFZ6_MEISD/2-118-----------------------SATRELLAKMLEVNAITDPDA------IAAMIFT-----------------------
D7B205_NOCDD/5-118-----------------------AATLAMVRGVLDRNGLSP.AD------VACLWFT-----------------------
A5GRN7_SYNR3/13-128-----------------------EAVDELLDALISNNGLQG.DQ------VLSATFS-----------------------
A4XKN8_CALS8/3-116-----------------------QSTQELLNEIIEKNQIKK.DD------IVFILFT-----------------------
C6CUD2_PAESJ/3-119-----------------------QATLELLQEVVKQNDIVP.DD------IASVFIT-----------------------
D3E7K4_GEOS4/4-119-----------------------QETLRLLEEMVRRNELQP.EY------ISNIWIT-----------------------
I4D4R7_DESAJ/2-117-----------------------EATKELLTKILQDNKLST.ED------LVSAIFT-----------------------
E4U7S7_OCEP5/5-121-----------------------AATRKLLEAILERNGIRDPAE------LAALIFT-----------------------
Q5NGK3_FRATT/3-117-----------------------SATKELLQQIIKHNNVSP.SD------IVNIVFT-----------------------
AROH_BACSU/3-119-----------------------QKTKQLLEKIIEENHTKP.ED------VVQMLLS-----------------------
D5X790_THEPJ/8-123-----------------------NATVELLQELMKENGVEI.ED------IASIFFT-----------------------
K9RJZ8_9CYAN/1-116-----------------------EAVMEILDELEERNQLHP.TD------MISVTFS-----------------------
L0EDU0_THECK/3-119-----------------------EATAELFQQLVDANGIVP.ED------IASIIIT-----------------------
D9S3D8_THEOJ/14-129-----------------------DATRELLSRMMELNDVAL.ED------ICFILFS-----------------------
Q3AEV3_CARHZ/7-121-----------------------RQTKKLLAEIMSKNSLQK.EK------IISIFFT-----------------------
Q7V615_PROMM/13-127-----------------------AAVSELVKALMQRNQLNP.AD------IVSITFS-----------------------
B2A4P0_NATTJ/8-121-----------------------SQTKTLLQELIDKNDLSREQD------IVSVMFT-----------------------
B8CWX1_HALOH/1-116-----------------------NSTRRLLSEIINENHIQQ.EE------IVSIIFT-----------------------
E3DQW0_HALPG/2-116-----------------------DATKEIMQSLIEANSLTE.KD------LVSIITT-----------------------
R4KN13_9FIRM/1-117-----------------------DAAQRLVSTMLVENNIST.ED------IASMLFT-----------------------
K9XR21_STAC7/5-121-----------------------EAVTELLNEIEAHNQFNP.QD------VVCVFFT-----------------------
Q55869_SYNY3/6-122-----------------------DAVCELLDVIEANNACPP.ED------IVSVTFS-----------------------
D9QPW2_ACEAZ/5-120-----------------------TSTQELLTEILERNQLDE.ED------IISIFFT-----------------------
A0ZE51_NODSP/5-120-----------------------EAVTELIDELEQRNQLQP.EE------MISVTFS-----------------------
L0F7F4_DESDL/4-119-----------------------QATHELLEEIVRRNSLAP.AD------IVSAIFT-----------------------
B8HM50_CYAP4/10-126-----------------------EAVHELLDAIETHNDLNL.EE------VVSVTFS-----------------------
C0ZCE0_BREBN/4-121-----------------------SATKWLLEEMVSRNEVNP.ED------IGSIIIT-----------------------
S5ZXS0_9SPIO/7-116-----------------------KEVCFLFSEILKLNRLRE.KD------IVSIQFT-----------------------
R6QFW9_9FIRM/4-117-----------------------SNTEEMLKTIIDENGLDI.SQ------IISIVFT-----------------------
Q46JN7_PROMT/12-125-----------------------SAVEELLVELVSRNNLIP.DQ------IISITFS-----------------------
Q2IMD0_ANADE/1-113-----------------------DAVTELCRELTSRNQLEP.QQ------IVWAIFT-----------------------
F8F3G9_TRECH/9-121-----------------------EKVTELYEALLSRNGLEE.EQ------IVSVQFT-----------------------
A5I2T1_CLOBH/1-119-----------------------EASIKLFSEILSRNNLNI.ED------IVSIFIS-----------------------
D7B1Z6_NOCDD/4-118-----------------------AGVRELLTKVLDANGIGS.ED------LVSILFT-----------------------
N0AVJ3_9BACI/2-118-----------------------SATERLLRQMIQENQISS.ND------VASIFIS-----------------------
C7PVY7_CATAD/3-118-----------------------AGTTELVKQVLEQNGFAV.ED------LISMLFT-----------------------
D2R2P9_PIRSD/3-118-----------------------TATRQLLALMIRVNDIKA.ED------VASAIFS-----------------------
B9KXC3_THERP/4-118-----------------------QATRELLLALVEANGVEP.DQ------IASIIFT-----------------------
K9S6J5_9CYAN/5-121-----------------------EAVHELLEALETYNQLDP.EQ------IISATFT-----------------------
C8WX62_ALIAD/3-119-----------------------RATRELMEEIVRANDIDV.DD------VASVILT-----------------------
Q8DHZ0_THEEB/10-126-----------------------EAVLELLGEIERRNALDF.SE------VISVTFS-----------------------
R5SBB9_9GAMM/4-116-----------------------AATIKLLTEMVRKNNIEI.DS------ISHAIFT-----------------------
Q31LX4_SYNE7/5-121-----------------------EAVSELLDELERRNPLNP.DD------IVSLTFS-----------------------
F0RVW8_SPHGB/7-120-----------------------AAACKLYASILEQNGLSE.TN------VVSLLIT-----------------------
H2J7F9_MARPK/3-112-----------------------SRTIELYTQIIEKNNIKR...------IISIFCS-----------------------
F8I591_SULAT/2-117-----------------------SRTAELLLQMAEQNAVQP.DD------IASILFT-----------------------
C9R7W9_AMMDK/6-121-----------------------EATKELLLALVRENKLAV.ED------IAGIFFT-----------------------
G8LU69_CLOCD/2-117-----------------------RETEKLLTEIYEKNKLKE.ED------LISIIFT-----------------------
Q7U527_SYNPX/9-123-----------------------QAVRELIDVLVSRNGISP.EQ------IVSVTFS-----------------------
Q5WGS6_BACSK/2-118-----------------------QATETLVREMVSQNALQP.EQ------IAQVIVT-----------------------
Q0AX52_SYNWW/3-118-----------------------RATRELLQQMQKENAFTV.EE------VASALFT-----------------------
Q111X4_TRIEI/5-122-----------------------EAVNELLNELEKKNDFDL.EQ------VISATFS-----------------------
D1BHJ1_SANKS/3-118-----------------------ERTRELVKEVLRANDLDT.EA------LISIVFT-----------------------
F4CLD4_PSEUX/3-118-----------------------EGSAELVKAVLDRNGLAS.DD------IISIVFT-----------------------
K9P5T4_CYAGP/7-122-----------------------EAVAELIEELLQRNDLAG.DR------VLSVTFS-----------------------
F2JS36_CELLD/4-119-----------------------EATHEMLEAILKNNELRL.DE------LIQLHFS-----------------------
B1I403_DESAP/4-119-----------------------KATRELLEAVIRANDLQV.ED------IVSVFLT-----------------------
R5HIX2_9SPIR/3-116-----------------------DAVIELLNEMVERNGILP.EN------ISHAIFT-----------------------
B1XKN9_SYNP2/5-121-----------------------DAVRELLDDIEVRNQLDP.EE------IISVVFT-----------------------
U5QIX8_9CYAN/5-122-----------------------QAVVELLEELSRRNRLNC.AD------IGCVIFT-----------------------
A8MFE5_ALKOO/4-119-----------------------AASYEMMKKIIELNSIVE.DD------VISITFT-----------------------
H9UJ60_SPIAZ/18-131-----------------------DGVTELIPALCKANGISE.PD------IVSIQFT-----------------------
A4J3M7_DESRM/4-119-----------------------DATREMLALIIQRNQINI.KD------ICSIFFT-----------------------
R6H0E7_9FIRM/1-112-----------------------KKTEELIGELIKRNGLSE.AD------IVCVVFS-----------------------
R7JF35_9FUSO/4-115-----------------------DAALELLNSMIAENNIDV.SM------ISHVIFT-----------------------
B7JUB1_CYAP8/5-121-----------------------EAVRELLDEIETQNQLDP.EE------IVSATFT-----------------------
Q7V0S3_PROMP/13-126-----------------------SAVVELIEELITRNNIVV.NN------LLSITFT-----------------------
J7IMU5_DESMD/2-117-----------------------EATQELLQMILSENSLCT.ED------LVSAIFT-----------------------
E8MZ77_ANATU/3-119-----------------------AGTRELLLALMQANPALKPED------IASIFFT-----------------------
D1A6X0_THECD/3-118-----------------------EATTELVTEVMRRNGLST.DD------VISVIFT-----------------------
F6DT67_DESRL/5-120-----------------------EATQELLEKIVQENHLDT.ED------ICSAFFT-----------------------
D1C4Y7_SPHTD/4-119-----------------------EATRELLATMIEANDIAA.ED------VASIIFT-----------------------
D2Q4I1_KRIFD/3-118-----------------------ERTAELVRAVLEANDLGA.EE------LISILFT-----------------------
D6XV93_BACIE/3-119-----------------------RASKEMLDKLVSDNDVIP.ED------ISQVWFT-----------------------
G2P0K8_STRVO/3-118-----------------------EQVSALLTAILGRNALDP.DD------LISVWFT-----------------------
B1W219_STRGG/3-118-----------------------RRVGELLTAVLDRNELVA.DD------LISIWFT-----------------------
Q2JA61_FRASC/1-116-----------------------EATVELVTEMLIRNGLVT.DD------VISVLFT-----------------------
A9AX92_HERA2/4-119-----------------------AATSELLLAMVQANEIDL.DD------VACVFFT-----------------------
M1E6Z4_9FIRM/12-124-----------------------EKVIELVTKMVNENDVKE.ED------MVNFFIS-----------------------
E3E4U5_PAEPS/4-119-----------------------EATSQLLEEIVSYNEIQP.DD------ISNVWIT-----------------------
K9VZM5_9CYAN/5-121-----------------------EAVKELLDELETKNQIDP.TE------IISAFFT-----------------------
A5UVT5_ROSS1/5-120-----------------------EATRDLLQRIIAANGVRP.ED------IASAIFS-----------------------
Q7UMM1_RHOBA/20-135-----------------------KATTQLLALMIRRNEIDS.AD------LASATFT-----------------------
D7CP86_SYNLT/4-119-----------------------EAATELLHEIVKRNEIEL.DD------VVAVIFT-----------------------
F2F6T7_SOLSS/2-118-----------------------GETARLVKEVAKQNKIEP.ED------IASVTIS-----------------------
Q7NH32_GLOVI/5-122-----------------------QAVVELMASICERNVFEP.QD------IGCVIFT-----------------------
F0SYU7_SYNGF/1-118-----------------------ESARELIQSIVTENELDV.ED------IVSIIFS-----------------------
X5A2M2_9BACL/4-119-----------------------RETVLLLREMVERNNIIA.ED------ICSVWIT-----------------------
R7K6Y0_9FIRM/1-115-----------------------NAAAELIDEIMNRNFLGG.ED------IVAIIFS-----------------------
K9XQ97_STAC7/22-138-----------------------EAVRELFDVLHSKNQLDT.DQ------VVSVVFS-----------------------
U5LCX2_9BACI/2-118-----------------------AAAELLLKKMIDENSIAP.EE------VASVFIS-----------------------
B0JXC5_MICAN/8-124-----------------------EAVTELLEAIEIHNSLDP.DD------IVSIIFT-----------------------
W0RHY8_9BACT/15-129-----------------------DAVAELLHALTSMNDFGP.DD------VVSAIFS-----------------------
R7XX76_9ACTN/4-118-----------------------ERVAEMVTDVMTANGLSV.DD------FISVIFT-----------------------
D5SYS0_PLAL2/3-119-----------------------AATRELLAELLQQNEIVDFDE------IVSAIFT-----------------------
D4ZWJ7_ARTPN/5-121-----------------------EAVTELLDELETRNQLDP.EQ------IISTTFS-----------------------
K0J2K9_AMPXN/4-120-----------------------ENTRQLVLEMIEKNNVQA.ED------VSSVLVT-----------------------
E6TZG3_BACCJ/3-119-----------------------LATAKLAERMQEENKYHP.SD------VSHILIT-----------------------
Q2RIT3_MOOTA/23-135-----------------------AATEQLLREIVIRNDLER.GD------IISAIFT-----------------------
K9XAN9_9CHRO/5-121-----------------------EAVLELLAEIEARNQLEP.HQ------IISATFS-----------------------
A5D1S9_PELTS/6-121-----------------------LATRELLELLVRENEIDP.ED------IASVIFT-----------------------
W5WDH3_9PSEU/3-118-----------------------AATAELVAEVLGRNGLTA.DD------LISVVLT-----------------------
C7LZX3_ACIFD/3-118-----------------------ERVQELVSRMLAANGIGK.EQ------LVSILFT-----------------------
B7KJL4_CYAP7/5-121-----------------------EAVIELLSEIETRNQLDP.TD------IISVIFT-----------------------
D3F1J6_CONWI/5-117-----------------------SATDELMHELMERNALTA.DA------MVSCIFT-----------------------
Q73MK6_TREDE/7-119-----------------------SAAVNLYSRILRENSLSE.KD------IVSIHFT-----------------------
R5WFK2_9DELT/1-111-----------------------ENALLLVSSILKRNNLSA.DS------VSAVFFS-----------------------
Q3AAT3_CARHZ/3-116-----------------------KATRELLETIFKENNLTV.NN------VVAVLFT-----------------------
V5WHX3_9SPIO/12-129-----------------------LRMGDLLDSLFRENGVEP.EH------IVHIFFS-----------------------
I0JNA3_HALH3/2-118-----------------------DKSVELMNDLIRQNQIQP.EQ------VVSVYFT-----------------------
C9LUS3_SELS3/1-117-----------------------QAVKLMVMGMCRTNKIDP.SD------IGAAIFS-----------------------
B0C4Y7_ACAM1/10-126-----------------------EAVNELMLAIESENSLDV.NE------IISVTFS-----------------------
Q8Y5X7_LISMO/1-118-----------------------AATKELFEEILTQNEVTNSEQ------LTSVIIT-----------------------
K4LIL4_THEPS/9-124-----------------------TATRQLLEKIARENLLEP.ER------IISIIFS-----------------------
R7MA55_9CLOT/4-117-----------------------KATLELLNEIWERNHLEGTSQ------ISHVIFT-----------------------
B7GHQ4_ANOFW/20-136-----------------------DETKRLLTEMIRQNDVHA.ED------VVSILIS-----------------------
I2F6C9_9BACT/1-111-----------------------NSVIELMEEIFSRNKITE...------LHSVIFT-----------------------
G8QW62_SPHPG/6-120-----------------------HAICKLFSQVLEANGLLE.RD------IAFLLMT-----------------------
K9YKF5_CYASC/7-123-----------------------EAVSELMIEIETRNQLDY.DD------VISVIFT-----------------------
E4RLQ8_HALHG/2-116-----------------------QATKELMRKTLEENDLKE.DD------LVSIITS-----------------------
F4GK06_SPHCD/7-122-----------------------NAVKRLFSELLLVNAIDE.TD------IGMIFFT-----------------------
R6MS35_9FIRM/2-117-----------------------EATKEMLETIISENNIKT.ED------MVSVIFT-----------------------
H6NAH5_9BACL/3-119-----------------------SATTELLHRIVLENGIVP.EE------IASVFIT-----------------------
F3ZZ30_MAHA5/3-118-----------------------DAVHELLTAIVEANGIAV.DD------VVSMLFS-----------------------
W0E964_9FIRM/2-117-----------------------KATQEMLQAIIKENSLEV.ED------IISALFT-----------------------
Q2JKJ5_SYNJB/5-121-----------------------AAVAELLDTLEHRNALDP.AE------LVSVIFS-----------------------
K9TFG9_9CYAN/5-121-----------------------EAVTELLDELEARNKLDP.EL------IISATFS-----------------------
Q8EQB8_OCEIH/3-119-----------------------LRTEELVKAMVEQNNIKS.DD------VSHVFIS-----------------------
K8GP50_9CYAN/5-121-----------------------EAVNELLDELEIHNQLDM.DE------IVSVTFS-----------------------
A6WCP4_KINRD/9-124-----------------------ARTRDLVSEVIRANDLSL.DD------FISVIFT-----------------------
Q7VB04_PROMA/3-118-----------------------SAVQELVSELVNQNKLKA.KQ------IISVTFS-----------------------
K9VM04_9CYAN/10-125-----------------------EAVRELLDELEAKNDINP.EL------IISATFS-----------------------

PF09663

C1E9U0_MICCC/10-395AFELHVTRTRDFKPEEVGTPVMARATRRAIEEYLGYGGNAPNWD------DMFVQIKCPLLTPERIAEAAARGETCATTD
J9SHA9_9ACTN/6-341GLVAAVGETPVIPPEDLGRVGQMEAVRDTVAKLVVDLGI.SADD------VHLVLVKCPLLTSTDITGLRDRGIEPASGD
B9K1J2_AGRVS/8-348SLAIGVARTASLLPEHLGRKEQVDLVAQGVRAAMADAGIDDPAD------VHFVQIKCPLLTSARVAEAQARGKRTVIAE
A8IKD2_AZOC5/5-352ALAIGRAHTPDLPFEALGRMGQVRMVAQAVRRAMAAAGITDPED------VHFVQVKCPLLTAMRVKEAEARGATTATSD
B0UET5_METS4/6-361ALAVGQARTPPLAAEDLGRRAQVEMVAAGVRAAMREAGL.DAGQ------VHYVQVKCPLLTSERIGAALARGAAPATRD
F8I3U1_SULAT/1-336RLAAARGQTRRFAPHEVGTLAMVEETARVVRQLLDDARI.HPQD------VHFVHIKGALPS..RVSGEYPRN.......
C0ZV96_RHOE4/6-366RLTVGVAMSEQLLPEDIGRTAMITKVAAAVKDAMADAGITDPAD------VHYVQTKTPLLTIHTIRDAKSRGKTVWTEQ
F4CUJ4_PSEUX/5-341ALVAAVGRTASIPIADLGRAGQVRAVAARVRELCADAAL.EPGD------VHLVLVKCPLLTTESISRCLADGVEPATRD
E3JD18_FRASU/20-386GLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDD------VHLVMVKGPALSSRAVADALSRGKTVVTGD
A4Z1C9_BRASO/9-368SLALGRARTPTLPGEHLGRMQQVAQVAAGVRAAMADAGIEDPAD------VHYVQVKCPLLTMERIEAAEARGARTAVRD
M2ZZ64_PSEFD/32-379GLIASVSRTWKLQPWQIGTAEHVSCVSATIRKMLETEKL.KADD------VQLVLIKCPLLTSEKVAATLAAGQKPITAD
D6Y348_THEBD/6-366RLSVGVAMSEPILPEDIGRPAMIEKVANGVREAMKIAGIEDPAD------VHYVQTKTPLLTLETINDAKRRGHTVVTED
K9XGJ2_9CHRO/4-340GLAIGISRTRDFLPTEIGTLAMVEEVAAGVEAAIADAKL.DKSD------VHFVQIKCPLIVSTQQVKASN.........
B1M816_METRJ/6-365ALAIGTAFTHAFRPEEIGRMSQVEATAAAVGRAMAEAGLTDPAD------VHLVQVKCPLLTSARIADAAARGHGVATHD
A8ICF8_AZOC5/4-365RLALGIGITRDIAPEEVGTTAMVEAVAGAVHTALAEAGITEPAD------VHYVQVKGPLLTPATIADADRRGARLVTRD
Q89E06_BRADU/7-367RLSIGMAHTRDFLPEELGRAAQIAETAAAVKAAMADAGIADPAD------VHFVQIKCPLLTSDRVEAASARGNKTATTS
A1SPN2_NOCSJ/6-368RVTVGYAMSEVLLPEDIGRPAMVEKVAAGVRVAMERAGITDPAD------VHYVQTKTPLLVQDTINDAERRGETVYTHN
Q2RGM7_MOOTA/5-366RLAVGVAFTRDFLPEELGRMEQVNEVARAVKEAMKDAQIDDPRD------VHFVQIKCPLLTAERIEDAKRRGKDVVVND
C6D0D9_PAESJ/5-353SLAIGVARTPDFMPEELGRLAQVDQVAEAVRRAMDGAGIHDAAD------VHFVQIKCPLLTAEQVQEANLRGASTVTED
F9ZUK7_ACICS/4-358GLALAVGYTRSFAPEEAGRIPMILETARVVRALQAQLGV.KTDD------VHLVQVKGAIPAVPSVLGQSTTRE......
K0CBY7_ALCDB/4-356GLAAGVAFTPAFLPEQIGRWAQIDATAQAVREAMARAGIERNED------VHFVQIKCPLLTSARCDEAARRGAAVATTD
K9XGD2_9CHRO/13-373RLAVGIADTRVLLPEEYGTMTQVELVAEAVEAAIAQAGISSLDD------VHCVEIKCPAMTLARLQDAEKRRVKVVNTN

PF14588

Q13J52_BURXL/18-164--------------------------HVGCTQD--------------------YDDMPLVL--DA--ASRLLQDVL----
Q8EFL1_SHEON/6-153--------------------------VLNVHQS--------------------CIEHPKAL--DG--ASDLLLEIF----

PF01042

UK114_MOUSE/11-129--------------------------LLADMND-------------------.FGTVNEIY--KT--YFQGS....----
RIDA_BACSU/7-124--------------------------FIADMEQ-------------------.FAEVNEVY--GQ--YFDTH....----
MMF1_YEAST/26-143--------------------------FLADMKN-------------------.FAEFNSVY--AK--HFHTH....----
Y364_AQUAE/6-125--------------------------YITDIKK-------------------.FKELNEIY--ED--YFKDV....----
Y322_HAEDU/1-114--------------------------YLANMAD-------------------.YTEMNRAW--DE--WVAPN....----
Y1627_HAEIN/2-116--------------------------FLADMKD-------------------.YAQLNQAW--DE--WVDHV....----
Q9ZBJ6_STRCO/11-130--------------------------FVTDMAN-------------------.MGAIRAAR--AE--HIPDD....----
O86529_STRCO/11-131--------------------------FTVDIEA-------------------VTAHYDAVL--DE--LAAAD....----
YJGH_ECOLI/11-128--------------------------FHTDPEN-------------------QFEDIMTVK--NE--IFSAP....----
Q55925_SYNY3/86-202--------------------------YHVGGLP-------------------..PEVNDVM--VR--LYRHY....----
YSD2_CAEEL/46-163--------------------------LLQNIAD-------------------.FAAVNEVY--GQ--YFKSP....----
Y709_SYNY3/8-128--------------------------FLKDMND-------------------.FAAVNAIY--GQ--YFDEA....----
RUTC_ECOLI/10-126--------------------------FITDWKN-------------------.YAAINEIY--AE--FFPGD....----
ALDR_LACLA/6-124--------------------------FLKNIED-------------------.FSRFNAIY--SK--FFDKE....----
HMF1_YEAST/10-127--------------------------FLADINH-------------------.FAEFNSVY--AK--YFNTH....----
Y4SK_SINFN/7-125--------------------------LLTDLGD-------------------.FADINRVY--TG--FFSTP....----
MMF1_SCHPO/41-162--------------------------FLADMDD-------------------.FAAVNKVY--TE--VLPDP....----
C1DI43_AZOVD/9-125--------------------------FLTDLAH-------------------.FAKVNEVM--GR--YFAQP....----
I6YA21_MYCTU/12-121--------------------------YVTDISR-------------------.WREVGEVH--AQ--AFGKI....----
I6YGW9_MYCTU/18-150--------------------------FVASAPG-------------------.FHGQPSVI--NG--ASDLLAE.V----
Y944_HELPY/8-124--------------------------LLKSLDD-------------------.FAVVNGIY--GS--YFTEP....----
YOAB_ECOLI/3-114--------------------------FLADKND-------------------.FAAMNKAW--DA--WVVAG....----
RIDA_ECOLI/7-126--------------------------FVKDLND-------------------.FATVNATY--EA--FFTEH....----
TDCF_ECOLI/7-126--------------------------FITDLND-------------------.FATINEVY--KQ--FFDEH....----
Q03UU6_LEUMM/8-129--------------------------FFDDIAD-------------------.FALVNDIY--AQ--YFDTT....----
Q1D7G7_MYXXD/12-130--------------------------FLTDLGD-------------------.FARVNEVY--GR--YFTGA....----
Q4CQG3_TRYCC/82-215--------------------------FVNSSPS-------------------.FTEQSYVA--NG--ASDLILSVF----
RIDA_PYRFU/8-124--------------------------YLKDMND-------------------.FAKMNEVY--AE--YFGES....----
Q8YYS9_NOSS1/63-181--------------------------LIVDHTE-------------------...DKLIPL--GR--EIQNL....----

PF07736

R6P3Z3_9CLOT/4-119--------------------------LTKDIKS-------------------AFPAKFVRRN.FD..VQYVPFICV----
K9RYI1_SYNP3/10-126--------------------------VTRDLDR-------------------IFPAAVARER.PQ..WQTIPLIDI----
F5YHG3_TREPZ/9-121--------------------------VTPDLDA-------------------KNPAAALRQ...GGRAGDLALFAL----
C5D3D9_GEOSW/2-118--------------------------VTEDITA-------------------AFPAQALRRI.EG..WTYVPVMCM----
G2TM72_BACCO/2-118--------------------------ATADIRS-------------------AFPSKVMRQF.SG..WKYVPIMNM----
A8FEK3_BACP2/4-119--------------------------ATQDIHS-------------------VFPAKALRQF.EG..WTYVPVTCM----
I0I4N0_CALAS/2-117--------------------------TTPDLTA-------------------AFPATAARQ..LG..WLDVPLMCS----
K9SJW3_9CYAN/5-121--------------------------VTTDINS-------------------VFPAKIARSL.PQ..WEHVPLLDV----
L0KAH2_HALHC/3-118--------------------------MTPDLDQ-------------------AFPAQAARE..MG..WNEVPLFCT----
K9TY01_9CYAN/6-121--------------------------VTRDLDA-------------------IFPAAIARKR.PF..WDCVAMLDV----
A9WFT7_CHLAA/5-120--------------------------TTPDLNA-------------------EFPAVAARA..IG..WVDTALLCG----
H6RWG6_BLASD/3-118--------------------------ATPDLVS-------------------EFPALAARE..LG..LGDVPLMCA----
D7CQ58_TRURR/6-122--------------------------TTHDLTS-------------------TFPAEAARR..LG..MNLVPLICN----
K9UWV8_9CYAN/7-122--------------------------VTRDLDA-------------------IFPAAIARSR.PF..WDTVPMLDV----
Q9KCB5_BACHD/3-119--------------------------VTEDLTA-------------------TFPAKALRRL.AG..WTHVPVMCA----
F6CMM4_DESK7/6-122--------------------------VTADLNA-------------------EFPATAAREL.LG..WKYVPLLCA----
Q5SJY4_THET8/2-118--------------------------VTEDLTS-------------------AFPAEAARQ..IG..MHRVPLLSA----
F2NYA7_TRES6/6-122--------------------------MTQDLHC-------------------MNAAAALRKCDVGIDTSLLALFVS----
A5GN07_SYNPW/7-122--------------------------VTTDLDA-------------------CFPAATARHR.AG..WDTVALLDV----
K9T1A7_9CYAN/5-121--------------------------ATPDLDA-------------------IFPAAIARER.PR..WENVPLLDV----
Q65I30_BACLD/3-119--------------------------ATSDIHA-------------------AFPAKVVRTF.DG..WQHVPVMCM----
F6B991_DESCC/5-120--------------------------VTPDLNA-------------------AFPARAARA..MG..WDYVPLMCA----
K9YGC3_HALP7/6-122--------------------------TTRDLDA-------------------TFPASIARER.PN..WDNVALLDV----
I0GSI6_SELRL/1-117--------------------------CTDDLTA-------------------GFPSTGARQM.EG..FDKVPLFDN----
F4LMP6_TREBD/21-137--------------------------VTPDLDA-------------------LNPAAALRRGPCGALVRRAALFCS----
F5YDH5_TREAZ/9-121--------------------------VTDDLDA-------------------KNPAAALRQ...GGRAGEASLFAV----
A3DDB7_CLOTH/3-117--------------------------VTKDLDA-------------------AFPAIAARN..MG..WTSTALMCM----
K9SUH2_9SYNE/5-121--------------------------VTPDIDV-------------------IFPAQIARSR.RD..WEYVPLIDV----
B8I2T8_CLOCE/3-118--------------------------VTHDLSA-------------------AFPAVAARQ..IG..WNDIPLMCT----
B0TFN2_HELMI/6-121--------------------------VTPDLNA-------------------DFPAYAARE..AG..WHQVPLMCM----
K9UI88_9CYAN/1-117--------------------------ATKDLDA-------------------VFPAAIARRLYPN..WQDVALMDV----
E6SM18_THEM7/1-116--------------------------VTGDLDR-------------------AFPASAVRE..LG..WTHVPLLDA----
J7LAI2_NOCAA/3-118--------------------------ATPDLTC-------------------EFPALAARE..VG..FSDVPLMCA----
F0SQI8_RUBBR/3-119--------------------------TSPDLNA-------------------VFPAEAARG..LG..MNEVPLLCA----
B1WYV6_CYAA5/21-137--------------------------ATQDLDA-------------------IFPAAIARQR.PH..WQDVPLLDV----
K9Z285_CYAAP/18-134--------------------------VTSDLDA-------------------TFPAAIAREN.PQ..WENVPLLDL----
Q895G0_CLOTE/2-115--------------------------CTKDIDK-------------------AYPGKFLREK.YD..LNKVGIMHF----
D7BFZ6_MEISD/2-118--------------------------LTDDLRA-------------------AFPAEAARQ..LG..MQMVPLINS----
D7B205_NOCDD/5-118--------------------------VTPDLTA-------------------DVPPLVLREHRL...LDDVPALCA----
A5GRN7_SYNR3/13-128--------------------------VTADLDA-------------------MFPASLARRR.PG..WDGVALLDC----
A4XKN8_CALS8/3-116--------------------------MTKDLKS-------------------TFPAYAARL..MG..FTDVPLICA----
C6CUD2_PAESJ/3-119--------------------------VTQDLDA-------------------TFPAIAIRQM.GG..WDLVPLMCA----
D3E7K4_GEOS4/4-119--------------------------MTQDLDA-------------------TFPAKAIRQL.EG..WDLVPLMCS----
I4D4R7_DESAJ/2-117--------------------------VTADLNA-------------------DFPASSARE..IG..WQLVPLLCA----
E4U7S7_OCEP5/5-121--------------------------VTEDLIS-------------------AFPAEAARQ..LG..MNRVPLLSA----
Q5NGK3_FRATT/3-117--------------------------ATTDIKS-------------------EFPAVAARE..LG..LVDVPLIDC----
AROH_BACSU/3-119--------------------------ATPDLHA-------------------VFPAKAVREL.SG..WQYVPVTCM----
D5X790_THEPJ/8-123--------------------------TTPDLNA-------------------EFPALAARE..LG..WKYVPLLCA----
K9RJZ8_9CYAN/1-116--------------------------VTPDLDA-------------------IFPAAVARHR.PH..WNNVPMIDV----
L0EDU0_THECK/3-119--------------------------VTQDLDA-------------------AFPARAIREL.PG..WDLVPLMCA----
D9S3D8_THEOJ/14-129--------------------------ATQDIDA-------------------AYPASAARE..MG..LDLVPLLDV----
Q3AEV3_CARHZ/7-121--------------------------ATPDLNA-------------------QFPATAARK..AG..LTEIPLLCA----
Q7V615_PROMM/13-127--------------------------VTADLNA-------------------CFPAAIARQQ.AG..WESIALLDC----
B2A4P0_NATTJ/8-121--------------------------ATKDLTA-------------------CFPAKAARK..LG..WTNTPLMCA----
B8CWX1_HALOH/1-116--------------------------ATEDLDQ-------------------EYPAVAARE..MG..YNNVPLLCL----
E3DQW0_HALPG/2-116--------------------------ATPDLTK-------------------VYPGQALRE..LG..YNLTPILCL----
R4KN13_9FIRM/1-117--------------------------VTSDLNA-------------------SFPAEAVRKL.AG..FSQVPMMCA----
K9XR21_STAC7/5-121--------------------------ATRDLDA-------------------IFPAAVARNR.PG..WDNIPLLDL----
Q55869_SYNY3/6-122--------------------------VTPDLDA-------------------IFPAAIARQR.PR..WENVPLLDV----
D9QPW2_ACEAZ/5-120--------------------------VTQDLDA-------------------AFPAQAARE..LG..LDFIPLLCA----
A0ZE51_NODSP/5-120--------------------------VTRDLDA-------------------IFPAAIARSR.SG..WDNVAMLDV----
L0F7F4_DESDL/4-119--------------------------LTKDLDA-------------------AFPAAFARQ..LG..WDRVPMLCL----
B8HM50_CYAP4/10-126--------------------------VTRDLDR-------------------IFPAAIARER.PH..WQNVALLDV----
C0ZCE0_BREBN/4-121--------------------------TTEDLCA-------------------TFPAQAARLL.EGEAWQYVPLMCA----
S5ZXS0_9SPIO/7-116--------------------------VTKDITA-------------------LNPATALRK...NGFAKDLALFCS----
R6QFW9_9FIRM/4-117--------------------------ATRDIDA-------------------AYPAVVARK..LG..IVDASLMCV----
Q46JN7_PROMT/12-125--------------------------VTSDLDA-------------------CFPASIARKN.TG..WEKIALLDC----
Q2IMD0_ANADE/1-113--------------------------VTHDLDA-------------------DFPARAARV..QG..WNGVPMICS----
F8F3G9_TRECH/9-121--------------------------VTPDITV-------------------LNPATALRR...AGKAQNVALFAA----
A5I2T1_CLOBH/1-119--------------------------CTNDIDK-------------------GYPGKYIREN.FN..LKNIAIMHF----
D7B1Z6_NOCDD/4-118--------------------------STSDLVS-------------------AFPAEAARE..LG..LLDVPLMCA----
N0AVJ3_9BACI/2-118--------------------------VTEDVSA-------------------TFPAKAVRLI.EG..WTYVPVMCM----
C7PVY7_CATAD/3-118--------------------------ATPDLHS-------------------EFPALAARE..LG..IVDVPLMCA----
D2R2P9_PIRSD/3-118--------------------------LTSDLDA-------------------EFPALAARQ..LG..WLDVPLLCT----
B9KXC3_THERP/4-118--------------------------TTRDLTA-------------------TFPAVAARE..LG..WIHVPLLCA----
K9S6J5_9CYAN/5-121--------------------------VTRDLDA-------------------VFPAAIARER.PR..WDSVPLLDV----
C8WX62_ALIAD/3-119--------------------------MTPDLNA-------------------AFPAFAVRQL.PG..WQWVPLMCA----
Q8DHZ0_THEEB/10-126--------------------------VTRDLDQ-------------------IFPAAIAREC.PH..WRNVPLLDV----
R5SBB9_9GAMM/4-116--------------------------LTNDLNA-------------------DFPAKYARVN.LK..WKNVPMMCF----
Q31LX4_SYNE7/5-121--------------------------VTRDLDA-------------------MFPAAVARQR.AG..WQNVPLLDV----
F0RVW8_SPHGB/7-120--------------------------QTSDLKS-------------------RNPATGLRK...GGYCSSTPLFCM----
H2J7F9_MARPK/3-112--------------------------VTPDITA-------------------YNPITAIREN.FK..LDNVALFTL----
F8I591_SULAT/2-117--------------------------LSPDLRA-------------------TFPAEAARK..IG..WKYVPVICA----
C9R7W9_AMMDK/6-121--------------------------LTPDLNA-------------------EFPALAARE..LG..WHYVPLLCA----
G8LU69_CLOCD/2-117--------------------------VTNDLNA-------------------TFPAVAARN..LG..WTSVALMCT----
Q7U527_SYNPX/9-123--------------------------VTADLDA-------------------CFPAAEARQR.TG..WDSVALLDC----
Q5WGS6_BACSK/2-118--------------------------ATNDIDA-------------------TFPAKAVRHL.QG..WQYVPVMCA----
Q0AX52_SYNWW/3-118--------------------------VTADIRS-------------------AFPAAAARA..IG..WDKVPLLCF----
Q111X4_TRIEI/5-122--------------------------VTHDLDA-------------------IFPAAIARQR.PN..WNNIPLLDV----
D1BHJ1_SANKS/3-118--------------------------CTPDLVS-------------------DFPAAAARE..MG..LGDVPLMCA----
F4CLD4_PSEUX/3-118--------------------------ATPDLTA-------------------EFPAYAARL..LG..LTDVPLMCA----
K9P5T4_CYAGP/7-122--------------------------VTADLDA-------------------CFPAAIARRR.AD..WGRVALLDC----
F2JS36_CELLD/4-119--------------------------CTKDLDA-------------------AYPAVAARV..LG..ITEASLMCF----
B1I403_DESAP/4-119--------------------------LTPDLNA-------------------DFPAVAARD..MG..WDRVPLLCA----
R5HIX2_9SPIR/3-116--------------------------LTDDLNA-------------------AFPAKFARID.LG..WENVAMMCF----
B1XKN9_SYNP2/5-121--------------------------TTADLDA-------------------IFPAAIARQR.PN..WDNVPLLDV----
U5QIX8_9CYAN/5-122--------------------------ATADLDA-------------------IFPSQAARLNLPG..WEQVALLDL----
A8MFE5_ALKOO/4-119--------------------------MTKDLNQ-------------------RYPSAIVREK.LN..WKNTPILNF----
H9UJ60_SPIAZ/18-131--------------------------QTDDLTA-------------------ANPARELRS..IG..FASTPLFCA----
A4J3M7_DESRM/4-119--------------------------VTPDLNA-------------------GFPAKAARD..MG..WEYVPLMCA----
R6H0E7_9FIRM/1-112--------------------------TTKDIKC-------------------MYPAKVFREKF....YSTVPLFST----
R7JF35_9FUSO/4-115--------------------------LTNDLNA-------------------AFPAKFARLE.LG..WTETAMMCF----
B7JUB1_CYAP8/5-121--------------------------ATPDLDA-------------------VFPAAIARQR.PH..WQNVPLLDV----
Q7V0S3_PROMP/13-126--------------------------VTNDLDA-------------------CFPASIARKC.KS..LDSVAFLDC----
J7IMU5_DESMD/2-117--------------------------VTSDLDA-------------------DFPASSARA..IG..WQLVPLLCS----
E8MZ77_ANATU/3-119--------------------------MTEDLDA-------------------VHPALAARQ..LG..WVEVPLMCA----
D1A6X0_THECD/3-118--------------------------ATPDLTA-------------------EFPALAARK..LG..FHEVPLLCA----
F6DT67_DESRL/5-120--------------------------VTQDLDT-------------------EFPAKAARA..LG..WTSVPLMCT----
D1C4Y7_SPHTD/4-119--------------------------TTPDLNA-------------------TFPAIAARD..YG..WDMVPLLCT----
D2Q4I1_KRIFD/3-118--------------------------VTPDLHS-------------------EFPAVAGRQ..IG..LTDVPLMCM----
D6XV93_BACIE/3-119--------------------------VTPDLNA-------------------IFPAKALRLL.EG..FQYVPVMCA----
G2P0K8_STRVO/3-118--------------------------ATPDLHS-------------------DFPAAAARK..LG..ITDVPLICA----
B1W219_STRGG/3-118--------------------------ATPDLHS-------------------DFPAAAARG..LG..IVDVPLICA----
Q2JA61_FRASC/1-116--------------------------ATSDLDA-------------------EFPALAARK..AG..FHTVPMICA----
A9AX92_HERA2/4-119--------------------------TSSNLNA-------------------QFPALAARQ..LG..WNDLAMLCA----
M1E6Z4_9FIRM/12-124--------------------------VTNDIHS-------------------EFAGKFVRET.....YPSTPVFGA----
E3E4U5_PAEPS/4-119--------------------------VTHDLDA-------------------AFPAMAIRQL.DG..WDMVPLMCA----
K9VZM5_9CYAN/5-121--------------------------TTRDLDA-------------------IFPAAIARQR.PH..WDNVALLDV----
A5UVT5_ROSS1/5-120--------------------------TTPDLTA-------------------EFPAVAARE..LG..WLDAALLCT----
Q7UMM1_RHOBA/20-135--------------------------VTKDLHS-------------------EFPALAARQ..LG..WLEVPLLCG----
D7CP86_SYNLT/4-119--------------------------ATKDLSS-------------------AYPAVAARK..MG..WNHIPLLCC----
F2F6T7_SOLSS/2-118--------------------------TTPDIHS-------------------AFPAKSVRTM.PG..WQYVPIMCM----
Q7NH32_GLOVI/5-122--------------------------ATSDLDA-------------------LFPSQAARCHLRG..WENVALLDL----
F0SYU7_SYNGF/1-118--------------------------VSPELNS-------------------EFPAAGIRE..LDGEWRYVPFFCT----
X5A2M2_9BACL/4-119--------------------------MTTDLDA-------------------TFPARAIREI.EG..WELVPLMCS----
R7K6Y0_9FIRM/1-115--------------------------CTKDLTA-------------------AYPAKGAREK.SG..LNKVPMFCV----
K9XQ97_STAC7/22-138--------------------------VTKDLNA-------------------IFPASVVRHR.PG..WDLVPLLDV----
U5LCX2_9BACI/2-118--------------------------ATDDIDQ-------------------GFPAKAMRTL.DG..WKHVPVMCM----
B0JXC5_MICAN/8-124--------------------------ATQDLDA-------------------IFPAAIARER.PH..WQNVPLLDV----
W0RHY8_9BACT/15-129--------------------------TTCDLRS-------------------RPPAAAARA..IG..WTDVPMLCM----
R7XX76_9ACTN/4-118--------------------------ATSDLVS-------------------EFPAYAARR..LG..FGDVPLICA----
D5SYS0_PLAL2/3-119--------------------------TTPDLTS-------------------TFPAEAARA..LG..MRQVPLLCA----
D4ZWJ7_ARTPN/5-121--------------------------VTRDLDA-------------------VFPAAIARER.PH..WQNVPLLDV----
K0J2K9_AMPXN/4-120--------------------------VTDDLTA-------------------TFPAKPIRQL.PG..WTYVPVMCM----
E6TZG3_BACCJ/3-119--------------------------TTNDLNA-------------------AFPAVGLREL.EG..YELVPVMCA----
Q2RIT3_MOOTA/23-135--------------------------VTPDLDA-------------------AFPAEAARR..LG..WLDVALMCA----
K9XAN9_9CHRO/5-121--------------------------VTRDLDV-------------------VFPAAIARER.PC..WDNVPMLDV----
A5D1S9_PELTS/6-121--------------------------ATPDLNA-------------------EFPALAARE..MG..WKHVPLLCA----
W5WDH3_9PSEU/3-118--------------------------ATPDVTS-------------------EFPAYAARM..AG..LADVPLLSA----
C7LZX3_ACIFD/3-118--------------------------ATDDLHS-------------------LFPATAARE..IG..LGDVPLICA----
B7KJL4_CYAP7/5-121--------------------------ATPDLNV-------------------VFPAAIARER.PN..WDNVPLLDV----
D3F1J6_CONWI/5-117--------------------------LTDDLDA-------------------QFPAVAARR..MG..LSRVPLMCA----
Q73MK6_TREDE/7-119--------------------------VTSDIRA-------------------LNPASALRK...NGFAKNTALFCA----
R5WFK2_9DELT/1-111--------------------------ATADLDA-------------------CYPATAVRRQL....LPEASFMCF----
Q3AAT3_CARHZ/3-116--------------------------QTKDIVS-------------------AYPAKTARE..LG..LKGIPLMSA----
V5WHX3_9SPIO/12-129--------------------------QTEDIDF-------------------LNAAAAARKSRVGESISRTPLFCS----
I0JNA3_HALH3/2-118--------------------------VTEDLND-------------------GFPAKSLRQI.KG..WTYVPVMCM----
C9LUS3_SELS3/1-117--------------------------ATPDLKS-------------------AFPAAGARFL.KG..FDAVPLFDT----
B0C4Y7_ACAM1/10-126--------------------------VTRDLDA-------------------IFPAAIARQR.PN..WDTVPLLDV----
Q8Y5X7_LISMO/1-118--------------------------VTEDISA-------------------AFPAKAVRET.PG..FELVPVMGM----
K4LIL4_THEPS/9-124--------------------------VTPDLNA-------------------AFPAEGARA..LG..WTKVPLFCT----
R7MA55_9CLOT/4-117--------------------------TTPDLNA-------------------AFPAKYPRIA.LG..WNDVAMMCF----
B7GHQ4_ANOFW/20-136--------------------------MTDDLNA-------------------TFPAKALRHF.DG..WTYVPVMCM----
I2F6C9_9BACT/1-111--------------------------VTNDITS-------------------YNPATAFRKV.FN..QSDVALLCL----
G8QW62_SPHPG/6-120--------------------------QTGDLKS-------------------RNPAAGLRS...GGFCATTPLFCM----
K9YKF5_CYASC/7-123--------------------------ATPDLDA-------------------AFPAAIARER.PH..WANVPLLDL----
E4RLQ8_HALHG/2-116--------------------------ATDDLDK-------------------VYPGKAIRE..LG..LELTPILCL----
F4GK06_SPHCD/7-122--------------------------MTSDLHS-------------------RNPAASLRKFFPK..VSTTALFCM----
R6MS35_9FIRM/2-117--------------------------VTPDLDK-------------------VFPAVAARK..MG..IVDVPLLDM----
H6NAH5_9BACL/3-119--------------------------VTPDLTA-------------------TFPAKTIRQM.KD..WELVPLMCS----
F3ZZ30_MAHA5/3-118--------------------------CTPDISS-------------------IYPGAPARD..MG..FVHCGIMCL----
W0E964_9FIRM/2-117--------------------------VTLDLNA-------------------AFPAVTARK..LG..WKWVPLMCC----
Q2JKJ5_SYNJB/5-121--------------------------VTPDLNA-------------------AFPAQFARRR.PG..WESVPLLDV----
K9TFG9_9CYAN/5-121--------------------------VTRDLDA-------------------IFPAAIARQR.PN..WENVPLLDV----
Q8EQB8_OCEIH/3-119--------------------------VTKDVTD-------------------GFPAKALRKIDDS..WKYVPVMCM----
K8GP50_9CYAN/5-121--------------------------VTRDLDA-------------------IFPAAIARER.AH..WSNVPLLDV----
A6WCP4_KINRD/9-124--------------------------STADLVS-------------------EFPAVAARE..LG..MGDVPLMCA----
Q7VB04_PROMA/3-118--------------------------VTNDLNA-------------------CFPAAMARKQ.HG..WEEVALLDC----
K9VM04_9CYAN/10-125--------------------------ATRDLDA-------------------VFPAAIARER.PH..WCNVALLDV----

PF09663

C1E9U0_MICCC/10-395....CYESMALSRGASSLGAMVAVESALGRYSAPDDARVDDAVYAKTCEDYSVFSDHVSSS--AGVELMHCEILMMLTRR
J9SHA9_9ACTN/6-341....TYESMARSRAASSLGIAL....SLGEID...EDTARAAL....AGQRTAWSNRASAS--SGAELNTCHVLVL....
B9K1J2_AGRVS/8-348....TLKSMGYSRGASALGVAV....ALGELDM..DDIKDTDI....CRTLDLYSARASTS--AGVELTDHEIIVL....
A8IKD2_AZOC5/5-352....TLKSMGLSRGASALGIAL....ALGEVAE..DALSDAVI....CADYGLWSARASCS--SGIELLGHEIVVL....
B0UET5_METS4/6-361....TLKSMGLSRAAAALGAAL....ALGEVPA..AAIGETVA....ETDPGRHARRCGAS--AGVELLDHEVVVM....
F8I3U1_SULAT/1-336.......TMAYARGASALGVAV....ALGEIAP..EKIHEDAI....LRDWTLYSSRASTS--AKPGVERSDILVL....
C0ZV96_RHOE4/6-366....THESMDLSNGGTALGIAV....ALGEI....DMPTDEDV....MHSRELFSSVASCS--SGVELDRAQIVVV....
F4CUJ4_PSEUX/5-341....TLRSMAMSRAASALGVAV....ALGEIS...EPDAAAAL....RGEADVWSSVASIS--SGAELDDCHILVL....
E3JD18_FRASU/20-386YGIGPMGSMCWSNDASALGVAV....ALGEVKR..DLVADDRI....RSDWDLFSAVAATS--SGGEKRGGEVLLL....
A4Z1C9_BRASO/9-368....TLKSMGFSRGASALGVAV....ALGELAF..DELSDADI....CADYSRYSERAATS--GGVELLDHEIMVA....
M2ZZ64_PSEFD/32-379....TYESMAWSRYASAIGIGA....ALGEVSM..EDVPTH......LHSGNFYTAKASCS--SGAELDDCHILIL....
D6Y348_THEBD/6-366....TLKSMDISNSTTALGIAV....ALGEI....EMPREDQI....HRDLSLYSSVASCS--SGVELDRAQIVVM....
K9XGJ2_9CHRO/4-340....SYQSMAYSRGTSALGVAV....AMGEINL..EQITATDI....CANYALYSQVASTS--AGVELHNCEIIVL....
B1M816_METRJ/6-365....TYASMGLSRGASALGIAL....ALGEVDR..EQLTDPAI....GTRRDLFSGRASAS--AGIELMRNEIIVL....
A8ICF8_AZOC5/4-365....PNGSKPYARGAMALGVAL....GLGEVAA..ERITPDMI....ACDMEVFSAVASTS--AGGELTKCEVLLF....
Q89E06_BRADU/7-367....AYGSMAYSRGASALGVAV....ALGETG...SDISDGDV....LRRYDLFSKVASTS--AGIELMHNVVIVL....
A1SPN2_NOCSJ/6-368....TLESMDVSNATTALGIAV....ALGEI....EMPTAEQI....FHDLSLYSSVASCS--SGVELDQAQIVVV....
Q2RGM7_MOOTA/5-366....TYKSMAYSRGASALGVAL....ALGEISA..DKISNEAI....CHDWNLYSSVASTS--AGVELLNDEIIVV....
C6D0D9_PAESJ/5-353....TYKSMGYSRGASALGAAV....ALGEIQR..ERLQDTDI....CHSWELYSKVASTS--AGSELAYCEVIVF....
F9ZUK7_ACICS/4-358....WRCDMAWSRGASALGVAL....ALGEVSA..DMLDDEMI....NRDWTQFSTRASVS--AKPALQRSEICLV....
K0CBY7_ALCDB/4-356....TYESMAYSRGASALGVAL....ALGELEP..AQLRDAAV....CHEFGLYSGRASTS--AGIELMRNEILVL....
K9XGD2_9CHRO/13-373....LNQASSMAKGACALGIGL....ALKEIPQ..EKLDDRAI....NSNHALYTNRGSVS--AGGEQSACRVLVM....

PF14588

Q13J52_BURXL/18-164---------------------------GER------------------------------GRHARTALGHHVMP---LGA
Q8EFL1_SHEON/6-153---------------------------GEA------------------------------GRHSRMIWTNPVMP---LNS

PF01042

UK114_MOUSE/11-129---------------------------...----------------------------...LPARAAYQVAALP...RGS
RIDA_BACSU/7-124---------------------------..K----------------------------....PARSCVEVARLP...KDA
MMF1_YEAST/26-143---------------------------..K----------------------------....PARSCVGVASLP...LNV
Y364_AQUAE/6-125---------------------------..S----------------------------VK..PARVTVGVKELP...LNA
Y322_HAEDU/1-114---------------------------...----------------------------..NAPPRAAIEARLAN...PNW
Y1627_HAEIN/2-116---------------------------...----------------------------..SPPSRATVEAKLAD...PHW
Q9ZBJ6_STRCO/11-130---------------------------...----------------------------..RLPAASAVQVAALV..RPEF
O86529_STRCO/11-131---------------------------...----------------------------..CRPASLLAEVRALS..DPRM
YJGH_ECOLI/11-128---------------------------...----------------------------..PYPNWTAVGVTWLA....GF
Q55925_SYNY3/86-202---------------------------..M----------------------------PNHAPIWTQVGVAALG..LPTM
YSD2_CAEEL/46-163---------------------------..Y----------------------------....PARAAYQVAALP...KGG
Y709_SYNY3/8-128---------------------------..T----------------------------.A..PARSCVEVARLP...KDV
RUTC_ECOLI/10-126---------------------------..K----------------------------....PARFCIQCGLVK...PDA
ALDR_LACLA/6-124---------------------------..F----------------------------....PARSAVGVAGLP...KNV
HMF1_YEAST/10-127---------------------------..K----------------------------....PARSCVAVAALP...LGV
Y4SK_SINFN/7-125---------------------------..Y----------------------------....PARACYEVKALP...KGA
MMF1_SCHPO/41-162---------------------------..K----------------------------....PARSCVAVKTVPLSTQGV
C1DI43_AZOVD/9-125---------------------------..Y----------------------------....PARAAIGVASLP...RGA
I6YA21_MYCTU/12-121---------------------------...----------------------------...RPVTSMVEVTALI..APGL
I6YGW9_MYCTU/18-150---------------------------FGD----------------------------.SGAHARSAVGVSELP...LDA
Y944_HELPY/8-124---------------------------..Y----------------------------....PARATFQVAKLP...KDA
YOAB_ECOLI/3-114---------------------------...----------------------------..HAPVRCTVQAGLMN...PKY
RIDA_ECOLI/7-126---------------------------..N----------------------------.ATFPARSCVEVARLP...KDV
TDCF_ECOLI/7-126---------------------------..Q----------------------------.ATYPTRSCVQVARLP...KDV
Q03UU6_LEUMM/8-129---------------------------..S----------------------------VEEFPARSAVQVAALP...KNA
Q1D7G7_MYXXD/12-130---------------------------..P----------------------------....PARATVQVSALP...RGS
Q4CQG3_TRYCC/82-215---------------------------GEE----------------------------.AGRHARCAVGVAQLP...FGA
RIDA_PYRFU/8-124---------------------------..K----------------------------....PARAAVEVSRLP...KDV
Q8YYS9_NOSS1/63-181---------------------------..W----------------------------PFRPPANTLIPVPRLA..LNGM

PF07736

R6P3Z3_9CLOT/4-119---------------------------NEM----------------------------DIEPSLKHCLRVLMVVN.TDKK
K9RYI1_SYNP3/10-126---------------------------QQM----------------------------YVEGGLERCIRCLIYFN.TPQP
F5YHG3_TREPZ/9-121---------------------------QEA----------------------------AALNSLERTIRVMIHCY.LDEG
C5D3D9_GEOSW/2-118---------------------------REI----------------------------PVPNTLPRCIRVMMTVE.TTKK
G2TM72_BACCO/2-118---------------------------QEI----------------------------PVEGSLVRCIRILIHVD.TDIG
A8FEK3_BACP2/4-119---------------------------QEL----------------------------DIHGGLKHCIRVLMTVQ.TDTK
I0I4N0_CALAS/2-117---------------------------HEI----------------------------DVPGSLHRCIRVLIHWN.TNTP
K9SJW3_9CYAN/5-121---------------------------QHM----------------------------HVEGDLKRCIRVLMHIN.TELE
L0KAH2_HALHC/3-118---------------------------QEL----------------------------AIEGALAKCIRILIHYN.TEKA
K9TY01_9CYAN/6-121---------------------------QQM----------------------------HVEGSLERCIRCLIHAN.LPAN
A9WFT7_CHLAA/5-120---------------------------HEM----------------------------AVPGSLPRCIRVLIHWN.TTKR
H6RWG6_BLASD/3-118---------------------------TEI----------------------------AVPHALPRVLRLMAHAE.TPKD
D7CQ58_TRURR/6-122---------------------------LEI----------------------------PVPNRLPRAVRVMMQVN.TQKS
K9UWV8_9CYAN/7-122---------------------------QQM----------------------------YVQGSLERCIRFLIHAQ.LPTS
Q9KCB5_BACHD/3-119---------------------------QEI----------------------------PVPNGLEKCIRVMITLN.TTKA
F6CMM4_DESK7/6-122---------------------------REI----------------------------DVPGRLPRCIRVLVHVN.TTRS
Q5SJY4_THET8/2-118---------------------------REV----------------------------PVPGSLPRVIRVLALWN.TDTP
F2NYA7_TRES6/6-122---------------------------QEA----------------------------SIDGMLPHVVRALVTAY.LPAG
A5GN07_SYNPW/7-122---------------------------QQM----------------------------AVHGDLARCIRLLAHAW.LPGD
K9T1A7_9CYAN/5-121---------------------------QQM----------------------------SVKGSIERCIRVLIQVN.TFKR
Q65I30_BACLD/3-119---------------------------QEM----------------------------DVEHGLKKCIRVMMTVQ.TDMR
F6B991_DESCC/5-120---------------------------LES----------------------------DVVGALPKCIRVLVHVN.TSKG
K9YGC3_HALP7/6-122---------------------------QQM----------------------------HVEGSLSRCIRFLIHVN.TANP
I0GSI6_SELRL/1-117---------------------------RVP----------------------------DVEGAMERCIRVLLLVN.TDLK
F4LMP6_TREBD/21-137---------------------------AEP----------------------------VVAGSLPRVVRLLVTAY.MDAD
F5YDH5_TREAZ/9-121---------------------------QEA----------------------------RIRGGLERTVRILVHCY.LDED
A3DDB7_CLOTH/3-117---------------------------NEI----------------------------DVPGSLEKCIRVMMHVN.TDKD
K9SUH2_9SYNE/5-121---------------------------QQM----------------------------YVKGGLSKCIRVLLHVN.SCLE
B8I2T8_CLOCE/3-118---------------------------NEI----------------------------DVPGSLEKCVRVLIHIN.TEKT
B0TFN2_HELMI/6-121---------------------------SEI----------------------------NVPEALGRCVRVLIHVN.TPKG
K9UI88_9CYAN/1-117---------------------------QQM----------------------------HVEGSLPRCIRFLIHAH.LPID
E6SM18_THEM7/1-116---------------------------VAP----------------------------PVEDDLPRCIRALMLVN.TDRS
J7LAI2_NOCAA/3-118---------------------------TEI----------------------------AVPHALPRVVRLMAHVE.TERP
F0SQI8_RUBBR/3-119---------------------------SEI----------------------------SVPGALPSCIRVLLHVN.TDKK
B1WYV6_CYAA5/21-137---------------------------QQM----------------------------SVEGSLKRCIRVLIHVN.TSKP
K9Z285_CYAAP/18-134---------------------------QQM----------------------------QVRGSLEKCIRVLIYFN.TDKP
Q895G0_CLOTE/2-115---------------------------NEM----------------------------IVENSLNLCIRILILLN....G
D7BFZ6_MEISD/2-118---------------------------REI----------------------------PVPGSLERVIRVMILWN.TDTP
D7B205_NOCDD/5-118---------------------------AEP----------------------------VWDGAPRRTVRVMALAR.VEPG
A5GRN7_SYNR3/13-128---------------------------QQM----------------------------RVQGDLPRCIRVLVQAQ.MPAE
A4XKN8_CALS8/3-116---------------------------QEL----------------------------DIEGALEKCIRVLVLIQ...KD
C6CUD2_PAESJ/3-119---------------------------LEV----------------------------PVKGSLERCVRFMIHLN.TDKT
D3E7K4_GEOS4/4-119---------------------------VEI----------------------------PVQGSLPRCIRFMVQVN.TDKS
I4D4R7_DESAJ/2-117---------------------------TEI----------------------------PVPGSLKRCIRVLIHAN.TDCT
E4U7S7_OCEP5/5-121---------------------------REV----------------------------PVPGSLPRVIRILALWN.TDAP
Q5NGK3_FRATT/3-117---------------------------QQM----------------------------MRDGALEFCIRVMLTYN.TDKT
AROH_BACSU/3-119---------------------------QEM----------------------------DVTGGLKKCIRVMMTVQ.TDVP
D5X790_THEPJ/8-123---------------------------REI----------------------------DVPKAMSGVIRVLMHVN.TTKK
K9RJZ8_9CYAN/1-116---------------------------QQM----------------------------YVRGSLEKCIRILIHAY.MKSS
L0EDU0_THECK/3-119---------------------------LEV----------------------------SVKGSLEKCIRLMVHVN.TDKR
D9S3D8_THEOJ/14-129---------------------------GQM----------------------------SVRDGLRKCIRILLVYN.TDKG
Q3AEV3_CARHZ/7-121---------------------------QEM----------------------------DVPGSLEKVIRVLILTY.LPEN
Q7V615_PROMM/13-127---------------------------QQM----------------------------YVEGDLKRCIRMLAHAW.LPSD
B2A4P0_NATTJ/8-121---------------------------QEI----------------------------DVDDSLPKCIRVLIQYY.APED
B8CWX1_HALOH/1-116---------------------------QEM----------------------------NVTGSLSSCLRVLIHIN.RNCS
E3DQW0_HALPG/2-116---------------------------QEM----------------------------KVENSSQKMIRLLVHVK.GNKD
R4KN13_9FIRM/1-117---------------------------LEV----------------------------DVPGSLRQCIRLMMLVN.TSAS
K9XR21_STAC7/5-121---------------------------QQM----------------------------HVAGSLPFCIRVLIQVN.TPHP
Q55869_SYNY3/6-122---------------------------QQM----------------------------CVKGSLERCIRVLIHVN.SQSP
D9QPW2_ACEAZ/5-120---------------------------NEI----------------------------DVPGAISKCVRILIHIN.AGEK
A0ZE51_NODSP/5-120---------------------------QQM----------------------------HVEGSLPRCIRFLIHAY.LPAS
L0F7F4_DESDL/4-119---------------------------NEI----------------------------PVPGSLPRCIRVLLHVE.SPLS
B8HM50_CYAP4/10-126---------------------------QQM----------------------------HVEGALPRCIRCLIHFN.TPVP
C0ZCE0_BREBN/4-121---------------------------REI----------------------------PVPGGLPLCIRVMMHVN.TDKT
S5ZXS0_9SPIO/7-116---------------------------AEP----------------------------ETENSLPNTVRLLIHYY...SR
R6QFW9_9FIRM/4-117---------------------------QEM----------------------------YVENSLKMCIRAMVMVE.TDKK
Q46JN7_PROMT/12-125---------------------------QQM----------------------------FVKDDLPKCIRLLAYVS.LPNE
Q2IMD0_ANADE/1-113---------------------------QEI----------------------------PVPGSMPRVVRVLLHVD.SDGP
F8F3G9_TRECH/9-121---------------------------AEP----------------------------VIDGMLPRMIRILIHCY.LSKD
A5I2T1_CLOBH/1-119---------------------------NEM----------------------------YVEGSMPLCIRILILIDKKNKN
D7B1Z6_NOCDD/4-118---------------------------REL----------------------------DVSGALPRTVRLMVHAR.SGLA
N0AVJ3_9BACI/2-118---------------------------TEI----------------------------PVPSGLKKCIRVMMHVN.TSRV
C7PVY7_CATAD/3-118---------------------------QEI----------------------------DVTGAMPRVVRLLAHVE.TLRA
D2R2P9_PIRSD/3-118---------------------------YEV----------------------------NVPGSLRRCIRILLNWN.TEKS
B9KXC3_THERP/4-118---------------------------HEM----------------------------DVPGAPMGVVRVLMHVN.TEKS
K9S6J5_9CYAN/5-121---------------------------QQM----------------------------YVKESLERCIRFLIHFN.TQNP
C8WX62_ALIAD/3-119---------------------------TEI----------------------------NVPGSLPRSIRVLVHLN.TDKR
Q8DHZ0_THEEB/10-126---------------------------QQM----------------------------HVEGGLPRCIRCLIYFN.TPNP
R5SBB9_9GAMM/4-116---------------------------NEL----------------------------DVPNSLQKCLRVLIVIN.CGEG
Q31LX4_SYNE7/5-121---------------------------QQM----------------------------YVEGSLERCIRLLLHFN.CPED
F0RVW8_SPHGB/7-120---------------------------QEL----------------------------EIDGMLGKVIRMLLILN.YHSK
H2J7F9_MARPK/3-112---------------------------QEA----------------------------VFENSPKAIIRLLIHCE.GDTQ
F8I591_SULAT/2-117---------------------------REL----------------------------DVPHGLPKTVRVLMHAE.SNRS
C9R7W9_AMMDK/6-121---------------------------REI----------------------------DVPGSLPRVIRVLLLAN.TEKS
G8LU69_CLOCD/2-117---------------------------NEI----------------------------PVPGSLEKCIRVLMHIN.TDKR
Q7U527_SYNPX/9-123---------------------------QQM----------------------------AVQGDLCRCIRVLAYVW.LPPE
Q5WGS6_BACSK/2-118---------------------------QEI----------------------------PVKGSLPLCIRVMMTVN.TSLK
Q0AX52_SYNWW/3-118---------------------------QEI----------------------------EVPDSLPRCIRVLLHVN.TEKS
Q111X4_TRIEI/5-122---------------------------QQM----------------------------YVKGSLKRCIRFLIYIN.MPEA
D1BHJ1_SANKS/3-118---------------------------TEI----------------------------AVPHALPRVVRLMAHVN.LEVP
F4CLD4_PSEUX/3-118---------------------------TEI----------------------------AVPGAMPRVLRLLAHVE.TPRS
K9P5T4_CYAGP/7-122---------------------------QQM----------------------------AVAGDLPRCIRLLAHAW.LETG
F2JS36_CELLD/4-119---------------------------QEM----------------------------YVVNSLNQCIRVDVLVDAAHLS
B1I403_DESAP/4-119---------------------------TEI----------------------------NVPGAMPRCLRILMHVH.TQRS
R5HIX2_9SPIR/3-116---------------------------NEL----------------------------NVPGALKMCLRVLIVLN.CDDS
B1XKN9_SYNP2/5-121---------------------------QQM----------------------------AVQGSLERCIRVLIHLN.TPKP
U5QIX8_9CYAN/5-122---------------------------TQM----------------------------AVPGSLPRCVRVLLQVN.TDLP
A8MFE5_ALKOO/4-119---------------------------EEK----------------------------DIIHSLEKCIRVLIYAY.SDKA
H9UJ60_SPIAZ/18-131---------------------------AEP----------------------------LYPDYLPRTVRVLLTFR.GSAE
A4J3M7_DESRM/4-119---------------------------LEV----------------------------GVEKALPRCIRVLVHVN.TEKA
R6H0E7_9FIRM/1-112---------------------------TEP----------------------------DIDGGMPLTLRILALAD.VKSP
R7JF35_9FUSO/4-115---------------------------HEL----------------------------DVPDSLEKCLRVLIVLN.CGES
B7JUB1_CYAP8/5-121---------------------------QQM----------------------------QVKDSLPRCIRVLIHIN.TPKL
Q7V0S3_PROMP/13-126---------------------------QQM----------------------------YVPNDIDFCIRLMAQVL.LPAD
J7IMU5_DESMD/2-117---------------------------TEI----------------------------PVPGALPYCIRVLLHVN.TERS
E8MZ77_ANATU/3-119---------------------------REI----------------------------SVPDSVQRCVRVLIHWN.TDMP
D1A6X0_THECD/3-118---------------------------TEL----------------------------DVPHALPRVIRLMAHVE.TDRP
F6DT67_DESRL/5-120---------------------------SEV----------------------------NVAGALPKCIRVLIHIN.TGRS
D1C4Y7_SPHTD/4-119---------------------------HEM----------------------------DVPGALDHVVRILMHVN.TEKS
D2Q4I1_KRIFD/3-118---------------------------QEI----------------------------DVPHALPRVVRMMVHAE.SPRS
D6XV93_BACIE/3-119---------------------------KEI----------------------------DVPGSLGKCIRVMVTVN.TTKA
G2P0K8_STRVO/3-118---------------------------QEL----------------------------DIEGAMPRVVRILAHVE.TSLP
B1W219_STRGG/3-118---------------------------QEL----------------------------DVEGAMPRVVRILVHVE.TYLS
Q2JA61_FRASC/1-116---------------------------SEI----------------------------GVPGALPRVVRLMAHVE.VDGA
A9AX92_HERA2/4-119---------------------------HEM----------------------------DVPGSLSMCIRVLILWN.TSRK
M1E6Z4_9FIRM/12-124---------------------------LET----------------------------NVTNAPKMCIRVLLQCY.SKKA
E3E4U5_PAEPS/4-119---------------------------LEI----------------------------PVAGSLPKCIRLMVQVN.TDKS
K9VZM5_9CYAN/5-121---------------------------QQM----------------------------HVEGGLERCIRFLIHIN.LPAS
A5UVT5_ROSS1/5-120---------------------------HEM----------------------------AVPGSLPRCIRVLIHWN.TTRR
Q7UMM1_RHOBA/20-135---------------------------YEV----------------------------SVEGSLPRCIRVLLHWN.TTKS
D7CP86_SYNLT/4-119---------------------------QEM----------------------------AVAEALPRCIRVLMLAN.TRLA
F2F6T7_SOLSS/2-118---------------------------HEM----------------------------DVPGALPLCIRVLLHVN.TDTP
Q7NH32_GLOVI/5-122---------------------------AQL----------------------------EVPGSIPRCIRVLLQIN.TPHP
F0SYU7_SYNGF/1-118---------------------------TEI----------------------------PVPNGIDKCIRVLVHVN.TGKS
X5A2M2_9BACL/4-119---------------------------TEI----------------------------PVKGSLPKCIRLMVQVN.TDKS
R7K6Y0_9FIRM/1-115---------------------------QEQ----------------------------YVVGAVDKCIRALVLCQ....K
K9XQ97_STAC7/22-138---------------------------QQM----------------------------DVPDSLPRCIRVLIQFN.TPLP
U5LCX2_9BACI/2-118---------------------------REM----------------------------SVQDALPLCIRVMIHLN.TEKS
B0JXC5_MICAN/8-124---------------------------QQM----------------------------HVVGSLDKCIRVILHVN.TPKL
W0RHY8_9BACT/15-129---------------------------AEM----------------------------EVTEPLSRCVRVLLHVAVADGR
R7XX76_9ACTN/4-118---------------------------REL----------------------------EIEGSMPRCVRMMAHVE.TDLP
D5SYS0_PLAL2/3-119---------------------------SEI----------------------------AVPQALPRCIRVLLHVN.SSKA
D4ZWJ7_ARTPN/5-121---------------------------QQM----------------------------YVKGSLERCIRFLVHVN.FPSH
K0J2K9_AMPXN/4-120---------------------------QEI----------------------------KVPHGLPRCIRIMMTIN.TSIA
E6TZG3_BACCJ/3-119---------------------------QEI----------------------------PVPNSLEKCIRIMATVN.TNKQ
Q2RIT3_MOOTA/23-135---------------------------REI----------------------------PVPGSQPGIVRVLIHAY.SDHQ
K9XAN9_9CHRO/5-121---------------------------QQM----------------------------HVERSLQRCIRLLLHVN.LPVS
A5D1S9_PELTS/6-121---------------------------VEM----------------------------SVPGRPGKCIRVLLHVN.TGKS
W5WDH3_9PSEU/3-118---------------------------TEI----------------------------DVPGAMPRVIRLLAHVE.TDLT
C7LZX3_ACIFD/3-118---------------------------REL----------------------------DIVGGTQRCVRVLMHLE.DERP
B7KJL4_CYAP7/5-121---------------------------QQM----------------------------HVEGSLERCIRVLIHVN.SPKP
D3F1J6_CONWI/5-117---------------------------REV----------------------------PVPGALPRVIRVMVHYY.AEPD
Q73MK6_TREDE/7-119---------------------------LEP----------------------------GMKGGLPKTIRILIYYY...SR
R5WFK2_9DELT/1-111---------------------------REM----------------------------DVKNSLPNCLRVAVFAD.VQTA
Q3AAT3_CARHZ/3-116---------------------------QEP----------------------------DVIGGMPRVIRVLLFVD.LGAD
V5WHX3_9SPIO/12-129---------------------------LEP----------------------------RYPGSLPMTLRILLTYY.SSGD
I0JNA3_HALH3/2-118---------------------------REI----------------------------PVPGSLPKCIRVMVTAE.TDAA
C9LUS3_SELS3/1-117---------------------------LEP----------------------------EIENSLPRCIRALLLVD.TDKP
B0C4Y7_ACAM1/10-126---------------------------QQM----------------------------HVSSDLEYCIRCLIHFN.TADP
Q8Y5X7_LISMO/1-118---------------------------QEI----------------------------PVPNSLPMCIRFMVFTD.LHKP
K4LIL4_THEPS/9-124---------------------------TEI----------------------------AVPGSLPRCVRVLVHAY.LTCA
R7MA55_9CLOT/4-117---------------------------HEL----------------------------DVPNSLKMCLRVLVVIN.CEEN
B7GHQ4_ANOFW/20-136---------------------------REI----------------------------NVPHALPKCIRVMMTVH.TKRS
I2F6C9_9BACT/1-111---------------------------YEA----------------------------SFENSPGGIIRVLLHCE.SETK
G8QW62_SPHPG/6-120---------------------------QEL----------------------------EIDGMLERVIRIMLVAN....R
K9YKF5_CYASC/7-123---------------------------QQM----------------------------KVEGSLERCIRVLIYFN.TTKP
E4RLQ8_HALHG/2-116---------------------------QEM----------------------------KVENSSAKMIRLLIHVD.GHKD
F4GK06_SPHCD/7-122---------------------------QEA----------------------------EIDGMLEKVIRILIVTT.YPLG
R6MS35_9FIRM/2-117---------------------------SEP----------------------------EIDGALKKCIRILMHVN.SDKQ
H6NAH5_9BACL/3-119---------------------------LEI----------------------------PVEGALPKCIRFMVMVN.TEKK
F3ZZ30_MAHA5/3-118---------------------------QEM----------------------------DVWGGLPSCIRVMLLIE.TDKA
W0E964_9FIRM/2-117---------------------------TEI----------------------------PVPGALPLCIRVLLHVN.TQKS
Q2JKJ5_SYNJB/5-121---------------------------QQM----------------------------EVSGDLPRCIRVLIQLN.TPLA
K9TFG9_9CYAN/5-121---------------------------QHM----------------------------YVQGDLERCIRFLIHVN.VASA
Q8EQB8_OCEIH/3-119---------------------------TEI----------------------------DVPDSLAKCIRVMMVIR.TDKT
K8GP50_9CYAN/5-121---------------------------QQM----------------------------HVEGSLERCIRFLIHFN.TPNP
A6WCP4_KINRD/9-124---------------------------REL----------------------------EIAGSMPRVIRLMAHVE.TPRA
Q7VB04_PROMA/3-118---------------------------QQM----------------------------YVKGDLANCIRILAIVN.LPED
K9VM04_9CYAN/10-125---------------------------QQM----------------------------HVEGALERCIRFLILVN.WPAH

PF09663

C1E9U0_MICCC/10-395REPSSKTPRSKFRMAR...........GRMDDAIDLAGVTRCVD..............AARGSRGTNTIVTAIVKADPAA
J9SHA9_9ACTN/6-341..GVSTEASNPLRALH...........TEMADAYDLAALQKAAD..............VVAQDGGRIRQLFVKAESDPSG
B9K1J2_AGRVS/8-348..GMSDHWSGPFAMTH...........TVMFDAMDAPSVRAAWSDMPL................GKLSAVLAKAEPDPRG
A8IKD2_AZOC5/5-352..GMSEGWSGPLAIAH...........GVMADAIDVTPVKAALSALG..............AEAGEATIVLAKAEPSRSG
B0UET5_METS4/6-361..GMSPDWTGPLVIDH...........AVMADAIDLRPVAACLGRLGLLGPDGF....VDEAGRARLAALLAKAEASADG
F8I3U1_SULAT/1-336..GNSPWWSGSLVSDH...........TVMRDMLDLESVKKTLSRWGVTGCP......LTPAEQERVVAVFAKAEADPQN
C0ZV96_RHOE4/6-366..GNARGVGGRYRIGH...........SVMKDPLDQDGIWAAIRDAGLELPERP....HSSDLDGQLVNVFLKCEASQDG
F4CUJ4_PSEUX/5-341..GNSPAAHGPLRAVH...........GVMRDAMDARTVLDLLD..............RVSADGGEVVQVLAKAEADPSG
E3JD18_FRASU/20-386..ANSAQSASELRIGH...........GITRDMADTEGIKTAIRTAGVDFDCC.....LSPAQQAQVVQVFGKFVLPGSD
A4Z1C9_BRASO/9-368..GMSARWTGPLAIDH...........GVMRDAIDIEPARAALSRLGLDGPGQ.....LPAASRGRIAAVLAKAEAAQSG
M2ZZ64_PSEFD/32-379..ANDP..SIDVEAEHGDPPPLIQGFCGVMSSAVDFAGLQEVLNRASRP.........KAPYRKAKLLQVFAKAEADPTG
D6Y348_THEBD/6-366..GNVRGIGGRYRIGH...........SVMKDALDTDGIWEAIRNAGLDLPERP....HPSDLKGRLVNVFLKCEADPTG
K9XGJ2_9CHRO/4-340..GNSHQSTSNFVIGH...........SVMQHALDREAICQAVR..............STNQPLERVVNIFAKAEADPSG
B1M816_METRJ/6-365..GNAPGWTGPLAIAH...........RVMDDGIDLPAILGVLSDLGFPEAGP.....LSRQESERVIALLVKAEPSHDG
A8ICF8_AZOC5/4-365..GNAPGATSAFRIGH...........GVLKDAIDVAGVKEALRSAGLSFHGT.....PSEEQAHEIVAVFAKAEAPVNG
Q89E06_BRADU/7-367..GNSAASASEFEIGH...........AVMNDAIDAAAVTSALKCVGLGVA.......PQAEAGRELVNIFAKAEASPDG
A1SPN2_NOCSJ/6-368..GNARGVGGRFRVGH...........SIMKDALDMDGVWAAIRDAGLD..DMPVDCIHPRHIKGRLVNLFLKCEADPTG
Q2RGM7_MOOTA/5-366..GNSTNSASDLVIGH...........SVMKDAIDADAVRAALKDAGLKFDCC.....PPAEELAKIVNVLAKAEAASSG
C6D0D9_PAESJ/5-353..GNSAYAEGPYFIDH...........DVMKDAIDAGALKRILE................KYPDAEMVQVLAKAEADPTG
F9ZUK7_ACICS/4-358..ANAAGWSKDFQIAH...........GTMRDILDVSAIYKVLEDLELRPVCGQ....LPREQAARVYGVFAKSDADPRG
K0CBY7_ALCDB/4-356..GNAPGWDSEFRIGH...........DVMADALDADAVARALAR.............VPGDGAGELVALLAKAEPSRNG
K9XGD2_9CHRO/13-373..GNSAFSASRYRIGS...........GVMQNQLDTTGVYAALKSAGLNCQIP.....LTTDQQNKITQVFVNCGADAVT

PF14588

Q13J52_BURXL/18-164P----VMLGFFAEI--------------------------------------------------
Q8EFL1_SHEON/6-153L----CLVYLFAEL--------------------------------------------------

PF01042

UK114_MOUSE/11-129R----VEIEAIAVQ--------------------------------------------------
RIDA_BACSU/7-124L----VEIEVIALV--------------------------------------------------
MMF1_YEAST/26-143D----LEMEVIAVE--------------------------------------------------
Y364_AQUAE/6-125E----VEIEIVAVK--------------------------------------------------
Y322_HAEDU/1-114K----VEIVITAAI--------------------------------------------------
Y1627_HAEIN/2-116K----VEIVIIATC--------------------------------------------------
Q9ZBJ6_STRCO/11-130L----MEIEAFAVV--------------------------------------------------
O86529_STRCO/11-131L----VEIEGLAAQ--------------------------------------------------
YJGH_ECOLI/11-128D----FEIKVIARI--------------------------------------------------
Q55925_SYNY3/86-202R----IEIRVTAIV--------------------------------------------------
YSD2_CAEEL/46-163L----VEIEAVAIA--------------------------------------------------
Y709_SYNY3/8-128L----VEIDCVAVL--------------------------------------------------
RUTC_ECOLI/10-126L----VEIATIAHI--------------------------------------------------
ALDR_LACLA/6-124L----IEIEVIAEV--------------------------------------------------
HMF1_YEAST/10-127D----MEMEAIAAE--------------------------------------------------
Y4SK_SINFN/7-125K----VEIEAVISL--------------------------------------------------
MMF1_SCHPO/41-162K----IEIECIALE--------------------------------------------------
C1DI43_AZOVD/9-125Q----VEMDGILV.--------------------------------------------------
I6YA21_MYCTU/12-121L----VEIEADAYV--------------------------------------------------
I6YGW9_MYCTU/18-150P----VEVELIVEV--------------------------------------------------
Y944_HELPY/8-124L----VEIEAIAI.--------------------------------------------------
YOAB_ECOLI/3-114K----VEIKIVAAV--------------------------------------------------
RIDA_ECOLI/7-126K----IEIEAIAV.--------------------------------------------------
TDCF_ECOLI/7-126K----LEIEAIAV.--------------------------------------------------
Q03UU6_LEUMM/8-129K----LEIEITAM.--------------------------------------------------
Q1D7G7_MYXXD/12-130K----VEIDAIAV.--------------------------------------------------
Q4CQG3_TRYCC/82-215A----VEVDALVE.--------------------------------------------------
RIDA_PYRFU/8-124L----IEIEAIAY.--------------------------------------------------
Q8YYS9_NOSS1/63-181L----FEIDAYAVI--------------------------------------------------

PF07736

R6P3Z3_9CLOT/4-119Q.NE-IKHVYLGGA----------------------------------KILRSDL---------
K9RYI1_SYNP3/10-126Q.AL-IQHIYLRQA----------------------------------RDLRPDL---------
F5YHG3_TREPZ/9-121S..T-PRHVYRNGA----------------------------------EALRPDR---------
C5D3D9_GEOSW/2-118Q.EE-ISHIYLRDA----------------------------------VTLRPDL---------
G2TM72_BACCO/2-118Q.ED-IKHVYLRRA----------------------------------AVLRPDL---------
A8FEK3_BACP2/4-119Q.ED-VQHVYLEEA----------------------------------VTLRPDL---------
I0I4N0_CALAS/2-117Q.DR-IQHVYLKEA----------------------------------QSLRPDK---------
K9SJW3_9CYAN/5-121Q.GQ-IQHIYLKDA----------------------------------SHLRPDL---------
L0KAH2_HALHC/3-118L.TE-INHIYLKAA----------------------------------KELRPDL---------
K9TY01_9CYAN/6-121Q.VQ-VWHPYLRKA----------------------------------KSLRPDW---------
A9WFT7_CHLAA/5-120A.DE-VVHVYIRGA----------------------------------RGLRPER---------
H6RWG6_BLASD/3-118R.AD-IQHVYLRGA----------------------------------VALRRDI---------
D7CQ58_TRURR/6-122Q.RE-MKHVYLRGA----------------------------------VSLRPDL---------
K9UWV8_9CYAN/7-122F..P-VQHIYLQKA----------------------------------KNLRPDW---------
Q9KCB5_BACHD/3-119Q.SE-IHHVYLNEA----------------------------------VKLRPDL---------
F6CMM4_DESK7/6-122Q.RE-IKHVYLREA----------------------------------TQLRTDL---------
Q5SJY4_THET8/2-118Q.DR-VRHVYLREA----------------------------------VRLRPDL---------
F2NYA7_TRES6/6-122K..N-PVHVYINGA----------------------------------EKLRPDF---------
A5GN07_SYNPW/7-122Q..P-LHHPYLRGA----------------------------------ARLRPDR---------
K9T1A7_9CYAN/5-121Q.VE-IHHSYLRGA----------------------------------KNLRRDW---------
Q65I30_BACLD/3-119Q.DE-VRHVYLENA----------------------------------VTLRPDL---------
F6B991_DESCC/5-120Q.KE-MKHVYLRQA----------------------------------INLRPDL---------
K9YGC3_HALP7/6-122N.WE-IVHPYLRHA----------------------------------QDLRPDW---------
I0GSI6_SELRL/1-117Q.AD-IQHVYMGKA----------------------------------QELRPDL---------
F4LMP6_TREBD/21-137R..M-PVHVYTGGA----------------------------------EVLRPDF---------
F5YDH5_TREAZ/9-121Q..E-IAHVYRNGA----------------------------------EVLRPDR---------
A3DDB7_CLOTH/3-117K.KD-IKHVYLNGA----------------------------------KVLRPDL---------
K9SUH2_9SYNE/5-121Q.SK-IQHIYLNGA----------------------------------RDLRPDL---------
B8I2T8_CLOCE/3-118N.AE-INHVYLNGA----------------------------------AVLRPDL---------
B0TFN2_HELMI/6-121Q.ED-MVHVYLGGA----------------------------------VRLRPDL---------
K9UI88_9CYAN/1-117A..K-IYHPYLRGA----------------------------------SNLRPDR---------
E6SM18_THEM7/1-116P.AE-IRHVYLGQA----------------------------------RCLRPDL---------
J7LAI2_NOCAA/3-118R.SE-VQHVYLRGA----------------------------------QALRLDI---------
F0SQI8_RUBBR/3-119Q.NE-ITHVYMREA----------------------------------VKLRPDM---------
B1WYV6_CYAA5/21-137Q.KE-ISHAYLRGA----------------------------------SNLRPDW---------
K9Z285_CYAAP/18-134Q.AE-IYHPYLRKA----------------------------------RNLRPDW---------
Q895G0_CLOTE/2-115HNLN-IKYVYLGKA----------------------------------KKLRDDL---------
D7BFZ6_MEISD/2-118Q.RN-VRHVYLREA----------------------------------VRLRPDL---------
D7B205_NOCDD/5-118H..E-VRHVYLDGA----------------------------------TRDRP..---------
A5GRN7_SYNR3/13-128Q..T-LHHPYLRDT----------------------------------QRLRPDR---------
A4XKN8_CALS8/3-116SVIK-PKHVYLKRA----------------------------------RSLREDL---------
C6CUD2_PAESJ/3-119Q.AE-INHVYLGGA----------------------------------RVLRPDL---------
D3E7K4_GEOS4/4-119Q.SE-IKHVYLNEA----------------------------------KRLRPDL---------
I4D4R7_DESAJ/2-117Q.RE-IKHIFLREA----------------------------------AGLRKDL---------
E4U7S7_OCEP5/5-121P.EA-IRHVYLGEA----------------------------------QRLRPDL---------
Q5NGK3_FRATT/3-117Q.TD-IKHIYLRGA----------------------------------KVLRPDL---------
AROH_BACSU/3-119Q.DQ-IRHVYLEKV----------------------------------VVLRPDL---------
D5X790_THEPJ/8-123Q.DE-IKHLYLRDA----------------------------------TKLRPDL---------
K9RJZ8_9CYAN/1-116T..S-ISHIYLRNA----------------------------------SKLRPDW---------
L0EDU0_THECK/3-119Q.DE-IRHIFLGRA----------------------------------RTLRPDL---------
D9S3D8_THEOJ/14-129L.KD-IKHVYLRGA----------------------------------KVLRPDL---------
Q3AEV3_CARHZ/7-121Q..K-VQHLYLEGA----------------------------------KVLRPDW---------
Q7V615_PROMM/13-127Q..P-PQHPYLGET----------------------------------SLLRPDR---------
B2A4P0_NATTJ/8-121H..S-PQAVYLKDA----------------------------------RKLRPDL---------
B8CWX1_HALOH/1-116L.SD-IKHVYLKEA----------------------------------KRLRPDL---------
E3DQW0_HALPG/2-116K.TQ-VKHQYLKKA----------------------------------KNLRPDL---------
R4KN13_9FIRM/1-117Q.SD-IKHIYLGGA----------------------------------AQLRPDL---------
K9XR21_STAC7/5-121Q.SA-MVHCYLRNA----------------------------------RNLRPDL---------
Q55869_SYNY3/6-122Q.SE-MYHAYLRQA----------------------------------RSLRPDW---------
D9QPW2_ACEAZ/5-120L.EE-VEHIYLKDA----------------------------------KKLRPDL---------
A0ZE51_NODSP/5-120T..P-IHHIYLRQA----------------------------------AKLRPDW---------
L0F7F4_DESDL/4-119Q.EE-IQPVYLRDA----------------------------------VNLRRDL---------
B8HM50_CYAP4/10-126H.PP-IHHAYLRQA----------------------------------RDLRPDW---------
C0ZCE0_BREBN/4-121A.KD-IHHVFLRDA----------------------------------VKLRPDL---------
S5ZXS0_9SPIO/7-116L..K-PVYVYLNGA----------------------------------ANLRK..---------
R6QFW9_9FIRM/4-117Q.NE-MKNVYLKGA----------------------------------TVLRPDL---------
Q46JN7_PROMT/12-125Q..I-PKNPYLGKA----------------------------------KNLRPDR---------
Q2IMD0_ANADE/1-113R...-.NHVYLRGA----------------------------------QALRPDL---------
F8F3G9_TRECH/9-121H..K-PEHVYIHGA----------------------------------EQLRPDL---------
A5I2T1_CLOBH/1-119IEEN-IEYVYLGRA----------------------------------KTLRKDL---------
D7B1Z6_NOCDD/4-118R.AD-VQHVYLGGA----------------------------------ACLREDL---------
N0AVJ3_9BACI/2-118Q.EE-IIHTYLDGA----------------------------------EVLRPDL---------
C7PVY7_CATAD/3-118K.NE-IQHVYLGGA----------------------------------AALRRDI---------
D2R2P9_PIRSD/3-118Q.SE-IQHVYIKEA----------------------------------VRLRPDL---------
B9KXC3_THERP/4-118P.RE-IRHVYLRGA----------------------------------RVLRPE.---------
K9S6J5_9CYAN/5-121D.AP-IYHPYLRDA----------------------------------QTLRPDL---------
C8WX62_ALIAD/3-119Q.DE-LVHVYLGEA----------------------------------VQLRPDI---------
Q8DHZ0_THEEB/10-126D.QP-IYHAYLRHA----------------------------------QSLRPDL---------
R5SBB9_9GAMM/4-116F..V-PEFVYLDGA----------------------------------DVLRK..---------
Q31LX4_SYNE7/5-121Q.PP-IEHPYLRGA----------------------------------QVLRPDW---------
F0RVW8_SPHGB/7-120H...-TKPVFLDGA----------------------------------ERLRPDL---------
H2J7F9_MARPK/3-112N...-..FVYLHKA----------------------------------KDLRKDI---------
F8I591_SULAT/2-117P.RE-IRHVYLEGA----------------------------------VVLREDL---------
C9R7W9_AMMDK/6-121Q.EE-IKHLYLREA----------------------------------AVLRPDL---------
G8LU69_CLOCD/2-117N.DE-IKHIYLNNA----------------------------------KVLRPDI---------
Q7U527_SYNPX/9-123Q..S-PQHPYLGEA----------------------------------SRLRPDR---------
Q5WGS6_BACSK/2-118Q.EE-IKHVFLEGA----------------------------------IVLRPDL---------
Q0AX52_SYNWW/3-118Q.QE-IKHIYLKAA----------------------------------RSLRRDL---------
Q111X4_TRIEI/5-122NPKK-IVHTYLREA----------------------------------KNLRPDL---------
D1BHJ1_SANKS/3-118R.RD-VQHVYLHGA----------------------------------TTLRKDL---------
F4CLD4_PSEUX/3-118R.AD-LRHVYLRGA----------------------------------AALRTDL---------
K9P5T4_CYAGP/7-122R..E-VVHPYLREA----------------------------------ARLRPDR---------
F2JS36_CELLD/4-119K.KT-VKHQYLRKA----------------------------------TNLRPDL---------
B1I403_DESAP/4-119Q.NE-IKHVYLGRT----------------------------------AALRPDL---------
R5HIX2_9SPIR/3-116F..T-PEFVYLKGA----------------------------------STLRS..---------
B1XKN9_SYNP2/5-121Q.AE-IYHSYLRHA----------------------------------QNLRPDW---------
U5QIX8_9CYAN/5-122Q.QA-IHHVYLRGA----------------------------------QHLRPDR---------
A8MFE5_ALKOO/4-119K.KD-VAHVYLKEA----------------------------------EKLRPDL---------
H9UJ60_SPIAZ/18-131H..A-PQSVYLGGA----------------------------------RVLRSD.---------
A4J3M7_DESRM/4-119Q.KD-MKHVYLRNA----------------------------------ACLRPDL---------
R6H0E7_9FIRM/1-112V...-..PVYLYET----------------------------------KKLRSDL---------
R7JF35_9FUSO/4-115F..K-PKFVYLKGA----------------------------------SILR...---------
B7JUB1_CYAP8/5-121Q.KE-IHHSYLRGA----------------------------------YNLRPDL---------
Q7V0S3_PROMP/13-126Q..T-VNHPYLRCA----------------------------------SKLRADR---------
J7IMU5_DESMD/2-117Q.KE-IRHIFLRNA----------------------------------VKLRKDL---------
E8MZ77_ANATU/3-119Q.NA-VRHVYLRGA----------------------------------VTLRPEY---------
D1A6X0_THECD/3-118R.SQ-IQHVYLRGA----------------------------------VALRLDI---------
F6DT67_DESRL/5-120Q.SE-IKHVYLGRA----------------------------------VQLRPDL---------
D1C4Y7_SPHTD/4-119P.SE-IRHVYLRRA----------------------------------RELRPEW---------
D2Q4I1_KRIFD/3-118R.DK-IQHVYLHGA----------------------------------VALRPDL---------
D6XV93_BACIE/3-119Q.EE-INHVYLKEA----------------------------------VKLRPDL---------
G2P0K8_STRVO/3-118K.SE-IAHVYLGAA----------------------------------AALRKDI---------
B1W219_STRGG/3-118R.AE-ISHVYLGAT----------------------------------AALRKDI---------
Q2JA61_FRASC/1-116R.PP-IRHVYLRGA----------------------------------SALRPDL---------
A9AX92_HERA2/4-119P.SE-IIHCYLGDA----------------------------------AKLRPER---------
M1E6Z4_9FIRM/12-124K.NQ-IRHIFLNEA----------------------------------SKLRPDL---------
E3E4U5_PAEPS/4-119Q.RE-MKHVYLNGA----------------------------------QMLRPDL---------
K9VZM5_9CYAN/5-121Q.TQ-IYHPYLRQA----------------------------------KNLRPDW---------
A5UVT5_ROSS1/5-120A.EE-IVHVYIRGA----------------------------------HTLRPDR---------
Q7UMM1_RHOBA/20-135Q.SE-IQHVYIRDA----------------------------------VKLRPDL---------
D7CP86_SYNLT/4-119I.QD-VRHVYLRGA----------------------------------KCLRTDI---------
F2F6T7_SOLSS/2-118Q.KE-IHHVYLEDA----------------------------------VKLRPDL---------
Q7NH32_GLOVI/5-122Q.PE-IQHVYLRGA----------------------------------RGLRPDR---------
F0SYU7_SYNGF/1-118L.KQ-IKHIYLKRA----------------------------------EKLRPDL---------
X5A2M2_9BACL/4-119Q.RE-IRHVYLNEA----------------------------------QKLRPDL---------
R7K6Y0_9FIRM/1-115TIKD-ARHIYLKGA----------------------------------INLRSDL---------
K9XQ97_STAC7/22-138Q.TA-LQPVYLRDA----------------------------------ALLRPDL---------
U5LCX2_9BACI/2-118Q.QE-ISHVYLGGA----------------------------------VVLRPDL---------
B0JXC5_MICAN/8-124Q.GE-MQHVYLQGA----------------------------------KNLRPDW---------
W0RHY8_9BACT/15-129R...-LRPVYLREA----------------------------------RALRPDL---------
R7XX76_9ACTN/4-118R.AD-ITHVYLHGA----------------------------------ANLRRDL---------
D5SYS0_PLAL2/3-119P.SE-IVHVYLGEA----------------------------------KKLRPDI---------
D4ZWJ7_ARTPN/5-121K.TQ-VHHPYLRGA----------------------------------KNLRPDW---------
K0J2K9_AMPXN/4-120Q.ED-IHHIYHNDA----------------------------------RKLRPDL---------
E6TZG3_BACCJ/3-119Q.HE-VQHIYLEKA----------------------------------IQLRPDL---------
Q2RIT3_MOOTA/23-135P...-.VHVYLGRA----------------------------------SQLRPDL---------
K9XAN9_9CHRO/5-121H.TQ-IYHTYLRGA----------------------------------KSLRPDW---------
A5D1S9_PELTS/6-121Q.KE-LKHVYLKGA----------------------------------ACLREDL---------
W5WDH3_9PSEU/3-118R.AE-IKHAYLRGA----------------------------------AALRTDL---------
C7LZX3_ACIFD/3-118R.SA-FHHVYLHGA----------------------------------VGLRDDL---------
B7KJL4_CYAP7/5-121Q.AE-MFHPYLRQA----------------------------------KNLRPDW---------
D3F1J6_CONWI/5-117H..V-SSHVYLRGA----------------------------------RVLRTDL---------
Q73MK6_TREDE/7-119K..K-PIHIYMGGA----------------------------------EVLRPDL---------
R5WFK2_9DELT/1-111V...-..HCYIGEA----------------------------------KKLRPDI---------
Q3AAT3_CARHZ/3-116E..N-VKHVYLKGA----------------------------------AKLREDL---------
V5WHX3_9SPIO/12-129Q..P-AKPVYLYGA----------------------------------EVLRKDM---------
I0JNA3_HALH3/2-118Q.HH-IKHIYHYEA----------------------------------KQLRPDL---------
C9LUS3_SELS3/1-117Q.SE-IRHIYLGGA----------------------------------ISLRPDL---------
B0C4Y7_ACAM1/10-126N.QA-IHHIYQRGA----------------------------------RHLRPDW---------
Q8Y5X7_LISMO/1-118L.GA-INHVYLRGA----------------------------------KVLRPDL---------
K4LIL4_THEPS/9-124Q.ED-VKHVYLGDA----------------------------------VALRPDL---------
R7MA55_9CLOT/4-117F..N-PQFVYLKDA----------------------------------EKLRK..---------
B7GHQ4_ANOFW/20-136Q.QD-IHHIYLRGA----------------------------------VQLRPDL---------
I2F6C9_9BACT/1-111N...-..FVYLRRA----------------------------------KNLRPDK---------
G8QW62_SPHPG/6-120EMEK-VVPVYTEGA----------------------------------EKLRPDL---------
K9YKF5_CYASC/7-123A.NE-IYHPYLRKA----------------------------------QNLRPDW---------
E4RLQ8_HALHG/2-116K.QD-VKHQYLKKA----------------------------------EKLRPDL---------
F4GK06_SPHCD/7-122R..H-GENVYMDGA----------------------------------RVLRPEF---------
R6MS35_9FIRM/2-117N.KD-MVHAYLRGA----------------------------------TVLRPDL---------
H6NAH5_9BACL/3-119Q.DE-IVHVYLREA----------------------------------MRLRPDL---------
F3ZZ30_MAHA5/3-118Q.KD-IVHIYLRDA----------------------------------KQLRPDL---------
W0E964_9FIRM/2-117Q.DE-VRHIYLRKA----------------------------------VQLRQDL---------
Q2JKJ5_SYNJB/5-121Q.AD-MQHVYLRGA----------------------------------RELRPDL---------
K9TFG9_9CYAN/5-121H.TA-IYHPYLRHA----------------------------------KNLRPDL---------
Q8EQB8_OCEIH/3-119Q.QE-INHVFHNNA----------------------------------VKLRPDL---------
K8GP50_9CYAN/5-121H.VE-IYHPYLRQA----------------------------------RDLRPDW---------
A6WCP4_KINRD/9-124R.SE-VKHVYLNGA----------------------------------QALRRDI---------
Q7VB04_PROMA/3-118Q..M-PRHTYLGEA----------------------------------SMLRPDR---------
K9VM04_9CYAN/10-125T..E-IYHPYLRGA----------------------------------QNLRPDR---------

PF09663

C1E9U0_MICCC/10-395SVRG.RRTTMLSDSDIHATR.HARAAVGGVVAAAVGDCRVYVSGGA..EHQGPDGGGPVCVISR
J9SHA9_9ACTN/6-341TIRG.LRHTMLTDSDINATR.HARAAVGALTAAVKGDGAVYVSGGA..EHQGRPGGGSVTVVY.
B9K1J2_AGRVS/8-348TVRG.KRHTMLEDSDISGTR.HARAFVGGVLAGVFGETDLYVSGGA..EHQGPPGGGPVAIIVE
A8IKD2_AZOC5/5-352RIRG.KRHTMLDDSDISPTR.HARAFVAGALAGVVGHTEIYVSGGG..EHQGPDGGGPVAVIAA
B0UET5_METS4/6-361AIRG.RRHTMLTDSDIAPTR.HARGFVAGALAGLVGATDLFVSGGA..EFQGPDGGGPVAVIAR
F8I3U1_SULAT/1-336SLRG.FRHTMRTDDDISETR.YARCVIGSVLAGFMQSPFIYVSTRA..EHHGPPGGGPVALIL.
C0ZV96_RHOE4/6-366TVRG.RRNAMLDDSDVHWHR.QIKSCVGGVTAAVTGDPAVFVSVSA..AHQGPEGGGPVAAIVD
F4CUJ4_PSEUX/5-341SIRG.RRHTMLTDSDLSSTR.HARAAVGGLLAGLVGDSAIYVSGGA..EHQGPPGGGPVTVVYR
E3JD18_FRASU/20-386VLRG.QHITALDDHEAHHV...AKAVGGALVVSITGQPMSFISGGERNSHMGPPGGNPVAAVVR
A4Z1C9_BRASO/9-368KVRG.LRHTMLDDSDVSSTR.HARAFVGGALAGLFGFTDLFVSGGA..EHQGPDGGGPVAIIVE
M2ZZ64_PSEFD/32-379MVAGTYRHTMLTDSDLHSTR.HARAAVGGLIAGVTGDCHIYVSGGA..EGQGPKGGGPVCVVAR
D6Y348_THEBD/6-366RVRG.RRNIMLDDSDVHWHR.QIKAAVGGVAASVTGDPAVFVSVAA..VHQGPAGGGPVIAIVD
K9XGJ2_9CHRO/4-340FILG.RRHTMLDDSDINHTR.MARAVVAAVAASVVQDPMVYVSGGS..EHQGPPGGGPVAAIA.
B1M816_METRJ/6-365LIRG.RRHIMNDDSDINATR.HARALVGGVAAAAIGRTDLFVSGGA..EHQGPDGGGPVAVIAR
A8ICF8_AZOC5/4-365RLRG.RRTTMLSDADIHYER.HARAAVGAVIASVTGDPAIFVSGGT..EHQCAPGAAPIAAIVR
Q89E06_BRADU/7-367SVRG.FRHTMLEDTDISSTR.HARAAVGGLIAGLAGTGAVYVSGGA..EHQGPAGGGPVAVIAR
A1SPN2_NOCSJ/6-368RVRG.RRNIMLDDSDVAWHR.QIKACVGGVVAAVSGDPMNFVSVAA..VHQGPSGGGPVIAIVD
Q2RGM7_MOOTA/5-366TVRG.RRNTMLDDSDINHTR.SARAVVNAVIASVVGDPMVYVSGGA..EHQGPDGGGPIAVIAR
C6D0D9_PAESJ/5-353YIRG.QRHTMLDDSDINHTR.HARAVVGGVLASVCGDPMIYVSGGA..EHQGPAGGGPVAVVFR
F9ZUK7_ACICS/4-358TVRG.RRHTMWTDGDISDMR.YSRCVVSSLLAGILGESAVYVSTRA..EHQGPLGGGPVAIIAR
K0CBY7_ALCDB/4-356LIRG.HRHIMWDDSDINATR.HARALVGGVLAGRTGHTALFVSGGA..EHQGPDGGGPLAVITR
K9XGD2_9CHRO/13-373AVGD.RRHTMHSDFLAGYAGIMAKAVANAIVASVVGDTMILASAGN..EHQGARGSNLVAAIVD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window