Sequence alignment for CL0536

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511----------------------------AGGFSQRLPNASALGKIFTALPL..................GEPLYQM...L
H0Z730_TAEGU/55-450----------------------------......RDFSFDDCGRAFTCLPA...............EDPGAPAEALVCNL
H2V794_TAKRU/111-514----------------------------AGGFSQRLPIASALGKIFAAVPL..................GDPLYQM...L
FUK_MOUSE/97-496----------------------------......RDFPFDDCGRAFTCLPV...............ENPQAPVEALVCNL
H2XT72_CIOIN/112-517----------------------------AGGYSQRLLIASALGKVFTSVPL..................NEPLYQT...L
H2UFX8_TAKRU/97-498----------------------------......RDFPWSSCSRAFCWLAV...............ENPDQSIHAPVCCV
W5P4P4_SHEEP/97-496----------------------------......RDFPFDDCGRAFTCLPV...............ENPQAPVEAVVCNL
U9SUG9_RHIID/114-546----------------------------AGGYSTRLPHVSILGKLFMKVPI...............SSDSTRERDWVELF
U3JEG4_FICAL/32-445----------------------------SGGHSQRLPSASALGKIFTALPL..................GPPVLQM...L
B3RXN8_TRIAD/106-509----------------------------AGGYSQRLPSASVLGKIFTALPF..................GNPLYQM...I
F7G1T1_ORNAN/113-528----------------------------SGGYSQRLPNASALGKIFTALP...................GDPIFQM...L
T1J558_STRMM/188-601----------------------------......RDYPFDPFGKTFISLPKTVTK....SNKYIEPAGLVTNLEELYCLV
I3J111_ORENI/111-518----------------------------AGGFSQRLPSASALGKIFMAVPL..................GDPIFQM...L
W4YPG4_STRPU/114-532----------------------------AGGYSQRLPSASLLGKIFTAVPY..................GRPIYQM...L
H9GU62_ANOCA/113-530----------------------------SGGYSQRLPNASALGKIFTALPF..................GDVVYQM...L
T1JC87_STRMM/128-547----------------------------AGGSSQRLPTASVLGKLFTPLPI..................GDPIYQM...L
G3TX92_LOXAF/97-494----------------------------......RDFPFDDCGRAFICLPV...............ENPQAPVEAVVCNL
R7BGP0_9FIRM/113-501----------------------------SGGDSKRIPQYSVCGKLFSPVPR...............QLPDGRMSTL...F
F1RBS0_DANRE/70-468----------------------------AGGFSQRLPNASALGKIFTAFPL..................GNPLYQM...L
F7C0H8_XENTR/114-520----------------------------AGGYSQRLPSASALGKIFTALPL..................GEPTYQM...L
I1NCN7_SOYBN/120-518----------------------------AGGDSKRVPWANPMGKVFLPLPY............LASDDPDGPVPLL...F
H3CAG6_TETNG/98-496----------------------------......RDFPWSSCSRAFCWLPL...............ESADQSVHAPLCCL
M0ZH48_SOLTU/137-535----------------------------AGGDSKRVPWANPMGKVFLPLPY............LAADDQDGPVPLL...F
F0ZSJ1_DICPU/37-438----------------------------.GGIHQHAPLVNLCTKSFSMLPL.........NNKFVGDSPVYPIDILLSNL
R5IAV3_9FIRM/116-510----------------------------SGGDSKRVPQYSVCGKLFSPVPR...............ELPDGRPSTL...F
D7FJB1_ECTSI/126-593----------------------------SGGDSQRSPTQCVCGKAWSALNS.........CGDSGSGRCNTPMDLL...L
T1FYY1_HELRO/80-485----------------------------AGGFSQRMPTMAALGKIFMSLPF..................GSPVWQI...F
G3NYZ9_GASAC/98-501----------------------------......RDFPWSSCSRAFCWVPA..............PEEPNCRVQAPVCCV
G3UP39_MELGA/32-450----------------------------SGGYSQRLPNASALGKIFTALPF..................GDPVYQM...L
FPGT_HUMAN/114-533----------------------------SGGYSQRLPNASALGKIFTALPL..................GNPIYQM...L
C3XWJ9_BRAFL/92-524----------------------------AGGYSQRLPSASVLGKVFLATPV..................GSPMWQM...L
F0SXR2_SYNGF/113-494----------------------------SGGDSKRVPQYSACGKLFSPVPR...............LLPNGKRSAI...F
K0T387_THAOC/108-580----------------------------AGGESSRCPTQIVLGKAWTSLPV.........VDKMACTGVTNPTSIL...I
H9G685_ANOCA/97-505----------------------------......RDFSFDDCSRAFTCLPL...............EDPSAPVEALTCNL
I1P6V0_ORYGL/150-552----------------------------AGGDSKRVPWANPMGKAFLPLPY............LAGDNPDGPVPLL...F
FKGP_ARATH/131-529----------------------------AGGDSKRVPWANPMGKVFLPLPY............LAADDPDGPVPLL...F
G3VJJ9_SARHA/106-523----------------------------SGGYSQRLPNASALGKIFMALPL..................GYPIYQM...L
A9TP04_PHYPA/132-540----------------------------.GGDSKRVPWANPIGKAFIPLPF............LAGDEPDGPILTL...F
Q02BJ1_SOLUE/128-518----------------------------AGGDSRRLPQYSLSGKLFSAVPV...............TTPWGEASTV...F
D7UCW9_VITVI/146-545----------------------------AGGDSKRVPWANPMGKVFLPLPY............LAADDPDGPVPLL...F
W5M6I6_LEPOC/116-528----------------------------AGGYSQRLPSASALGKIFTALPL..................GEPLYQM...L
E9PSM4_RAT/106-522----------------------------SGGYSQRLPNASALGKIFTALPL..................GEPIYQM...L
M0RP18_MUSAM/153-575----------------------------AGGDSKRVPWANPMGKVFLPLPY............LAADNPDGPVPLL...F
F0ZWK1_DICPU/160-551----------------------------AGGYSKRLPNHSSTGKIFASIPY..............TLESGFKACSM...L
D4M6A5_9FIRM/114-496----------------------------SGGDSKRVPQYSAIGKLFSPVPR...............ELPDGRSSTL...F
U5D0Y7_AMBTC/152-554----------------------------AGGDSKRVPWANPMGKVFLPLPY............LASDDPDGPVPLL...F
M4AF92_XIPMA/111-517----------------------------AGGFSQRMPSASALGKIFMPLPL..................GNPIYQM...L
V8P3W9_OPHHA/98-513----------------------------.GGYSQRLPNASALGKIFTALPC..................GDPIYQM...L
B9I905_POPTR/194-593----------------------------AGGDSKRVPWANPMGKIFLPLPF............LAADDPDGPVPLL...F
M3ZWZ0_XIPMA/97-496----------------------------......RDFPWSSCSRAFCWLPE...............EKPGQKVQAPVCVL
B7S4B1_PHATC/94-530----------------------------AGGESSRCPTQMILGKAWTSLPT....MSSVGSPGVATCRLQTPVHVW...L
Q54NH4_DICDI/127-556----------------------------AGGYSKRLPNHSTTGKIFASIPCTLGMGGNNNNNNDDEDESKLQACSM...L
H3ANF5_LATCH/114-531----------------------------AGGYSQRLPSASALGKIFTTLPL..................GDPVYQM...L
H2YSE9_CIOSA/106-502----------------------------AGGYSQRLLIASVLGKVFTSVPL..................NEPLYQL...L

PF16314

R6X3X4_9PORP/7-660.RHLLSEEIADLEKNGCTADNWENIKVASPFHAEHVCNVHFSGNVALGLFEKEF..TLPGGVKKHSGIRNATLHNCEIGD
Q5LHM9_BACFN/5-659YRRLTEDEVLQLKSQSCLADDWNKVAVAEEFTTEFVHHTRFSGEVKLGVFHSDF..ILPGGIKKHSGLRHVTLHNVTVGD
H1XPF7_9BACT/41-722FRNLTSREIEILVKHNNSAESWDRVLVTDHFNPNLVKNCEFWGLVRIGDLQSGY..LAYHKLRLPVGLYNSTIISCDLGD
R5GF65_9PORP/2-659.RTLTRSEVAVLEKNNCRSEQWELVKVAETFDPESCRDVQFSGSCQIGDLSGSR..VNEYGIAVQNGIRSASISECKIGN
E4T878_PALPW/4-655YRPLLDKEIATLTVYGCSAENWKEVQVTEEFSPSYFYNVHFSGTVFLGNYTEVF..ELAGGIKKHAGIYNCHLHNCTIGN
F3ZTN4_9BACE/4-657YRKLLTKEIDALKQQGCQSSNWDIIEVHPLFNAKNVHRVTFMGNIKLGLLEGTF..QLPGGVTQQSMIKDATLHNCEIGD
R5PLK0_9BACT/5-659YRPLTQEEIITLKKQNCTATDWNHIKVAPHFTTDYISNVRFSGDIYLGEFSQSF..HLDGGLCKHSGIYYATLHNCRIGN
Q7MTP4_PORGI/8-662YRHLTEEEISVLEGNYCQCADWTMVEVADGFDANRCLHVMFSGQIRIGSTRGSH..LLPGGLHVPTGINIARLHNCIVGD
R5VAS6_9BACT/7-661YRNLSPKEILALQQQYCTSDDWNRIKVAEDFTPEHICHVRFSGDIYLGKFQDSF..TLAGGLVKHSGLFHVTLHNCCVGN
F9ZCM7_ODOSD/4-657.RNLTQEEITRLQAQGCSSTDWQRVKVASGFKTDYIQNVRFSGDIELGIFDYEF..ILEGGLPRHAGLFNVTLHNCRVGN
R5I224_9BACT/5-658YRQLTAEEISVLRTQGCWAEDWQHIYVSERFTPESIVRVNFYGVVRLGAFSGSI..ALPGGLSIHSGIYDATLFNVNVDD
F4KKJ2_PORAD/2-657.RKLNTKEIKQLTEQGCQAQDWSLIRVHRYFDASRCQQVHFIGKCEIGDNRGGRPSEEEPSYVEPYRLAHAKLINCTIGD
A6LH30_PARD8/5-658.RNLRPDEIATLRSQACRADDWNQVWVPEVFDIEYVNHVRFSGVVKLGAFRKIF..TLPGGLVKHSGLRHVTLHNCTLGD
R5LL62_9SPIR/12-659FRKLKKKEIEFLKSHGCISQSWDKILI.KNVDLNRIKDVSFHGKIKIKELNGVV..NYHNKVKVIASITRAVLIDVIING
R6SVY6_9BACE/4-659YISLTAQQIAQLEAQSCRCEDWTNVLVDPEFDPEYIRNANFSGQIKLGAFRKIF..TLAGGIHKHSGIYHATLHNVVVGD
R5VUQ7_9BACE/5-659YRLLTKEEIARLEAQHCIASDWSGVEVADDFHTDYIHHTRFSGKVRLGVFEKEF..TLAGGMAKHSGVYYATLHNVTVGD
X5DE87_9BACT/9-663YRNLYDEEIGQLVHQGCSSSDWSLIKVSHDFIPDCIENSKFSGSVRLNSFAGSV..KLIGGINFKTGIYNAWLHNCEVGK
H1XNG4_9BACT/3-653FKSLSSAEINQLKEQGCRAEDWSAVLIHRETDLARIRFVTFKGKVAVGKLSDFI..EIEPGRVEECSLQNVTLDSTVIAD
R5IQU5_9PORP/5-659FRKLTIKEIDILKNQQCMSDDWSSIDVAKDFNPEHIFHTRFSGKIKMGVFEKSF..TLPGGFKKHSGLRHVSLHNCTLGN
C0R0B6_BRAHW/11-658FRNLTSEEINFLKSQGCSSQSWEKILI.KNVDLSRIKDVQFHGKIKINSLNGMV..KYHKKVKLLASINRATLINVYING

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511ELKLAMYVDFPS.HM.KPGMLVTCADDLE............LY......SASDS..IVFDKP...GFTALAHPSPLS.IG
H0Z730_TAEGU/55-450DSLLGTMTHRLCVGS.PPGVWVCSTDMLLTVPSTPGINWDGFQ......................GVRVIAVPGSPA.YA
H2V794_TAKRU/111-514EIKLALFVDFPS.RM.KPGVLVAAADCLE............LY......CVTEDDGALFDRH...GFTALAHPSSLI.TG
FUK_MOUSE/97-496DCLLDIMTHRLGPGS.PPGVWVCSTDMLLSVPPNPGISWDGFR......................GARVIAFPGSLA.YA
H2XT72_CIOIN/112-517ELKLASYIDFPK.KIKTGGVFVCCSDTFE............TY.........TDCNFDFSYFSIKGMTGLAHPSSIT.IG
H2UFX8_TAKRU/97-498DLLLNCLNHQVCPGS.PPGVWVCSTDMILTIPPDFVMSWEGFS......................GARALALPGDIS.YA
W5P4P4_SHEEP/97-496DCLLDIMSHRLGPGS.PPGVWVCSTDMLLSVPLDPEV............................PAQPCPERVPPA.YA
U9SUG9_RHIID/114-546DLKLIIYIELIK.HLKKGTVFLTSSDTIE............LM.......SINVKETSLQNT...SLVALAHPSTLH.IG
U3JEG4_FICAL/32-445ELKLAMYLDFPR.HM.APGVLVTCSDDIE............LY......STAATESITFDKP...GFTALAHPSELA.VG
B3RXN8_TRIAD/106-509EAKLMMYIDFPS.RM.KAGVFVTCADDIE............LF........TIDGNWDFYQP...GFTALGHPSPLK.IG
F7G1T1_ORNAN/113-528ELKLAMYIDFPGPHE.IPEFLVTXADDIE............LY......DTGKTEFIKFEKP...GFTALAHPSDL..IG
T1J558_STRMM/188-601SEIAVNY.........SHGVWVCSTEMLLTGELRHPLRLPANC......................DVVLFSTLEIAD.YA
I3J111_ORENI/111-518ELKLAMYVDFPS.QM.KPGVLVTCADDIE............LY......SIAEEESVKFDKP...GFTALAHPSPLS.VG
W4YPG4_STRPU/114-532ELILAMYIDLPA.HMPSGGIFLACSDVII............LY......DCTVGVEWSFDKP...GITAFGHPAPIA.VG
H9GU62_ANOCA/113-530DLKLAMYIDFPA.HM.NPGVLITCADDIE............LY......NTGKTEFIKFDQP...GFTALAHPSSLI.IG
T1JC87_STRMM/128-547DLKLALYLPFLK.RM.APGILVTCSDDIE............TFWLDDINKDSPDSIWSFEER...GFVALAHRSNVE.TG
G3TX92_LOXAF/97-494DCLLDIMTHRLGPGS.PPGVWVCSTDMLLSVPPNPGISWDGFR......................GARVIALPGSSA.YA
R7BGP0_9FIRM/113-501DEFLIAMAGIPG.RI.ESGMLTLSGDVML............LF.........NVLQLDLQYT...GAAAISIKESVD.TG
F1RBS0_DANRE/70-468ELKLAMYVDFPS.HM.KPGMLVTCSDDIE............LY......SIPDQEFVVFDKP...GFTALAHPSSLS.IG
F7C0H8_XENTR/114-520DLKLAMYIDFPR.NM.KPGVLVTCADDLE............LY......ASGDLA.VTFDRP...GITALAHPSTLT.IG
I1NCN7_SOYBN/120-518DHILAIASCARQAFGNQGGMLTMTGDVLP............CF.........DASLMTLPVD...TSCIITVPITLD.VA
H3CAG6_TETNG/98-496DLLLDRLGRQVCPGS.PPGVWVCSTDMILHIPPDFVLSWEGFS......................GVRVLALPGDVS.YA
M0ZH48_SOLTU/137-535DHILAIASCARQAFENEGGMLTMTGDVLP............CF.........DASTMVMPKD...ASCIVTVPITLD.VA
F0ZSJ1_DICPU/37-438NVILPHA.........QPGFMVCSTESLI............FL......DLNDKNLNSPSSWQKPGVSVITMDVGPD.YY
R5IAV3_9FIRM/116-510DEFLIGMAGVPS.RF.REGMLVLSGDVLL............LF.........NPLQIDAQFH...GAAAISMKSPVE.IG
D7FJB1_ECTSI/126-593EHLSRLFSGGSSGSLEPGTLVVTACDVMLLVPPEVAATADWSF..............DQQSGAAGGVAGLAIAADAAKYA
T1FYY1_HELRO/80-485DLKLACYLPFLQ.NM.NPGYFQASSDTIE............VF.NEAILENCEVLQYSFKNE...GLTALAHPSTVN.IG
G3NYZ9_GASAC/98-501DLLLDRLSTNICPGS.PPGVWVCSTDMILNIPPDFTLSWNGFS......................GVRVLALPGDAS.YA
G3UP39_MELGA/32-450ELKLAMYIDFPS.HM.KPGILITCSDDIE............LY......STGPTETIRFDKP...GFTALAHPSDLT.VG
FPGT_HUMAN/114-533ELKLAMYIDFPL.NM.NPGILVTCADDIE............LY......SIGEFEFIRFDKP...GFTALAHPSSLT.IG
C3XWJ9_BRAFL/92-524ELKLALYMDFPQ.RM.KPGVFLCSSDTVE............TF......ECPPRANWFFTQD...GFTALAHPSPVS.IG
F0SXR2_SYNGF/113-494DELIISLSGIPG.RM.NSGLLVIPGDTVI............VF.........NPLQLDLKSA...DSAALSIKTSVT.EG
K0T387_THAOC/108-580SGLSEVFADVP.....RGSVIVAASDVLL...........LFRSVGDDASSKKCEVINFDQVDHCKVLGLSVPAPLS.TA
H9G685_ANOCA/97-505DNLLATLTCQICKGS.PPGVWVCSTDMLLTVPSVPKIDWHGFT......................GARVVAMPGSFS.YA
I1P6V0_ORYGL/150-552DHILAISSSARQAFKNQGGIFIMTGDVLP............CF.........DASNLVLPDD...AACIVTVPTTLD.VA
FKGP_ARATH/131-529DHILAIASCARQAFQDQGGLFIMTGDVLP............CF.........DAFKMTLPED...AASIVTVPITLD.IA
G3VJJ9_SARHA/106-523ELKLAMYVDFPS.HM.SPGILVTCADDIE............LY......SVPDDTPLRFDKP...GFTALAHPSDLA.VG
A9TP04_PHYPA/132-540DHILAISAGVLQSFSNKGGLLIMTGDVLP............CF.........DASSMTLPEN...GAIVITVPAPLS.RA
Q02BJ1_SOLUE/128-518DEMMALSTAWVE.RL.SSGLVVGSGDVIL............TF.........DAAEVDWSRA...GVSGVAMLQPAV.TG
D7UCW9_VITVI/146-545DHILAISCCARQAFKNEGGIFIMTGDVLP............CF.........DASTMVLPED...TSCIITVPLTLD.IA
W5M6I6_LEPOC/116-528ELKLAMYIDFPS.RM.QPGVLVTCADDIE............LY......SVKGGGAVAFDRA...GFTALAHPSTLS.TG
E9PSM4_RAT/106-522ELKLAMYVDFPS.HM.KPGVLVTCADDIE............LY......SVGDCQYIAFDQP...GFTALAHPSSLA.VG
M0RP18_MUSAM/153-575DHILAISSSARQAFKNKGGILIMTGDVLP............CF.........DASTMILPDD...SGCIITVPITLD.IA
F0ZWK1_DICPU/160-551EIKLIILIDIPK.RM.KPGVFLACSDDIE............LF.........ESKDISFDDPSHQGFIALSQPGTLD.IG
D4M6A5_9FIRM/114-496DEFIVGMSGVPS.RI.QEGMLVLSGDVLL............LF.........NPLQIDAQFD...GAAAISIKEPVA.TG
U5D0Y7_AMBTC/152-554DHVLAISSSAIQAFENKGGLLIMTGDVLP............CF.........DTSSMVLPDN...ASCIITVPITLD.VA
M4AF92_XIPMA/111-517ELKLAMYVDFPS.QM.KPGFLVTCADDIE............LY......SIPEGERVSFDKP...GFTALAHPSPLS.VG
V8P3W9_OPHHA/98-513DLKLAMYIDFLA.CM.NPGVLITCADDIE............FY......NIDATELLRFNQP...GFTALAHPSSLS.IG
B9I905_POPTR/194-593DHILAIASCARQAFKNEGGILTMTGDVLP............CF.........DASTLVIPED...ASCIITVPITLD.VA
M3ZWZ0_XIPMA/97-496DLLLDRLSTQICPGS.PPGVWVCSTDMILSVPTHCVLSWEGFS......................GVRVLAVPGDVS.YA
B7S4B1_PHATC/94-530RICERLFRGIP.....NGSIVVLAADTLL....................RLPDSKFAIDWEAHADTVFGLAVPAPLA.TA
Q54NH4_DICDI/127-556EIKLIILIDIPK.RM.KPGVFLACSDDIE............LF.........ESNEMSFNSSEDGTFIALSQPGTLD.IG
H3ANF5_LATCH/114-531ELKLAMYIDFPV.HM.NPGVLVTCADDIE............LY......GIGETEFIQFDKP...GFTALAHPSSLH.IG
H2YSE9_CIOSA/106-502ELKLASYIDFPR.KIERGGVFVYNTKRF.............FI......................GVTGLAHPSSVT.IG

PF16314

R6X3X4_9PORP/7-660NTLIENVHNYISNYFIGDDCFIQNVNVMYVEGRSSFGNNVE...........VSVLNETGGREVPIYNGLSASLAYLIAL
Q5LHM9_BACFN/5-659NCCIENIQNYIANYEIGNNTFIENVDIILVDGLTQFGNGVE...........TAVLNETGGREVLINDKLSAHQAYILAL
H1XPF7_9BACT/41-722NVVVRNV.RYLSHYIIGHHTILFNLDEMITVDNAKFGNGIVKEGETEDVRIWIELANENGNRAILPFVGILPADAYIWSR
R5GF65_9PORP/2-659GVCIDHVHDVISRYDIGDNVTISNVNVVAMKGSSTFGIGVR...........ASVLNETGGMEVPISRDLTAQTAYMFTL
E4T878_PALPW/4-655NVFIDKINNYIANYEIGDGTYIENVNLILTEGESSFGNGIK...........IPVMIEAGGREIPVFDQLSAPLAYMMAF
F3ZTN4_9BACE/4-657GVYIDRVHNYIANYKIEDGTYIQNVNCIYVEGNSSFGNGTC...........VAVMNEQGGREVIIYDYLNAHFAYILTF
R5PLK0_9BACT/5-659NVLIENIPNYIANYTIGDDCFIQNVNLIVVEQKSSFGNGTP...........VSVLNETGGREVPIFNELSAHLAYIIAL
Q7MTP4_PORGI/8-662EVVIFHVNSYLANYRIGDYTRIENIDTIAVTESTSFGNGVE...........VTVLNETGGREVTITDNLTAQTAYLMAM
R5VAS6_9BACT/7-661NVLIENIQNYIANYEIGDNSFIQNVNLIVTEGKSSFGNGVL...........VSVLNETGGREVPIFNDLSAHLAYIVAL
F9ZCM7_ODOSD/4-657NVLIENIPNYIANYRIGENCFIQNANLIVTEGRSSFGNGTL...........VAVLNETGGREVPIFNELSAHLAYIIAL
R5I224_9BACT/5-658DALITHIHGYIANYDIGPRVYICDVGKIYMEGVPSFGIGTR...........VNVLPETGGREVAIHEELSAQTAYLSAM
F4KKJ2_PORAD/2-657RVIIDGVRDCISHYDIGDDVVIHDIATLKVMGETSFGNGTL...........VEVLNETGGREVPICDILTAQTAYMLAM
A6LH30_PARD8/5-658NVLIENVQNYIANYQIGDDCFIQNINVMLVEGKATFGNNVE...........VSVLNETGGREVPIYDGLSASLAYIIAL
R5LL62_9SPIR/12-659DVYINNVGRFIANYEIENGVIIENAGSIYMEGKSSFGNGVE...........TSPIMEGNGRSVKIFNRLNSHIAYIVAM
R6SVY6_9BACE/4-659DCMIEHVRNYIANYVIGRGSYLENVTDLITYGETTFGNGIK...........IKVLNETGGREVAIHDHLSSHEAYISAL
R5VUQ7_9BACE/5-659NCYIENVKNYIANYEIGHDTFIENVDIILVDCHSRFGNGVE...........VSVLNETGGREVIIHDRLSAHQAYIMAL
X5DE87_9BACT/9-663NALIHNVRSYIANYRIEENVVIHNITTLAVDGETSFGNGVV...........VEAINEGGGREIPIYDYLSTHVAYMMAL
H1XNG4_9BACT/3-653EVYLNDV.GLIKNYAIGDGAAIEQVKLLSATGKTTFGNGVR...........IEALNEGGGREMIIFDQLSAQIAYLQTL
R5IQU5_9PORP/5-659NVLIENVSNYIANYSIGNDTFIQNVNVILVDGKSTFGNGTE...........VSVLNETGGREVPIYNKMSAHLAYIIAM
C0R0B6_BRAHW/11-658NVYINNVGRFIENYKIENGVIIENAGSIYMEGKSSFGNGVE...........TSPIMEGNGRSVKIFYRLNSHIAYLVSM

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511TTHGVFVLEPA........DSSSVR.DLEYRTCFQFLHKPSVERMRKC.GAVLKKA.................DREFVYT
H0Z730_TAEGU/55-450RNHGVYLTNEQ...................GLVRDIIYKGTEAQIQ...QCAGPD....................GTVPL
H2V794_TAKRU/111-514TTHGVFVLDPS........KRSADL.DVEKVGCLRFLHKPRIAEMRAN.GAVHSNC.............LSLPDTEFVYT
FUK_MOUSE/97-496LNHGVYLTDSQ...................GLVLDIYYQGTKAEIQ...RCVGPD....................GLVPL
H2XT72_CIOIN/112-517TTHGVYLLDHD............APVTSLIRSCKKFLHKPSAERMRATPGCVLTTASS.................EIVLT
H2UFX8_TAKRU/97-498LSHGVYLSDKQ...................GHVRDIIYRGTEDQLR...PALMPD....................GKVPL
W5P4P4_SHEEP/97-496RSHGVYLTDSE...................GFVLDIYYQGTEAEIQRW...........................GRGAL
U9SUG9_RHIID/114-546STHGVYKIQDDFNQCQNDIKKQPKDRECLIKLCKEYLHKPSIEIMRFHKEIIHLDNNGN................EFVYT
U3JEG4_FICAL/32-445TAHGVFVLEPS........SLSGKG.GLHYGSCRRFLHKPDLQTMRQS.GAVCLRGAGPQPGCPGSPGG.....SQCVYT
B3RXN8_TRIAD/106-509TTHGVFVLNAE.......DNKSDSEFSVQSAKCRRFLHKPSIEVMHRE.GAVVDA....................DTVFT
F7G1T1_ORNAN/113-528TSHGVFVLEHS........DVSEYA.DLEYQTCNLYLHKPTVEEMHRS.RAVYGKRYVPQGEASAYSRLSDDLFSEYVFT
T1J558_STRMM/188-601AQHGTIKIRND...................NSVASIIYLGSSDELQ...QLSQDG....................KNVPV
I3J111_ORENI/111-518TTHGVFVLDPR........EKSSYS.EMETASCLHFLHKPSVDKMRGS.GAVCKQQSG............SFTDSEFVYT
W4YPG4_STRPU/114-532TTHGVFLYKDT..........PNVCSQVHIVECEEFLHKRSEDVLREK.GVLLPQPCQQTLGISE..........DHVLV
H9GU62_ANOCA/113-530TTHGVFVLEPP........LHETEKGELEYRFCHRFLHKPSIESMHQS.GAVYKKHNCLLHELPK.ELGNPTVDSEYVYT
T1JC87_STRMM/128-547ENHGVYVLPYA.........NFDLDAVVTFGGCLQVLQKPSAKTMDLK.GAIIEG....................FGVCT
G3TX92_LOXAF/97-494RNHGIYLSDSQ...................GFVLDIYYQGTEAEIQ...RCARPD....................GRVPL
R7BGP0_9FIRM/113-501KDHGVFLNDGN...................GYVKRFLHKQTKESLTNL.GAVNAQ....................GNVDL
F1RBS0_DANRE/70-468TTHGVFVLEPA........EVPTIS.DMQYRTCSQFLHKPTIERMRKS.NAICKRK.................EEEFVYT
F7C0H8_XENTR/114-520TTHGVFVLEAT........TSGYE..ELEYRQCKSYLHKPSVEKMRQS.GAVNILQS...........GDSMPDPEIVYT
I1NCN7_SOYBN/120-518ANHGVIVAAET..........EHSTQSYAVSLVDNLLQKPSVDELVKS.KAVLAD....................GRTLL
H3CAG6_TETNG/98-496LNHGVYLSDQQ...................GRVRDIVYKGREEQLV...PAVMPD....................GKVPL
M0ZH48_SOLTU/137-535SNHGVIVAAKS..........GISNDTYSINLVENLLQKPCLDELVRH.QAILDD....................GRTLL
F0ZSJ1_DICPU/37-438TNHGVCRLNEK...................DEILEIAYKRSAEYLSNN.GFISKE....................DKASI
R5IAV3_9FIRM/116-510KDHGVFLNNGN...................DYVKKFLHKQSIETLQQL.GAVNNH....................GNVDL
D7FJB1_ECTSI/126-593SNHGVYCLDGG........GGGGGQESHGITGVRKYLQKPSREEAEAS.GAFLNPGGMAAPKNESGNPNHDPSANPEVAI
T1FYY1_HELRO/80-485ESHGVFVVDDP....QEINNHSLNELCTTFINCSEVLQKPTLQNMEDK.KAILKLKDGE................VFVYT
G3NYZ9_GASAC/98-501ADHGVYLSDPQ...................GQVRDIIYRGTREQIQ...QAVMHD....................GKVPL
G3UP39_MELGA/32-450TTHGVFVLDPS........GLSGKG.GLEYTSCRRFLHKPDVETMRRC.GAVCVRRNSSQLDSFA.DHTDWEVDSECVYT
FPGT_HUMAN/114-533TTHGVFVLDPF........DDLKHR.DLEYRSCHRFLHKPSIEKMYQF.NAVCRPGNFCQQDFAGGDIADLKLDSDYVYT
C3XWJ9_BRAFL/92-524TGHGVFILDQS......DSVDGVPHDSVEMRECVQFIHKPTVEEMHAK.GAVLPQEASTVFLQNTNNAE......PLVYT
F0SXR2_SYNGF/113-494KDHGVFINGEN...................NLVSEFLHKQPESVLKAK.GAVNGE....................NQVDV
K0T387_THAOC/108-580KNHGVFVSDGT..........HCEGEGWNIQSTDKVLQKPSPDEMRSTANCTFSLDGGGKN..............QVAWI
H9G685_ANOCA/97-505KQHGVYLADGQ...................GFVQDIIYQGSEDQIQ...RCVGSD....................GKVPL
I1P6V0_ORYGL/150-552ANHGVVVAAKD..........GTDGENYSLCLVDNLLQKPTVHELVEG.QAIRDD....................GRALL
FKGP_ARATH/131-529SNHGVIVTSKS..........ESLAESYTVSLVNDLLQKPTVEDLVKK.DAILHD....................GRTLL
G3VJJ9_SARHA/106-523TTHGVFVLKPS........GGSESG.DLEYRTCHRFLHKPSLEEMYRS.GAVGTKASPSPKNLAAGDPSAPSAYSDFVYT
A9TP04_PHYPA/132-540SKHGVILGSQS............DKNTSTLPLVIDLLQKPSSKEMGKR.GAMLAD....................GTALL
Q02BJ1_SOLUE/128-518TQHGVYVTNDQ...................GRIYAFLQKPSLSELSAS.GGLLKN....................DQVAL
D7UCW9_VITVI/146-545SNHGVIVASKT..........GILNKTSYVSLVENLLQKPTMEELVKN.QAILDD....................GRTLL
W5M6I6_LEPOC/116-528TAHGVFVLEPA........EGTEPG.DLEYRSCRRFLHKPSVQEMHSS.GAVCSRAAG.....GTGTGGQWAGRPEFVYT
E9PSM4_RAT/106-522TTHGVFVLHSA........SSLQHG.DLEYRQCHRFLHKPTIENMHQF.NAVQRQGSFAQQDFPGGDTACLPLHTEYVYT
M0RP18_MUSAM/153-575ANHGVVVASSD..........GITNDDYSICLVENLLQKPTLTELTEG.HAILHD....................GRTLL
F0ZWK1_DICPU/160-551VGHGVFILDQL...........NQFKPNELNLCKKFIHKPSKEKMKLE.GAILDN....................GLVLV
D4M6A5_9FIRM/114-496KNHGVFLNDGH...................DYVKCFLHKQTEERLREM.GAVNKA....................GNVDL
U5D0Y7_AMBTC/152-554RNHGVVVTSTI........ENLEQNSGRELNLVENLLQKPSLKELEAN.NAIRQD....................GRTLL
M4AF92_XIPMA/111-517TTHGVFVLDPR........ERSSYP.EMENASCLYFLHKPSIDEMQDS.GAVCTNQNG..........LFSMSDSEFVYT
V8P3W9_OPHHA/98-513TTHGVFVLEPP........LHLIEK.ELEYRSCHLFLHKPSIAKMYQS.GAVHKRSDY..QTSPSGELGDSLMESEFVYT
B9I905_POPTR/194-593SNHGVIVASDT..........GILTESYTVSLVDNLLQKPSLEELVEN.EAILDD....................GRTLL
M3ZWZ0_XIPMA/97-496ADHGVYLSDSQ...................GRVRDIIYRGTREEIQ...RALMPD....................GKVPL
B7S4B1_PHATC/94-530SNHGVFVLPPMRTNAVPGASDQSSEPVIQVEPCHDVLQKPSQSTLQA..HCQFKQNGQ.................ACAWI
Q54NH4_DICDI/127-556VGHGVFILDDV...........NQYKPNQLNSCRKFIHKPSKEKMKNE.NAILSN....................GLVLM
H3ANF5_LATCH/114-531TTHGVFVLEPN........ADSGCQ.ELENRSCHRFLHKPSIEQMHQS.GAVCKTKQTCQGNFTEEHNIFLKFDSEFVYT
H2YSE9_CIOSA/106-502TTHGVYLLNHD............APVDTLIRSCKKFLHKPSAERMHATDGCVIRNGAE.................ELVLT

PF16314

R6X3X4_9PORP/7-660Y.RHRPALILRLQAMIADFAERQTGNYGFIGNHVKIINTGTVRNTVIADYATVENCTRLDNGTVNSNANAPVYIGDSVIA
Q5LHM9_BACFN/5-659Y.RHRPELISRMKEITDYYSNKHASAVGTIGNHVMILNTGSIKNVRIGDFCRICGTCRLYNGSINSNESAPVHIGHGVIC
H1XPF7_9BACT/41-722N.RADRKFQQKLKELTDKLGDTRRGYYGEVGDHCVIKNSRIIKNVNFGSYCYVKGANKLKNLTIQSSADEPSQIGEGVEL
R5GF65_9PORP/2-659IGRQDGTLRGSLIDLVDQEAREAESERGIIEESVSIRNCGSIVNAYIGAHAKVEGATFLENCSLCSSAEHLIEIGYNVMG
E4T878_PALPW/4-655Y.RHDKEAVNNLEHQISDYANSQKSDKGRIGKNVRIMNSDVIRNVRIDDFATIEGTLRLENGTISSNKQAPVYIGQGVQC
F3ZTN4_9BACE/4-657Y.RHRPLLISKLQDMVKKYSAYVSSTMGYIGKGVKIINTGSIKNVKVGDYTTIEGTQLLENGSINSNVHAPVHIGYGVVA
R5PLK0_9BACT/5-659Y.RHLPVLTEKLKRLIDRYTEKHSSETGSIGRGVTIVSSGSIRNVIIGDKCTIDGASRLKNGTINSNETAPVYIGHNVVA
Q7MTP4_PORGI/8-662Y.RHDKVLTESLAAMARAYAESRRSDMGAIGSHVVIHGCNTIENVCIGDYTEITGASHLCNGSINSKKEAPVSVGYNVVC
R5VAS6_9BACT/7-661Y.RHYPILTEKLVQFIDRYVETHSSEKGRIGKNVSIVSAGSIRNVMIGDHCTIDGTSRLKNGSINSNVLAPIYVGYNVVA
F9ZCM7_ODOSD/4-657Y.RHFPVLTERLKALIERYTEQVSSTEGKIGNHVRIINTGTIRNVCIGDYTTIEGTSRLKNGSINSNAEAPVFIGHNVMA
R5I224_9BACT/5-658Y.RHRPELTERLHAMADIRARAVASERGTIGPGARIENVGIIRNVRIGEAAVLQGCLRLFDGTVVSSTDAPVLIGSGVVC
F4KKJ2_PORAD/2-657Y.RHDKELQAALSTLVEKYTASVRSDRGTIGESSQIKHCGLMTNIKVGPHSSIIGASVLENGSVNSTVLSPTRIGYGVIC
A6LH30_PARD8/5-658Y.RHRPALIERLRDMITAYTEGIASTEGTVGDKVKIVNTGTIRNVKIGDYATIENSARLENGSVNSKREAPVFIGDSVIA
R5LL62_9SPIR/12-659Y.RHNFVMRKKINKIIDDYASSKLREFGTIKKHAKIINARLIKNALIDPYTTIENTDEINNTTIISAKESPSYIGTSVIL
R6SVY6_9BACE/4-659Y.RHKPALTEALDAMVERYAASVCAPFGVIGENVEILDAMHIVNVNVGAYCKIKGVSRLRNGSIISCKEDPVEIGMNVIA
R5VUQ7_9BACE/5-659Y.RHRPVLIDKMRKIIESYADAHASDTGTIGSHVMIVNAGYIKNVRIGDYCQIEGTGRLKNGSINSNEHAPVHIGYGVIC
X5DE87_9BACT/9-663Y.RHRPEVVRSLKTMVDDYTQYVRSEMGVIGADSNILNCNTILNVKTGPATIIDGAKKLHNGSINSNYEAPVKIGEGVIM
H1XNG4_9BACT/3-653Y.RHEPQLINALQKMIDQYVEEQKSSIGVIGNQARVLRCNQIVNVKIGACAVIRGAQSLENGTIQSEKAAPVLIGDGVIA
R5IQU5_9PORP/5-659Y.RHRPILIEKLKKMIDDYASEVSSETGYIGENVSIINTGTIKNVCIGDCCIINGTSKLENGTVNSNSTDPVTIGCNVMA
C0R0B6_BRAHW/11-658Y.RHEKIMREKINSMIDEYTKQKTRRFGKIKKYAKIINARLIKNSLIDPYATIENTDEINNTTVISTKECPSYIGTSVIL

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511DS.TYYVDYATMLTLLNLFK.DIRPLRCE..................................VDAYGDFLQSLGPGATV
H0Z730_TAEGU/55-450VCGIVFFSSDAAEQLLATHV..VPPLDACTYM........GLDSGA..PPIQ...........LSLFFDIVLCMAGGMTE
H2V794_TAKRU/111-514DS.TFYFDFQTSRSLLNLLK.ELEPLTCE..................................IDAYGDFLQALGPKATI
FUK_MOUSE/97-496VSGVVFFSVETAEHLLATHV..SPPLDACTYM........GLDSGA..QPVQ...........LSLFFDILLCMARNMSR
H2XT72_CIOIN/112-517DS.AFFMAPDVCNKLRLFYN.SHKPLTCE..................................IDAYGDFMQALGSESDN
H2UFX8_TAKRU/97-498VSGPVFFSSLVSEKLLRTHV..TPPLDGCTYL........GLDSGA..PPLQ...........VSLFLDVLKCLCSDVTQ
W5P4P4_SHEEP/97-496VSGVVFFSVETAECLLATHL..SPPLDACTYM........GLDSGAQHPPLSQ..........LSLFFDILLCMARNVQR
U9SUG9_RHIID/114-546DS.TYFFDYNTIKIFLEILD.EIQPLTYE..................................LEAWSDFLKT.......
U3JEG4_FICAL/32-445DS.VFYMDHGTARQLLLFYK.QMGSLCCE..................................IDAYGDFLQALGPGATP
B3RXN8_TRIAD/106-509DS.AYFMDRNTAKLLLKYYL.NHRPLQCE..................................IDAYGDFLQALGSEAND
F7G1T1_ORNAN/113-528DS.LYYMDHASAKKLLAFYQ.GLGTLNCE..................................IDAYGDFLQALGPKATI
T1J558_STRMM/188-601VSGIVFLSVPVAESLLSLHV..LAPLDCCTYL........GQDNGA..KPLQV..........VSLYFDILTTMTTEAIE
I3J111_ORENI/111-518DS.TYYVDFDTAKSLLNVLT.ELGPLSCE..................................IDAYGDFLQALGPKATI
W4YPG4_STRPU/114-532DS.GYFMDGETAKKMIEFYE.EKSPLSCE..................................IDSHGDFLHGLGNCGNN
H9GU62_ANOCA/113-530DS.LFYIDHSTAKLLLAFYK.QMGMLHCE..................................VDAYGDFLQALGPGATQ
T1JC87_STRMM/128-547DS.VFYFSKEIVSKLIGFYK.TIRPLECE..................................VDAYQDFLQALGTNANM
G3TX92_LOXAF/97-494VSGIVFFSVETAERLLATHV..SPPLDACTYM........GLDSGA..RPVQ...........LSLFFDIVLSMARNVSK
R7BGP0_9FIRM/113-501DTGAIMFDKNLLKALWGLIS.TDGMLDEDKFSSFVNERSR.......................VSFYGDFLYPLAKASTL
F1RBS0_DANRE/70-468DS.TYYIDHSTAMTLLHIFS.EISPLTCE..................................VDAYGDFLQALGRRASV
F7C0H8_XENTR/114-520DS.LFYMDHNTVGLLLGFFH.DSGGLSCE..................................IDAYGDFLQALGPDATA
I1NCN7_SOYBN/120-518DTGIIAVRGKAWLELVTLAC.SCQQMISELL.....................QSKKE......MSLYEDLVAAWVPAKHE
H3CAG6_TETNG/98-496VSGPVFFSSLVSEKLLLTHV..TPPLDGCTYL........GLDSGA..PPLQ...........ISLFLDVLKCLCSDVTQ
M0ZH48_SOLTU/137-535DTGIIAVRGQAWLNLVKLAC.SSQSMISELL.....................EKKKE......MSLYEDLVAAWVPAKHE
F0ZSJ1_DICPU/37-438YTGLVFFCQKTTEKLLYLHN..TPPLDSCTYL........GVDSGSQLLK.............FGVFPDILCAMTKHETL
R5IAV3_9FIRM/116-510DTGAVLFDVDLVNSLLSLIQ.TNGQIDEEKYARFVNDTSR.......................ISLYGDFLYPLAEDSTL
D7FJB1_ECTSI/126-593DSGVVVFSGAATRALTSLA.......HSETFKGCTSRGVAGGASAL..R..............LELYSDLLLALRTGGGT
T1FYY1_HELRO/80-485DS.CFYFDQKFAKKLLDFYE.LEKPLTCE..................................IDGYGDFMQSLGPNAST
G3NYZ9_GASAC/98-501VSGPVFFSRSISEKLLQAHV..TPPLDGCTYL........GLDSGA..PPLQ...........VSLFLDLLKCLCSDLTQ
G3UP39_MELGA/32-450DS.IFYIDHSTAKQLLAFYK.QIDTLCCE..................................IDAYGDFLQALGRGTTQ
FPGT_HUMAN/114-533DS.LFYMDHKSAKMLLAFYE.KIGTLSCE..................................IDAYGDFLQALGPGATV
C3XWJ9_BRAFL/92-524DS.AFYFDHQTGNKLLDFYK.KNKPLNCE..................................LEAYGDFLRPLGPNATD
F0SXR2_SYNGF/113-494DTGFIWFGGNIMQELLNLIS.TDGKIDEEKCNRFINDTVS.......................LNFYADFVFPLAQNCTL
K0T387_THAOC/108-580DTGVVCFLPKSAATLRDLSG...SSMKCCTRTGIAELYGQGGTSHSSIEAFAVQKSIK.....LCLYGDMLRALKTASSQ
H9G685_ANOCA/97-505VSGIVFFSSEAAEQLLATHV..IPPLNACTYL........GLDSGA..PPIQ...........LSLFFDILLSMARGVSE
I1P6V0_ORYGL/150-552DTGIISARGKAWQELVRLAYSSSHVMIKELI.....................TGRKE......MSLYEDLVAAWVPSRHE
FKGP_ARATH/131-529DTGIISARGRAWSDLVALGC.SCQPMILELI.....................GSKKE......MSLYEDLVAAWVPSRHD
G3VJJ9_SARHA/106-523DS.LFYMDHDSARKLLAFYQ.QLGPLTCE..................................IDAYGDFLQALGPGATV
A9TP04_PHYPA/132-540DTGIFVVRGDAFSNLVAFAL.LDPNPVADILATGEEVGGLPLFATI..FPLSATGT.......VSLYEEVAGAWVSARHE
Q02BJ1_SOLUE/128-518DTGLMRFAPETAARLTRLAG.VT...EADGVIALGPGVIDGSLDGG..KPVA...........IDLYEHVTMALTGQWTP
D7UCW9_VITVI/146-545DTGIIAVRGKAWVELVRLAC.SSQPMIADLL.....................KSKKE......MSLYEDLVAAWVLARHE
W5M6I6_LEPOC/116-528DS.TYYMDPDTAGRLLGLLA.EIGPLGCE..................................IDAYGDFLQALGSGATS
E9PSM4_RAT/106-522DS.LFYMDHKSAKKLLDFYK.SVDQLNCE..................................IDAYGDFLQALGPGATA
M0RP18_MUSAM/153-575DTGIIAARGKAWAELVKLACSSSQAMISELILVTLDSFFQLVLFVNIFVPFKEGQNY......MSLYEDLVSAWVPAKHE
F0ZWK1_DICPU/160-551DS.CYYFDHYVTQLLLKYYN.ENKPISCE..................................IDAYSDFLQPLGSNAEP
D4M6A5_9FIRM/114-496DTGAVLFGSALLQALFRLIS.TGGKVDEKKFRQFCNEEAR.......................ISFYGDFLYPLANDSTL
U5D0Y7_AMBTC/152-554DTGIISVRGKAWADLLLLSS.SSPSMISELL.....................RCGKE......MSLYEDLVAAWVPAKHN
M4AF92_XIPMA/111-517DS.TYYMDFKSAKSLLNLLN.ELGPLNCE..................................IDAYGDFLQALGPKATI
V8P3W9_OPHHA/98-513DS.LFYIDHTTAKLLLTFYK.QIGKLCYE..................................IDAYGDFLQALGSGATK
B9I905_POPTR/194-593DTGIIAARGKAWAELAMLAS.SCEPMIEELL.....................KSRKE......MSLYEDLVAAWVPAKHD
M3ZWZ0_XIPMA/97-496VSGPVFFCRSVSEKLLQTHV..SPPLDGCTYL........GVDSGA..PPLQ...........ISLFLDLLKCLCSDLTQ
B7S4B1_PHATC/94-530DTGVIVFLPTTATILRRLAF.DDELLSRCTASTLQSMQNRHLADGD..SPESALIKAQDASFRFDLYTDLLQALPMVASM
Q54NH4_DICDI/127-556DS.CYYFDHKVFSILLNYYN.QNNPINCE..................................IDAYSDFLQPLGKSAEP
H3ANF5_LATCH/114-531DS.TFYFDQKTAKQLLLFFE.EIGQVSCE..................................IDAYGDFLQALGPGATE
H2YSE9_CIOSA/106-502DS.AFFMAPDVCEKLRKFYT.SHKPLTCE..................................IDAYGDFMQALGSKSDD

PF16314

R6X3X4_9PORP/7-660EDFIISSGAVVADAAKIIRCFIGQACHVTHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY...SFLN
Q5LHM9_BACFN/5-659DDFIISSGSHVDDGAMLTRCFVGQACQLGHNYSASDSLFFSNCQGENGEACAIFAGPYTVTHHKSTLLIAGMF...SFMN
H1XPF7_9BACT/41-722VNGIIGYGNRIFYGVKAVRFITGRNVQLKYGARLLNSFLGDNSTISCCEVLNNLIFPFHEQHHNNSFLIAATVQGQANIA
R5GF65_9PORP/2-659RDFVASLGAKIGGSSIIERCFIGQSCHIDHLFSAHDSLIFANCNLENGEACAIFAGPFTVSSHKSSLLIAGHF...SFLN
E4T878_PALPW/4-655KNFIICSGTNITESALISNCFVGQACIIDKQFSAIDSVFFANCQGLHGEAVSIFAGPYTVTHHKSTLMLTALY...SFMN
F3ZTN4_9BACE/4-657NNFIISSGVRMKDGVMLNRCFVGQACELGHTYTATDSLFFSNCQGENGEAASIFAGPFTVTHHKSTLLISGMF...SFMN
R5PLK0_9BACT/5-659EDFIIASGTSITDGATLVRCFIGQACHLGHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF...SFLN
Q7MTP4_PORGI/8-662RDFILCSGSSVTDGATVSHCFVGQGTHLGHLFSAHDSLFFANCQGENGEACAVFAGPYTVSMHKSSLLIAGLY...SFLN
R5VAS6_9BACT/7-661EDFIISSGSRITDGVTLMRCFIGQACHFSHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF...SFLN
F9ZCM7_ODOSD/4-657EDFIFSSGTCINDGAALVRCFIGQACHLGHLFSAHDSLFFSNCQGENGEACAVFAGPYTVTMHKSSLLIAGMF...SFLN
R5I224_9BACT/5-658TDFIVQSGSVVENGAVVTRSFVGQGVTLSKGFSCSDCLFFANSHCENGEAVSVFAGPFTVSHHKSTLLIGSMF...SFMN
F4KKJ2_PORAD/2-657RDFVFSAGCVVADGSNVSRCFIGQGCSVTHLFSAHDSLFFANCQCENGEACAVFAGPFTVTMHKSSLLIAGYY...SFLN
A6LH30_PARD8/5-658QDFIVSSGAKIADAAKIIRCFIGQACQVTHNFSAHDSLLFSNCAFENGEACAIFAGPFTVSMHKSSLLIAGMY...SFLN
R5LL62_9SPIR/12-659KDCIVLKGAHIVDGTVIKKAFIGEGVKLGRQFSCEDSLLFANCEGEHGEMFSIFAGPYTVTHHKATLLIASHF...SFFN
R6SVY6_9BACE/4-659DDFIVESGSKITDGVMISKCFVGQACVLGHGYSASESLFFSNCQGENGEACSLFAGPYTVTHHKSTLLIAGMF...SFMN
R5VUQ7_9BACE/5-659DDFIISSGSHVEDGTMLTRCFVGQACHLGHTYSASDSLFFSNCQEENGEACAIFAGPFTVTHHKSTLLIAGMF...SFMN
X5DE87_9BACT/9-663DNFIVSSGSKITDATLVSKCFIGQGCVLDKHYSAENSLFFANFQGFHGEACSIFAGPYTVTHHKSTLLIAGMY...SFLN
H1XNG4_9BACT/3-653RNFIVLSGSEVKDGALLTDCFVGQGVRIGRQFSAENSAFFANCEGFHSEAVSVFAGPYSVTHHKSTLLIAGMF...SFYN
R5IQU5_9PORP/5-659DDFIISSGSHISDGVVMLRCFIGQGCSLSHLFSAHDSLFFSNCQGENGEACAIFAGPYTVSMHKSSLLIAGMF...SFLN
C0R0B6_BRAHW/11-658TDSIVLKGAHIVDGTVIKKAFIGEGVKLGRQFSCEDSLLFANCEGEHGEMFSIFAGPYTVTHHKATLLIASHF...SFFN

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511DYTN..........DTANVTKKDINL....VEIRKKIYNCLRGAS...LNVILLN...........ESKFYHLGTTEEYL
H0Z730_TAEGU/55-450EDFV..............KGGGDASV....RNARSVLWTALRGFP...LSMACIP...........NASYDYMTASASDH
H2V794_TAKRU/111-514DYTG..........NTANVTKEESSL....VETRKRIFHRLKGTP...LNVLVLN...........NSKFYHLGTTSEYI
FUK_MOUSE/97-496ENFL........AGRPPELGQGDMDVASYLKGARAQLWRELRDQP...LTMVYVP...........DGGYSYMTTDATEF
H2XT72_CIOIN/112-517QYIT..........NSANVVCETDSL....VALRQKVYELLSNTS...LQVVCLA...........TSHFYHFGTTVEYM
H2UFX8_TAKRU/97-498DQFV....REERTGCSSPVGPQGETV....RQCREELWRILRGTP...LTVAYVP...........DGCYDYLNLSGKRH
W5P4P4_SHEEP/97-496EDFL........VGRPPEMGQGDADIAGYLHGARAELWRQLRGQP...LTVAYVP...........DGSYSYMTNSASEF
U9SUG9_RHIID/114-546............KFEAHSIPQEMTPL....EEAQLTIIKKLYSSDNRELNVLILN...........NSKFYHLGTMLEYI
U3JEG4_FICAL/32-445DYTR..........NTSNVCREGSGL....VAVRQQLYSLLRGTP...LNVIVLT...........NSQFYHIGTAQEYL
B3RXN8_TRIAD/106-509DYTH..........NTSNITDVTETI....VQTRKEIFQWLKGTQ...LNVLLFK...........NSVFYHIGTTLEYL
F7G1T1_ORNAN/113-528DYTR..........DASNVTKEDPEL....VGMREKIFLLLKGTP...LNVVVLR...........NSKFYHIGTTLEYL
T1J558_STRMM/188-601EKFVTGDYCKSYNVKHGYEKQFSKSI....QQARSLVWNVLHKYT...MKTCILE...........DVHHEYWNESSNAD
I3J111_ORENI/111-518EYTN..........NTANVTKEESSL....VEIRQKIFHLLKGTP...LNVILLN...........SSKFYHIGTTSEYL
W4YPG4_STRPU/114-532SYIN..........DMSNVSSKTDKL....LSMRQEVFKLLQGTP...LHVLVLP...........YSKFYHIGTTEELL
H9GU62_ANOCA/113-530NYAK............NNITKEETSL....FEIREKLFTLLKGLS...LNVILLN...........NSKFYHIGTTQECL
T1JC87_STRMM/128-547DYIH..........NARNKSIASKKL....TNIRQKLYLLLHNTP...LNVLLLH...........WSRFFHLGTCSEYI
G3TX92_LOXAF/97-494EDFL........VGRPPEMGQGDVGIAAYLQGARAELWRELRDQP...LTMAYVP...........DGSYSYMTSLASEL
R7BGP0_9FIRM/113-501EEFY..........TQAPEGEFNDEL....FACRTGIWEALNGFS...MKLLCLA...........PAEFIHFGTTRELW
F1RBS0_DANRE/70-468DYTE..........NTANVTKKEKGL....VEIRRKIFHRLKGTA...LNVILLN...........NSKFYHVGTTEEYL
F7C0H8_XENTR/114-520DYTE..........NVENVSKVESEL....TEVRKRIYYLLRGTG...FTVILLN...........NSKFYHIGTTREYL
I1NCN7_SOYBN/120-518WLRK..........................RPLGEELVNKLGKRK...MFSYCAY...........DLLFLHFGTSNEVL
H3CAG6_TETNG/98-496DRFV....SEDRTGCSSPVGPQGATV....RRGREELWRILRGTP...LTVAYVP...........GGCYDYLTLSGKQH
M0ZH48_SOLTU/137-535WLRS..........................RPLGDELVNSLGEQE...MFSYCAC...........DLLFLHFGTSSEVL
F0ZSJ1_DICPU/37-438ESYL..........NQPCFPGSNKKLV...EGARKIVWKTFRDIE...LHSIKIK............GNYYYFKNPMDFL
R5IAV3_9FIRM/116-510EQYY..........KEQPEGKFCEEL....TACRTEIWNALHNYG...MKLICLS...........PAEFIHFGTTWELL
D7FJB1_ECTSI/126-593GESA.EGTLDAYLEACGHVLPPDHDV....SKARREIWDALSGFP...LGALLLQ...........GATFVHLGTTPELM
T1FYY1_HELRO/80-485DFIS..........DVRNVSVTTESL....RPTRLKLFNALNGSN...LNVIAFN...........ESEFYHLGTMNEYL
G3NYZ9_GASAC/98-501DQFV....TEDRAGCSSPVGPEGASV....RRSRAELWRLLRGETCT.LLYSYVP...........GGCYDYLTLSGKHH
G3UP39_MELGA/32-450DYTK..........NTSNATEEESQL....AEVRQKLCALLKGTS...LNVIVLN...........NSKFYHIGTTQEYL
FPGT_HUMAN/114-533EYTR..........NTSNVIKEESEL....VEMRQRIFHLLKGTS...LNVVVLN...........NSKFYHIGTTEEYL
C3XWJ9_BRAFL/92-524EYVN..........IAANVCEATSEL....APTKTKLFKLLKGLP...LHVVLLN...........NSRFYHLGTTAEYL
F0SXR2_SYNGF/113-494EEYQ..........REAPEGAFSMEL....TDCRNDIWKCLYGFS...MKLVRMT...........PARYIHFGTTNELF
K0T387_THAOC/108-580GPTG..........................MTGTLAAVNKLSQHE...ICICSYS...........SGSFVHLGTTRELV
H9G685_ANOCA/97-505EAFV..NGLGPRTGGSGDNTQSEAAL....WSARAVLWKTLHTMP...LIMAYVP...........DGSYDYMTSSASDH
I1P6V0_ORYGL/150-552WLRT..........................RPFGMELIAALGKHR...MFSFCSY...........DFSFLHFGTSAEVL
FKGP_ARATH/131-529WLRT..........................RPLGELLVNSLGRQK...MYSYCTY...........DLQFLHFGTSSEVL
G3VJJ9_SARHA/106-523EYTR..........NTANVTREESQL....VRVREEIFRLLRGTP...LHVVALH...........KSKFYHLGTSHEYL
A9TP04_PHYPA/132-540WLVS..........................RPLGKKLINALGSSR...LYHHCAE...........ELEFLHFGTSSEVL
Q02BJ1_SOLUE/128-518GEHD..........................APALHALAGALKETPFWCSVV...............SGDFTHIGTTALFR
D7UCW9_VITVI/146-545WLRL..........................RPLGEELINRLGKQK...MYSYCAY...........DLLFLHFGTSSEVL
W5M6I6_LEPOC/116-528AYTK..........NTTNVTKEERNL....VEVRGKIFDLLEGTP...LNVILLN...........NSKFYHIGTTQEYL
E9PSM4_RAT/106-522EYTR..........NTSHVTKEDSQL....LDMRQKIFHLLKGTP...LNVVVLN...........NSRFYHIGTTQEYL
M0RP18_MUSAM/153-575WLRS..........................RPLGEELINALGNQK...MFSFCAF...........GLSFLHFGTSIEVL
F0ZWK1_DICPU/160-551NYFN..........VKSNITKFLPHL....PKEREKIYSLLNSSSCK.LNMIPLM...........PSNFIHIGTCHEYI
D4M6A5_9FIRM/114-496EDFY..........KEAAEGQLNEAL....HECRTQIWNAIHHFS...MKLLCLS...........PAEFIHFGTTRELR
U5D0Y7_AMBTC/152-554WLKS..........................RPLGIELVSGLGNQN...LFSYCAF...........DLSFLHFGTSTEVL
M4AF92_XIPMA/111-517EYTK..........NTANVTKEESNL....VEIRQKIFHLLKGMP...LNVILLN...........NSKFYHIGTTSEYL
V8P3W9_OPHHA/98-513DYAK..........KIENVT.EELGL....IEIREKVFNILKGLP...LNVILLN...........NSKFYHIGTTRECL
B9I905_POPTR/194-593WLRA..........................RPLGEEMVRSLGRQN...MFSYCAY...........DLLFLHLGTSSEVL
M3ZWZ0_XIPMA/97-496DQFV....NEGRAGCSPTDGLQGATV....RAGRAELWRILRGAP...LSLVYVP...........GGCYDYLTLSGKQH
B7S4B1_PHATC/94-530DDRL....DNGKVTQGPSYAVLRESF....RSCR..............LSVMTIP...........SGRFLHLGTTRELL
Q54NH4_DICDI/127-556NYFQ..........VKSNVTKFLPHL....PKEREKIYNFLNSNKCK.LEMIPMS...........PSAFIHIGTCHEYI
H3ANF5_LATCH/114-531EYTK..........NMANVTKEEANL....VELRRKLFFLLKGTP...LNIIALN...........NSKFYHIGTTQEYL
H2YSE9_CIOSA/106-502QYIT..........NSANVVFETDSL....VALRQEVFQLMRDTP...LQVVCLASFNDVPDSDKITSHFYHFGTTAEYI

PF16314

R6X3X4_9PORP/7-660AGS..GSNQSNHMYKLGPIHQGIVERGSKTTSDSYILWP.........ARVGAFSLVM.GRHHHHSDTSDMPFSYL..IE
Q5LHM9_BACFN/5-659AGS..GSNQSNHMYKLGPIHQGTLERGAKTTSDSYILWP.........ARVGAFSLVM.GRHVNHADTSNLPFSYL..IE
H1XPF7_9BACT/41-722AGATIGSNHNSR....APDGEIIAERG.........FWPGLCSNFKHNSYFAPFALVAKGTYYSELNIK.LPFALVSPAD
R5GF65_9PORP/2-659AGS..GSNQSNHLYKLGPIHQGVVERGSKTSSDSYILWP.........SRIGAFTLIM.GRHVHNVDTTDFPFSYL..LE
E4T878_PALPW/4-655AGS..GTNFSNHMYKLGPVHQGITERGVKTSSGSYIMWP.........AKIGAFTVVL.GRHKGNPDISELPFSYL..LE
F3ZTN4_9BACE/4-657AGS..GSNQSNHMYKLGAIHQGIIERGGKTTSNSYILWP.........ARIGAFSLIM.GRHTNNSDTSNLPFSYL..IE
R5PLK0_9BACT/5-659AGS..GSNQSNHLYKLGPIHQGIVERGSKTTSDSYILWP.........AKIGAFSLIM.GRHVNHPDTSDLPFSYL..IE
Q7MTP4_PORGI/8-662AGS..GSNQSNHLYKLGPIHQGIVERGSKTTSDSYILWP.........SRIGPFTLVM.GRHVHHIDSSAFPFSYI..IE
R5VAS6_9BACT/7-661AGS..GSNQSNHLYKLGPIHQGIVERGSKTTSDSYILWP.........AKIGAFSLIM.GRHVNHPDTSDLPFSYL..IE
F9ZCM7_ODOSD/4-657AGS..GSNQSNHLYKLGPIHQGIVERGSKTTSDSYILWP.........AKIGAFSLIM.GRHVSHPDTSDLPFSYL..IE
R5I224_9BACT/5-658AGS..ATNFSNHQYKLGPVHQGVFGRGVKCGSGSYMMLP.........VRVAPFTTVL.GHHTGRIDTPDMPFSYI..LE
F4KKJ2_PORAD/2-657AGS..GSNQSNHLYKLGPIHQGVVERGSKTTSDSYVLWP.........SRIGAFSLIM.GRHVDHIDSSDFPFSYI..IE
A6LH30_PARD8/5-658AGS..GSNQSNHMYKLGPIHQGIVERGSKTTSDSYILWP.........ARIGAFSLVM.GRHHHHSDTSDIPFSYL..IE
R5LL62_9SPIR/12-659AGS..GTNQSNHMYKLGPYHHGFMERGCKTGSNSYILWP.........SRIGAFSTVI.GAHYDNVDSSDFPFSYI..TE
R6SVY6_9BACE/4-659AGS..GSNQSNHMYKLGPIHQGILERGAKTTSDSYILWP.........AKIGAFSLVM.GRHVNNLDTTDLPFSYL..IE
R5VUQ7_9BACE/5-659AGS..GSNQSNHMYKLGPIHQGALERGAKTTSDSYILWP.........ARIGAFSLVM.GRHVTHPDTSNLPFSYL..IE
X5DE87_9BACT/9-663AGS..GSNQSNHLYKLGPIHQGIMERGAKTTSDSYMLWP.........TRIGAFTLVM.GRHYKHCDTTDFPFSYL..IE
H1XNG4_9BACT/3-653AGS..GTNQSNHMYKLGPVHQGILERGAKTGSFSYLLWP.........ARVAPFTAVI.GKHYANFDAANLPFSYI..EE
R5IQU5_9PORP/5-659AGS..GSNQSNHMYKLGPIHQGVVERGSKTTSDSYILWP.........AKIGAFSLVM.GRHVRHPDTSALPFSYL..IE
C0R0B6_BRAHW/11-658AGS..GTNQSNHMYKLGPYHHGFMERGCKTGSNSYILWP.........SHIGAFSTVI.GAHYDNVDTSDFPFSYI..TE

PF00132

A0A0F6C616_ECOLX/86-121-------------------------------------------------------------LHGVE--------------
A0A0F7WUQ7_CHLPN/153-188-------------------------------------------------------------HSVLG--------------
A0A0F7WUQ7_CHLPN/117-152-------------------------------------------------------------TARIE--------------
LPXD_ECOLI/109-144-------------------------------------------------------------TAKLG--------------
LPXA_ECOLI/65-100-------------------------------------------------------------FASIG--------------
LPXA_ECOLI/108-143-------------------------------------------------------------LTKVG--------------
LPXD_ECOLI/222-257-------------------------------------------------------------DTIIG--------------
A0A0F7WUQ7_CHLPN/231-266-------------------------------------------------------------NTVIH--------------
A0A0F6C616_ECOLX/122-157-------------------------------------------------------------NTHIG--------------
LPXA_ECOLI/17-52-------------------------------------------------------------GASIG--------------
YVOF_BACSU/59-94-------------------------------------------------------------GKQTS--------------
EI2BE_HUMAN/416-451-------------------------------------------------------------NAEVK--------------
YBB2_SCHPO/366-401-------------------------------------------------------------TTIMR--------------
E7LS70_YEASV/289-323-------------------------------------------------------------RSVVL--------------
A0A0E1AGQ2_STAAU/80-114-------------------------------------------------------------DIHIF--------------
LPXA_SYNY3/151-186-------------------------------------------------------------HIYIE--------------
O58150_PYRHO/245-280-------------------------------------------------------------EVKVE--------------
O66933_AQUAE/320-355-------------------------------------------------------------NGVIC--------------
Q48392_KLEOX/245-280-------------------------------------------------------------HTTLG--------------
LPXD_AQUAE/252-287-------------------------------------------------------------SVKTG--------------
Q46674_ECOLX/152-187-------------------------------------------------------------DVSVG--------------
EPSM_BACSU/156-191-------------------------------------------------------------AVSVQ--------------
F6RW81_MACMU/98-133-------------------------------------------------------------AMKMG--------------
WBPD_PSEAE/14-49-------------------------------------------------------------GAQIG--------------
Q79H46_BORPE/13-48-------------------------------------------------------------GARIG--------------
O86157_CAMJU/151-186-------------------------------------------------------------NVKIG--------------
YBB2_SCHPO/287-322-------------------------------------------------------------PVFIH--------------
F6RW81_MACMU/8-43-------------------------------------------------------------SVKIA--------------
Q46674_ECOLX/104-139-------------------------------------------------------------GIFIG--------------
LPXD_CHLTR/152-187-------------------------------------------------------------YSTVG--------------
P74589_SYNY3/319-354-------------------------------------------------------------ACVVG--------------
Q48392_KLEOX/113-148-------------------------------------------------------------HCQIG--------------
LPXD_NEIMB/105-140-------------------------------------------------------------TAVVE--------------
O27626_METTH/368-403-------------------------------------------------------------GAVFG--------------
GLMU_AQUAE/401-436-------------------------------------------------------------ESYVG--------------
GLMU_MYCTU/405-440-------------------------------------------------------------RTTVG--------------
GLMU_NEIGO/393-428-------------------------------------------------------------KTVIG--------------
GLMU_SYNY3/390-425-------------------------------------------------------------ATVIG--------------
A0A077Z6C0_TRITR/394-429-------------------------------------------------------------KTIIG--------------
Q56274_9PROT/119-154-------------------------------------------------------------RTIIG--------------
Q48792_LISMN/188-223-------------------------------------------------------------KTIIG--------------
GLMU_BACCL/51-86-------------------------------------------------------------MTKIE--------------
O33923_CORAM/34-69-------------------------------------------------------------KTVIG--------------
LPXD_CHLTR/116-151-------------------------------------------------------------TAIIE--------------
C9K1L0_KLEPN/162-197-------------------------------------------------------------KITIG--------------
A0A0T7RR04_SALET/149-184-------------------------------------------------------------PIKIG--------------
LPXD_SYNY3/118-153-------------------------------------------------------------SVHCG--------------
Y3034_MYCTU/218-253-------------------------------------------------------------PVRIG--------------
WBBJ_ECOLI/132-167-------------------------------------------------------------AVVIG--------------
P72981_SYNY3/162-197-------------------------------------------------------------RITIG--------------
O59588_PYRHO/365-400-------------------------------------------------------------GAIIG--------------
LPXD_BRUA2/128-163-------------------------------------------------------------TAQIE--------------
H9L4Q4_VIBCH/121-156-------------------------------------------------------------PVLIK--------------
WCAB_ECOLI/108-143-------------------------------------------------------------CPHIG--------------
SRPH_SYNE7/260-295-------------------------------------------------------------HPVIE--------------
P93544_SPIOL/265-300-------------------------------------------------------------HPKVG--------------
CYSE_BUCAP/194-229-------------------------------------------------------------HPIIR--------------
CYSE_BACSU/118-153-------------------------------------------------------------HPTIK--------------
O69218_AZOVI/117-152-------------------------------------------------------------HPTLE--------------
NIFP_AZOCH/118-153-------------------------------------------------------------HPTLG--------------
CYSE_STAXY/120-155-------------------------------------------------------------HPDIG--------------
Q7AQF4_MYCLE/117-152-------------------------------------------------------------HPTIG--------------
CYSE_SYNE7/117-152-------------------------------------------------------------HPTLA--------------
CYSE_HELPY/116-151-------------------------------------------------------------HPTLG--------------
YRDA_ECOLI/97-132-------------------------------------------------------------GCTIG--------------
Q9ZD31_RICPR/89-124-------------------------------------------------------------ACTIH--------------
YTOA_BACSU/87-122-------------------------------------------------------------SAVIR--------------
O26372_METTH/143-178-------------------------------------------------------------GPIIR--------------
DAPH_BACSU/165-200-------------------------------------------------------------PVVIE--------------
DAPD_ECOLI/175-210-------------------------------------------------------------PTIIE--------------
F3K8R5_PSEAJ/175-210-------------------------------------------------------------PVVIE--------------
O59257_PYRHO/88-123-------------------------------------------------------------GAKVG--------------
O67576_AQUAE/90-125-------------------------------------------------------------GCVLH--------------
CAIE_ECOLI/88-123-------------------------------------------------------------GCLIG--------------
PAAY_ECOLI/88-123-------------------------------------------------------------GCIIR--------------
Q45929_COXBE/117-152-------------------------------------------------------------GCTIG--------------
O27625_METTH/74-109-------------------------------------------------------------GCIVA--------------
Y3753_PSEAE/87-122-------------------------------------------------------------GCSVG--------------
Y304_METJA/77-112-------------------------------------------------------------GCRIE--------------
WBPD_PSEAE/101-136-------------------------------------------------------------NTLVK--------------
YVOF_BACSU/106-141-------------------------------------------------------------KVLIG--------------
F7YJG3_VIBA7/98-133-------------------------------------------------------------KTVVC--------------
GLMU_NEIGO/264-299-------------------------------------------------------------RLKHG--------------
O59364_PYRHO/307-342-------------------------------------------------------------EAIIG--------------
LPXD_RICRS/123-158-------------------------------------------------------------SATIG--------------
LPXD_PASMU/111-146-------------------------------------------------------------SAVIG--------------
O87774_LACSK/117-152-------------------------------------------------------------DTIIE--------------
A0A0E1AGQ2_STAAU/130-165-------------------------------------------------------------DVKIG--------------
O68047_RHOCA/110-145-------------------------------------------------------------SVVIG--------------
Q2G1K1_STAA8/119-154-------------------------------------------------------------RTTIK--------------
Q8U5W2_AGRFC/180-215-------------------------------------------------------------DTVVG--------------
MATA_LYSSH/77-112-------------------------------------------------------------DTVIG--------------
O87276_9STAP/118-153-------------------------------------------------------------NTEIG--------------
CAT4_PSEAE/110-145-------------------------------------------------------------DTLIG--------------
Q79EF3_SYNY3/114-149-------------------------------------------------------------DTVIG--------------
O86929_SALTM/110-145-------------------------------------------------------------NTVIG--------------
CAT4_AGRFC/109-144-------------------------------------------------------------DTVIG--------------
O87158_VIBCL/104-139-------------------------------------------------------------PIKIG--------------
Q56045_STRTR/106-141-------------------------------------------------------------AIQIG--------------
M5JVF4_STREE/129-164-------------------------------------------------------------PVMIG--------------
THGA_LACLA/133-168-------------------------------------------------------------KVYIE--------------
Y1064_METJA/159-194-------------------------------------------------------------PIEIG--------------
YA39_SCHPO/150-185-------------------------------------------------------------PINIQ--------------
E7KQ17_YEASL/130-165-------------------------------------------------------------PVTIG--------------
J0UV19_RHILV/131-166-------------------------------------------------------------PVSIG--------------
THGA_ECOLI/131-166-------------------------------------------------------------PITIG--------------
MAA_BACSU/130-165-------------------------------------------------------------PVTIG--------------
H7C7I4_CAUCR/142-177-------------------------------------------------------------DCRLG--------------
O86157_CAMJU/109-144-------------------------------------------------------------YVVIN--------------
LPXA_CHLTR/61-96-------------------------------------------------------------SAMIG--------------
LPXA_RICRS/63-98-------------------------------------------------------------FASIG--------------
LPXA_HAEIN/65-100-------------------------------------------------------------FTSIG--------------
LPXA_SYNY3/73-108-------------------------------------------------------------GAVIG--------------
LPXA_AQUAE/60-95-------------------------------------------------------------GAVIG--------------
Q45929_COXBE/39-74-------------------------------------------------------------PKLLG--------------
YRDA_ECOLI/12-47-------------------------------------------------------------FPQIG--------------
CAIE_ECOLI/10-45-------------------------------------------------------------IPVVH--------------
PAAY_ECOLI/10-45-------------------------------------------------------------TPVVP--------------
O59257_PYRHO/10-45-------------------------------------------------------------KPRIH--------------
YTOA_BACSU/9-44-------------------------------------------------------------KPDIH--------------
Q9ZD31_RICPR/10-45-------------------------------------------------------------IPKIA--------------
O67576_AQUAE/11-46-------------------------------------------------------------YPKIH--------------
O66933_AQUAE/251-286-------------------------------------------------------------RIYVE--------------
DAPH_BACSU/121-156-------------------------------------------------------------GSVIG--------------
DAPD_BUCAP/131-166-------------------------------------------------------------GAYVD--------------
F3K8R5_PSEAJ/131-166-------------------------------------------------------------GAYVG--------------
Q56274_9PROT/77-111-------------------------------------------------------------AAKIG--------------
O59588_PYRHO/306-340-------------------------------------------------------------NSIIM--------------
O27626_METTH/309-343-------------------------------------------------------------NSIIM--------------
P74589_SYNY3/249-284-------------------------------------------------------------DIWIG--------------
F7YJG3_VIBA7/12-47-------------------------------------------------------------SSNIG--------------
EI2BE_SCHPO/330-364-------------------------------------------------------------RTLIG--------------
P72757_SYNY3/62-97-------------------------------------------------------------DVKIQ--------------
O30712_SYNP2/59-94-------------------------------------------------------------NIEIH--------------
LPXD2_ARATH/98-133-------------------------------------------------------------GAVVH--------------
GLGC_MYCLE/328-362-------------------------------------------------------------NSVLS--------------
P71784_MYCTU/106-141-------------------------------------------------------------DGRIG--------------
Q2G1K1_STAA8/49-83-------------------------------------------------------------NSHIG--------------
EI2BE_SCHPO/387-422-------------------------------------------------------------SVKIG--------------
EI2BE_YEAST/382-416-------------------------------------------------------------DCIIG--------------
LPXA_CHLTR/103-138-------------------------------------------------------------TVSIG--------------
LPXA_RICRS/106-141-------------------------------------------------------------MTRVG--------------
LPXA_ALLVD/103-138-------------------------------------------------------------GTRIG--------------
LPXA_AQUAE/103-138-------------------------------------------------------------KTVVG--------------
LPXA_NEIMB/104-139-------------------------------------------------------------ETRIG--------------
LPXA_SYNY3/115-150-------------------------------------------------------------VTRIG--------------
LPXA_HELPY/104-139-------------------------------------------------------------KTLIG--------------
LPXA_HAEIN/108-143-------------------------------------------------------------VTAIG--------------
LPXA_PROMH/108-143-------------------------------------------------------------ITKIG--------------
LPXD_HAEIN/225-260-------------------------------------------------------------ATIIE--------------
LPXD_SYNY3/231-266-------------------------------------------------------------ETRIG--------------
LPXD_AQUAE/216-251-------------------------------------------------------------NTLIG--------------
LPXD_HELPY/216-251-------------------------------------------------------------ETLIK--------------
LPXD_NEIMB/224-259-------------------------------------------------------------DTTVG--------------
LPXD2_ARATH/199-234-------------------------------------------------------------ETVIE--------------
LPXD_BRUA2/240-275-------------------------------------------------------------DTVIG--------------
Q48392_KLEOX/209-244-------------------------------------------------------------NTTIG--------------
LPXD_RICRS/235-270-------------------------------------------------------------DTIIK--------------
LPXD_CHLTR/230-265-------------------------------------------------------------HSVVR--------------
LPXA_BRUA2/106-141-------------------------------------------------------------YTSIG--------------
O26372_METTH/95-130-------------------------------------------------------------HSKIG--------------
F7YJG3_VIBA7/48-83-------------------------------------------------------------DVTIG--------------
LPXD_NEIMB/147-182-------------------------------------------------------------DCKLG--------------
LPXD_SYNY3/154-189-------------------------------------------------------------GVTIG--------------
LPXD_AQUAE/139-174-------------------------------------------------------------NTVIG--------------
LPXD_SALTY/145-180-------------------------------------------------------------NSKIG--------------
LPXD_PASMU/147-182-------------------------------------------------------------NSKIG--------------
LPXD_HAEIN/148-183-------------------------------------------------------------NTKIG--------------
LPXD_YEREN/145-180-------------------------------------------------------------NTHIG--------------
LPXD_BRUA2/164-198-------------------------------------------------------------NCQIG--------------
LPXD_HELPY/120-155-------------------------------------------------------------GVEIG--------------
LPXD_RICRS/159-193-------------------------------------------------------------GVNIG--------------
LPXA_NEIMB/1-36-------------------------------------------------------------MTLIH--------------
MPG1_SCHPO/249-284-------------------------------------------------------------SSNII--------------
E7LS70_YEASV/248-283-------------------------------------------------------------GANIV--------------
G0RMQ5_HYPJQ/251-286-------------------------------------------------------------PYVHG--------------
MPG1_CANAL/249-284-------------------------------------------------------------KYVHG--------------
O27787_METTH/325-360-------------------------------------------------------------NCVVD--------------
GLMU_SYNY3/313-348-------------------------------------------------------------QSQIG--------------
GLMU_AQUAE/324-359-------------------------------------------------------------NSEIK--------------
GLMU_BACSU/317-352-------------------------------------------------------------HSKVG--------------
Q48792_LISMN/111-146-------------------------------------------------------------ESKVG--------------
GLMU_MYCTU/328-363-------------------------------------------------------------SSSIG--------------
GLMU_NEIGO/316-351-------------------------------------------------------------GCEVG--------------
A0A077Z6C0_TRITR/317-352-------------------------------------------------------------DANLA--------------
GLMU_HAEIN/317-352-------------------------------------------------------------DSIVG--------------
EI2BE_YEAST/330-364-------------------------------------------------------------DVVLA--------------
LPXA_ALLVD/12-47-------------------------------------------------------------GAQLH--------------
LPXA_SYNY3/25-60-------------------------------------------------------------QAQLH--------------
LPXA_RICRS/15-50-------------------------------------------------------------GAKLG--------------
LPXA_CHLTR/13-48-------------------------------------------------------------GARIG--------------
A0A0F7WUZ8_CHLPN/13-48-------------------------------------------------------------GAKIG--------------
LPXA_BRUA2/15-50-------------------------------------------------------------GVELG--------------
LPXA_HAEIN/17-52-------------------------------------------------------------GAVIG--------------
LPXA_YEREN/17-52-------------------------------------------------------------GAVIG--------------
LPXA_PROMH/17-52-------------------------------------------------------------GAVIG--------------
O27787_METTH/255-290-------------------------------------------------------------KIWIG--------------
O58775_PYRHO/315-344-------------------------------------------------------------DAILG--------------
H7C7I4_CAUCR/106-141-------------------------------------------------------------SVRLG--------------
EPSM_BACSU/102-137-------------------------------------------------------------SAVIG--------------
O58775_PYRHO/245-280-------------------------------------------------------------YMILG--------------
GLMU_AQUAE/272-307-------------------------------------------------------------DVSIE--------------
GLMU_SYNY3/262-297-------------------------------------------------------------TVVLE--------------
GLMU_BACSU/266-301-------------------------------------------------------------DAVIG--------------
GLMU_MYCTU/277-312-------------------------------------------------------------DVTIG--------------
Q48792_LISMN/60-95-------------------------------------------------------------DVKIG--------------
O84634_CHLTR/59-94-------------------------------------------------------------TIEIQ--------------
A0A0F7YVQ3_CHLPN/60-95-------------------------------------------------------------KIEIA--------------
O26372_METTH/41-76-------------------------------------------------------------PPVIG--------------
EI2BE_HUMAN/359-393-------------------------------------------------------------NVLLG--------------
LPXA_HELPY/13-48-------------------------------------------------------------KAEIN--------------
O27626_METTH/256-291-------------------------------------------------------------PVAIG--------------
O59588_PYRHO/253-288-------------------------------------------------------------PVEIG--------------
LPXA_AQUAE/12-47-------------------------------------------------------------EVEIP--------------
O59364_PYRHO/256-290-------------------------------------------------------------SLFTG--------------
LPXD_AQUAE/103-138-------------------------------------------------------------ELEIG--------------

PF14602

DAPD_SULDN/300-333-------------------------------------------------------------PITIG--------------
Q8FQF4_COREF/259-293-------------------------------------------------------------YLGIG--------------
E8NC18_MICTS/219-252-------------------------------------------------------------RVSIG--------------
A1STS6_PSYIN/252-285-------------------------------------------------------------VITIG--------------
Q8U2R4_PYRFU/37-72-------------------------------------------------------------GAKIG--------------
E8V741_TERSS/175-210-------------------------------------------------------------PVIIE--------------
A1WX25_HALHL/176-211-------------------------------------------------------------PTIIE--------------
Q15QD8_PSEA6/210-243-------------------------------------------------------------INAIG--------------
A0RN31_CAMFF/297-330-------------------------------------------------------------AISVG--------------
D5V5C0_ARCNC/297-330-------------------------------------------------------------PVSIG--------------
A0JYR5_ARTS2/248-281-------------------------------------------------------------KISLG--------------
B9L6I2_NAUPA/287-320-------------------------------------------------------------PITIG--------------
D7GF12_PROFC/226-259-------------------------------------------------------------RVRIG--------------
E2SBF8_9ACTN/226-259-------------------------------------------------------------VISIG--------------
DAPD_ZYMMO/171-206-------------------------------------------------------------PVIIG--------------
Q0VQG2_ALCBS/253-286-------------------------------------------------------------IISLG--------------
DAPD_BLOFL/180-215-------------------------------------------------------------PTIIE--------------
C1A408_GEMAT/176-211-------------------------------------------------------------PVVIE--------------
B0VHT1_CLOAI/167-202-------------------------------------------------------------PVIIE--------------
D9SGU0_GALCS/175-210-------------------------------------------------------------PTIIG--------------
C6Y287_PEDHD/166-201-------------------------------------------------------------PVIIE--------------
C4LHT9_CORK4/233-266-------------------------------------------------------------VISIG--------------
A7ZCR0_CAMC1/300-333-------------------------------------------------------------PVSIG--------------
D7WDN8_9CORY/234-268-------------------------------------------------------------PLHIG--------------
D1BYT1_XYLCX/243-276-------------------------------------------------------------RVVIG--------------
E3GF87_EUBLK/173-208-------------------------------------------------------------PVIIE--------------
Q6NHZ9_CORDI/229-263-------------------------------------------------------------QLRVG--------------
B2V696_SULSY/121-156-------------------------------------------------------------NVKIG--------------
D1BKM4_SANKS/225-258-------------------------------------------------------------VVSIG--------------
DAPD_BEII9/183-218-------------------------------------------------------------PTIIE--------------
GLMU_AGRRK/379-414-------------------------------------------------------------ETHIG--------------
C8XJN1_NAKMY/241-274-------------------------------------------------------------QVTIG--------------
B3ET32_AMOA5/167-202-------------------------------------------------------------PVIIE--------------
Q2GI44_EHRCR/182-217-------------------------------------------------------------PVVIE--------------
D3UHQ9_HELM1/290-323-------------------------------------------------------------PISIG--------------
C7MVH9_SACVD/242-275-------------------------------------------------------------IISVG--------------
B3QZC3_CHLT3/182-217-------------------------------------------------------------PVIIE--------------
E3PSU4_CLOSD/168-203-------------------------------------------------------------PVIVG--------------
DAPH_STRSV/161-196-------------------------------------------------------------PVRVG--------------
GLMU_STRSY/395-429-------------------------------------------------------------.TTVG--------------
C5AZJ3_METEA/178-213-------------------------------------------------------------PVIIE--------------
D9Q9N2_CORP2/229-261-------------------------------------------------------------.ISIG--------------
D9Q9N4_CORP2/230-263-------------------------------------------------------------.LRVG--------------
D9TDT4_MICAI/233-265-------------------------------------------------------------.VRIG--------------
E0TE45_PARBH/181-214-------------------------------------------------------------PVIIE--------------
E4PGY8_MARAH/252-284-------------------------------------------------------------.IAVG--------------
F0P119_WEEVC/165-199-------------------------------------------------------------PVIIE--------------
G2NH01_STREK/246-278-------------------------------------------------------------.IAIG--------------
DAPD_HELPY/301-334-------------------------------------------------------------PISIG--------------
Q2G043_STAA8/106-141-------------------------------------------------------------PVTIG--------------
Q2IG91_ANADE/168-203-------------------------------------------------------------PNIIE--------------
Q79VH2_CORGL/241-274-------------------------------------------------------------PLSIG--------------
GLMU_STRR6/394-428-------------------------------------------------------------.TVIG--------------
DAPD_BIFLO/246-278-------------------------------------------------------------.NSIG--------------
DAPD_VIBCH/253-285-------------------------------------------------------------.VSIG--------------
R6X2K4_9PORP/76-110-------------------------------------------------------------.TYIG--------------
R7JIP3_9BACT/169-203-------------------------------------------------------------PVIIE--------------

PF07959

W5LBD8_ASTMX/112-511FH-FTSDPCLRAEL....GILPAAFSIYEPEALE....................KAMACVMHSVLH.-------------
H0Z730_TAEGU/55-450IR-...............SLTLLPSSASHLRFCKTAHSHVDQPCLL........EDGSSVTNCVLE.-------------
H2V794_TAKRU/111-514LY-FTEDVVLRSEL....GLLSSAFSLPVKENPDE...................VSGGVVMHSVLH.-------------
FUK_MOUSE/97-496LH-...............RLTMPGVAVA.....QIVHSQVEEPQLL........EATCSVVSCLLE.-------------
H2XT72_CIOIN/112-517ET-LTKDTTFLNLV....GSDGLAYSAGVPYSSVPDLS................TPMLSIAATVMY.-------------
H2UFX8_TAKRU/97-498VE-...............RLSQNCTDGN.....VLSHIQVTLPVPV........SHTCLIINSVLD.-------------
W5P4P4_SHEEP/97-496LH-...............SLTSPGAPGA.....QVIHSQVEVRPAW........SRGGPAAGARPP.-------------
U9SUG9_RHIID/114-546N.-VNVDPQFKDEL....GIVSFTQGQLLNKRNSI...................KGNICMMNSQIN.-------------
U3JEG4_FICAL/32-445LH-LTAESKLSFEL....GLQPVAFSIFPGAGAS....................SERLSIIQSILE.-------------
B3RXN8_TRIAD/106-509NH-YCNNTDFQYEL....SCHPMVMTVGKNALTDASCPEV..............GSRCSIIHSKIG.-------------
F7G1T1_ORNAN/113-528HY-LTC.SSLKSEL....GLLSEAFSIVPAKSGCV...................SPKPCIIQSILD.-------------
T1J558_STRMM/188-601QH-......................VKI.....LKKISQASLNHIAIIDSNLPETNSPLITNSFLQ.-------------
I3J111_ORENI/111-518FH-LTEHTALRDEL....GLLSSAFSVPMNENPEG...................SSGCCIMYSVLN.-------------
W4YPG4_STRPU/114-532SH-FCDNCSLRREL....SLTKDAFNRSVDLGDSNTVLDKCA............TREACIMDSIVP.-------------
H9GU62_ANOCA/113-530FH-FTSDRKLKLEM....GLLPAVFSICPNSIGDL...................EKSACIIHSILN.-------------
T1JC87_STRMM/128-547EN-LTFSTNKRNLFQDL.AFKNVACSKIVVDNLGKNENVVKK............FPTLTVMHSIIQ.-------------
G3TX92_LOXAF/97-494LH-...............SLTVPSTPRA.....QTVHSQVEELELL........EPGSSVVSCVLE.-------------
R7BGP0_9FIRM/113-501NL-ETNELGSYEHLGWTKRVCTDYQG............................GLPLSVINGHIS.-------------
F1RBS0_DANRE/70-468FH-LTADPCLRAEL....GLMASAFSSFILE.......................KTRVCVMHSILH.-------------
F7C0H8_XENTR/114-520HH-LTSDPKLKAEL....GLRSKVFSIVPGQDEAA...................NETVCVIQSVLD.-------------
I1NCN7_SOYBN/120-518EQ-LSGVGSELVGRRHLCSIPATTASDI..........................TASAIILSSKIA.-------------
H3CAG6_TETNG/98-496VE-...............RLSRDWTDRN.....VLSHIQK..ERGV........DPGARIINSVLE.-------------
M0ZH48_SOLTU/137-535DH-MSETGAGLVGRRHLCSIPATNVSDI..........................AASAIILSSKIE.-------------
F0ZSJ1_DICPU/37-438NF-IHNNGKYQISRKMHSFIATKS..............................PCNGVVINSILL.-------------
R5IAV3_9FIRM/116-510EL-LTNDIADYEYLDWKSLVFTNYIPEG..........................SMHVAVHNSLIE.-------------
D7FJB1_ECTSI/126-593EM-LTLRLPEFIEPY...GLTARASSVVGAACSVEN..................DPPAVVVNSSLH.-------------
T1FYY1_HELRO/80-485EN-LNPFCSLGKII....EWKPITSSYFATDTSNI...................ADDATVIECLAT.-------------
G3NYZ9_GASAC/98-501VQ-...............RLCCDWMNRN.....TLSHIQFQRESAV........RDGGRVINGVLE.-------------
G3UP39_MELGA/32-450FH-FASDSKLKFEL....NLLPEAFSISSDKTEAL...................GGSASIIQSILE.-------------
FPGT_HUMAN/114-533FY-FTSDNSLKSEL....GLQSITFSIFPDIPECS...................GKTSCIIQSILD.-------------
C3XWJ9_BRAFL/92-524DH-LCCNTSFQSEL....GLSPKVFTAIFDKENKASEALHQLPKLSQV......QDEVCLMHSVVS.-------------
F0SXR2_SYNGF/113-494DL-MVKDIIKYHYLGWDKIVLCNLED............................KHKGSVSNCLIM.-------------
K0T387_THAOC/108-580DF-LTVGASVAAT.....SSRDVKPSAWKRYQNFGKTMKLTRRSGSFVSGLDTQADGHVVLNSVLTC-------------
H9G685_ANOCA/97-505IH-...............HLTTSVGNAHGGSFSKVAHSHVEEPGLL........EEGCSVTNSLLE.-------------
I1P6V0_ORYGL/150-552DH-LAGSYSGLVGRRHMSSIPETTACDI..........................AATAVILSSKIS.-------------
FKGP_ARATH/131-529DH-LSGDASGIVGRRHLCSIPATTVSDI..........................AASSVILSSEIA.-------------
G3VJJ9_SARHA/106-523QH-FSADSALRFEL....GLLSTAGSVFAGGSEGS...................RETPCVIQSIIE.-------------
A9TP04_PHYPA/132-540DH-LVEDHKGRVLRKQFSDIPGSPLCEV..........................AASASVIGCKVH.-------------
Q02BJ1_SOLUE/128-518EL-MTGEAAFREIYTVQQQLGVTRQSGV..........................RSAGVVIDSVLS.-------------
D7UCW9_VITVI/146-545DH-LSGADSGLVGRRHLCSVPATTVSDI..........................AASAVVISSKIA.-------------
W5M6I6_LEPOC/116-528FH-LTGDPNLRAEL....GLLSDAFSVCPADASK....................NPAVCIIHSVLH.-------------
E9PSM4_RAT/106-522LH-FTSDSTLRRARLTVHSFQSLQVSLNP.........................PMKQPVSFTVYW.-------------
M0RP18_MUSAM/153-575DH-LGGSNSALVGRRHLCSMPETTSCDI..........................AASAVILSSKIA.-------------
F0ZWK1_DICPU/160-551EH-FTVNFPRL.......GFNKIVYSVINNNS......................KSNRFNIESMIQ.-------------
D4M6A5_9FIRM/114-496SL-VTKDVQDYEFLDWKMQVNSAVQ.............................KEGFAAHNAYVG.-------------
U5D0Y7_AMBTC/152-554DH-LGEAHSRYVGRRHLCSIPATTECDI..........................AASAVILSSKLA.-------------
M4AF92_XIPMA/111-517FH-LTEDEAFRGEL....DLLSSAFSVNANEN......................FSGCCIMYSVLD.-------------
V8P3W9_OPHHA/98-513YH-YTSDRKMKLEL....GLLPNVFSICSNKAEDL...................DKSACIIHSMLS.-------------
B9I905_POPTR/194-593DH-LSGASSELVGRRHLCSIPATTSSDI..........................AASAVVLSSKIE.-------------
M3ZWZ0_XIPMA/97-496VD-...............RLTSDWTVGN.....TLSHIQVN.ENLL........SEGARIINSILD.-------------
B7S4B1_PHATC/94-530DF-YTHGCHSNTE.....PLTASMSPPQALCREFGTSLALTRRLEAF...............TLVG.-------------
Q54NH4_DICDI/127-556EH-FTINFPKL.......GFKNLIFSEIGSGINNNN..................NNNSVILHSILL.-------------
H3ANF5_LATCH/114-531FH-FTADTKLKEEL....RLLSEAFSICPSMSKEG...................EKAVCIIWSILD.-------------
H2YSE9_CIOSA/106-502EI-LTKDSGFLDLV....GSDGLAYCADQTAK......................RSMYSIAASVIY.-------------

PF16314

R6X3X4_9PORP/7-660KD.DETYLVPGV....NLRSVGTIRDAQKWPKRDKRTDQQRLDMINYNLLSPYTIYKMMKAVGILKN.LQELVGET...S
Q5LHM9_BACFN/5-659QQ.NTTYLVPGV....NLRSVGTIRDAQKWPKRDKRTDPNRLDYINYNLLSPYTIQKMFKGRSILKE.LKRVSGET...S
H1XPF7_9BACT/41-722KA.NEINIYPGYWFKHNMYALA..RNSWKFKNRDKRVIKEQ..HIETDYLAPDTVESMISGIEILRQGICQAAGKEFSIA
R5GF65_9PORP/2-659DD.NKSYLVPGR....NLLSVGTMRDAKKWPARDKRPETIRPDCINYNLLSPFTIGKMERAYNKLLS.LKKFLGGH...E
E4T878_PALPW/4-655NE.GESNLLPAI....NLHSAGTKRDVQKWQKRDIRTDEIKLDPINFDFLSPYTLSKALKGINILNG.LLENMEAG...A
F3ZTN4_9BACE/4-657NN.DQSILVPGV....NLRSVGTIRDAKKFPKRDKRTDPHPLDFLNFNLLSPYTIQKMLKGIDVLEN.LKMTCGE....S
R5PLK0_9BACT/5-659KN.NQTYLVPGV....NLRSVGTIRDALKWPKRDKRTDPCKLDYINFNLLSPYTIRKMIAGIEVLHS.LRSVSGET...S
Q7MTP4_PORGI/8-662DR.NESYLVPGI....NLRSVGTIRDAKKWPARDKRKDPDLLDNINFNLLSPFTAGKMMRGSRKLKK.LRKILGSE...G
R5VAS6_9BACT/7-661KN.NQTYLVPGV....NLRSVGTIRDALKWPKRDKRTDPHQLDCINFNLLSPYSIQKMLTGMEVLNS.LRQVSGET...S
F9ZCM7_ODOSD/4-657QN.NQTYLVPAV....NLRSVGTIRDAQKWPKRDKRKDSHQLDYINFNLLSPYTIQKMLSGIEVLRT.LQQVSGET...S
R5I224_9BACT/5-658SE.GRSYLVPGV....NLRSVGLFRDIRKWPSRDRRSLSGRMDNISFEVFSPYTAGAMLSGRDRLVQ.MLSEERFS...G
F4KKJ2_PORAD/2-657ND.NQTYLVPGT....NLRSVGTIRDTKKWPKRDKRHPEEKLDCINFNLLSPYTVGKMYKGWHKLKA.LETHLGSS...N
A6LH30_PARD8/5-658KD.DETYLVPGI....NLRSVGTIRDAQKWPKRDKRTDPDRLDMINYNLLSPYTIQKMLKAVDILKN.LQALVGET...S
R5LL62_9SPIR/12-659HGYHQTRLIPAL....NLFGVGLARDENKWIERDRRTGDKK.DLIIFEVFSPYTVSKMINAEKILKD.IRKNKDENNKKG
R6SVY6_9BACE/4-659QQ.GSTYIVPGV....NLKSVGTIRDVKKWPERDRRKDPHRLDHINFNHLSPFTVQKMFSGIDILER.LKEASGLR...A
R5VUQ7_9BACE/5-659EK.NTTYLVPGV....NLRSVGTIRDAQKWPKRDQRKDPNRLDQINYNLLSPYTIQKMMAGRQILKE.LARVSGET...S
X5DE87_9BACT/9-663SK.DESILVPGI....NLKSIGTIRDTQKWPKRDKRTDSNLLDLINFNLLSPYTIDKMIKGREKLME.LQKSSDEN...T
H1XNG4_9BACT/3-653VA.GRTLLTPGM....NLFTVGTRRDSAKWPKRDRRKGENKLDLIHFDLFSPFVINRVRKGKKILAE.LYAAANPK...Q
R5IQU5_9PORP/5-659KG.SETYIVPGV....NLRSVGTIRDALKWPKRDNRKDPEKLDCINFNLLSPYTIQKMLTAIDVLRS.LQKSSGET...S
C0R0B6_BRAHW/11-658HGYHQTRLIPAL....NLFGVGLSRDENKWRERDRRKGDKK.DLIIFNVFSPYTVSKMINSEKILEE.IKNERNNNN..G

PF00132

A0A0F6C616_ECOLX/86-121-----------------------------------PITIKH--P.....N-SV--VY--------------DH--TM--I
A0A0F7WUQ7_CHLPN/153-188-----------------------------------ANCLIH--P.....K-VV--IR--------------ER--VL--M
A0A0F7WUQ7_CHLPN/117-152-----------------------------------KNVTIE--P.....Y-VV--IS--------------QH--AH--I
LPXD_ECOLI/109-144-----------------------------------NNVSIG--A.....N-AV--IE--------------SG--VE--L
LPXA_ECOLI/65-100-----------------------------------EVNQDL--K.....Y-AG--EP--------------TR--VE--I
LPXA_ECOLI/108-143-----------------------------------SDNLLM--I.....N-AH--IA--------------HD--CT--V
LPXD_ECOLI/222-257-----------------------------------NGVIID--N.....Q-CQ--IA--------------HN--VV--I
A0A0F7WUQ7_CHLPN/231-266-----------------------------------EGTKID--N.....Q-VQ--VA--------------HH--VE--I
A0A0F6C616_ECOLX/122-157-----------------------------------RFFHAN--I.....Y-SY--VA--------------HD--CQ--I
LPXA_ECOLI/17-52-----------------------------------ANAHIG--P.....F-CI--VG--------------PH--VE--I
YVOF_BACSU/59-94-----------------------------------FALMVM--P.....D-IM--FP--------------EK--IS--V
EI2BE_HUMAN/416-451-----------------------------------ERVTLK--P.....R-SV--LT--------------SQ--VV--V
YBB2_SCHPO/366-401-----------------------------------NSVKVQ--A.....I-TV--MG--------------AD--CI--V
E7LS70_YEASV/289-323-----------------------------------CNSTIK--......N-HS--LV--------------KS--TI--V
A0A0E1AGQ2_STAAU/80-114-----------------------------------QSPGTY--......F-NN--FS--------------AV--IY--I
LPXA_SYNY3/151-186-----------------------------------SQARIS--G.....V-LG--VH--------------QF--VH--I
O58150_PYRHO/245-280-----------------------------------TRAKII--G.....R-VK--IE--------------EG--AQ--I
O66933_AQUAE/320-355-----------------------------------NDVKIG--K.....R-VK--AK--------------EG--VV--I
Q48392_KLEOX/245-280-----------------------------------DHVIVQ--G.....Q-VG--TS--------------GH--IA--I
LPXD_AQUAE/252-287-----------------------------------KNVILA--G.....Q-VG--VA--------------DH--VE--I
Q46674_ECOLX/152-187-----------------------------------EETFVG--S.....V-TV--VN--------------GQ--LK--L
EPSM_BACSU/156-191-----------------------------------EGAHVG--T.....G-AS--VI--------------PQ--II--I
F6RW81_MACMU/98-133-----------------------------------DNNVIE--S.....K-AY--VG--------------RN--VI--L
WBPD_PSEAE/14-49-----------------------------------SDSRVW--H.....F-VH--IC--------------AG--AR--I
Q79H46_BORPE/13-48-----------------------------------ANSRIW--H.....W-VH--IC--------------GG--AE--I
O86157_CAMJU/151-186-----------------------------------KNCFLG--I.....N-SC--VL--------------PN--LS--L
YBB2_SCHPO/287-322-----------------------------------PNAIVS--K.....G-AK--IG--------------PN--VS--I
F6RW81_MACMU/8-43-----------------------------------PGAVVC--V.....E-SE--IR--------------GD--VT--I
Q46674_ECOLX/104-139-----------------------------------KMCILN--R.....D-TR--IH--------------DA--VV--I
LPXD_CHLTR/152-187-----------------------------------EHSYIH--P.....R-VV--IR--------------ER--VS--I
P74589_SYNY3/319-354-----------------------------------RGCRIE--R.....R-VQ--VL--------------EG--AV--I
Q48392_KLEOX/113-148-----------------------------------DGCIFM--P.....G-VK--IM--------------NG--VI--I
LPXD_NEIMB/105-140-----------------------------------PGATVP--T.....S-CE--IG--------------AN--VY--I
O27626_METTH/368-403-----------------------------------DGVKTG--I.....N-SS--FN--------------PG--VK--V
GLMU_AQUAE/401-436-----------------------------------KSAFIG--S.....N-SL--LI--------------AP--IR--V
GLMU_MYCTU/405-440-----------------------------------SHVRTG--S.....D-TM--FV--------------AP--VT--I
GLMU_NEIGO/393-428-----------------------------------DEVRIG--S.....N-CV--LV--------------AP--VT--L
GLMU_SYNY3/390-425-----------------------------------SGTKTG--A.....N-SV--FV--------------AP--VQ--V
A0A077Z6C0_TRITR/394-429-----------------------------------DDVFVG--S.....D-TQ--LV--------------AP--VT--V
Q56274_9PROT/119-154-----------------------------------NDVFIG--S.....D-SQ--LV--------------AP--VN--I
Q48792_LISMN/188-223-----------------------------------DNVFVG--C.....N-SN--LI--------------AP--VK--V
GLMU_BACCL/51-86-----------------------------------NGAFIG--C.....N-VN--LI--------------AP--VT--V
O33923_CORAM/34-69-----------------------------------NGVFIG--C.....N-SN--LV--------------AP--VT--V
LPXD_CHLTR/116-151-----------------------------------DHVCIE--P.....Y-AV--VC--------------QH--AH--V
C9K1L0_KLEPN/162-197-----------------------------------ENCLIG--N.....N-VA--IN--------------KG--CI--I
A0A0T7RR04_SALET/149-184-----------------------------------NCCWIG--D.....N-AV--IL--------------AG--SE--I
LPXD_SYNY3/118-153-----------------------------------EDVSIG--P.....H-VV--IY--------------PN--VT--L
Y3034_MYCTU/218-253-----------------------------------PDTWIG--V.....K-VS--VL--------------RG--TT--I
WBBJ_ECOLI/132-167-----------------------------------QRVWLG--E.....N-VT--VL--------------PG--TI--I
P72981_SYNY3/162-197-----------------------------------NNVFIS--A.....G-VG--LG--------------PG--VA--I
O59588_PYRHO/365-400-----------------------------------HNVKTG--I.....N-VS--IY--------------PG--RK--I
LPXD_BRUA2/128-163-----------------------------------DGATVE--A.....G-AV--IG--------------SG--VT--I
H9L4Q4_VIBCH/121-156-----------------------------------KHSILG--A.....G-CV--VL--------------PK--VI--V
WCAB_ECOLI/108-143-----------------------------------NGVELG--A.....N-VI--IL--------------GD--IT--L
SRPH_SYNE7/260-295-----------------------------------DDVVIY--A.....G-AT--LL--------------GR--IT--V
P93544_SPIOL/265-300-----------------------------------DGVLIG--A.....G-AT--IL--------------GN--VR--I
CYSE_BUCAP/194-229-----------------------------------KNVTIG--A.....G-AK--IL--------------GN--IE--V
CYSE_BACSU/118-153-----------------------------------DDALIA--T.....G-AK--VL--------------GS--IT--V
O69218_AZOVI/117-152-----------------------------------DGVIVG--A.....G-AK--IL--------------GP--FT--V
NIFP_AZOCH/118-153-----------------------------------DVVLVG--A.....G-AK--IL--------------GP--IT--I
CYSE_STAXY/120-155-----------------------------------DNVLIA--A.....G-AK--VL--------------GN--IT--I
Q7AQF4_MYCLE/117-152-----------------------------------DRVTIG--A.....G-AK--VL--------------GA--IK--I
CYSE_SYNE7/117-152-----------------------------------NNVVVG--A.....G-AK--VL--------------GN--IQ--I
CYSE_HELPY/116-151-----------------------------------NRVVVG--A.....G-AK--VL--------------GA--IC--V
YRDA_ECOLI/97-132-----------------------------------NRVLVG--M.....G-SI--LL--------------DG--AI--V
Q9ZD31_RICPR/89-124-----------------------------------SNAFIG--M.....S-AT--IM--------------DY--AV--I
YTOA_BACSU/87-122-----------------------------------KNALIG--M.....G-SI--IL--------------DG--AE--I
O26372_METTH/143-178-----------------------------------QGASIG--A.....N-ST--FL--------------SR--IE--V
DAPH_BACSU/165-200-----------------------------------DDVVIG--A.....N-AV--VL--------------EG--VT--V
DAPD_ECOLI/175-210-----------------------------------DNCFIG--A.....R-SE--VV--------------EG--VI--V
F3K8R5_PSEAJ/175-210-----------------------------------DNVFIG--A.....R-SE--VA--------------EG--VI--V
O59257_PYRHO/88-123-----------------------------------NYVIIG--I.....S-SV--IL--------------DG--AK--I
O67576_AQUAE/90-125-----------------------------------NNILVG--M.....G-AV--VM--------------DG--VE--I
CAIE_ECOLI/88-123-----------------------------------RDALVG--M.....N-SV--IM--------------DG--AV--I
PAAY_ECOLI/88-123-----------------------------------RNALVG--M.....N-AV--VM--------------DG--AV--I
Q45929_COXBE/117-152-----------------------------------DHSVIA--I.....G-AI--VM--------------NN--AI--I
O27625_METTH/74-109-----------------------------------DNVLIG--M.....N-ST--IL--------------NG--AV--I
Y3753_PSEAE/87-122-----------------------------------DYSLVG--I.....N-AV--IL--------------NG--AK--I
Y304_METJA/77-112-----------------------------------DNVLVG--M.....N-AT--IL--------------NG--AK--I
WBPD_PSEAE/101-136-----------------------------------KGATLG--A.....N-CT--IV--------------CG--VT--I
YVOF_BACSU/106-141-----------------------------------DEVMIG--A.....N-TT--IL--------------PG--VK--I
F7YJG3_VIBA7/98-133-----------------------------------DNASIG--A.....N-TT--IL--------------PG--VT--I
GLMU_NEIGO/264-299-----------------------------------QDVVID--V.....N-VV--IE--------------GE--VE--L
O59364_PYRHO/307-342-----------------------------------ENVYIG--R.....G-AV--IE--------------PG--SV--I
LPXD_RICRS/123-158-----------------------------------KNCYIG--H.....N-VV--IE--------------DD--VI--I
LPXD_PASMU/111-146-----------------------------------KNVSIG--A.....N-AV--IE--------------DG--VT--L
O87774_LACSK/117-152-----------------------------------DGAWLG--M.....R-AL--IM--------------PG--VH--I
A0A0E1AGQ2_STAAU/130-165-----------------------------------NYSWIG--M.....N-SV--IL--------------PG--VE--L
O68047_RHOCA/110-145-----------------------------------SDVWIG--R.....D-TI--IQ--------------AG--VR--I
Q2G1K1_STAA8/119-154-----------------------------------NDVWIG--A.....N-VI--IM--------------DG--LT--I
Q8U5W2_AGRFC/180-215-----------------------------------HDVWIG--H.....N-AA--IM--------------PG--VR--I
MATA_LYSSH/77-112-----------------------------------NDVWIG--Q.....N-VT--IM--------------PG--VI--I
O87276_9STAP/118-153-----------------------------------NDVWIG--R.....D-VT--IM--------------PG--VK--I
CAT4_PSEAE/110-145-----------------------------------HDVWIG--T.....E-AM--FM--------------PG--VR--V
Q79EF3_SYNY3/114-149-----------------------------------NDVWIG--Y.....E-AV--IM--------------PG--IK--V
O86929_SALTM/110-145-----------------------------------NDVWIG--S.....E-AM--VM--------------PG--IK--I
CAT4_AGRFC/109-144-----------------------------------NDVWIG--S.....E-AI--IM--------------PG--IT--V
O87158_VIBCL/104-139-----------------------------------NHVQVG--A.....G-AI--IL--------------PG--VE--V
Q56045_STRTR/106-141-----------------------------------RNCWIG--S.....Q-VT--IL--------------KG--VT--I
M5JVF4_STREE/129-164-----------------------------------ENVWIG--A.....N-SI--VL--------------KG--VS--I
THGA_LACLA/133-168-----------------------------------ENVWLG--A.....G-VI--VL--------------PG--VR--I
Y1064_METJA/159-194-----------------------------------DDVWIG--T.....G-VK--IL--------------KG--VK--I
YA39_SCHPO/150-185-----------------------------------DNVWIG--M.....G-VI--VL--------------PG--VT--I
E7KQ17_YEASL/130-165-----------------------------------DNVWIG--G.....G-VS--II--------------PG--VN--I
J0UV19_RHILV/131-166-----------------------------------RHAWIG--G.....G-AI--IL--------------PG--VT--I
THGA_ECOLI/131-166-----------------------------------NNVWIG--S.....H-VV--IN--------------PG--VT--I
MAA_BACSU/130-165-----------------------------------DQVWIG--G.....R-AV--IN--------------PG--VT--I
H7C7I4_CAUCR/142-177-----------------------------------AACHLG--P.....A-SA--LA--------------GG--VS--V
O86157_CAMJU/109-144-----------------------------------AKAKIE--K.....G-VI--LN--------------TS--SV--I
LPXA_CHLTR/61-96-----------------------------------NKPQDL--K.....F-KG--EK--------------TF--VE--I
LPXA_RICRS/63-98-----------------------------------QPPQIL--K.....Y-AN--ER--------------SS--TI--I
LPXA_HAEIN/65-100-----------------------------------EVNQDL--K.....Y-KG--EA--------------TK--TI--I
LPXA_SYNY3/73-108-----------------------------------CEPQDL--K.....Y-KG--GE--------------SW--VK--I
LPXA_AQUAE/60-95-----------------------------------EAPQHL--K.....Y-EG--EE--------------TS--VE--I
Q45929_COXBE/39-74-----------------------------------DNYFIA--D.....S-AD--VI--------------GS--VI--I
YRDA_ECOLI/12-47-----------------------------------QRVMID--D.....S-SV--VI--------------GD--VR--L
CAIE_ECOLI/10-45-----------------------------------PTAFVH--P.....S-AV--LI--------------GD--VI--V
PAAY_ECOLI/10-45-----------------------------------EESFVH--P.....T-AV--LI--------------GD--VI--L
O59257_PYRHO/10-45-----------------------------------PSAFVD--E.....N-AV--VI--------------GD--VV--L
YTOA_BACSU/9-44-----------------------------------PTAFIA--D.....N-AT--IT--------------GD--VV--I
Q9ZD31_RICPR/10-45-----------------------------------KSAYVA--K.....N-SA--LI--------------GD--VV--I
O67576_AQUAE/11-46-----------------------------------ESVYLS--E.....N-VV--VI--------------GD--VE--I
O66933_AQUAE/251-286-----------------------------------EGTEIP--E.....N-VS--LK--------------GT--VI--L
DAPH_BACSU/121-156-----------------------------------EGTMID--M.....N-VV--LG--------------GR--AT--V
DAPD_BUCAP/131-166-----------------------------------QGTMID--T.....W-TT--VG--------------SC--AQ--I
F3K8R5_PSEAJ/131-166-----------------------------------EGTMID--T.....W-ST--VG--------------SC--AQ--V
Q56274_9PROT/77-111-----------------------------------AGSKAN--H.....L-SY--L.--------------GD--AE--I
O59588_PYRHO/306-340-----------------------------------DNSNAP--H.....L-NY--V.--------------GD--SI--I
O27626_METTH/309-343-----------------------------------DGTNIN--H.....L-SY--V.--------------GD--SV--I
P74589_SYNY3/249-284-----------------------------------ENTTID--P.....T-AI--LT--------------PP--LA--I
F7YJG3_VIBA7/12-47-----------------------------------INTKIW--Q.....F-SV--VL--------------PN--AI--I
EI2BE_SCHPO/330-364-----------------------------------AYTKVG--D.....A-SV--V.--------------AN--TI--I
P72757_SYNY3/62-97-----------------------------------EQTAIA--P.....G-CL--VI--------------GP--VT--I
O30712_SYNP2/59-94-----------------------------------AGAIIG--A.....G-CL--II--------------GQ--CS--V
LPXD2_ARATH/98-133-----------------------------------EKAVLG--A.....E-VH--VG--------------SG--TV--I
GLGC_MYCLE/328-362-----------------------------------SNVVVD--N.....G-AI--V.--------------EG--SV--I
P71784_MYCTU/106-141-----------------------------------ENVFLL--E.....D-NT--IQ--------------PF--VS--I
Q2G1K1_STAA8/49-83-----------------------------------EYSYIG--F.....G-SD--F.--------------NN--VE--V
EI2BE_SCHPO/387-422-----------------------------------NNCSIE--D.....G-AI--VA--------------AG--VV--I
EI2BE_YEAST/382-416-----------------------------------NNSIID--......H-SL--IA--------------SN--AT--L
LPXA_CHLTR/103-138-----------------------------------NNCLIM--P.....W-AH--IA--------------HN--CS--V
LPXA_RICRS/106-141-----------------------------------NNNLFM--V.....G-VH--IG--------------HD--CK--I
LPXA_ALLVD/103-138-----------------------------------SHNYWM--A.....F-SH--AG--------------HD--CV--V
LPXA_AQUAE/103-138-----------------------------------DNVMLM--A.....Y-SH--VA--------------HD--CV--V
LPXA_NEIMB/104-139-----------------------------------DDNWIM--A.....Y-CH--LA--------------HD--CV--I
LPXA_SYNY3/115-150-----------------------------------DRNLLM--A.....Y-AH--VA--------------HN--CV--I
LPXA_HELPY/104-139-----------------------------------DKNLLM--A.....Y-VH--VA--------------HD--CV--I
LPXA_HAEIN/108-143-----------------------------------NNNLLM--I.....N-VH--VA--------------HD--CQ--I
LPXA_PROMH/108-143-----------------------------------NDNLLM--I.....N-TH--VA--------------HD--CI--I
LPXD_HAEIN/225-260-----------------------------------DNVIID--N.....L-CQ--IA--------------HN--VH--I
LPXD_SYNY3/231-266-----------------------------------KNTKLD--N.....M-VH--VA--------------HG--CR--I
LPXD_AQUAE/216-251-----------------------------------KNTKID--N.....L-VM--VA--------------HN--CK--V
LPXD_HELPY/216-251-----------------------------------EGVKID--N.....L-VQ--IG--------------HN--CV--L
LPXD_NEIMB/224-259-----------------------------------NGTKID--N.....Q-VQ--IG--------------HN--CK--I
LPXD2_ARATH/199-234-----------------------------------DDTKID--N.....L-VQ--IG--------------HN--VI--I
LPXD_BRUA2/240-275-----------------------------------EGTKID--N.....L-VQ--IA--------------HN--VR--I
Q48392_KLEOX/209-244-----------------------------------RGTKID--N.....Q-IQ--IG--------------HD--CH--I
LPXD_RICRS/235-270-----------------------------------DLCRID--N.....L-VQ--IG--------------HG--VK--I
LPXD_CHLTR/230-265-----------------------------------EGSKID--N.....L-VQ--IA--------------HQ--VE--V
LPXA_BRUA2/106-141-----------------------------------DNCSFL--A.....Y-AH--VA--------------HD--CD--I
O26372_METTH/95-130-----------------------------------SNVSIQ--S.....N-VY--LP--------------KN--SY--I
F7YJG3_VIBA7/48-83-----------------------------------NNVTIK--C.....G-VQ--IW--------------DG--IL--I
LPXD_NEIMB/147-182-----------------------------------DEVVLH--P.....N-AV--VY--------------YG--CT--L
LPXD_SYNY3/154-189-----------------------------------NDSVLH--G.....N-CT--IH--------------ER--TQ--I
LPXD_AQUAE/139-174-----------------------------------DNTVIF--S.....G-VH--IY--------------RN--TV--I
LPXD_SALTY/145-180-----------------------------------AGSRLW--A.....N-VT--IY--------------HD--IQ--I
LPXD_PASMU/147-182-----------------------------------AYTQLW--A.....N-VS--VY--------------HE--VE--I
LPXD_HAEIN/148-183-----------------------------------SGTQLW--A.....N-VT--VY--------------HN--VE--I
LPXD_YEREN/145-180-----------------------------------AGSRLW--A.....N-VS--VY--------------HE--VV--I
LPXD_BRUA2/164-198-----------------------------------RNSYIA--P.....G-VS--VQ--------------CA--F.--I
LPXD_HELPY/120-155-----------------------------------ENSLIY--P.....G-VV--IA--------------DG--VK--I
LPXD_RICRS/159-193-----------------------------------RNARIE--Q.....H-VS--IN--------------YA--I.--I
LPXA_NEIMB/1-36-----------------------------------PTAVID--P.....K-AE--LD--------------SG--VK--V
MPG1_SCHPO/249-284-----------------------------------GNVLID--P.....S-AT--IG--------------KN--CK--I
E7LS70_YEASV/248-283-----------------------------------GNALID--P.....T-AK--IS--------------ST--AK--I
G0RMQ5_HYPJQ/251-286-----------------------------------GNVMIH--P.....S-AK--IG--------------KN--CR--I
MPG1_CANAL/249-284-----------------------------------GNVLID--P.....T-AK--IH--------------PS--AL--I
O27787_METTH/325-360-----------------------------------EDCEIG--A.....G-CA--ID--------------RC--AI--I
GLMU_SYNY3/313-348-----------------------------------DGCRLG--P.....Y-SH--VR--------------GE--AD--I
GLMU_AQUAE/324-359-----------------------------------KRAVVG--P.....F-AR--IR--------------NE--SV--I
GLMU_BACSU/317-352-----------------------------------NDVNIG--P.....F-AH--IR--------------PD--SV--I
Q48792_LISMN/111-146-----------------------------------DDVQIG--P.....Y-AH--LR--------------PE--SD--I
GLMU_MYCTU/328-363-----------------------------------DGAAVG--P.....F-TY--LR--------------PG--TA--L
GLMU_NEIGO/316-351-----------------------------------ENNRIG--P.....Y-AR--LR--------------PQ--AR--L
A0A077Z6C0_TRITR/317-352-----------------------------------AACTIG--P.....F-AR--LR--------------PG--AE--L
GLMU_HAEIN/317-352-----------------------------------EKAAIG--P.....F-SR--LR--------------PG--AE--L
EI2BE_YEAST/330-364-----------------------------------QSCKIG--K.....C-TA--IG--------------SG--TK--I
LPXA_ALLVD/12-47-----------------------------------DSVTVG--P.....Y-SI--IE--------------SG--AV--I
LPXA_SYNY3/25-60-----------------------------------ATVQVG--A.....F-SV--IG--------------EK--VT--I
LPXA_RICRS/15-50-----------------------------------KNVKIG--P.....Y-CI--IG--------------PE--VV--L
LPXA_CHLTR/13-48-----------------------------------NNVTIE--P.....Y-AI--VK--------------KN--VT--L
A0A0F7WUZ8_CHLPN/13-48-----------------------------------KDVVIE--P.....Y-VV--IK--------------AT--VT--L
LPXA_BRUA2/15-50-----------------------------------QGVSVG--P.....F-CH--VQ--------------SG--AI--I
LPXA_HAEIN/17-52-----------------------------------EDVFIG--P.....F-CI--IE--------------GT--VE--I
LPXA_YEREN/17-52-----------------------------------AGVHIG--P.....F-CF--VG--------------SQ--VE--I
LPXA_PROMH/17-52-----------------------------------ANVRIG--P.....F-CV--IG--------------SH--VE--I
O27787_METTH/255-290-----------------------------------RDVVIG--D.....R-VR--IV--------------GP--AV--L
O58775_PYRHO/315-344-----------------------------------EGVVVG--K.....D-VI--IK--------------EN--AV--I
H7C7I4_CAUCR/106-141-----------------------------------EGVAVM--A.....G-VA--IN--------------AD--SW--I
EPSM_BACSU/102-137-----------------------------------EGTVIM--A.....G-AI--IQ--------------AD--AR--I
O58775_PYRHO/245-280-----------------------------------ENVEIP--D.....D-VE--VQ--------------GP--VY--I
GLMU_AQUAE/272-307-----------------------------------PDVEIF--P.....D-VM--LK--------------GK--TK--I
GLMU_SYNY3/262-297-----------------------------------ADVIIE--P.....N-TH--LR--------------GK--TV--I
GLMU_BACSU/266-301-----------------------------------SDTVIY--P.....G-TV--IK--------------GE--VQ--I
GLMU_MYCTU/277-312-----------------------------------RDTVIH--P.....G-TQ--LL--------------GR--TQ--I
Q48792_LISMN/60-95-----------------------------------QDTVIE--P.....G-VM--LR--------------GK--TV--I
O84634_CHLTR/59-94-----------------------------------EGAYVE--S.....G-AY--IC--------------GP--CI--I
A0A0F7YVQ3_CHLPN/60-95-----------------------------------EDAYVE--S.....G-AY--IV--------------GP--CI--L
O26372_METTH/41-76-----------------------------------KNPLLR--S.....N-TV--IY--------------ND--VT--I
EI2BE_HUMAN/359-393-----------------------------------SGTVIG--S.....N-CF--IT--------------NS--V.--I
LPXA_HELPY/13-48-----------------------------------KGVEIG--E.....F-CV--IG--------------DG--VK--L
O27626_METTH/256-291-----------------------------------EGTIIR--S.....G-TY--IQ--------------GP--VY--I
O59588_PYRHO/253-288-----------------------------------EGTIVR--S.....G-SY--II--------------GP--VK--I
LPXA_AQUAE/12-47-----------------------------------EDVEIG--A.....Y-TV--IQ--------------GN--VK--I
O59364_PYRHO/256-290-----------------------------------SKCLIR--NPKIVGF-AV--LG--------------NN--VK--V
LPXD_AQUAE/103-138-----------------------------------MGSFIG--D.....F-VV--IG--------------KN--VK--I

PF14602

DAPD_SULDN/300-333-----------------------------------KNTLLG--A-----N.ST..C.--------------.G..IP--L
Q8FQF4_COREF/259-293-----------------------------------EDCTFG--V-----S.SG.VI.--------------.G..VS--L
E8NC18_MICTS/219-252-----------------------------------ARTLLG--A-----N.AG..I.--------------.G..IS--L
A1STS6_PSYIN/252-285-----------------------------------ENSLLG--A-----N.AG..L.--------------.G..IP--L
Q8U2R4_PYRFU/37-72-----------------------------------KNCNIG--K-----D.VYIDV.--------------.S..VE--I
E8V741_TERSS/175-210-----------------------------------DDCLIG--G-----N.TG..VY--------------EG..TI--V
A1WX25_HALHL/176-211-----------------------------------DDCFIG--A-----R.SE..IV--------------EG..VT--V
Q15QD8_PSEA6/210-243-----------------------------------KNSMVG--A-----N.AG..I.--------------.G..IS--L
A0RN31_CAMFF/297-330-----------------------------------KKCLLG--A-----N.SV..T.--------------.G..VP--L
D5V5C0_ARCNC/297-330-----------------------------------ENTLLG--A-----N.SC..T.--------------.G..TA--I
A0JYR5_ARTS2/248-281-----------------------------------ERVLLG--A-----N.SG..V.--------------.G..IS--I
B9L6I2_NAUPA/287-320-----------------------------------RNTLLG--A-----N.SV..T.--------------.G..IP--L
D7GF12_PROFC/226-259-----------------------------------KGCLLG--A-----E.SG..C.--------------.G..IA--L
E2SBF8_9ACTN/226-259-----------------------------------ENSLLG--A-----N.SG..I.--------------.G..IS--L
DAPD_ZYMMO/171-206-----------------------------------DNAFIG--A-----R.SEVAE.--------------.G..VT--V
Q0VQG2_ALCBS/253-286-----------------------------------EGCLLG--A-----N.AG..T.--------------.G..IP--L
DAPD_BLOFL/180-215-----------------------------------DNCFIG--A-----R.SE..IA--------------EG..VI--I
C1A408_GEMAT/176-211-----------------------------------DDVVVG--G-----N.CG..VY--------------EG..TV--V
B0VHT1_CLOAI/167-202-----------------------------------DDVFVG--G-----N.TG..IY--------------EG..II--V
D9SGU0_GALCS/175-210-----------------------------------DNCFVG--A-----R.SE..IV--------------EG..VI--L
C6Y287_PEDHD/166-201-----------------------------------DNCFLG--S-----R.AIVVE.--------------.G..VK--V
C4LHT9_CORK4/233-266-----------------------------------QRCLLG--A-----N.SG..V.--------------.G..IS--L
A7ZCR0_CAMC1/300-333-----------------------------------KHCLLG--A-----N.SV..T.--------------.G..VP--L
D7WDN8_9CORY/234-268-----------------------------------ADCIIH--P-----S.AG.II.--------------.D..LD--L
D1BYT1_XYLCX/243-276-----------------------------------ERALLG--A-----N.AG..A.--------------.G..IA--L
E3GF87_EUBLK/173-208-----------------------------------DEVLIG--A-----N.AV..IL--------------EG..VK--I
Q6NHZ9_CORDI/229-263-----------------------------------ANCVFG--L-----GSAV..M.--------------.G..IN--L
B2V696_SULSY/121-156-----------------------------------KNCIIH--P-----F.CY..I.--------------.GENTQ--I
D1BKM4_SANKS/225-258-----------------------------------RRSLLG--A-----N.AG..L.--------------.G..IV--L
DAPD_BEII9/183-218-----------------------------------DDCFIG--A-----R.SE..IV--------------EG..VI--I
GLMU_AGRRK/379-414-----------------------------------ANSFIG--S-----N.SSLVA.--------------.P..VR--I
C8XJN1_NAKMY/241-274-----------------------------------AHCLLG--A-----N.SG..V.--------------.G..IS--L
B3ET32_AMOA5/167-202-----------------------------------DDVFIG--A-----K.CIVVE.--------------.G..VI--I
Q2GI44_EHRCR/182-217-----------------------------------DNCFIG--A-----R.SE..IV--------------EG..VV--V
D3UHQ9_HELM1/290-323-----------------------------------RNCLLG--V-----N.SS..T.--------------.G..IS--L
C7MVH9_SACVD/242-275-----------------------------------ERCLIG--A-----N.GG..I.--------------.G..IS--L
B3QZC3_CHLT3/182-217-----------------------------------DEVMIG--G-----N.CG..IY--------------EG..TI--V
E3PSU4_CLOSD/168-203-----------------------------------DDVLVG--A-----N.AV..VL--------------EG..VV--I
DAPH_STRSV/161-196-----------------------------------DNVLIG--A-----N.AV.VI.--------------EG..VQ--I
GLMU_STRSY/395-429-----------------------------------DNAFVG--S-----N.ST..II--------------AP..VT--I
C5AZJ3_METEA/178-213-----------------------------------DNCFVG--A-----R.AE..VA--------------EG..VI--I
D9Q9N2_CORP2/229-261-----------------------------------ERCLLG--A-----N.SG..C.--------------.G..IP--L
D9Q9N4_CORP2/230-263-----------------------------------NNCRLG--L-----GAAV..I.--------------.G..ID--L
D9TDT4_MICAI/233-265-----------------------------------ERSLVG--A-----N.AG..V.--------------.G..IT--L
E0TE45_PARBH/181-214-----------------------------------DNCFIG--A-----R.SE..VA--------------EG..VI--V
E4PGY8_MARAH/252-284-----------------------------------ENCLIG--A-----N.AG..I.--------------.G..IP--L
F0P119_WEEVC/165-199-----------------------------------DGAFIG--S-----R.CI..VV--------------EG..VR--V
G2NH01_STREK/246-278-----------------------------------ERCLIG--A-----E.AG..I.--------------.G..IA--L
DAPD_HELPY/301-334-----------------------------------KNCLLG--A-----N.SV..T.--------------.G..IS--L
Q2G043_STAA8/106-141-----------------------------------SNTLIG--A-----N.AT..IL--------------PG..IT--I
Q2IG91_ANADE/168-203-----------------------------------DGCFIG--S-----R.CILVE.--------------.G..VL--V
Q79VH2_CORGL/241-274-----------------------------------QNCNFG--V-----S.SG.II.--------------.G..VS--L
GLMU_STRR6/394-428-----------------------------------DNVFVG--S-----N.ST..II--------------AP..VE--L
DAPD_BIFLO/246-278-----------------------------------EHSLLG--A-----N.AG..I.--------------.G..IS--L
DAPD_VIBCH/253-285-----------------------------------ENSLLG--A-----N.AG..L.--------------.G..FP--L
R6X2K4_9PORP/76-110-----------------------------------KRCFIG--V-----N.AI..IM--------------CG..VK--V
R7JIP3_9BACT/169-203-----------------------------------DDCFIG--S-----R.AI..VV--------------EG..AH--I

PF07959

W5LBD8_ASTMX/112-511-----------------------------------PTASVS..V-----G-SV--VE.......FSRIE..AK--AT..V
H0Z730_TAEGU/55-450-----------------------------------GAVQLA..A-----G-SV--IQ.......HCHLQ..GP--LV..I
H2V794_TAKRU/111-514-----------------------------------PSCTVG..A-----R-SV--VE.......YSRLE..AG--VC..I
FUK_MOUSE/97-496-----------------------------------GPVHLG..P-----R-SV--LQ.......HCHLR..GP--IR..I
H2XT72_CIOIN/112-517-----------------------------------STVTIG..D-----G-TV--IE.......YCKLK..EN--VS..I
H2UFX8_TAKRU/97-498-----------------------------------GDVTVA..T-----G-AV--VQ.......HCHLK..GP--LK..V
W5P4P4_SHEEP/97-496-----------------------------------GVGRPA..P-----G-RT--WAPLSTQTLSSPRQ..GP--IH..V
U9SUG9_RHIID/114-546-----------------------------------ENIVSF..E-----E-SV--PIILDNVKIHSTTSNEEN--KKIII
U3JEG4_FICAL/32-445-----------------------------------PGCVLG..P-----G-SV--IE.......YSRIG..PG--VS..V
B3RXN8_TRIAD/106-509-----------------------------------KNVQLY..G-----E-SI--VE.......YCLIE..ND--VT..I
F7G1T1_ORNAN/113-528-----------------------------------SSSSVA..R-----G-SV--VE.......YSRLG..PN--VS..I
T1J558_STRMM/188-601-----------------------------------.YAKIG..E-----N-SV--IQ.......HCNLQGTAN--FPIEI
I3J111_ORENI/111-518-----------------------------------PSCSVG..A-----G-SV--VE.......YSRLG..AG--VS..V
W4YPG4_STRPU/114-532-----------------------------------QGMDTS..K-----P-CI--VE.......YCHFK..SP--CH..L
H9GU62_ANOCA/113-530-----------------------------------SQCSVA..P-----G-SI--VE.......YSRLG..PE--VS..V
T1JC87_STRMM/128-547-----------------------------------QSNCLSCCG-----P-AV--IE.......YCDLN..AP--VS..I
G3TX92_LOXAF/97-494-----------------------------------GPVWLG..P-----G-SV--LQ.......HCHLR..GP--IH..I
R7BGP0_9FIRM/113-501-----------------------------------DDVQAD..G-----A-VY--IE.......NSVIG..KD--TK..L
F1RBS0_DANRE/70-468-----------------------------------PSVSVS..E-----G-SV--VE.......YCRLD..AN--VY..V
F7C0H8_XENTR/114-520-----------------------------------ATATVS..P-----H-SV--VE.......YSRLG..PN--VS..I
I1NCN7_SOYBN/120-518-----------------------------------PGVSIG..E-----D-SL--IY.......DSSIC..GG--IH..I
H3CAG6_TETNG/98-496-----------------------------------EDVAVA..T-----G-AV--VQ.......HCHLK..GP--LK..V
M0ZH48_SOLTU/137-535-----------------------------------PGVSIG..E-----D-SL--IY.......DSFIS..GG--IQ..I
F0ZSJ1_DICPU/37-438-----------------------------------GNGKCS..D-----T-SI--IY.......SSVLS..GN--WS..V
R5IAV3_9FIRM/116-510-----------------------------------KSVQLA..D-----Y-CY--VE.......NSCLC..GN--TT..L
D7FJB1_ECTSI/126-593-----------------------------------GAGVVA..G-----G-AV--VE.......HCYFD.RDG--WE..V
T1FYY1_HELRO/80-485-----------------------------------QHLAVK..N-----R-AI--IE.......YCEFN..CP--IQ..I
G3NYZ9_GASAC/98-501-----------------------------------GDIAVA..T-----G-AV--VQ.......HCHLQ..GP--LE..V
G3UP39_MELGA/32-450-----------------------------------PGCFVG..P-----G-SI--IE.......YSRIG..PG--VL..V
FPGT_HUMAN/114-533-----------------------------------SRCSVA..P-----G-SV--VE.......YSRLG..PD--VS..V
C3XWJ9_BRAFL/92-524-----------------------------------SDATIG..R-----R-SV--VE.......YGDIG..KD--VN..V
F0SXR2_SYNGF/113-494-----------------------------------PKAKIN..S-----Q-SY--LE.......DSIIG..AE--VT..I
K0T387_THAOC/108-580-----------------------------------SRGRLG..A-----N-CV--VE.......HCDLR.SDE--IS..I
H9G685_ANOCA/97-505-----------------------------------GAVFVG..P-----G-TA--IQ.......HCCLK..GP--LQ..I
I1P6V0_ORYGL/150-552-----------------------------------AGVSVG..E-----D-SL--VY.......DSSLS..GR--IR..I
FKGP_ARATH/131-529-----------------------------------PGVSIG..E-----D-SL--IY.......DSTVS..GA--VQ..I
G3VJJ9_SARHA/106-523-----------------------------------PGSRWG..P-----G-TV--VE.......YSWLG..PD--VA..I
A9TP04_PHYPA/132-540-----------------------------------PCVSVG..E-----G-SL--VF.......SCTLV..AG--TR..V
Q02BJ1_SOLUE/128-518-----------------------------------GGADLG..A-----G-TV--VI.......ECHLE..SH--VR..A
D7UCW9_VITVI/146-545-----------------------------------PSVSIG..D-----D-SI--VY.......DSSIS..GG--IQ..I
W5M6I6_LEPOC/116-528-----------------------------------PACTVG..L-----G-SV--IE.......YSRLG..PN--VT..V
E9PSM4_RAT/106-522-----------------------------------SGCCVA..P-----G-SV--VE.......YSRLG..PE--VS..I
M0RP18_MUSAM/153-575-----------------------------------PGVSVG..E-----D-CL--VY.......NSSLS..GR--IQ..I
F0ZWK1_DICPU/160-551-----------------------------------........D-----N-SV--IE.......YCSFK...N--IDLII
D4M6A5_9FIRM/114-496-----------------------------------SRAKIG..K-----E-AY--LE.......NCYIL..GN--SE..V
U5D0Y7_AMBTC/152-554-----------------------------------PGVSIG..E-----D-SL--IY.......DSSLS..TG--VQ..I
M4AF92_XIPMA/111-517-----------------------------------PSCSVE..A-----G-SV--VE.......YSRLE..TG--VS..V
V8P3W9_OPHHA/98-513-----------------------------------SKCFVA..P-----G-SL--IE.......YSRLG..SK--VS..V
B9I905_POPTR/194-593-----------------------------------PGVSVG..E-----D-SL--IY.......DSFIS..SG--IQ..I
M3ZWZ0_XIPMA/97-496-----------------------------------GGVTVA..T-----R-AV--VQ.......HCHLQ..GP--LD..V
B7S4B1_PHATC/94-530-----------------------------------PYGQID..P-----S-AI--IM.......HSSIQDSLS--ME.SV
Q54NH4_DICDI/127-556-----------------------------------NNLNTIIND-----N-SV--IE.......YCNFKGINK--LS..I
H3ANF5_LATCH/114-531-----------------------------------HSSSVL..P-----G-TV--VE.......YSVLG..PN--TR..I
H2YSE9_CIOSA/106-502-----------------------------------SIMQVG..D-----G-SV--IE.......YCKFK..EN--VS..I

PF16314

R6X3X4_9PORP/7-660EV.................YYYQNTRIKGSSLR..TALNLYGMAINKFLGNSL--IKRLEGT....DFCSMEE--VWSQL
Q5LHM9_BACFN/5-659EI.................YSYQSAKIKNSSLN..SGIRYYEIAIHKFLGNSI--IKRLEGI....NFKDNEE--IRRRL
H1XPF7_9BACT/41-722EIIEQQNSIDGKLQVVLNDFVYHG...KARVLKPAQGLHLYYQMIAYYGGLAL--YEFLKTQ....SFKSEKE--LAAAL
R5GF65_9PORP/2-659HV.................YVYYNLFIKPSSLE..KGLEIYKWGIEKFIGNSL--IQRIQNKFGNEAITSEQK--LLEVL
E4T878_PALPW/4-655SF.................VWYQNCKIKRSSIK..KGIELYEMAINQFIGDKI--IEKLSQL....EIFSKDN--LHKLL
F3ZTN4_9BACE/4-657KT.................YGYQGCVINGRSLH..RGIELYHMAIRKFLGNSL--ISRLTKC....SCESDEI--IRECL
R5PLK0_9BACT/5-659EE.................YSYQSARIKNSSLE..KGIVLYAKAINKFLGNSL--IKRLENI....RFRTNEE--IRSRL
Q7MTP4_PORGI/8-662QT.................YVYHDMRIRSSALD..KGLMFYEMGLNKFFGNSI--IKRLEDC....PCRTDEE--VLSAL
R5VAS6_9BACT/7-661EE.................YAYQSARIKNSSLE..KGLVLYAKAVNKFLGNSL--IKRLEKI....SFAADSE--IRARL
F9ZCM7_ODOSD/4-657EE.................YSYQSAHIKSNSLK..KGIQYYSMAINKFLGNSI--IKRLENL....TFHNNEE--IRQRL
R5I224_9BACT/5-658TP.................SSYGGCTIAGSSLT..SGVERYEKALKYYVGLQV--ALALRGR....KLGSDEA--ITAAL
F4KKJ2_PORAD/2-657AT.................YIYHDMHIRHSSLV..KGCRYYEMGIVKFLGNSL--IQRIQTQ....APKSKRE--LVTCL
A6LH30_PARD8/5-658EI.................YYYQNTRIKGSSLR..NALNFYGMAINKFFGNSL--IKRLEGT....TYCSMEE--VWEQL
R5LL62_9SPIR/12-659DF.................IVYKNMIIKGASLN..KYSQRYSIAIDLYLRNKL--LSYIKDC......KNIND--IIESL
R6SVY6_9BACE/4-659DN.................YSYKKATIRNAALF..KGIKYYQTAIVKFLGNSL--ISRIQDF....DISTDEG--LRRAL
R5VUQ7_9BACE/5-659EI.................YSYQSAKIKNSALN..KGIKFYETAIHKFLGNSV--IKRLEAI....RFASDEE--IRARL
X5DE87_9BACT/9-663EV.................YTYDRMKIEKHALN..RGIQLYEMAIWKFLGNSL--ITRLNGN....EYEIAAD--IQKAL
H1XNG4_9BACT/3-653EF.................VKFKGLYLKRLLLK..RGIKYYQMAMDIFVGEQL--LRRLQPI...DELKGWTD--VAARL
R5IQU5_9PORP/5-659EV.................YSYQSACIKNSSLV..KGITLYSKAINKFLGNSI--IKRLEKT....HFNSNQE--IRERL
C0R0B6_BRAHW/11-658DF.................LTYKNMIIKISSLD..KYSKRYSIAIDLYLHNKI--LSYIENS......KNIDE--IIKNL

PF00132

A0A0F6C616_ECOLX/86-121GSGAIISPFVTIST------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188GNRVVVQPGAVLGS------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152GSDTYIGAGSVIGA------------------------------------------------------------------
LPXD_ECOLI/109-144GDNVIIGAGCFVGK------------------------------------------------------------------
LPXA_ECOLI/65-100GDRNRIRESVTIHR------------------------------------------------------------------
LPXA_ECOLI/108-143GNRCILANNATLAG------------------------------------------------------------------
LPXD_ECOLI/222-257GDNTAVAGGVIMAG------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266GKHSIIVAQAGIAG------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157GDYVTFAPGAKCNG------------------------------------------------------------------
LPXA_ECOLI/17-52GEGTVLKSHVVVNG------------------------------------------------------------------
YVOF_BACSU/59-94GTNTIIGYNTTILA------------------------------------------------------------------
EI2BE_HUMAN/416-451GPNITLPEGSVISL------------------------------------------------------------------
YBB2_SCHPO/366-401HDEVRVQNCLVLPH------------------------------------------------------------------
E7LS70_YEASV/289-323GWNSTVGQWCRLEG------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114GRGVYIAPNVGIIT------------------------------------------------------------------
LPXA_SYNY3/151-186GRLAMVGGMSRIER------------------------------------------------------------------
O58150_PYRHO/245-280DENSVIKGPAVIGK------------------------------------------------------------------
O66933_AQUAE/320-355AEDCEVEDEVLFLK------------------------------------------------------------------
Q48392_KLEOX/245-280GSHSIIKAKSGVSH------------------------------------------------------------------
LPXD_AQUAE/252-287GDNVIVTAKSGVAN------------------------------------------------------------------
Q46674_ECOLX/152-187GSKSIIGSGSVVIR------------------------------------------------------------------
EPSM_BACSU/156-191GAWSIVGAGSAVIR------------------------------------------------------------------
F6RW81_MACMU/98-133TSGCIIGACCNLNT------------------------------------------------------------------
WBPD_PSEAE/14-49GAGVSLGQNVFVGN------------------------------------------------------------------
Q79H46_BORPE/13-48GAGCSLGQNVFVGN------------------------------------------------------------------
O86157_CAMJU/151-186ADDSILGGGATLVK------------------------------------------------------------------
YBB2_SCHPO/287-322GARVRIEDGARIRN------------------------------------------------------------------
F6RW81_MACMU/8-43GPRTVIHPKARIIA------------------------------------------------------------------
Q46674_ECOLX/104-139NTRSLIEHGNEIGC------------------------------------------------------------------
LPXD_CHLTR/152-187GKRVIIQPGAVIGS------------------------------------------------------------------
P74589_SYNY3/319-354GPLSIIGEEAQINS------------------------------------------------------------------
Q48392_KLEOX/113-148GDNVAIHCNTVIKE------------------------------------------------------------------
LPXD_NEIMB/105-140GANTVLGEGCRILA------------------------------------------------------------------
O27626_METTH/368-403GKDSCIGAGCVISR------------------------------------------------------------------
GLMU_AQUAE/401-436GDWAYIAGGSVVNK------------------------------------------------------------------
GLMU_MYCTU/405-440GDGAYTGAGTVVRE------------------------------------------------------------------
GLMU_NEIGO/393-428GNKVTTGAGSAITR------------------------------------------------------------------
GLMU_SYNY3/390-425GEGVTVAAGSVINR------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429GKGATIAAGTTVTR------------------------------------------------------------------
Q56274_9PROT/119-154GDGATIGAGSTITK------------------------------------------------------------------
Q48792_LISMN/188-223GDRAFIAAGSTITK------------------------------------------------------------------
GLMU_BACCL/51-86GQGAYVAAGSTITN------------------------------------------------------------------
O33923_CORAM/34-69EDGAYVAAGSTITE------------------------------------------------------------------
LPXD_CHLTR/116-151GSACHIGSGSVIGA------------------------------------------------------------------
C9K1L0_KLEPN/162-197ADGCVVASHSVVNG------------------------------------------------------------------
A0A0T7RR04_SALET/149-184CDGCVIAANSVVKD------------------------------------------------------------------
LPXD_SYNY3/118-153GDRVCIHGNVVIYP------------------------------------------------------------------
Y3034_MYCTU/218-253GRGCVLGSHAVVRG------------------------------------------------------------------
WBBJ_ECOLI/132-167GNGVVVGANSVVRG------------------------------------------------------------------
P72981_SYNY3/162-197ADGSYIPFGKMIFP------------------------------------------------------------------
O59588_PYRHO/365-400GSGALVGPGVIVDK------------------------------------------------------------------
LPXD_BRUA2/128-163GAGTLIAATAVIGQ------------------------------------------------------------------
H9L4Q4_VIBCH/121-156GEGVSVGALSLVNK------------------------------------------------------------------
WCAB_ECOLI/108-143GNNVTVGAGSVVLD------------------------------------------------------------------
SRPH_SYNE7/260-295GRGSTIGGNVWLTR------------------------------------------------------------------
P93544_SPIOL/265-300GDGAKIGAGSVVLI------------------------------------------------------------------
CYSE_BUCAP/194-229GQGVKVGAGSIVLK------------------------------------------------------------------
CYSE_BACSU/118-153GEGSKIGAGSVVLH------------------------------------------------------------------
O69218_AZOVI/117-152GAGAKIGSNAVVTR------------------------------------------------------------------
NIFP_AZOCH/118-153GANARVGANSVVVQ------------------------------------------------------------------
CYSE_STAXY/120-155NANVNIGANSVVLN------------------------------------------------------------------
Q7AQF4_MYCLE/117-152GEDSRIGANAVVVK------------------------------------------------------------------
CYSE_SYNE7/117-152GENVRIGAGSVVLR------------------------------------------------------------------
CYSE_HELPY/116-151GDDVKIGANAVVLS------------------------------------------------------------------
YRDA_ECOLI/97-132EDDVMIGAGSLVPQ------------------------------------------------------------------
Q9ZD31_RICPR/89-124EEYAFIAAGSLVPP------------------------------------------------------------------
YTOA_BACSU/87-122GEGAFIGAGSLVPP------------------------------------------------------------------
O26372_METTH/143-178GEGAMVAAGAVVTR------------------------------------------------------------------
DAPH_BACSU/165-200GKGAVVAAGAIVVN------------------------------------------------------------------
DAPD_ECOLI/175-210EEGSVISMGVYIGQ------------------------------------------------------------------
F3K8R5_PSEAJ/175-210RSGAVIGMGVYLGA------------------------------------------------------------------
O59257_PYRHO/88-123GDHVIIGAGAVVPP------------------------------------------------------------------
O67576_AQUAE/90-125EDYVIVGAGALVTP------------------------------------------------------------------
CAIE_ECOLI/88-123GEESIVAAMSFVKA------------------------------------------------------------------
PAAY_ECOLI/88-123GENSIVGASAFVKA------------------------------------------------------------------
Q45929_COXBE/117-152GKNCIIGANALILE------------------------------------------------------------------
O27625_METTH/74-109GENSIVGAGAVITS------------------------------------------------------------------
Y3753_PSEAE/87-122GKYCIIGANALIPE------------------------------------------------------------------
Y304_METJA/77-112GENCIIGANALVTQ------------------------------------------------------------------
WBPD_PSEAE/101-136GEYAFVGAGAVINK------------------------------------------------------------------
YVOF_BACSU/106-141GDGAVVSAGTLVHK------------------------------------------------------------------
F7YJG3_VIBA7/98-133GEGALVGAGSVVTK------------------------------------------------------------------
GLMU_NEIGO/264-299GDNVEIGANCVIKN------------------------------------------------------------------
O59364_PYRHO/307-342GDNSVIEEYSKIGA------------------------------------------------------------------
LPXD_RICRS/123-158GDNSIIEAGSFIGR------------------------------------------------------------------
LPXD_PASMU/111-146GDHVVIGANCFVGK------------------------------------------------------------------
O87774_LACSK/117-152GQGAIIAAGAVVVK------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165GEHTIVGAGSVVTK------------------------------------------------------------------
O68047_RHOCA/110-145GHGAVIGTRALVTS------------------------------------------------------------------
Q2G1K1_STAA8/119-154NTGAVIAAGSVVTK------------------------------------------------------------------
Q8U5W2_AGRFC/180-215GAGAIVAAASVVAR------------------------------------------------------------------
MATA_LYSSH/77-112GDGAIIAANSTVVK------------------------------------------------------------------
O87276_9STAP/118-153GNGAIIAAKSVVTK------------------------------------------------------------------
CAT4_PSEAE/110-145GHGAIIGSRALVTG------------------------------------------------------------------
Q79EF3_SYNY3/114-149GDGAIIAAKAVVTN------------------------------------------------------------------
O86929_SALTM/110-145GHGAVIGSRSLVTK------------------------------------------------------------------
CAT4_AGRFC/109-144GDGAVIGTRALVTK------------------------------------------------------------------
O87158_VIBCL/104-139GDNVMIGAGAVVTK------------------------------------------------------------------
Q56045_STRTR/106-141GDNSIIGAGVVVYQ------------------------------------------------------------------
M5JVF4_STREE/129-164GENSVVAAGSVVTK------------------------------------------------------------------
THGA_LACLA/133-168GKNSVIGAGSLVTK------------------------------------------------------------------
Y1064_METJA/159-194GEGAVIGAGSVVTR------------------------------------------------------------------
YA39_SCHPO/150-185GEGSVIGAGAVVTK------------------------------------------------------------------
E7KQ17_YEASL/130-165GKNSVIAAGSVVIR------------------------------------------------------------------
J0UV19_RHILV/131-166GDHAVIGAGSVVTR------------------------------------------------------------------
THGA_ECOLI/131-166GDNSVIGAGSIVTK------------------------------------------------------------------
MAA_BACSU/130-165GDNAVIASGSVVTK------------------------------------------------------------------
H7C7I4_CAUCR/142-177GERAFLGVGARVIP------------------------------------------------------------------
O86157_CAMJU/109-144EHECVIGEFSHVSV------------------------------------------------------------------
LPXA_CHLTR/61-96GEHCEIREFAMITS------------------------------------------------------------------
LPXA_RICRS/63-98GSNNTIREYVTVQA------------------------------------------------------------------
LPXA_HAEIN/65-100GNSNKIREHVTIHR------------------------------------------------------------------
LPXA_SYNY3/73-108GNDNQIREYVTINR------------------------------------------------------------------
LPXA_AQUAE/60-95GNNVIIREYVTIHR------------------------------------------------------------------
Q45929_COXBE/39-74HNNVSILPHAVIRA------------------------------------------------------------------
YRDA_ECOLI/12-47ADDVGIWPLVVIRG------------------------------------------------------------------
CAIE_ECOLI/10-45GAGVYIGPLASLRG------------------------------------------------------------------
PAAY_ECOLI/10-45GKGVYVGPNASLRG------------------------------------------------------------------
O59257_PYRHO/10-45EEKTSVWPSAVLRG------------------------------------------------------------------
YTOA_BACSU/9-44GEQSSIWFSVVIRG------------------------------------------------------------------
Q9ZD31_RICPR/10-45GNNSSIWFNTVLRG------------------------------------------------------------------
O67576_AQUAE/11-46GEDSSIWFGSVVRG------------------------------------------------------------------
O66933_AQUAE/251-286GKNVKVGEGSELKN------------------------------------------------------------------
DAPH_BACSU/121-156GKNCHIGAGSVLAG------------------------------------------------------------------
DAPD_BUCAP/131-166GKNVHLSGGVGIGG------------------------------------------------------------------
F3K8R5_PSEAJ/131-166GSRCHISGGVGLGG------------------------------------------------------------------
Q56274_9PROT/77-111GTGVNVGAGTITCN------------------------------------------------------------------
O59588_PYRHO/306-340GENTNLGAGTITAN------------------------------------------------------------------
O27626_METTH/309-343GMNCNIAAGTNIAN------------------------------------------------------------------
P74589_SYNY3/249-284GDNCNIGSGTKLEA------------------------------------------------------------------
F7YJG3_VIBA7/12-47GKNCNICSHTFIEN------------------------------------------------------------------
EI2BE_SCHPO/330-364GRNCTIGSNCSIDS------------------------------------------------------------------
P72757_SYNY3/62-97GATACLGSRSTVFQ------------------------------------------------------------------
O30712_SYNP2/59-94GENACLGYGSTLFQ------------------------------------------------------------------
LPXD2_ARATH/98-133GPSVDIGPSTRIGY------------------------------------------------------------------
GLGC_MYCLE/328-362MPGARVGRGAVIRH------------------------------------------------------------------
P71784_MYCTU/106-141GNNVTLWSGNHIGH------------------------------------------------------------------
Q2G1K1_STAA8/49-83GRYCSISSDVKIGL------------------------------------------------------------------
EI2BE_SCHPO/387-422GDNTIIEKNKRLTT------------------------------------------------------------------
EI2BE_YEAST/382-416GSNVRLNDGCIIGF------------------------------------------------------------------
LPXA_CHLTR/103-138GNNVVFSTHVQLAG------------------------------------------------------------------
LPXA_RICRS/106-141GNNVVFANYVSLAG------------------------------------------------------------------
LPXA_ALLVD/103-138GDHNVFANTATLAG------------------------------------------------------------------
LPXA_AQUAE/103-138GNNVIMANCATLGG------------------------------------------------------------------
LPXA_NEIMB/104-139GNHTIFANNASLAG------------------------------------------------------------------
LPXA_SYNY3/115-150ENEVIIANSVALAG------------------------------------------------------------------
LPXA_HELPY/104-139GSHCILANGVTLAG------------------------------------------------------------------
LPXA_HAEIN/108-143KNNCILANNATLAG------------------------------------------------------------------
LPXA_PROMH/108-143GDRCIIANNGTLGG------------------------------------------------------------------
LPXD_HAEIN/225-260GTGTAVAGGVIMAG------------------------------------------------------------------
LPXD_SYNY3/231-266GEACALAGQVGLAG------------------------------------------------------------------
LPXD_AQUAE/216-251GENNILVSQVGLSG------------------------------------------------------------------
LPXD_HELPY/216-251GEHSIVVSQVGLSG------------------------------------------------------------------
LPXD_NEIMB/224-259GSHTVIAAKTGISG------------------------------------------------------------------
LPXD2_ARATH/199-234GKCCLLCGQVGIAG------------------------------------------------------------------
LPXD_BRUA2/240-275GRFCLVAAHCGISG------------------------------------------------------------------
Q48392_KLEOX/209-244GENCLIVSQAGFAG------------------------------------------------------------------
LPXD_RICRS/235-270GKGSIIVAQTGIAG------------------------------------------------------------------
LPXD_CHLTR/230-265GQHSMIVAQAGIAG------------------------------------------------------------------
LPXA_BRUA2/106-141GDYVTFSNNVMIGG------------------------------------------------------------------
O26372_METTH/95-130EDNVFIGPCACFTN------------------------------------------------------------------
F7YJG3_VIBA7/48-83GNNVFIGPNATFTN------------------------------------------------------------------
LPXD_NEIMB/147-182GRRVEIHSGAVIGA------------------------------------------------------------------
LPXD_SYNY3/154-189GQGCVIHSGAAIGA------------------------------------------------------------------
LPXD_AQUAE/139-174GRNVRIHSGAVIGA------------------------------------------------------------------
LPXD_SALTY/145-180GENCLIQSSTVIGA------------------------------------------------------------------
LPXD_PASMU/147-182GQHCLIQSGAVIGS------------------------------------------------------------------
LPXD_HAEIN/148-183GANCLIQSGTVIGS------------------------------------------------------------------
LPXD_YEREN/145-180GQNCLIQSGTVIGA------------------------------------------------------------------
LPXD_BRUA2/164-198GNNVSLHPGVRIGQ------------------------------------------------------------------
LPXD_HELPY/120-155GKNCILYPRVTLYQ------------------------------------------------------------------
LPXD_RICRS/159-193GDDVVILAGAKIGQ------------------------------------------------------------------
LPXA_NEIMB/1-36GAYTVIGPNVQIGA------------------------------------------------------------------
MPG1_SCHPO/249-284GPNVVIGPNVTIGD------------------------------------------------------------------
E7LS70_YEASV/248-283GPDVVIGPNVTIGD------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286GPNVTIGPDVVVGD------------------------------------------------------------------
MPG1_CANAL/249-284GPNVTIGPNVVVGE------------------------------------------------------------------
O27787_METTH/325-360GRGAFIGPSTVIRS------------------------------------------------------------------
GLMU_SYNY3/313-348QANCRIGNFVEVKK------------------------------------------------------------------
GLMU_AQUAE/324-359GEEAEIGNFVEVKK------------------------------------------------------------------
GLMU_BACSU/317-352GNEVKIGNFVEIKK------------------------------------------------------------------
Q48792_LISMN/111-146HDHVKIGNYVETKK------------------------------------------------------------------
GLMU_MYCTU/328-363GADGKLGAFVEVKN------------------------------------------------------------------
GLMU_NEIGO/316-351ADDVHVGNFVEIKN------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352LEGAHVGNFVEMKK------------------------------------------------------------------
GLMU_HAEIN/317-352AAETHVGNFVEIKK------------------------------------------------------------------
EI2BE_YEAST/330-364GEGTKI.ENSVIGR------------------------------------------------------------------
LPXA_ALLVD/12-47GEGCRIESNVRIFG------------------------------------------------------------------
LPXA_SYNY3/25-60GANTVIGPHVVVEG------------------------------------------------------------------
LPXA_RICRS/15-50NDNVELKSHVVIEG------------------------------------------------------------------
LPXA_CHLTR/13-48CDDVVVKSYAYIDG------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48CDNVVVKSYAYIDG------------------------------------------------------------------
LPXA_BRUA2/15-50GNDCELMSHVVITG------------------------------------------------------------------
LPXA_HAEIN/17-52KARTVLKSHVVVRG------------------------------------------------------------------
LPXA_YEREN/17-52GAGTELKSHVVVNG------------------------------------------------------------------
LPXA_PROMH/17-52GEGTDIKSHVVING------------------------------------------------------------------
O27787_METTH/255-290GDGSRVDDGAYIGK------------------------------------------------------------------
O58775_PYRHO/315-344GDYAKIYD......------------------------------------------------------------------
H7C7I4_CAUCR/106-141GDLAIINTGAVVDH------------------------------------------------------------------
EPSM_BACSU/102-137GAHCIINTGAVAEH------------------------------------------------------------------
O58775_PYRHO/245-280DDNAKIGHGVKIKA------------------------------------------------------------------
GLMU_AQUAE/272-307KKGSVIGKGSVIKD------------------------------------------------------------------
GLMU_SYNY3/262-297GRGSRIGPGSLIED------------------------------------------------------------------
GLMU_BACSU/266-301GEDTIIGPHTEIMN------------------------------------------------------------------
GLMU_MYCTU/277-312GGRCVVGPDTTLTD------------------------------------------------------------------
Q48792_LISMN/60-95GDDCVVTSGSEIVN------------------------------------------------------------------
O84634_CHLTR/59-94GPYTQVRHGAYIRG------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95GSQTEVRHGAYLRG------------------------------------------------------------------
O26372_METTH/41-76GDNLRTGHNVLIRE------------------------------------------------------------------
EI2BE_HUMAN/359-393GPGCHIGDNVVLDQ------------------------------------------------------------------
LPXA_HELPY/13-48DEGVKLHNNVTLQG------------------------------------------------------------------
O27626_METTH/256-291GRNCDIGPNSYLRA------------------------------------------------------------------
O59588_PYRHO/253-288GKNCRIGPNCFIRP------------------------------------------------------------------
LPXA_AQUAE/12-47GKGTKIGNRVTIKG------------------------------------------------------------------
O59364_PYRHO/256-290GRDVKIER......------------------------------------------------------------------
LPXD_AQUAE/103-138GRNVKIYPFTYVGD------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333GDGCIIDGGLAVFA------------------------------------------------------------------
Q8FQF4_COREF/259-293GDNCHVGNNIVLDC------------------------------------------------------------------
E8NC18_MICTS/219-252GDDCVVEAGLYVTA------------------------------------------------------------------
A1STS6_PSYIN/252-285GNRCTIEAGLYITA------------------------------------------------------------------
Q8U2R4_PYRFU/37-72GDNVKIQNGVSVYR------------------------------------------------------------------
E8V741_TERSS/175-210RSKAILAAGTILTR------------------------------------------------------------------
A1WX25_HALHL/176-211GRGAVISMGVYVGQ------------------------------------------------------------------
Q15QD8_PSEA6/210-243GDDCIVEAGLYVTA------------------------------------------------------------------
A0RN31_CAMFF/297-330GDDCIVDAGVAILE------------------------------------------------------------------
D5V5C0_ARCNC/297-330GDGCILDAGVTILP------------------------------------------------------------------
A0JYR5_ARTS2/248-281GDDSVVEAGLYVTA------------------------------------------------------------------
B9L6I2_NAUPA/287-320GDGCIVDAGIAVLE------------------------------------------------------------------
D7GF12_PROFC/226-259GDNCVIEAGLYLTA------------------------------------------------------------------
E2SBF8_9ACTN/226-259GDDCVVAAGCYVTA------------------------------------------------------------------
DAPD_ZYMMO/171-206GEGAVLSMGVFIGA------------------------------------------------------------------
Q0VQG2_ALCBS/253-286GDRCTIEAGLYITS------------------------------------------------------------------
DAPD_BLOFL/180-215EENSVLAMGVFISQ------------------------------------------------------------------
C1A408_GEMAT/176-211RTKAVLAAGVVLTR------------------------------------------------------------------
B0VHT1_CLOAI/167-202QNKVVIASGVVITA------------------------------------------------------------------
D9SGU0_GALCS/175-210EDNVVISMGVFIGQ------------------------------------------------------------------
C6Y287_PEDHD/166-201EKEAVLGANVVLTA------------------------------------------------------------------
C4LHT9_CORK4/233-266GNDCVVEAGLYITY------------------------------------------------------------------
A7ZCR0_CAMC1/300-333GDNCIVDAGIAVLE------------------------------------------------------------------
D7WDN8_9CORY/234-268GDRCEIGAGVMLEP------------------------------------------------------------------
D1BYT1_XYLCX/243-276GADSVIEAGLYVTA------------------------------------------------------------------
E3GF87_EUBLK/173-208GKGAVVAAGSVVTE------------------------------------------------------------------
Q6NHZ9_CORDI/229-263GDNVRVGNNVVIDK------------------------------------------------------------------
B2V696_SULSY/121-156GDNCILYPNVVIYK------------------------------------------------------------------
D1BKM4_SANKS/225-258GDDCVVESGLYLTA------------------------------------------------------------------
DAPD_BEII9/183-218GQGSVVSMGVFISS------------------------------------------------------------------
GLMU_AGRRK/379-414GDNAYVASGSVITE------------------------------------------------------------------
C8XJN1_NAKMY/241-274GDECVVEAGLYLTA------------------------------------------------------------------
B3ET32_AMOA5/167-202GRGAVLGANVTLTA------------------------------------------------------------------
Q2GI44_EHRCR/182-217GEGSVIAMGVYIGA------------------------------------------------------------------
D3UHQ9_HELM1/290-323GDGCIVDGGIAVLS------------------------------------------------------------------
C7MVH9_SACVD/242-275GNDCVVEAGLYVTA------------------------------------------------------------------
B3QZC3_CHLT3/182-217EEKAVIGTGVILNA------------------------------------------------------------------
E3PSU4_CLOSD/168-203GNNSVVAAGAVVTE------------------------------------------------------------------
DAPH_STRSV/161-196GSGSVVAAGAIVTQ------------------------------------------------------------------
GLMU_STRSY/395-429GDNALLAAGSVITK------------------------------------------------------------------
C5AZJ3_METEA/178-213GEGSVLSMGVYIGA------------------------------------------------------------------
D9Q9N2_CORP2/229-261GDDCVIEAGLYVTA------------------------------------------------------------------
D9Q9N4_CORP2/230-263GDNITVCNNIVLDP------------------------------------------------------------------
D9TDT4_MICAI/233-265GDDCVVEAGCYITA------------------------------------------------------------------
E0TE45_PARBH/181-214REGAVLSMGVFL..------------------------------------------------------------------
E4PGY8_MARAH/252-284GDRCKVEAGLYITA------------------------------------------------------------------
F0P119_WEEVC/165-199GKEAVLGANVVLT.------------------------------------------------------------------
G2NH01_STREK/246-278GDECVVEAGLYVTA------------------------------------------------------------------
DAPD_HELPY/301-334GDGCIVDAGVAILA------------------------------------------------------------------
Q2G043_STAA8/106-141GDNVKVAAGTVVSK------------------------------------------------------------------
Q2IG91_ANADE/168-203EEDCVLGANVVITA------------------------------------------------------------------
Q79VH2_CORGL/241-274GDNCDIGNNIVLD.------------------------------------------------------------------
GLMU_STRR6/394-428GDNSLVGAGSTITK------------------------------------------------------------------
DAPD_BIFLO/246-278GDNCTVEAGLYITA------------------------------------------------------------------
DAPD_VIBCH/253-285GDRCTVESGLYVTA------------------------------------------------------------------
R6X2K4_9PORP/76-110NDNVIVGSGSVVTK------------------------------------------------------------------
R7JIP3_9BACT/169-203CRESVLGAGVVIT.------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511GTRAIVSGCWVCTGLS...........................VPDETFIHTLCTNQ.NGQTS............FVTVA
H0Z730_TAEGU/55-450GPGCLLSGLDVDSSPA......................LRGCPLR.DVVLQGHHVRL.RDLPC............RVFTL
H2V794_TAKRU/111-514GQGSIISSCWVSEGLS...........................VPDGILVHSLCVNY.ERRPR............FLTVI
FUK_MOUSE/97-496GAGCFVSGLDTAHSEA......................LHGLELH.DVILQGHHVRL.HGSLS............RVFTL
H2XT72_CIOIN/112-517GSNCVLSNCMLKPNTK...........................LPYGMLLHTLAIST.ADKEGSCGRVQ......YVTVV
H2UFX8_TAKRU/97-498PTGCLLSGLNMMTLQC.....................PLWQLDLASDIIIQGRFIEL.GELKL............KVFTV
W5P4P4_SHEEP/97-496GTGCFVSGLDVAQSQA......................LHGVELR.DLILRGHHVQL.HGAPS............RAFTL
U9SUG9_RHIID/114-546GGWSILSNIDLIISKE.........................IRVPNYTCMFTSFLRKITSSEISSTSSFSEKEEGYVTFI
U3JEG4_FICAL/32-445GKGCIVSGTCINSSAD...........................IPSSCLLSSVSVKI.AAQVE............FVTMA
B3RXN8_TRIAD/106-509QPNCILSNIHLSSNLT...........................VPENSFLHSVAVKQ.GTQKY............FVTVA
F7G1T1_ORNAN/113-528GEQSLISGVCILDKME...........................LPSNAFVCSLSLKL.SERVT............FATMA
T1J558_STRMM/188-601RPYSYVVGIHIRTE........................LIPFILKEELVLIETNIID.DDLKEK...........KIRVL
I3J111_ORENI/111-518GKGSIISGCWVSPGLS...........................VPGEAFMHSLCVSH.HGQTS............FVTVF
W4YPG4_STRPU/114-532GERCIVSNCVVQAPSS.....................GC.PVSIPSFTFLHTAAVKT.REGSTL...........YVTIF
H9GU62_ANOCA/113-530GTNSIISGCSIDTKAD...........................IPADTFMTTLSVRI.DGNLM............YASMV
T1JC87_STRMM/128-547GESCLLSGCYVQCVTP.........................VIIPSHTLMHTIAVNS.SECKVC...........FVTVA
G3TX92_LOXAF/97-494STGCFLSGLDIAQSEA......................LHGMELR.DLILQGHHMRL.HGSLG............RVFTL
R7BGP0_9FIRM/113-501GTNVILSGLNIS............................DISIPSDCCMHKVKLLN.GK...............YVVRV
F1RBS0_DANRE/70-468GSRSIISGSWIGTDLK...........................VPSDTFMHSLSVNL.DGSTG............FVTVA
F7C0H8_XENTR/114-520GEHCIISGVSIHVGSH...........................IPPKSFVSSFSLRL.GGQLM............YSTVT
I1NCN7_SOYBN/120-518GSLCIVVGVNISL...............DNLLSVENSI..KFMLPDRHCLWEVPLIG.NRE..............LVLVY
H3CAG6_TETNG/98-496PAGCLLSGLSSAASQC......................LRQLDLGADIIVQGHHIQL.GDLKL............RVYTV
M0ZH48_SOLTU/137-535GSQSIVVGVNVPA...............ASDMTEKVPF..RFMLPDRHCFWEVPLVE.RTE..............RVIVY
F0ZSJ1_DICPU/37-438GEDSIVFGAKSLSA..........................NYHIKDRMIVNEIRLKP.IKMKHSSNETP......RALLV
R5IAV3_9FIRM/116-510EEGTVVSHLNLT............................DVKVPP.MVLHGIVLRQ.NADCLANGKKE......HIVRA
D7FJB1_ECTSI/126-593GAGSLISGIRSLEEDC........................HLRLRGGMCLQQTDLDR.ASPEETASR........FVVSL
T1FYY1_HELRO/80-485GQNCIVSNCYLGKKLE......................GIQLNIPQDCMICTLPING.KNGNIE...........YVTLT
G3NYZ9_GASAC/98-501PSGCLLSGLPLMTSQC......................LRQLQLADDIIIQGHRIEV.GGLKL............SVYTV
G3UP39_MELGA/32-450GENCIISGSCINLEVD...........................VPSNCFLSSLSVKI.DDQVK............YVSMV
FPGT_HUMAN/114-533GENCIISGSYILTKAA...........................LPAHSFVCSLSLKM.NRCLK............YATMA
C3XWJ9_BRAFL/92-524GANCIISNCVLEAKIA.......................TRCIVPDYTFMHTVAVVE.KETKLLR..........YVTIV
F0SXR2_SYNGF/113-494GKNSIISGIELI............................DEKVPDEVVLHCLQLKD.GK...............YVCRI
K0T387_THAOC/108-580GENSLVSGVRDTGG..........................VFSIGGDLCLQLLPVRQ.SWKDANLPASSDVARPCFVCLC
H9G685_ANOCA/97-505HSGCLLTGLDGDSSEA......................LRGHHLK.DVVIQGHAVRL.KGLSC............KVFTL
I1P6V0_ORYGL/150-552GSQCIVVGVNIHELHG............NRSQIISTSS..YFTLPDRHCLWEVPLVN.SVE..............RVMVY
FKGP_ARATH/131-529GSQSIVVGIHIPS...............EDLGTPE.SF..RFMLPDRHCLWEVPLVG.HKG..............RVIVY
G3VJJ9_SARHA/106-523GANSIVSGCHVPAGTA...........................LPPNSFLCALSLKV.NGCSM............YATMA
A9TP04_PHYPA/132-540GSRCVAMGLTSEEPDS........................SFTLPDRHCLWRVPVSL.KTLSGA...........QVVLC
Q02BJ1_SOLUE/128-518ASGSVLHGLDAISG..........................TLDIPEDTVIHQLPVEL.PSGQRG...........VVIRA
D7UCW9_VITVI/146-545GSQSIVVGVNVPG...............DSNGIEDNGF..RFILPDRHCLWEVPLVG.CTG..............RVIVY
W5M6I6_LEPOC/116-528GGNTVISSCWIEGDFN...........................VPSDAFIHSLSLSV.NRATL............FVTIA
E9PSM4_RAT/106-522GENCIVSSSVLANTA............................VPAYSFVCSLSVRT.NGLLE............YSTMV
M0RP18_MUSAM/153-575GSQSIVVGVSIASL..............NKYEQIDNSS..RFVLPDRHCLWEVPLAE.SLG..............RIIVY
F0ZWK1_DICPU/160-551GNRCILSDLEYDSNNN................NTSKNKIESITIPSNTFIHTLSLNN.NR...............FVTIL
D4M6A5_9FIRM/114-496GDGTVLSHVRIM............................DRKIPEQIVMHGIELTG.GK...............KVIRI
U5D0Y7_AMBTC/152-554GSRCIIVGVHLQRE..............NIVGSIGNSS..WFILPDRHCLWEVPLVG.CSQ..............RVILF
M4AF92_XIPMA/111-517GGGSIISSCWVSPGLS...........................VPAGVFMHTLCVTH.QKQIR............FVTVF
V8P3W9_OPHHA/98-513GTNSIISSCSINTKAD...........................IPPNTFMTTLSIRI.DGELR............YVSIV
B9I905_POPTR/194-593GSLSVVVGVNVPR...............DIGGMADDSF..RFMLPDRHCLWEVPLVG.CTE..............RVIVY
M3ZWZ0_XIPMA/97-496PSGCLLSGVDVSASAC......................LRRLALSSDIIIQGHRIQL.GELKL............NMYTV
B7S4B1_PHATC/94-530GSLPMV.....................................IPDNTIVQQVRRVP.QDEADTCA.........CTLVV
Q54NH4_DICDI/127-556GNRCIVSDLEFENSNEQQQQQQQQQQQQQQQQQTLSSSNYSIEIPSNSFIQTLSISC.NR...............YVTIF
H3ANF5_LATCH/114-531GTNCIISGCWIDRKAD...........................IPSDTFLHSLSVKL.NGESG............FVTIV
H2YSE9_CIOSA/106-502GANCILSNCILKPNTT...........................LPDGILLHTVAICS.PDTDSANKSIK......YVTVL

PF16314

R6X3X4_9PORP/7-660KPTSSAGRGEWLDL----------------------SGLILPREELDGLIEKVEEGKITSLEAIEEFFAAMHSNYYDMEW
Q5LHM9_BACFN/5-659KPDTEIGVGEWVDI----------------------AGLIAPKSEVEKLIDGIESGEINRLKSMNACFAAMHDNYYTYEW
H1XPF7_9BACT/41-722QERLTEHHRKWVNL----------------------GGQLVPAAEVQKLIDDIKSGLLDSWQKIHERYDRLWEAYPRQKW
R5GF65_9PORP/2-659IPDHTFGKGEWIDA----------------------SGMIAPLGCIQEIMGEIKGKQLKSLPEINHRIRGLHKMYYEYEW
E4T878_PALPW/4-655STKTDTGIGEWSDM----------------------AGLIAPKSEINRLLKDISDKKL.SLDEIQNRINELHANYAAYSF
F3ZTN4_9BACE/4-657KPDSSIGLGDWRDL----------------------AGLIAPQSEIVKLLNDVENDRITNSKQIYDQFEYLHENYYAIEW
R5PLK0_9BACT/5-659KPDTSKGAGEWIDL----------------------AGLIVPQKEIENLITAIENGEIDSVEQICSFLEALHRDYYTLEW
Q7MTP4_PORGI/8-662KPTHNEGDGSWVDI----------------------CGMIAPQQQIHRLASLIKEGKIKSLAEVNERMKEIHSRYYDYEW
R5VAS6_9BACT/7-661QPNSEKGLGEWIDL----------------------AGLIAPQKEIENLIRQIETGEITSVEQINKTFDTLHQQYYELEW
F9ZCM7_ODOSD/4-657APTRTEGSGEWVDL----------------------SGLIVPQQGIIRLIRRIENGEIESVGQITDTFRQLHADYYQLEW
R5I224_9BACT/5-658TPVSPVGDGRWIDV----------------------AGLLAPKAEIDQIVEEVVSGSLDTPGAVESRLSAIASNYQLYEW
F4KKJ2_PORAD/2-657SPTSNEGLSDWLDL----------------------AGMIAPRRLIRSLITQIKEGQIKTLQEVNVAIRSIHSRYYEIEW
A6LH30_PARD8/5-658RPTESKGSGEWLDL----------------------AGLILPREPLEALLQDIEQGEIASLEDVECFFRLVHGRYYSLEW
R5LL62_9SPIR/12-659K..SEKVYSDWVDA----------------------GGLICAKERLDNIIKDIENENINNIESILNAFKSLYDNYYPDEK
R6SVY6_9BACE/4-659RRDTSVGSGQWVDI----------------------SGLIAPASEIERICDDVISGVIADVNVLSDRFLDIFNHYYSYEW
R5VUQ7_9BACE/5-659VPDTPIGTGEWVDI----------------------SGLIAPKSEIERLMEDIECDRLSSVDEIHDRFAEMHANYYTYEW
X5DE87_9BACT/9-663QPDMKFGKGYWVDL----------------------AGMICPFEALDQLLQAIENGSVQSLEEVNSALATIHKNYYNFEW
H1XNG4_9BACT/3-653KAPNTKKLEEWYDW----------------------FGMFIPQSAAEELLGKIKSNQIKTVQDLLTQLRQYFERYDEWAW
R5IQU5_9PORP/5-659QPTIEGGSGEWLDL----------------------SGLIAPKAEIDKLISGIETGIITSLETIHSTFAELHKNYYDLEW
C0R0B6_BRAHW/11-658NYDENSIFEKWVDI----------------------GGLICAKQRIDNIIKDLENDKISDVKSLTERFEDIYNLYLEDEK

PF00132

A0A0F6C616_ECOLX/86-121--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/153-188--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/117-152--------------------------------------------------------------------------------
LPXD_ECOLI/109-144--------------------------------------------------------------------------------
LPXA_ECOLI/65-100--------------------------------------------------------------------------------
LPXA_ECOLI/108-143--------------------------------------------------------------------------------
LPXD_ECOLI/222-257--------------------------------------------------------------------------------
A0A0F7WUQ7_CHLPN/231-266--------------------------------------------------------------------------------
A0A0F6C616_ECOLX/122-157--------------------------------------------------------------------------------
LPXA_ECOLI/17-52--------------------------------------------------------------------------------
YVOF_BACSU/59-94--------------------------------------------------------------------------------
EI2BE_HUMAN/416-451--------------------------------------------------------------------------------
YBB2_SCHPO/366-401--------------------------------------------------------------------------------
E7LS70_YEASV/289-323--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/80-114--------------------------------------------------------------------------------
LPXA_SYNY3/151-186--------------------------------------------------------------------------------
O58150_PYRHO/245-280--------------------------------------------------------------------------------
O66933_AQUAE/320-355--------------------------------------------------------------------------------
Q48392_KLEOX/245-280--------------------------------------------------------------------------------
LPXD_AQUAE/252-287--------------------------------------------------------------------------------
Q46674_ECOLX/152-187--------------------------------------------------------------------------------
EPSM_BACSU/156-191--------------------------------------------------------------------------------
F6RW81_MACMU/98-133--------------------------------------------------------------------------------
WBPD_PSEAE/14-49--------------------------------------------------------------------------------
Q79H46_BORPE/13-48--------------------------------------------------------------------------------
O86157_CAMJU/151-186--------------------------------------------------------------------------------
YBB2_SCHPO/287-322--------------------------------------------------------------------------------
F6RW81_MACMU/8-43--------------------------------------------------------------------------------
Q46674_ECOLX/104-139--------------------------------------------------------------------------------
LPXD_CHLTR/152-187--------------------------------------------------------------------------------
P74589_SYNY3/319-354--------------------------------------------------------------------------------
Q48392_KLEOX/113-148--------------------------------------------------------------------------------
LPXD_NEIMB/105-140--------------------------------------------------------------------------------
O27626_METTH/368-403--------------------------------------------------------------------------------
GLMU_AQUAE/401-436--------------------------------------------------------------------------------
GLMU_MYCTU/405-440--------------------------------------------------------------------------------
GLMU_NEIGO/393-428--------------------------------------------------------------------------------
GLMU_SYNY3/390-425--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/394-429--------------------------------------------------------------------------------
Q56274_9PROT/119-154--------------------------------------------------------------------------------
Q48792_LISMN/188-223--------------------------------------------------------------------------------
GLMU_BACCL/51-86--------------------------------------------------------------------------------
O33923_CORAM/34-69--------------------------------------------------------------------------------
LPXD_CHLTR/116-151--------------------------------------------------------------------------------
C9K1L0_KLEPN/162-197--------------------------------------------------------------------------------
A0A0T7RR04_SALET/149-184--------------------------------------------------------------------------------
LPXD_SYNY3/118-153--------------------------------------------------------------------------------
Y3034_MYCTU/218-253--------------------------------------------------------------------------------
WBBJ_ECOLI/132-167--------------------------------------------------------------------------------
P72981_SYNY3/162-197--------------------------------------------------------------------------------
O59588_PYRHO/365-400--------------------------------------------------------------------------------
LPXD_BRUA2/128-163--------------------------------------------------------------------------------
H9L4Q4_VIBCH/121-156--------------------------------------------------------------------------------
WCAB_ECOLI/108-143--------------------------------------------------------------------------------
SRPH_SYNE7/260-295--------------------------------------------------------------------------------
P93544_SPIOL/265-300--------------------------------------------------------------------------------
CYSE_BUCAP/194-229--------------------------------------------------------------------------------
CYSE_BACSU/118-153--------------------------------------------------------------------------------
O69218_AZOVI/117-152--------------------------------------------------------------------------------
NIFP_AZOCH/118-153--------------------------------------------------------------------------------
CYSE_STAXY/120-155--------------------------------------------------------------------------------
Q7AQF4_MYCLE/117-152--------------------------------------------------------------------------------
CYSE_SYNE7/117-152--------------------------------------------------------------------------------
CYSE_HELPY/116-151--------------------------------------------------------------------------------
YRDA_ECOLI/97-132--------------------------------------------------------------------------------
Q9ZD31_RICPR/89-124--------------------------------------------------------------------------------
YTOA_BACSU/87-122--------------------------------------------------------------------------------
O26372_METTH/143-178--------------------------------------------------------------------------------
DAPH_BACSU/165-200--------------------------------------------------------------------------------
DAPD_ECOLI/175-210--------------------------------------------------------------------------------
F3K8R5_PSEAJ/175-210--------------------------------------------------------------------------------
O59257_PYRHO/88-123--------------------------------------------------------------------------------
O67576_AQUAE/90-125--------------------------------------------------------------------------------
CAIE_ECOLI/88-123--------------------------------------------------------------------------------
PAAY_ECOLI/88-123--------------------------------------------------------------------------------
Q45929_COXBE/117-152--------------------------------------------------------------------------------
O27625_METTH/74-109--------------------------------------------------------------------------------
Y3753_PSEAE/87-122--------------------------------------------------------------------------------
Y304_METJA/77-112--------------------------------------------------------------------------------
WBPD_PSEAE/101-136--------------------------------------------------------------------------------
YVOF_BACSU/106-141--------------------------------------------------------------------------------
F7YJG3_VIBA7/98-133--------------------------------------------------------------------------------
GLMU_NEIGO/264-299--------------------------------------------------------------------------------
O59364_PYRHO/307-342--------------------------------------------------------------------------------
LPXD_RICRS/123-158--------------------------------------------------------------------------------
LPXD_PASMU/111-146--------------------------------------------------------------------------------
O87774_LACSK/117-152--------------------------------------------------------------------------------
A0A0E1AGQ2_STAAU/130-165--------------------------------------------------------------------------------
O68047_RHOCA/110-145--------------------------------------------------------------------------------
Q2G1K1_STAA8/119-154--------------------------------------------------------------------------------
Q8U5W2_AGRFC/180-215--------------------------------------------------------------------------------
MATA_LYSSH/77-112--------------------------------------------------------------------------------
O87276_9STAP/118-153--------------------------------------------------------------------------------
CAT4_PSEAE/110-145--------------------------------------------------------------------------------
Q79EF3_SYNY3/114-149--------------------------------------------------------------------------------
O86929_SALTM/110-145--------------------------------------------------------------------------------
CAT4_AGRFC/109-144--------------------------------------------------------------------------------
O87158_VIBCL/104-139--------------------------------------------------------------------------------
Q56045_STRTR/106-141--------------------------------------------------------------------------------
M5JVF4_STREE/129-164--------------------------------------------------------------------------------
THGA_LACLA/133-168--------------------------------------------------------------------------------
Y1064_METJA/159-194--------------------------------------------------------------------------------
YA39_SCHPO/150-185--------------------------------------------------------------------------------
E7KQ17_YEASL/130-165--------------------------------------------------------------------------------
J0UV19_RHILV/131-166--------------------------------------------------------------------------------
THGA_ECOLI/131-166--------------------------------------------------------------------------------
MAA_BACSU/130-165--------------------------------------------------------------------------------
H7C7I4_CAUCR/142-177--------------------------------------------------------------------------------
O86157_CAMJU/109-144--------------------------------------------------------------------------------
LPXA_CHLTR/61-96--------------------------------------------------------------------------------
LPXA_RICRS/63-98--------------------------------------------------------------------------------
LPXA_HAEIN/65-100--------------------------------------------------------------------------------
LPXA_SYNY3/73-108--------------------------------------------------------------------------------
LPXA_AQUAE/60-95--------------------------------------------------------------------------------
Q45929_COXBE/39-74--------------------------------------------------------------------------------
YRDA_ECOLI/12-47--------------------------------------------------------------------------------
CAIE_ECOLI/10-45--------------------------------------------------------------------------------
PAAY_ECOLI/10-45--------------------------------------------------------------------------------
O59257_PYRHO/10-45--------------------------------------------------------------------------------
YTOA_BACSU/9-44--------------------------------------------------------------------------------
Q9ZD31_RICPR/10-45--------------------------------------------------------------------------------
O67576_AQUAE/11-46--------------------------------------------------------------------------------
O66933_AQUAE/251-286--------------------------------------------------------------------------------
DAPH_BACSU/121-156--------------------------------------------------------------------------------
DAPD_BUCAP/131-166--------------------------------------------------------------------------------
F3K8R5_PSEAJ/131-166--------------------------------------------------------------------------------
Q56274_9PROT/77-111--------------------------------------------------------------------------------
O59588_PYRHO/306-340--------------------------------------------------------------------------------
O27626_METTH/309-343--------------------------------------------------------------------------------
P74589_SYNY3/249-284--------------------------------------------------------------------------------
F7YJG3_VIBA7/12-47--------------------------------------------------------------------------------
EI2BE_SCHPO/330-364--------------------------------------------------------------------------------
P72757_SYNY3/62-97--------------------------------------------------------------------------------
O30712_SYNP2/59-94--------------------------------------------------------------------------------
LPXD2_ARATH/98-133--------------------------------------------------------------------------------
GLGC_MYCLE/328-362--------------------------------------------------------------------------------
P71784_MYCTU/106-141--------------------------------------------------------------------------------
Q2G1K1_STAA8/49-83--------------------------------------------------------------------------------
EI2BE_SCHPO/387-422--------------------------------------------------------------------------------
EI2BE_YEAST/382-416--------------------------------------------------------------------------------
LPXA_CHLTR/103-138--------------------------------------------------------------------------------
LPXA_RICRS/106-141--------------------------------------------------------------------------------
LPXA_ALLVD/103-138--------------------------------------------------------------------------------
LPXA_AQUAE/103-138--------------------------------------------------------------------------------
LPXA_NEIMB/104-139--------------------------------------------------------------------------------
LPXA_SYNY3/115-150--------------------------------------------------------------------------------
LPXA_HELPY/104-139--------------------------------------------------------------------------------
LPXA_HAEIN/108-143--------------------------------------------------------------------------------
LPXA_PROMH/108-143--------------------------------------------------------------------------------
LPXD_HAEIN/225-260--------------------------------------------------------------------------------
LPXD_SYNY3/231-266--------------------------------------------------------------------------------
LPXD_AQUAE/216-251--------------------------------------------------------------------------------
LPXD_HELPY/216-251--------------------------------------------------------------------------------
LPXD_NEIMB/224-259--------------------------------------------------------------------------------
LPXD2_ARATH/199-234--------------------------------------------------------------------------------
LPXD_BRUA2/240-275--------------------------------------------------------------------------------
Q48392_KLEOX/209-244--------------------------------------------------------------------------------
LPXD_RICRS/235-270--------------------------------------------------------------------------------
LPXD_CHLTR/230-265--------------------------------------------------------------------------------
LPXA_BRUA2/106-141--------------------------------------------------------------------------------
O26372_METTH/95-130--------------------------------------------------------------------------------
F7YJG3_VIBA7/48-83--------------------------------------------------------------------------------
LPXD_NEIMB/147-182--------------------------------------------------------------------------------
LPXD_SYNY3/154-189--------------------------------------------------------------------------------
LPXD_AQUAE/139-174--------------------------------------------------------------------------------
LPXD_SALTY/145-180--------------------------------------------------------------------------------
LPXD_PASMU/147-182--------------------------------------------------------------------------------
LPXD_HAEIN/148-183--------------------------------------------------------------------------------
LPXD_YEREN/145-180--------------------------------------------------------------------------------
LPXD_BRUA2/164-198--------------------------------------------------------------------------------
LPXD_HELPY/120-155--------------------------------------------------------------------------------
LPXD_RICRS/159-193--------------------------------------------------------------------------------
LPXA_NEIMB/1-36--------------------------------------------------------------------------------
MPG1_SCHPO/249-284--------------------------------------------------------------------------------
E7LS70_YEASV/248-283--------------------------------------------------------------------------------
G0RMQ5_HYPJQ/251-286--------------------------------------------------------------------------------
MPG1_CANAL/249-284--------------------------------------------------------------------------------
O27787_METTH/325-360--------------------------------------------------------------------------------
GLMU_SYNY3/313-348--------------------------------------------------------------------------------
GLMU_AQUAE/324-359--------------------------------------------------------------------------------
GLMU_BACSU/317-352--------------------------------------------------------------------------------
Q48792_LISMN/111-146--------------------------------------------------------------------------------
GLMU_MYCTU/328-363--------------------------------------------------------------------------------
GLMU_NEIGO/316-351--------------------------------------------------------------------------------
A0A077Z6C0_TRITR/317-352--------------------------------------------------------------------------------
GLMU_HAEIN/317-352--------------------------------------------------------------------------------
EI2BE_YEAST/330-364--------------------------------------------------------------------------------
LPXA_ALLVD/12-47--------------------------------------------------------------------------------
LPXA_SYNY3/25-60--------------------------------------------------------------------------------
LPXA_RICRS/15-50--------------------------------------------------------------------------------
LPXA_CHLTR/13-48--------------------------------------------------------------------------------
A0A0F7WUZ8_CHLPN/13-48--------------------------------------------------------------------------------
LPXA_BRUA2/15-50--------------------------------------------------------------------------------
LPXA_HAEIN/17-52--------------------------------------------------------------------------------
LPXA_YEREN/17-52--------------------------------------------------------------------------------
LPXA_PROMH/17-52--------------------------------------------------------------------------------
O27787_METTH/255-290--------------------------------------------------------------------------------
O58775_PYRHO/315-344--------------------------------------------------------------------------------
H7C7I4_CAUCR/106-141--------------------------------------------------------------------------------
EPSM_BACSU/102-137--------------------------------------------------------------------------------
O58775_PYRHO/245-280--------------------------------------------------------------------------------
GLMU_AQUAE/272-307--------------------------------------------------------------------------------
GLMU_SYNY3/262-297--------------------------------------------------------------------------------
GLMU_BACSU/266-301--------------------------------------------------------------------------------
GLMU_MYCTU/277-312--------------------------------------------------------------------------------
Q48792_LISMN/60-95--------------------------------------------------------------------------------
O84634_CHLTR/59-94--------------------------------------------------------------------------------
A0A0F7YVQ3_CHLPN/60-95--------------------------------------------------------------------------------
O26372_METTH/41-76--------------------------------------------------------------------------------
EI2BE_HUMAN/359-393--------------------------------------------------------------------------------
LPXA_HELPY/13-48--------------------------------------------------------------------------------
O27626_METTH/256-291--------------------------------------------------------------------------------
O59588_PYRHO/253-288--------------------------------------------------------------------------------
LPXA_AQUAE/12-47--------------------------------------------------------------------------------
O59364_PYRHO/256-290--------------------------------------------------------------------------------
LPXD_AQUAE/103-138--------------------------------------------------------------------------------

PF14602

DAPD_SULDN/300-333--------------------------------------------------------------------------------
Q8FQF4_COREF/259-293--------------------------------------------------------------------------------
E8NC18_MICTS/219-252--------------------------------------------------------------------------------
A1STS6_PSYIN/252-285--------------------------------------------------------------------------------
Q8U2R4_PYRFU/37-72--------------------------------------------------------------------------------
E8V741_TERSS/175-210--------------------------------------------------------------------------------
A1WX25_HALHL/176-211--------------------------------------------------------------------------------
Q15QD8_PSEA6/210-243--------------------------------------------------------------------------------
A0RN31_CAMFF/297-330--------------------------------------------------------------------------------
D5V5C0_ARCNC/297-330--------------------------------------------------------------------------------
A0JYR5_ARTS2/248-281--------------------------------------------------------------------------------
B9L6I2_NAUPA/287-320--------------------------------------------------------------------------------
D7GF12_PROFC/226-259--------------------------------------------------------------------------------
E2SBF8_9ACTN/226-259--------------------------------------------------------------------------------
DAPD_ZYMMO/171-206--------------------------------------------------------------------------------
Q0VQG2_ALCBS/253-286--------------------------------------------------------------------------------
DAPD_BLOFL/180-215--------------------------------------------------------------------------------
C1A408_GEMAT/176-211--------------------------------------------------------------------------------
B0VHT1_CLOAI/167-202--------------------------------------------------------------------------------
D9SGU0_GALCS/175-210--------------------------------------------------------------------------------
C6Y287_PEDHD/166-201--------------------------------------------------------------------------------
C4LHT9_CORK4/233-266--------------------------------------------------------------------------------
A7ZCR0_CAMC1/300-333--------------------------------------------------------------------------------
D7WDN8_9CORY/234-268--------------------------------------------------------------------------------
D1BYT1_XYLCX/243-276--------------------------------------------------------------------------------
E3GF87_EUBLK/173-208--------------------------------------------------------------------------------
Q6NHZ9_CORDI/229-263--------------------------------------------------------------------------------
B2V696_SULSY/121-156--------------------------------------------------------------------------------
D1BKM4_SANKS/225-258--------------------------------------------------------------------------------
DAPD_BEII9/183-218--------------------------------------------------------------------------------
GLMU_AGRRK/379-414--------------------------------------------------------------------------------
C8XJN1_NAKMY/241-274--------------------------------------------------------------------------------
B3ET32_AMOA5/167-202--------------------------------------------------------------------------------
Q2GI44_EHRCR/182-217--------------------------------------------------------------------------------
D3UHQ9_HELM1/290-323--------------------------------------------------------------------------------
C7MVH9_SACVD/242-275--------------------------------------------------------------------------------
B3QZC3_CHLT3/182-217--------------------------------------------------------------------------------
E3PSU4_CLOSD/168-203--------------------------------------------------------------------------------
DAPH_STRSV/161-196--------------------------------------------------------------------------------
GLMU_STRSY/395-429--------------------------------------------------------------------------------
C5AZJ3_METEA/178-213--------------------------------------------------------------------------------
D9Q9N2_CORP2/229-261--------------------------------------------------------------------------------
D9Q9N4_CORP2/230-263--------------------------------------------------------------------------------
D9TDT4_MICAI/233-265--------------------------------------------------------------------------------
E0TE45_PARBH/181-214--------------------------------------------------------------------------------
E4PGY8_MARAH/252-284--------------------------------------------------------------------------------
F0P119_WEEVC/165-199--------------------------------------------------------------------------------
G2NH01_STREK/246-278--------------------------------------------------------------------------------
DAPD_HELPY/301-334--------------------------------------------------------------------------------
Q2G043_STAA8/106-141--------------------------------------------------------------------------------
Q2IG91_ANADE/168-203--------------------------------------------------------------------------------
Q79VH2_CORGL/241-274--------------------------------------------------------------------------------
GLMU_STRR6/394-428--------------------------------------------------------------------------------
DAPD_BIFLO/246-278--------------------------------------------------------------------------------
DAPD_VIBCH/253-285--------------------------------------------------------------------------------
R6X2K4_9PORP/76-110--------------------------------------------------------------------------------
R7JIP3_9BACT/169-203--------------------------------------------------------------------------------

PF07959

W5LBD8_ASTMX/112-511FSIQDDLKKSVSKPADMDQLKMFGAPLDECV.SRW........GLCAEDVRFSGDGSVC....NLWNCCIFPVCPD----
H0Z730_TAEGU/55-450TGRLDDWQSPVE......KATYLNVPWAEFF.QRT........GLREGDLWDAEMPRGSR...CLLSARLFPVLHA----
H2V794_TAKRU/111-514FGIDDDLKRRSEAPR..EELKLFGRSLAECL.SHW........ELGDEAVRFSRDEPKW....SLWEARLFPVCP.----
FUK_MOUSE/97-496AGRLDSWERQGA.......GMYLNMSWNEFF.KKT........GIRDWDLWDPDTPPSDR...CLLTARLFPVLHP----
H2XT72_CIOIN/112-517FSVYDNMKSFVA.VSDAANLTYLKKPLKHWF..............QNPELAFSGVKASK...ASLWYAKLFPVCNT----
H2UFX8_TAKRU/97-498MGAQDDLESSFD....DARASFLNQSWNHFC.SRT........GIQPEELWVKKEQR......SLLEARLFPVFSP----
W5P4P4_SHEEP/97-496VGRLDSWERQGT.......GTYLNMSWSKFF.QKT........GIRDWDLWDPDVPPAER...CLLSARLFPVLHP----
U9SUG9_RHIID/114-546FGTNDDMKASYS..................FNSLVIYKNILVHKIVLSQCIKSIQQKGEHKY.ALWNVPIFPMTKT----
U3JEG4_FICAL/32-445FGVGDDLKKSVESLSDIHSLRFFGASLPECL.GLW........SIEASDQLFSSEDTHL....GLWTARIFPVCST----
B3RXN8_TRIAD/106-509YSVGDNIKKYTSNISQLDTLNYAGRKISHVIRNVL........NLNPADIWTNGTKI......DLWHAKLFPSYKS----
F7G1T1_ORNAN/113-528CGVRDDPKKSVKGLSDLQSLQFFGVSFPDCL.ALW........NLQITEERFSGDKT......SLWTARIFPVCSS----
T1J558_STRMM/188-601FGLFDHLFQTFH....SIDATFCNIPWKYFF.DHT........EITTHDLWGSNEAQSM....SLMNARLFPISTD----
I3J111_ORENI/111-518FGINDNLKYTVGTPAYMEELKLFGFTLEKCL.SIW........GMEKEVLRFSGDASSF....NLWNACLFPVCSD----
W4YPG4_STRPU/114-532FDIRDNLKRSAPHLEEAGQLSFLNQSLQVLF.NNF........NSTSLQAIFPPGTTTF....SIWNAKLFP....----
H9GU62_ANOCA/113-530FGIEDNLKKKVTDLAEIRLLSFFGISFEEFL.ELC........GLRVSNELFSDDKTHL....ALWTARIFPVCST----
T1JC87_STRMM/128-547FGMDDDLKMHYS.TFDANSMVYFGRRMGNLL.SYL........GIKNVLELFDEKDEVC....ALWNAKLFTVYST----
G3TX92_LOXAF/97-494TGRLDNWE.........VGALHLPHLCPPNV.PSP........PVRDWDLWDPDTPPTER...CLLSARLFPVFHP----
R7BGP0_9FIRM/113-501YGCLDNPKGKYH..AGDSSAAFLGSTLRDFI.EVM........GLDTTDVWDSGDEADW....YLWNAKLYPEC..----
F1RBS0_DANRE/70-468FGVLDDLKKNVPRPADMKALSLFKRSLEDCV.GLW........GLCLEKVRFSGDASVC....SLWNACIFPVCSD----
F7C0H8_XENTR/114-520LGIDDNLKANVGSLSNVGSLRFCGRSLSECL.GIW........GIDASEELFSGDSAAR....SLWTARLFPVCSA----
I1NCN7_SOYBN/120-518CGLHDNPKSSLS.....KDGTFCGKPWKKIL.HDL........GIQESDLWGSSGPEK.....YLWNSKIFPILPY----
H3CAG6_TETNG/98-496MGAQDPLEASFG....DRGASFLNQSWSRFC.SRT........GIQPEEVWLKPEQR......SLLEARLFPVFSP----
M0ZH48_SOLTU/137-535CGIHDNPKIPLS......NGTFCGKPWRKVL.DDL........GIQDTDMWISENTLEK....CLWNAKIFPVLPY----
F0ZSJ1_DICPU/37-438LGIQDDLNLYFT....DPNATIANRTWEEFL.KTS........GIAPEELWSKGLPR......ILRTARLFPII..----
R5IAV3_9FIRM/116-510YGIKDNPKKTWE.....ENGSFLNGGLKNLT.ELN........SLDVDDIWVDEDH.......SLWKAKLYPAAKS----
D7FJB1_ECTSI/126-593FGARDDIKAHYS....ADRARVCGATWEAFF.GYT........GATAEDVWGGIEEGDR....KLWSARLFPVLTR----
T1FYY1_HELRO/80-485FNINDDLKKVYQ...SPEDVKYFGKHLADLF.............TSPLECEFHNNIY......SLWNCKLF.....----
G3NYZ9_GASAC/98-501TGAQDVLEASSE....DSGASFLNHGWSLFF.SRT........GIQSEELWVRGERR......SLLAARLFPVLHP----
G3UP39_MELGA/32-450FSVEDDLKKNVELLSDTNSLRFFGVSLQECL.ELW........GVQLSDQLFSGENSQF....GLWTARIFPVCSS----
FPGT_HUMAN/114-533FGVQDNLKKSVKTLSDIKLLQFFGVCFLSCL.DVW........NLKVTEELFSGNKTCL....SLWTARIFPVCSS----
C3XWJ9_BRAFL/92-524FDIRDDMKKSVA.PNDAGKLRYYGMSLDDVA.KCL........QKPTPQQLFPSNAQSC....SLWNGKLFPLS..----
F0SXR2_SYNGF/113-494YGINDNPKSSAD.......GRFLNTTLRKIL.DKY........RLKNLDVWDETPP.......SLWNAKLYPICG.----
K0T387_THAOC/108-580FGINDGIKDFPM.......KTVYGVDLRALTRGFATANECGIISIKESEIWNENVPSSRR...MLWNANMHPIIE.----
H9G685_ANOCA/97-505SGRHNRWESLAE.....EDGTYLNARWSDLF.LRT........GIRREDLWSGDVLPGRG...CLLNAHLFPVLHA----
I1P6V0_ORYGL/150-552CGLHDNPKVSMK.....KDGTFCGKPWRNVL.EHL........KIQDTDLWSSTNEDN.....CLWNAKLFPVMSL----
FKGP_ARATH/131-529CGLHDNPKNSIH.....KDGTFCGKPLEKVL.FDL........GIEESDLWSSYVAQDR....CLWNAKLFPILTY----
G3VJJ9_SARHA/106-523YGVEDDLKRKVRALPDVRSLRFSGQGFLDCL.DLW........GLEVTGDLFSSSDL......GLWTARIFPVCPT----
A9TP04_PHYPA/132-540CGLDDDPKVSFS.....SGGSFCGGQWGKFI.RDR........GICKSDLWGPNEDE......NLWNAKLFPVVSL----
Q02BJ1_SOLUE/128-518YGVEDDAKMSVA....RGKATWFGRPMLAEL.EAL........GLAPEVVWPDLPREEW....TLWNAHLFPVTTV----
D7UCW9_VITVI/146-545CGLHDNPKDSLS.....RNGTFCGKPWDKVL.HDL........GIQEGDLWSTRSTHEK....CLWNAKIFPILSY----
W5M6I6_LEPOC/116-528FAVGDNLKQSVPSVSDIGQLQFYGRSLLECL.GLW........GLSVQDLQFSGDTSCL....SLWTAKLFPLCC.----
E9PSM4_RAT/106-522FSVQDNLKGSVKTLEDIKALQFFGVCFLSCL.DIW........NLKATEKLFSGSKRNL....SLWTARIFPVCPS----
M0RP18_MUSAM/153-575CGLHDNPKISVE.....NGGTFCGKPWKKIL.HYL........QIQESDLWSSLAGQEK....CLWTAKLFPVVSS----
F0ZWK1_DICPU/160-551FGIDDDLKTAND.......PKLFGKSLKQEY..............SFSGKIWPNENNGNPIVESLWNASIFPISN.----
D4M6A5_9FIRM/114-496YGVPDNPKGKYP.....GEVSFLGTTLNQFM.AQN........KVTKEELWKGEET.......YLWFADLYPVCD.----
U5D0Y7_AMBTC/152-554CGLHDNPKSSHA.....KDGTFCGKPWKKVL.HEH........GIQQSELWNTSDAQEQ....CLWNAKIFPVLPR----
M4AF92_XIPMA/111-517FGIKDNLKQSVASPSYVEELEFFGLNLAKCL.SHW........GMENERLKFSGDTSSC....SLWNACLFPVCSE----
V8P3W9_OPHHA/98-513LGIEDNLKQNVENLGDIHLLSFFGIGLKQCL.ELW........GLRISDELFSGDKTCL....GLWTVRIFPVCSH----
B9I905_POPTR/194-593CGLHDNPKSSLS.....RDGTFCGKPWKKVL.LDL........GIQESDLWSSVGVQEN....CLWNAKLFPILSY----
M3ZWZ0_XIPMA/97-496TGAHDDLQVPFN....DSGASFLNQTWTVFF.SSS........GIKPEELWVKGEHC......SLLEARLFPVLHP----
B7S4B1_PHATC/94-530LGVDDKIKSLDG.........LYGRPLQDFM.SWA........GLSESDLWDEEADHK.....MVWNARLHPS...----
Q54NH4_DICDI/127-556FGIDDDLKSTTN.......PKLFGIPLKDYN.............LNSINTSDDNNNNN.....SLWNAPLFPIS..----
H3ANF5_LATCH/114-531FGIEDNLKKTTKSINKISKLQFFGNSFLTCL.EQW........GLTISEKLFSGDRKHL....SLWNARIFPVH..----
H2YSE9_CIOSA/106-502FSVLDCMKSAVP.ISSAANLTYLGKPLENWF..............KNPDQAFSDVQSTK...ASLWNAKLFTVCDS----

PF16314

R6X3X4_9PORP/7-660TWAYDMLEEYYGVNLSS.ISAAQIVDLVRRWQDSVIGLDNLLYKDAKKEFSLTFMTGFGVDGSDKE.KQEDFEGVR.GAF
Q5LHM9_BACFN/5-659TWAYHKIQEFYGLNPET.ITAKDIIAIVRAWREAVVGLDRMVYDDARKEFSLSSMTGFGADGSRDE.MKLDFGQVR.GDF
H1XPF7_9BACT/41-722SHAVYSLLDLYEITPHD.LTFERLRKILKHVKEIAGQLLKNAFKSREKDYTNPYR.......KMTYENEQEMEAVL.GKI
R5GF65_9PORP/2-659DWSFDLLCRWYDINEDHPLTIELIRSILKDWIDAVLAIDDALLNDAHKEYNIIGRVNFGVKNSDMQ.TTTYTEQIE.AEY
E4T878_PALPW/4-655VWVKSILEKQVGKPIHE...KEVIISSIENWKKAVQTFEDMILRDAKKEFNSISKTGFGLDGDDSD.KQLDFENVR.GNF
F3ZTN4_9BACE/4-657TWAWEKIKSYYGVNLNS.ITAQDVILIVEEWKKAVTGLDKMIYEDAKKEFSLSSRISFGLDGNRYV.QKVDFEKVR.GLF
R5PLK0_9BACT/5-659TWAWDTIQKWYDISPDS.ITAQDIIRIVNIWKEAVISLDEMLYNDARKEFSLMAQTGFGVDGTNHQ.KQMDFEQVR.GDF
Q7MTP4_PORGI/8-662CWAYNALLEWYELNPED.LTRSKVAELVHTWMRSVIRLDEMLYEDAKKEFQMHSQVGFGIDLVGEM.KHRDFDEVR.GDF
R5VAS6_9BACT/7-661NWAWQIICKWYDVSLDT.ITSSDIIRIVNIWKEAVISLDEMLYADAHKEFSLTAQTGFGIDGNSRQ.KQKDFEQVR.GGF
F9ZCM7_ODOSD/4-657TWAWEVMQPWYRVTPES.ITAGDVIRIVNTWKEAVVNLDKMLYEDAKKEFSMTAQTGFGADGNQKQ.KKIDFEQVR.GAF
R5I224_9BACT/5-658RWVYAHIRTVYNVDPQK.ITRKKLIELLRQWRAASESLFADIEMDASKEFGEGGMTGFGLDVTDRDEILADFRHVR.GEF
F4KKJ2_PORAD/2-657HWAYDLLLRWYDISAKD.LTVERVIQIVKEWQETVIALDECLLKDAHKEFEMLTQVGFGIDLNGEHNRRIDFEQVR.GSY
A6LH30_PARD8/5-658TWAYEMIERYYGVDLRS.ISAAEIIDLVRRWQECVIRLDEMLYEDARKEFSLTSMIGFGVDGSNKE.KQQDFEGVR.GDF
R5LL62_9SPIR/12-659SWVIDITKKRYSIKN...IDKEIIIKILKEYISLLKTSYDILYRDAEKEYDISKMVSCGIDDKNFM..EEDFKSIR.GTV
R6SVY6_9BACE/4-659TWAYDAIERYWKIDLSK.ITRSEAAEIVKQWKNAVVSLDKLIYDDASKEFALTSMTGFGADGDKTR.RDEDFNAVRGGGF
R5VUQ7_9BACE/5-659TWAYEKMLDFYGLQTDK.ITAADIAAIVRQWQEAVVGLDKMVYEDAKKEFSLTSMTGFGADGSSEE.KMRDFEEVR.GVF
X5DE87_9BACT/9-663TWAVDVLESFYGKSISE.FEASDVISIVKKWKESVLGIDRFLYEDARKEFSMSKMTGFGVDGQNGA.RELDFTEVR.GEF
H1XNG4_9BACT/3-653NWTAALLKEEWQIDVET.IEKDQFKQLIANWKNQKIRFNNLILSDAQKEFDSNSRIAYGIDGDEQI.ALKDFEAVR.GTL
R5IQU5_9PORP/5-659TWAYEVMQKWYGKSISK.ITAEDITEIVNIWKDAVVSLDEMLYADAKKEFSMTAKTGFGVDGNSQQ.KNTDFEQVR.GVF
C0R0B6_BRAHW/11-658SWVMNTIKSRYNIKD...IDKETIKKLLINHISLLEEAYNIFYKDVEKEYDASKMVSSGIDDKSVM..EKDFEAVR.GTV

PF00132

A0A0F6C616_ECOLX/86-121---------------------------
A0A0F7WUQ7_CHLPN/153-188---------------------------
A0A0F7WUQ7_CHLPN/117-152---------------------------
LPXD_ECOLI/109-144---------------------------
LPXA_ECOLI/65-100---------------------------
LPXA_ECOLI/108-143---------------------------
LPXD_ECOLI/222-257---------------------------
A0A0F7WUQ7_CHLPN/231-266---------------------------
A0A0F6C616_ECOLX/122-157---------------------------
LPXA_ECOLI/17-52---------------------------
YVOF_BACSU/59-94---------------------------
EI2BE_HUMAN/416-451---------------------------
YBB2_SCHPO/366-401---------------------------
E7LS70_YEASV/289-323---------------------------
A0A0E1AGQ2_STAAU/80-114---------------------------
LPXA_SYNY3/151-186---------------------------
O58150_PYRHO/245-280---------------------------
O66933_AQUAE/320-355---------------------------
Q48392_KLEOX/245-280---------------------------
LPXD_AQUAE/252-287---------------------------
Q46674_ECOLX/152-187---------------------------
EPSM_BACSU/156-191---------------------------
F6RW81_MACMU/98-133---------------------------
WBPD_PSEAE/14-49---------------------------
Q79H46_BORPE/13-48---------------------------
O86157_CAMJU/151-186---------------------------
YBB2_SCHPO/287-322---------------------------
F6RW81_MACMU/8-43---------------------------
Q46674_ECOLX/104-139---------------------------
LPXD_CHLTR/152-187---------------------------
P74589_SYNY3/319-354---------------------------
Q48392_KLEOX/113-148---------------------------
LPXD_NEIMB/105-140---------------------------
O27626_METTH/368-403---------------------------
GLMU_AQUAE/401-436---------------------------
GLMU_MYCTU/405-440---------------------------
GLMU_NEIGO/393-428---------------------------
GLMU_SYNY3/390-425---------------------------
A0A077Z6C0_TRITR/394-429---------------------------
Q56274_9PROT/119-154---------------------------
Q48792_LISMN/188-223---------------------------
GLMU_BACCL/51-86---------------------------
O33923_CORAM/34-69---------------------------
LPXD_CHLTR/116-151---------------------------
C9K1L0_KLEPN/162-197---------------------------
A0A0T7RR04_SALET/149-184---------------------------
LPXD_SYNY3/118-153---------------------------
Y3034_MYCTU/218-253---------------------------
WBBJ_ECOLI/132-167---------------------------
P72981_SYNY3/162-197---------------------------
O59588_PYRHO/365-400---------------------------
LPXD_BRUA2/128-163---------------------------
H9L4Q4_VIBCH/121-156---------------------------
WCAB_ECOLI/108-143---------------------------
SRPH_SYNE7/260-295---------------------------
P93544_SPIOL/265-300---------------------------
CYSE_BUCAP/194-229---------------------------
CYSE_BACSU/118-153---------------------------
O69218_AZOVI/117-152---------------------------
NIFP_AZOCH/118-153---------------------------
CYSE_STAXY/120-155---------------------------
Q7AQF4_MYCLE/117-152---------------------------
CYSE_SYNE7/117-152---------------------------
CYSE_HELPY/116-151---------------------------
YRDA_ECOLI/97-132---------------------------
Q9ZD31_RICPR/89-124---------------------------
YTOA_BACSU/87-122---------------------------
O26372_METTH/143-178---------------------------
DAPH_BACSU/165-200---------------------------
DAPD_ECOLI/175-210---------------------------
F3K8R5_PSEAJ/175-210---------------------------
O59257_PYRHO/88-123---------------------------
O67576_AQUAE/90-125---------------------------
CAIE_ECOLI/88-123---------------------------
PAAY_ECOLI/88-123---------------------------
Q45929_COXBE/117-152---------------------------
O27625_METTH/74-109---------------------------
Y3753_PSEAE/87-122---------------------------
Y304_METJA/77-112---------------------------
WBPD_PSEAE/101-136---------------------------
YVOF_BACSU/106-141---------------------------
F7YJG3_VIBA7/98-133---------------------------
GLMU_NEIGO/264-299---------------------------
O59364_PYRHO/307-342---------------------------
LPXD_RICRS/123-158---------------------------
LPXD_PASMU/111-146---------------------------
O87774_LACSK/117-152---------------------------
A0A0E1AGQ2_STAAU/130-165---------------------------
O68047_RHOCA/110-145---------------------------
Q2G1K1_STAA8/119-154---------------------------
Q8U5W2_AGRFC/180-215---------------------------
MATA_LYSSH/77-112---------------------------
O87276_9STAP/118-153---------------------------
CAT4_PSEAE/110-145---------------------------
Q79EF3_SYNY3/114-149---------------------------
O86929_SALTM/110-145---------------------------
CAT4_AGRFC/109-144---------------------------
O87158_VIBCL/104-139---------------------------
Q56045_STRTR/106-141---------------------------
M5JVF4_STREE/129-164---------------------------
THGA_LACLA/133-168---------------------------
Y1064_METJA/159-194---------------------------
YA39_SCHPO/150-185---------------------------
E7KQ17_YEASL/130-165---------------------------
J0UV19_RHILV/131-166---------------------------
THGA_ECOLI/131-166---------------------------
MAA_BACSU/130-165---------------------------
H7C7I4_CAUCR/142-177---------------------------
O86157_CAMJU/109-144---------------------------
LPXA_CHLTR/61-96---------------------------
LPXA_RICRS/63-98---------------------------
LPXA_HAEIN/65-100---------------------------
LPXA_SYNY3/73-108---------------------------
LPXA_AQUAE/60-95---------------------------
Q45929_COXBE/39-74---------------------------
YRDA_ECOLI/12-47---------------------------
CAIE_ECOLI/10-45---------------------------
PAAY_ECOLI/10-45---------------------------
O59257_PYRHO/10-45---------------------------
YTOA_BACSU/9-44---------------------------
Q9ZD31_RICPR/10-45---------------------------
O67576_AQUAE/11-46---------------------------
O66933_AQUAE/251-286---------------------------
DAPH_BACSU/121-156---------------------------
DAPD_BUCAP/131-166---------------------------
F3K8R5_PSEAJ/131-166---------------------------
Q56274_9PROT/77-111---------------------------
O59588_PYRHO/306-340---------------------------
O27626_METTH/309-343---------------------------
P74589_SYNY3/249-284---------------------------
F7YJG3_VIBA7/12-47---------------------------
EI2BE_SCHPO/330-364---------------------------
P72757_SYNY3/62-97---------------------------
O30712_SYNP2/59-94---------------------------
LPXD2_ARATH/98-133---------------------------
GLGC_MYCLE/328-362---------------------------
P71784_MYCTU/106-141---------------------------
Q2G1K1_STAA8/49-83---------------------------
EI2BE_SCHPO/387-422---------------------------
EI2BE_YEAST/382-416---------------------------
LPXA_CHLTR/103-138---------------------------
LPXA_RICRS/106-141---------------------------
LPXA_ALLVD/103-138---------------------------
LPXA_AQUAE/103-138---------------------------
LPXA_NEIMB/104-139---------------------------
LPXA_SYNY3/115-150---------------------------
LPXA_HELPY/104-139---------------------------
LPXA_HAEIN/108-143---------------------------
LPXA_PROMH/108-143---------------------------
LPXD_HAEIN/225-260---------------------------
LPXD_SYNY3/231-266---------------------------
LPXD_AQUAE/216-251---------------------------
LPXD_HELPY/216-251---------------------------
LPXD_NEIMB/224-259---------------------------
LPXD2_ARATH/199-234---------------------------
LPXD_BRUA2/240-275---------------------------
Q48392_KLEOX/209-244---------------------------
LPXD_RICRS/235-270---------------------------
LPXD_CHLTR/230-265---------------------------
LPXA_BRUA2/106-141---------------------------
O26372_METTH/95-130---------------------------
F7YJG3_VIBA7/48-83---------------------------
LPXD_NEIMB/147-182---------------------------
LPXD_SYNY3/154-189---------------------------
LPXD_AQUAE/139-174---------------------------
LPXD_SALTY/145-180---------------------------
LPXD_PASMU/147-182---------------------------
LPXD_HAEIN/148-183---------------------------
LPXD_YEREN/145-180---------------------------
LPXD_BRUA2/164-198---------------------------
LPXD_HELPY/120-155---------------------------
LPXD_RICRS/159-193---------------------------
LPXA_NEIMB/1-36---------------------------
MPG1_SCHPO/249-284---------------------------
E7LS70_YEASV/248-283---------------------------
G0RMQ5_HYPJQ/251-286---------------------------
MPG1_CANAL/249-284---------------------------
O27787_METTH/325-360---------------------------
GLMU_SYNY3/313-348---------------------------
GLMU_AQUAE/324-359---------------------------
GLMU_BACSU/317-352---------------------------
Q48792_LISMN/111-146---------------------------
GLMU_MYCTU/328-363---------------------------
GLMU_NEIGO/316-351---------------------------
A0A077Z6C0_TRITR/317-352---------------------------
GLMU_HAEIN/317-352---------------------------
EI2BE_YEAST/330-364---------------------------
LPXA_ALLVD/12-47---------------------------
LPXA_SYNY3/25-60---------------------------
LPXA_RICRS/15-50---------------------------
LPXA_CHLTR/13-48---------------------------
A0A0F7WUZ8_CHLPN/13-48---------------------------
LPXA_BRUA2/15-50---------------------------
LPXA_HAEIN/17-52---------------------------
LPXA_YEREN/17-52---------------------------
LPXA_PROMH/17-52---------------------------
O27787_METTH/255-290---------------------------
O58775_PYRHO/315-344---------------------------
H7C7I4_CAUCR/106-141---------------------------
EPSM_BACSU/102-137---------------------------
O58775_PYRHO/245-280---------------------------
GLMU_AQUAE/272-307---------------------------
GLMU_SYNY3/262-297---------------------------
GLMU_BACSU/266-301---------------------------
GLMU_MYCTU/277-312---------------------------
Q48792_LISMN/60-95---------------------------
O84634_CHLTR/59-94---------------------------
A0A0F7YVQ3_CHLPN/60-95---------------------------
O26372_METTH/41-76---------------------------
EI2BE_HUMAN/359-393---------------------------
LPXA_HELPY/13-48---------------------------
O27626_METTH/256-291---------------------------
O59588_PYRHO/253-288---------------------------
LPXA_AQUAE/12-47---------------------------
O59364_PYRHO/256-290---------------------------
LPXD_AQUAE/103-138---------------------------

PF14602

DAPD_SULDN/300-333---------------------------
Q8FQF4_COREF/259-293---------------------------
E8NC18_MICTS/219-252---------------------------
A1STS6_PSYIN/252-285---------------------------
Q8U2R4_PYRFU/37-72---------------------------
E8V741_TERSS/175-210---------------------------
A1WX25_HALHL/176-211---------------------------
Q15QD8_PSEA6/210-243---------------------------
A0RN31_CAMFF/297-330---------------------------
D5V5C0_ARCNC/297-330---------------------------
A0JYR5_ARTS2/248-281---------------------------