Sequence alignment for CL0537

PF00642

ZC3H3_HUMAN/668-694KRKEYCM-YYNRFG..RCNRGERCPYIHDP
C3H5_ARATH/375-403WKVAICG-EYMKSRLKTCSRGSACNFIHCF
U2AFB_ORYSJ/149-174FREATCR-QFEE.N..SCNRGGYCNFMHVK
C3H24_ARATH/80-106WKTSLCS-YFRREA..SCSHGNECKYAHGE
HELZ_HUMAN/179-205EEYTLCK-RFLEQG..ICRYGAQCTSAHSQ
C3H34_ARATH/308-334PDQPECQ-YFMRTG..DCKFGSSCRYHHPV
C3H34_ARATH/101-127MGHPVCQ-HFMRTG..TCKFGASCKYHHPR
C3H34_ARATH/149-175PGEKECS-YYLRTG..QCKFGLTCRFNHPV
C3H34_ARATH/354-380PGVAQCT-HFAQHG..ICKFGPACKFDHSM
C3H32_ARATH/137-163EGDNECS-YYLKTG..QCKFGITCKFHHPQ
CPSF4_BOVIN/91-116TKMPECY-FYSKFG..ECSN.KECPFLHID
TISB_HUMAN/153-179YKTELCR-TFHTIG..FCPYGPRCHFIHNA
C3H42_ARATH/131-156EARGVCR-AFQR.G..ECTRGDSCKFSHDE
Q9W674_XENLA/133-159PYRERCR-LWSAPG..GCPYGARCHFQHPK
Q9W671_XENLA/142-168YKTELCH-KFYLYG..ECPYGSRCNFIHHP
C3H26_ARATH/308-334PGQPACG-NFKAYG..FCKFGANCKFDHSM
ZFS1_SCHPO/365-391YKSERCR-SFMMYG..YCPYGLRCCFLHDE
ZMAT5_HUMAN/52-78QNKRPCR-KFLLTG..QCDFGSNCRFSHMS
Q9W6Q9_TAKRU/169-195RDVSNCP-FFLKTG..SCRFGDRCSRKHVY
Z3H7B_HUMAN/903-929GEFRLCD-RLQKGK..ACPDGDKCRCAHGQ
MEX6_CAEEL/274-301FKTRLCM-THAAGI.NPCALGARCKFAHGL
C3H43_ARATH/393-419PDQNICT-YYSRYG..ICKFGPACRFDHSV
O18251_CAEEL/112-138YKTVLCD-NFSTTG..HCKYGTKCQFIHRT
C3H43_ARATH/111-137PGAEDCS-FYMRTG..SCKFGSSCKFNHPL
Q10954_CAEEL/207-233SSRRRCK-DFEERG..YCIRGDQCPYYHGR
Q9Y1V9_HALRO/584-610YKTEICN-VWAMGL..RCSHGSDCHFAHGR
Q9VV48_DROME/418-444YKISLCR-DLNVRR..VCPRGSSCTFAHSQ
TRM1_HUMAN/601-626LKTFPCK-RFKE.G..TCQRGDQCCYSHSP
CWC24_YEAST/139-165FQPDVCK-DYKQTG..YCGYGDSCKFLHSR
Q20155_CAEEL/237-263YKTEACQ-SFHQSG..YCPYGPRCHFIHNE
C3H32_ARATH/336-362PGVQRCT-FYVQNG..FCKFGSTCKFDHPM
CTH1_YEAST/205-231YKTELCE-SFTIKG..YCKYGNKCQFAHGL
Q9U2V1_CAEEL/89-115FKTALCL-SHKRGK..TCIYGEQCKFAHGV
U2AFL_HUMAN/172-198KDRANCP-FYSKTG..ACRFGDRCSRKHNF
PIE1_CAEEL/185-210NRRQICH-NFER.G..NCRYGPRCRFIHVE
O93432_DANRE/174-200PRGALCR-TFSAFG..FCLYGTRCRFQHGL
ZFNL_PEA/76-102LGQPECQ-YYLKTG..TCKFGATCRFHHPK
O02289_CAEEL/653-679SFLEPCD-FFAATG..SCPFGDACHQSHSI
PIE1_CAEEL/99-125YKTRLCD-AFRREG..YCPYNDNCTYAHGQ
Q9W674_XENLA/46-72YKTELCS-RYAESG..FCAYRNRCQFAHGL
C3H26_ARATH/45-71PGERDCQ-FFLRTG..QCGYGNSCRYNHPL
UNK_DROME/273-299YKSTKCN-DVQQAG..YCPRSVFCAFAHVE
C3H32_ARATH/290-316PGEPECQ-YYLKTG..DCKFGTSCKFHHPR
Q9VZ55_DROME/246-272KPPLRCR-NFDRDG..TCKYGPKCRFAHLP
Q9VUH9_DROME/327-353DTYSLCE-TFSEAH..ICHYGAQCVEAHGQ
O45289_CAEEL/89-115FKTSLCG-FHRRGQ..KCAYGEKCKFAHSV
MEX5_CAEEL/315-343YKTKLCK-NFARGGTGFCPYGLRCEFVHPT
C3H32_ARATH/46-72PGAPDCA-YYMRTG..VCGYGNRCRYNHPR
C3H26_ARATH/262-288SERAECR-FFMNTG..TCKYGDDCKYSHPK
Q9W674_XENLA/84-110YKTELCR-SFHVLG..TCNYGLRCLFIHSP
Q9U2U0_CAEEL/21-47KDKVNCS-FFFKTG..ACRHGDKCSRAHHT
YTH1_SCHPO/77-103KKMPPCH-FYAERG..WCSNGEECLYLHLD
Z3H7B_HUMAN/771-797QQYDLCI-.HAQNG.RKCQYVGNCSFAHSP
C3H26_ARATH/130-156QGEKPCP-YYMQTG..LCRFGVACKFHHPH
U2AF1_SCHPO/143-169DFREACC-RQHETS..ECQRGGLCNFMHAK
C3H2_ARATH/123-149YSGEVCP-EFRRGG..DCSRGDDCEFAHGV
U2AF1_DROME/151-177DFREACC-RQYEMG..ECTRSGFCNFMHLK
CTH1_YEAST/243-269YRTKPCI-NWSKLG..YCPYGKRCCFKHGD
O93432_DANRE/87-113YKTELCR-TYHTAG..YCVYGTRCLFVHNL
Q9W674_XENLA/160-186SARETCR-HFAALG..DCPYGACCHFSHSP
O93432_DANRE/123-149RRNVPCR-TFRAFG..VCPFGTRCHFLHVE
ZFNL_PEA/31-57PGEPDCS-YYIRTG..LCRFGATCRFNHPP
U2AF1_SCHPO/13-39QDKVNCS-FYYKIG..ACRHGERCSRKHVK
C3H43_ARATH/205-231PGEVECP-YYMRNG..SCKYGAECKFNHPD
C3H33_ARATH/132-158SNEVDCA-YFLRTG..HCKFGGTCKFNHPQ
Q9Y1V9_HALRO/545-571YKTRMCK-VLQQIG..RCPYGAQCTFAHKQ
ZFS1_SCHPO/327-353YKTEPCK-NWQISG..TCRYGSKCQFAHGN
Q9W671_XENLA/104-130YKTELCR-TFSETG..TCKYGAKCQFAHGK
C3H43_ARATH/159-185LGLIDCK-YYFRTG..GCKYGETCRFNHTI
RN113_CAEEL/176-202FAPDICK-DYKETG..FCTFGDSCKFVHDR
ZFNL_PEA/279-305PDQPECQ-FYMKTG..DCKFGAVCRFHHPR
O93432_DANRE/49-75YKTELCS-RYAETG..TCKYAERCQFAHGL
O18251_CAEEL/69-95FKTALCK-TFQLTK..ACSYGEQCKFAHSV
U2AFA_ARATH/13-39KDRVNCP-FYFKIG..ACRHGDRCSRLHNR
TTP_MOUSE/96-122YKTELCR-TYSESG..RCRYGAKCQFAHGL
O16809_CRAVI/116-142YKTELCR-PFEESG..HCKYGDKCQFAHGA
O45289_CAEEL/130-156YKTVLCN-NFSTTG..HCKYGIRCQFIHRS
Q20155_CAEEL/199-225YKTELCR-SWMDHG..RCNYGERCQYAHGE
C0SV73_ARATH/144-170WKTRICN-KWQTTG..YCPFGSHCHFAHGP
C3H33_ARATH/86-112IGQPECE-YYLKTG..TCKFGVTCKFHHPR
U2AFL_MOUSE/158-184KYRPSCP-FYNKTG..ACRFGNRCSRKHDF
ZFNL_PEA/325-351PGEPLCV-FYSRYG..ICKFGPSCKFDHPM
C3H32_ARATH/91-117FGEPPCQ-FYLKTG..TCKFGASCKFHHPK
Q9Y1V9_HALRO/465-491YRTEPCT-TYHTIG..MCPYGEQCNFYHDL
CPSF4_BOVIN/63-88EKTVVCK-HWLR.G..LCKKGDQCEFLHEY
Q9Y1V9_HALRO/506-532YKTRLCK-TWQKAG..ECPYGVKCDFAHGT
O77151_CRYPV/766-791YKRALCR-HWMR.G..YCWLEADCKFAHGE
LEE1_YEAST/88-113YSHVPCK-.FFKMG..NCQAGSSCPFSHSP

PF14608

Q7PQL7_ANOGA/1092-1110----PCK.AFPS----.CKFGDKCLYLHP-
B6K9Y0_TOXGO/516-534----KCT.KWPR----.CAFGDACFYWHP-
B6AAH1_CRYMR/228-246----ACK.LWPH----.CPYGPGCFYIHP-
E3XCF1_ANODA/1153-1171----LLV.AFPG----.CKFGDKCLYLHP-
D2A0F2_TRICA/571-589----TCE.KFPH----.CKFGDKCLFLHP-
F1KW82_ASCSU/689-707----PCS.NFPK----.CHFGDRCLYVHP-
E1FV39_LOALO/655-673----PCS.NFPN----.CSFGDRCIYIHP-
E9HK18_DAPPU/76-94----PCK.NFPI----.CLFGENCLFIHP-
C3YGV8_BRAFL/535-553----PCR.NFPK----.CKYGEKCLFIHP-
ZC3HE_MOUSE/621-639----PCK.AFPN----.CKFAEKCLFVHP-
B4HGM1_DROSE/883-901----PCK.SFPN----.CKFADKCMYSHP-
ZC3HE_DANRE/560-578----QCK.VFPN----.CKFADKCLFIHP-
C9SIR3_VERA1/186-204----DCK.FFPQ----.LPPTRQCPFKHP-
C7YK52_NECH7/382-399----DCK.FFPN----.CQNP.RCPFKHP-
A7EXH5_SCLS1/388-405----DCI.YFPN----.CKNA.NCPFRHP-
D5GFG7_TUBMM/383-400----ECK.FYPN----.CTNP.ACPFKHP-
E3S6Z9_PYRTT/457-475----ECA.FWPN----.CRDPASCPYKHP-
B2AY14_PODAN/402-419----DCK.FFPN----.CSNP.HCTFRHP-
E7R3H9_PICAD/776-793----QCK.FGAY----.CKNF.RCPKRHA-
C4QYX4_PICPG/377-394----QCR.FGKS----.CRNY.KCPRRHA-
A3GFH6_PICST/335-352----QCK.FGSQ----.CTNY.KCPRRHA-
A5DVN2_LODEL/437-454----QCK.FGMS----.CTNA.RCPRRHA-
A5DFH1_PICGU/356-373----QCK.YGAN----.CTKA.NCPRRHA-
C4XYA0_CLAL4/516-533----QCK.FGMN----.CTNQ.SCPKRHS-
Q6CKL1_KLULA/399-416----QCK.FGPK----.CTNK.NCPKRHA-
B3LHI2_YEAS1/386-403----QCK.FGTH----.CTNK.RCKYRHA-
Q6C5Z5_YARLI/366-383----QCK.FNNY----.CTNP.KCRFRHA-
B8NYB4_ASPFN/156-173----TCR.NGAG----.CRVI.ECKYSHP-
Q2TYR2_ASPOR/116-133----LCR.NGAG----.CRKL.GCTFAHP-
C7YLG2_NECH7/111-128----ICH.YGAG----.CRQF.GCEYLHP-
C7YLG2_NECH7/195-212----KCR.HGAG----.CKSK.NCKFSHP-
A0D1W1_PARTE/73-93----ICRHFELG----NCSIGEKCQFAHG-
E4V1U6_ARTGP/984-1001----NCW.FGAG----.CTNM.ECPFVHY-
C7YLG2_NECH7/153-170----PCQ.FGGD----.CTTP.GCTFGHP-
Q5KPH9_CRYNJ/350-367----ACE.KGKD----.CKDP.ECIKSHV-
E4V1U6_ARTGP/1024-1041----ACR.YMAK----.CTNP.GCPFRHL-
C5GTA7_AJEDR/431-448----LCR.FFPH----.CTNP.NCTFKHP-
C5PH93_COCP7/414-431----LCK.YFPH----.CQNP.HCQFKHP-
A2QVI7_ASPNC/378-395----LCR.FFPN----.CANP.HCHFKHP-
B8C2A1_THAPS/67-87----ICKPFLAG----LCTYGSRCINRHP-
Q23AS1_TETTS/92-110----PCT.FFPT----.CKYGSQCINKHP-
E2C9G4_HARSA/962-980----MCS.AFPA----.CKFGDKCAYRHP-
Q55BM8_DICDI/293-311----QCL.LFPN----.CTYGDKCLYIHP-
F0ZSS5_DICPU/261-279----QCS.NFPN----.CTFGNKCLYIHP-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window