Sequence alignment for CL0537

PF00642

Q9VUH9_DROME/327-353---------------------------------------------------DTY--------------------------
ZC3H3_HUMAN/668-694---------------------------------------------------KRK--------------------------
C3H5_ARATH/375-403---------------------------------------------------WKV--------------------------
U2AFB_ORYSJ/149-174---------------------------------------------------FRE--------------------------
C3H24_ARATH/80-106---------------------------------------------------WKT--------------------------
HELZ_HUMAN/179-205---------------------------------------------------EEY--------------------------
C3H34_ARATH/308-334---------------------------------------------------PDQ--------------------------
C3H34_ARATH/101-127---------------------------------------------------MGH--------------------------
C3H34_ARATH/149-175---------------------------------------------------PGE--------------------------
C3H34_ARATH/354-380---------------------------------------------------PGV--------------------------
C3H32_ARATH/137-163---------------------------------------------------EGD--------------------------
CPSF4_BOVIN/91-116---------------------------------------------------TKM--------------------------
TISB_HUMAN/153-179---------------------------------------------------YKT--------------------------
C3H42_ARATH/131-156---------------------------------------------------EAR--------------------------
C3H26_ARATH/308-334---------------------------------------------------PGQ--------------------------
ZFS1_SCHPO/365-391---------------------------------------------------YKS--------------------------
ZMAT5_HUMAN/52-78---------------------------------------------------QNK--------------------------
Q9W6Q9_TAKRU/169-195---------------------------------------------------RDV--------------------------
Z3H7B_HUMAN/903-929---------------------------------------------------GEF--------------------------
MEX6_CAEEL/274-301---------------------------------------------------FKT--------------------------
C3H43_ARATH/393-419---------------------------------------------------PDQ--------------------------
O18251_CAEEL/112-138---------------------------------------------------YKT--------------------------
C3H43_ARATH/111-137---------------------------------------------------PGA--------------------------
Q10954_CAEEL/207-233---------------------------------------------------SSR--------------------------
Q9VV48_DROME/418-444---------------------------------------------------YKI--------------------------
TRM1_HUMAN/601-626---------------------------------------------------LKT--------------------------
CWC24_YEAST/139-165---------------------------------------------------FQP--------------------------
Q20155_CAEEL/237-263---------------------------------------------------YKT--------------------------
C3H32_ARATH/336-362---------------------------------------------------PGV--------------------------
CTH1_YEAST/205-231---------------------------------------------------YKT--------------------------
Q9U2V1_CAEEL/89-115---------------------------------------------------FKT--------------------------
U2AFL_HUMAN/172-198---------------------------------------------------KDR--------------------------
PIE1_CAEEL/185-210---------------------------------------------------NRR--------------------------
O02289_CAEEL/653-679---------------------------------------------------SFL--------------------------
PIE1_CAEEL/99-125---------------------------------------------------YKT--------------------------
C3H26_ARATH/45-71---------------------------------------------------PGE--------------------------
UNK_DROME/273-299---------------------------------------------------YKS--------------------------
C3H32_ARATH/290-316---------------------------------------------------PGE--------------------------
Q9VZ55_DROME/246-272---------------------------------------------------KPP--------------------------
O45289_CAEEL/89-115---------------------------------------------------FKT--------------------------
MEX5_CAEEL/315-343---------------------------------------------------YKT--------------------------
C3H32_ARATH/46-72---------------------------------------------------PGA--------------------------
C3H26_ARATH/262-288---------------------------------------------------SER--------------------------
Q9U2U0_CAEEL/21-47---------------------------------------------------KDK--------------------------
YTH1_SCHPO/77-103---------------------------------------------------KKM--------------------------
Z3H7B_HUMAN/771-797---------------------------------------------------QQY--------------------------
C3H26_ARATH/130-156---------------------------------------------------QGE--------------------------
U2AF1_SCHPO/143-169---------------------------------------------------DFR--------------------------
C3H2_ARATH/123-149---------------------------------------------------YSG--------------------------
U2AF1_DROME/151-177---------------------------------------------------DFR--------------------------
CTH1_YEAST/243-269---------------------------------------------------YRT--------------------------
U2AF1_SCHPO/13-39---------------------------------------------------QDK--------------------------
C3H43_ARATH/205-231---------------------------------------------------PGE--------------------------
C3H33_ARATH/132-158---------------------------------------------------SNE--------------------------
ZFS1_SCHPO/327-353---------------------------------------------------YKT--------------------------
C3H43_ARATH/159-185---------------------------------------------------LGL--------------------------
RN113_CAEEL/176-202---------------------------------------------------FAP--------------------------
O18251_CAEEL/69-95---------------------------------------------------FKT--------------------------
U2AFA_ARATH/13-39---------------------------------------------------KDR--------------------------
TTP_MOUSE/96-122---------------------------------------------------YKT--------------------------
Q20155_CAEEL/199-225---------------------------------------------------YKT--------------------------
C3H33_ARATH/86-112---------------------------------------------------IGQ--------------------------
U2AFL_MOUSE/158-184---------------------------------------------------KYR--------------------------
C3H32_ARATH/91-117---------------------------------------------------FGE--------------------------
CPSF4_BOVIN/63-88---------------------------------------------------EKT--------------------------
LEE1_YEAST/88-113---------------------------------------------------YSH--------------------------
A8WGZ9_XENTR/142-168---------------------------------------------------YKT--------------------------
B6AGW8_CRYMR/601-626---------------------------------------------------YKR--------------------------
K1PQ11_CRAGI/114-139---------------------------------------------------YKT--------------------------
Q28DF9_XENTR/134-159---------------------------------------------------.YR--------------------------
C3H28_ARATH/144-170---------------------------------------------------WKT--------------------------

PF14608

I3KDP8_ORENI/551-569--------------------------------------------------------------------------------
Q297C0_DROPS/920-938--------------------------------------------------------------------------------
Q55BM8_DICDI/293-311--------------------------------------------------------------------------------
E3LKF3_CAERE/509-527--------------------------------------------------------------------------------
A7RGB7_NEMVE/26-44--------------------------------------------------------------------------------
C3YGV8_BRAFL/535-553--------------------------------------------------------------------------------
G4VBK2_SCHMA/517-535--------------------------------------------------------------------------------
A0CQL8_PARTE/62-83--------------------------------------------------------------------------------
A5AP98_VITVI/106-127--------------------------------------------------------------------------------
K7IQZ9_NASVI/973-991--------------------------------------------------------------------------------
N4TDU0_FUSC1/396-413--------------------------------------------------------------------------------
A7RGB7_NEMVE/84-101--------------------------------------------------------------------------------
A0A023BBH5_GRENI/182-200--------------------------------------------------------------------------------
K4DD74_SOLLC/140-161--------------------------------------------------------------------------------
A7EXH5_SCLS1/388-405--------------------------------------------------------------------------------
I1CPT5_RHIO9/261-280--------------------------------------------------------------------------------
F4PBR7_BATDJ/444-461--------------------------------------------------------------------------------
T1JIC4_STRMM/1608-1625--------------------------------------------------------------------------------
Q2TYR2_ASPOR/158-175--------------------------------------------------------------------------------
C5G125_ARTOC/402-419--------------------------------------------------------------------------------
K4AUB9_SOLLC/221-241--------------------------------------------------------------------------------
Q23AS1_TETTS/216-234--------------------------------------------------------------------------------
A8N2N5_COPC7/171-189--------------------------------------------------------------------------------
I4YE26_WALSC/127-145--------------------------------------------------------------------------------
F4PBR7_BATDJ/364-382--------------------------------------------------------------------------------
B7P524_IXOSC/479-497--------------------------------------------------------------------------------
F1N567_BOVIN/655-672--------------------------------------------------------------------------------
E7NHK1_YEASO/436-453--------------------------------------------------------------------------------
S2IZS8_MUCC1/280-297--------------------------------------------------------------------------------
J3NZI5_GAGT3/422-439--------------------------------------------------------------------------------
U4LUG0_PYROM/355-372--------------------------------------------------------------------------------
C5E402_ZYGRC/413-430--------------------------------------------------------------------------------
Q6C5Z5_YARLI/409-426--------------------------------------------------------------------------------
M0S017_MUSAM/56-75--------------------------------------------------------------------------------
I1CPT5_RHIO9/341-358--------------------------------------------------------------------------------
W5MWI0_LEPOC/688-705--------------------------------------------------------------------------------
W1QK89_OGAPD/386-403--------------------------------------------------------------------------------
G8YKR4_PICSO/262-279--------------------------------------------------------------------------------
K1XJA7_MARBU/545-562--------------------------------------------------------------------------------
D5GFG7_TUBMM/315-332--------------------------------------------------------------------------------
K7IQZ9_NASVI/1012-1029--------------------------------------------------------------------------------
G8B5V7_CANPC/375-392--------------------------------------------------------------------------------
R7YUC6_CONA1/423-440--------------------------------------------------------------------------------
Q75E99_ASHGO/412-429--------------------------------------------------------------------------------
Q6C5Z5_YARLI/366-383--------------------------------------------------------------------------------
W5J6C8_ANODA/1223-1240--------------------------------------------------------------------------------
D7LXW5_ARALL/56-77--------------------------------------------------------------------------------
E5SGZ2_TRISP/337-357--------------------------------------------------------------------------------
G7E314_MIXOS/472-492--------------------------------------------------------------------------------
D3AZW6_POLPA/279-296--------------------------------------------------------------------------------
A5DFH1_PICGU/282-299--------------------------------------------------------------------------------
G4TBK1_PIRID/435-452--------------------------------------------------------------------------------
U6GYR7_EIMAC/502-519--------------------------------------------------------------------------------
U9T7M9_RHIID/466-483--------------------------------------------------------------------------------
E1FV39_LOALO/733-750--------------------------------------------------------------------------------
G4TBK1_PIRID/326-343--------------------------------------------------------------------------------
G7E245_MIXOS/298-315--------------------------------------------------------------------------------
F4WPJ0_ACREC/915-932--------------------------------------------------------------------------------
A3GFH6_PICST/357-374--------------------------------------------------------------------------------
Q55BM8_DICDI/314-331--------------------------------------------------------------------------------
Q6CKL1_KLULA/399-416--------------------------------------------------------------------------------
A5DVN2_LODEL/459-476--------------------------------------------------------------------------------
Q5KPH9_CRYNJ/454-471--------------------------------------------------------------------------------
C7YLG2_NECH7/237-254--------------------------------------------------------------------------------
S8BX70_DACHA/370-387--------------------------------------------------------------------------------
A0DW37_PARTE/236-253--------------------------------------------------------------------------------
E4V1U6_ARTGP/1106-1123--------------------------------------------------------------------------------
A5DFH1_PICGU/378-395--------------------------------------------------------------------------------
J4VXD4_BEAB2/318-335--------------------------------------------------------------------------------
J4HSX7_FIBRA/488-505--------------------------------------------------------------------------------
B8P1F0_POSPM/511-528--------------------------------------------------------------------------------
C4QYX4_PICPG/377-394--------------------------------------------------------------------------------
C7YLG2_NECH7/153-170--------------------------------------------------------------------------------
Q2TYR2_ASPOR/116-133--------------------------------------------------------------------------------
Q2TYR2_ASPOR/137-154--------------------------------------------------------------------------------
E4V1U6_ARTGP/1004-1021--------------------------------------------------------------------------------
I2FVU5_USTH4/481-498--------------------------------------------------------------------------------
A0A023BBH5_GRENI/203-220--------------------------------------------------------------------------------
U5GXY5_USTV1/360-377--------------------------------------------------------------------------------
T1JIC4_STRMM/1627-1644--------------------------------------------------------------------------------
F4Q9D5_DICFS/419-436--------------------------------------------------------------------------------
U9T7M9_RHIID/382-399--------------------------------------------------------------------------------
C7YLG2_NECH7/195-212--------------------------------------------------------------------------------

PF16131

G3JQI7_CORMM/42-148KKRKPARVQI...D.PSLIT...SEPPPQTG.TIFNIWYN...........KWS....GG...D.HDGN..AQT......
G1XUG1_ARTOA/44-153KRRRPARPQV...D.IATFK..PGEIPQQTG.TVWNIWYN...........KWS....GG...D.REDKYISKH......
F2PPW7_TRIEC/55-163RKRRPARVQV...D.PSTVK...SEPPPQTG.TIFNIWYN...........KWS....GG...D.REDKYLSQQ......
G8BCZ4_CANPC/12-123PMSSPARVQV...D.INAIQ..DEERPQQVGGTTFNMWYL...........NWSGGGGGM...N.SSAT.DSFT......
G8JM53_ERECY/9-119WKGRFAKVQV...R.EDDLP...SLLPAQTGL.SFNIWYN...........KWS.........Q.GQG.SGSRF......
CWC2_CANAL/15-120PMTKPARVQV...N.PEDID..DLDKTQQVNNHQYNIWYS...........KSL....SD...A.NNK...STT......
D3AYH7_POLPA/48-153LLSRPARKQS.....SNLNS...RYEDHDTDTQEYNIWYH...........KKL...........GKRNWRDRD......
G0SXB9_RHOG2/20-129VKRKPARKQV...E.PGQIE...KREAPQTG.QTYNLWYH...........KWA....GG...D.KYDSMGVQE......
Q4U9J8_THEAN/101-218LLSRPARVQV.....KDY.....ANSCYVEGNQTYNIWYN...........KWA....GERNCD.YVNGRTSLA......
A5DU75_LODEL/15-122PMSIPARLQV...D.INTVQ..GDDRPQQVGNQVFNIWYL...........KWS....GS...D.NSAS.NSFT......
B3L6B6_PLAKH/424-543ILKRPAKLQV...T.QEEL....NKVEYSEGNDQYNMWFG...........KYVPDKFDKGRSA.SSVGGVQRL......
G8BZZ9_TETPH/2-112WKNRSAKVQV...P.ESELP...SSIPPQVGL.SFNVWYN...........KWS.........Q.GQS.GTSRY......
A7AT19_BABBO/152-268LMSRPARQQI.....KEF.....EGNAYIQGSEEYNIWYN...........KWS....GER.TN.TVNGRPSLM......
CWC2_YARLI/56-165YHTRKARIQV...D.PDSVN..TDDRPPQTG.TVYNIWFN...........KWS....GG...D.KEDEKFNQK......
A4RQW4_OSTLU/78-192SRSRKARVQY...D.PETGPRIRHRSDAAKG..DFNVWWG...........KHA...........TSSGTTARDFN....
A9V616_MONBE/22-132WRKRPARVQV.....EDTGRQYMSAEHTTGG..NYNIWYN...........RDF.........SEGRHRQVDRG......
F2UEH1_SALR5/17-130WRQRPARKQVGGGAKRGPVRGGGSSSTPVDG.STYNIWYH...........KRV...........GERQSKPG.......
E7Q1M5_YEASB/4-114WRDKSAKVQV...K.ESELP...SSIPAQTGL.TFNIWYN...........KWS.........Q.GFA.GNTRF......
I1BWV1_RHIO9/1-119M..RPARVQV...S.QAELDEYIREKRPEGG..TYNIWHH...........RYS....GL...ERDFNKRRSITIRLDEK
B6K822_SCHJY/43-151KKTRPARKQV...E.TRMEF...EQEAPEPG.QVYNIWYG...........KWS....GG...S.RRDPLKSQI......
F4PVC4_DICFS/45-150LLARPARKQS.....NNINT...RYEEHDVDSQDYNIWYG...........KKV...........GKRNWRDRD......
B2B7B7_PODAN/48-156RKKRPARAQV...D.PATVK...SEPPAQTG.TTFNIWYN...........KWA....GG...D.KEDSAMSQT......
F0ZDH1_DICPU/40-145LLNRPARKQS.....THINS...RYEDHDVDTTEYNIWYH...........RKL...........GNKNFKDRD......
C5DIA0_LACTC/7-117WAERSAPVQI...S.EAELP...SSIPPQTGL.TFNVWYN...........KWS.........Q.GNS.GQSRF......
A0DPK2_PARTE/224-334VMLRPARKQV.....EESLA...TKFGYKQGDEEYNTWFD...........RFL.........S.DGNKYKEKD......
A0A016Q1H0_GIBZA/45-153KKKRPARAQV...D.PDFFT...TEPPPQTG.TIFNIWYN...........KWS....GG...D.REDKYLSKT......
C5MD14_CANTT/16-121PMSKPARLQV...N.PDDIS..DSNKPQQVGSQQFNIWWT...........NWS....KN...D.NNQ...AKT......
C4Y4T6_CLAL4/2-107SSEKPARLQV...D.PETIV..DDDKPPQTG.HTFNIWYL...........KWA....GG...D.SSSR..NYI......
E1ZMU0_CHLVA/14-126APKRLARKQV.....DAPVT..GHEEVHAAG..TVNIWTGRV.......LKEYR...........KPRENRKKE......
G8YAD9_PICSO/11-116GSSRPARLQV...D.PDTIG..DDDKPPQSG.TVFNIWFL...........KWS....GG...D.SSRK..NFT......
CWC2_KLULA/5-115WKNRPARVQL...Q.ESDLP...SSVPPQTGL.AFNVWYN...........KWS.........Q.GQS.GSTRF......
B6HND7_PENCW/57-163RKKRPARIQV...D.ASTIK...AEPAQQPG.LDYNIWYN...........K......SG...D.NDDKYGLSQ......
A5DF02_PICGU/28-132MLKRPARLQV...D.PETIT..DDDKPPQTG.TVFNIWYL...........KWS....GG...D.NTR...NLI......
E9E222_METAQ/37-143KKKKPARVQI...D.PSEFA...SEAPPQTG.TTYNIWFN...........KWA....GG...D.REAY..QQT......
B6AJG7_CRYMR/20-128DLGRPARVQC.....NSK.....QNIAYIEGGEQYNIWYG...........RYV...........YDYAKRTRL......
F9XH34_ZYMTI/45-159RKRRPARPQQ...D.PSTFK...TEPPPQTG.TIFNIWYN...........KWS....GG...D.REDAFSSKH......
F4RVB5_MELLP/42-153VKRRRARKQVTLEE.AGSF....KKQPEQSG.QTYNVWYN...........KWA....GG...D.KYDSYSQKE......
D2V8Q1_NAEGR/25-134KKIRKARVQA.....QRKTAEQNLQKEETGG..EYNIWYH...........KYI....G......QQHQKKEIE......
Q4Y0R8_PLACH/160-274ILKSPARLQV...T.QEELNK.VEHAQDNQNSNNNNIWFG...........KYVT..D.......KNNNNNPKF......
CWC2_SCHPO/45-153RKKQPARKQI...E.TRPEY...EMEPEQPG.QVYNLWYN...........KWS....GG...M.RQDPLKSQV......
G0VCN6_NAUCC/4-115WRDKPARIQV...K.EKDLP...STIPQQNGL.SFNVWYN...........KWS.........QGGSGNGGDRF......
G7E837_MIXOS/15-124VRRRPARQQV...K.PGQIE...KKPLEQTG.SVYNIFYH...........KWA....GG...D.KYDEYNAKE......
CWC2_CANGA/7-112WRQRKARVQL......AEVS...GELAAAQQTHSVNIWYG...........KWQ................SSRH......
Q8I3V8_PLAF7/525-641ILKTPARLQI...T.QEEL....NKIEYTEGSEQYNIWFG...........KYVTDRYDK..S..VKGSSTPRF......
A3LNL2_PICST/17-124NAGGPARLQV...D.PDTIP..DDDKPAQSG.SVFNIWYL...........KWS...GGG...D.SSSK.SNYT......
C4R2K8_PICPG/1-110MGRRPARVQV...D.PESID..SDERPPQTG.NIFNIWYS...........KWS....GG...D.SSDR.NTQT......
C5DPF7_ZYGRC/5-115WRERSAKVQV...K.ESDLP...SSIPPQTGL.VFNIWYN...........KWS.........Q.GQG.GQSRF......
A7SHW9_NEMVE/102-217YKKRPAKRQA...D.PDEKK...KVHWIPEGATEYNIWYD...........RWV....GE...H.WHKDTMGAE......
G0WBM3_NAUDC/3-114WKNRSAKIQV...K.ESDLP...SSIPLQNGL.TFNVWYN...........KWS.........Q.GTSNGHDRF......
G3AFX9_SPAPN/15-120PMSKPARLQV...D.PATIP..DSDKPPQSG.TTFNIWFL...........KWS....GG...D.SSTR..SFT......
B3RVJ1_TRIAD/118-230WLKRPARKQV......EEQQ...KVHWRPEGAQEYNIWYD...........RWV....GE.....LWKGEKHGG......
G0RHN9_HYPJQ/48-154RKRRPARPQV...D.PSTFS...NEPPPQTG.TTFNIWYN...........KWA....GG...D.HEAY..QQT......
D8FGE1_ASHGO/9-119WKTRAAPVQV...R.EADLP...SSLPPQTGL.TFNIWYN...........KWS.........Q.GYS.GDARF......
G2XE84_VERDV/45-163KKRRPARPQV...D.PSFIT...SEPPPQTG.TIFNIWYALSPFSLVQQMVRWR.........P.AKDKYLSKT......
G8ZNV4_TORDC/7-117WRDRSAKVQV...S.ESELP...SSIPSQTGL.VFNVWYN...........KWS.........Q.GSS.EQKRF......
F8PXK7_SERL3/15-124KKLKPARKQV...K.PGDVE...KKETPQTG.KEYNIWYN...........KWA....GG...D.REDNYSNKV......
F4PB39_BATDJ/15-117YQDRPARKQV......EYAQ...SQSIENTG..TYNIWYS...........RFS....GD.....GNRFGKGLE......
A7THZ4_VANPO/9-119WKERSAKVQV...R.ESDLP...SSIPPQTGL.SFNLWYN...........KWS.........Q.GHS.GNARF......
G4TI12_PIRID/19-128KKDRPARKQV...K.PGQVT...KNEVVQSG.KEYNIWYN...........KWA....GG...D.REDAYSNKV......
D8MAN1_BLAHO/150-263FLKRPARKQV......EWIA...ANRSRREGNNEYNIWYG...........RWV....GD...N.WSYGMEQGE......
C4LW00_ENTHI/23-126.TNRPARKQS.....DGYV....PYTPTRSG..DYNIWYN...........RYS....GF...E.SKQ.TRGDR......
D0MSU9_PHYIT/135-244.MARPARTQL......DAMP...TANSQLEGAYEYNIWYD...........KYI....G....D.HWDDARGKD......
E5AB62_LEPMJ/104-211.KRRPARPQV...D.PATFK...TDTPAPTG.TIFNIWYN...........KWS....GG...D.REDKYLSKT......
CWC2_CRYNJ/13-120..LKPARKQV...A.SDEVD...KSQGYQAG.REYNIWYN...........KWA....GG...D.REDALASKV......
Q23MM8_TETTS/193-302...RPSRKQI.....EQSLA...DKYAYKEGDQEYNIWYG...........KHL....SD...T.RDTVRDHKT......
CWC2_MAGO7/39-146.KKRPARPQI...D.PALVK...SEPPPQTG.TTFNIWYN...........KWS....GG...D.REDKYTSQT......
V4ZEL8_TOXGO/132-245WMRRPARQQI...D.RNEAS...RYSHTEGG.TEYNIWYG...........KYL....TD...RYNRPSYLDRE......
W1QI95_OGAPD/2-115.ARRPARLQL...D.PESVT..ADTKPPQTG.QVFNLWYS...........RWT....GG...E...YNGRTVA......

PF15663

G1KZ30_ANOCA/1-109-------------------------------------------------------------------------------M
D2A082_TRICA/4-108-------------------------------------------------------------------------------L
H1A4D2_TAEGU/1-110-------------------------------------------------------------------------------M
H2RKG4_TAKRU/1-109-------------------------------------------------------------------------------M
H9JJ34_BOMMO/1-111-------------------------------------------------------------------------------M
H2M3R3_ORYLA/1-110-------------------------------------------------------------------------------M
E2AA72_CAMFO/20-132-------------------------------------------------------------------------------M
G5BC32_HETGA/1-110-------------------------------------------------------------------------------M
I1EXH3_AMPQE/43-148-------------------------------------------------------------------------------M
F1QNW1_DANRE/1-111-------------------------------------------------------------------------------M
E5S922_TRISP/1-100-------------------------------------------------------------------------------M
H2N430_PONAB/1-109-------------------------------------------------------------------------------M

PF00642

Q9VUH9_DROME/327-353-----------------------------------SLCETFSEAH..ICHYGA--QCVEAHGQ-----------------
ZC3H3_HUMAN/668-694-----------------------------------EYCMYYNRFG..RCNRGE--RCPYIHDP-----------------
C3H5_ARATH/375-403-----------------------------------AICGEYMKSRLKTCSRGS--ACNFIHCF-----------------
U2AFB_ORYSJ/149-174-----------------------------------ATCRQFEE.N..SCNRGG--YCNFMHVK-----------------
C3H24_ARATH/80-106-----------------------------------SLCSYFRREA..SCSHGN--ECKYAHGE-----------------
HELZ_HUMAN/179-205-----------------------------------TLCKRFLEQG..ICRYGA--QCTSAHSQ-----------------
C3H34_ARATH/308-334-----------------------------------PECQYFMRTG..DCKFGS--SCRYHHPV-----------------
C3H34_ARATH/101-127-----------------------------------PVCQHFMRTG..TCKFGA--SCKYHHPR-----------------
C3H34_ARATH/149-175-----------------------------------KECSYYLRTG..QCKFGL--TCRFNHPV-----------------
C3H34_ARATH/354-380-----------------------------------AQCTHFAQHG..ICKFGP--ACKFDHSM-----------------
C3H32_ARATH/137-163-----------------------------------NECSYYLKTG..QCKFGI--TCKFHHPQ-----------------
CPSF4_BOVIN/91-116-----------------------------------PECYFYSKFG..ECSN.K--ECPFLHID-----------------
TISB_HUMAN/153-179-----------------------------------ELCRTFHTIG..FCPYGP--RCHFIHNA-----------------
C3H42_ARATH/131-156-----------------------------------GVCRAFQR.G..ECTRGD--SCKFSHDE-----------------
C3H26_ARATH/308-334-----------------------------------PACGNFKAYG..FCKFGA--NCKFDHSM-----------------
ZFS1_SCHPO/365-391-----------------------------------ERCRSFMMYG..YCPYGL--RCCFLHDE-----------------
ZMAT5_HUMAN/52-78-----------------------------------RPCRKFLLTG..QCDFGS--NCRFSHMS-----------------
Q9W6Q9_TAKRU/169-195-----------------------------------SNCPFFLKTG..SCRFGD--RCSRKHVY-----------------
Z3H7B_HUMAN/903-929-----------------------------------RLCDRLQKGK..ACPDGD--KCRCAHGQ-----------------
MEX6_CAEEL/274-301-----------------------------------RLCMTHAAGI.NPCALGA--RCKFAHGL-----------------
C3H43_ARATH/393-419-----------------------------------NICTYYSRYG..ICKFGP--ACRFDHSV-----------------
O18251_CAEEL/112-138-----------------------------------VLCDNFSTTG..HCKYGT--KCQFIHRT-----------------
C3H43_ARATH/111-137-----------------------------------EDCSFYMRTG..SCKFGS--SCKFNHPL-----------------
Q10954_CAEEL/207-233-----------------------------------RRCKDFEERG..YCIRGD--QCPYYHGR-----------------
Q9VV48_DROME/418-444-----------------------------------SLCRDLNVRR..VCPRGS--SCTFAHSQ-----------------
TRM1_HUMAN/601-626-----------------------------------FPCKRFKE.G..TCQRGD--QCCYSHSP-----------------
CWC24_YEAST/139-165-----------------------------------DVCKDYKQTG..YCGYGD--SCKFLHSR-----------------
Q20155_CAEEL/237-263-----------------------------------EACQSFHQSG..YCPYGP--RCHFIHNE-----------------
C3H32_ARATH/336-362-----------------------------------QRCTFYVQNG..FCKFGS--TCKFDHPM-----------------
CTH1_YEAST/205-231-----------------------------------ELCESFTIKG..YCKYGN--KCQFAHGL-----------------
Q9U2V1_CAEEL/89-115-----------------------------------ALCLSHKRGK..TCIYGE--QCKFAHGV-----------------
U2AFL_HUMAN/172-198-----------------------------------ANCPFYSKTG..ACRFGD--RCSRKHNF-----------------
PIE1_CAEEL/185-210-----------------------------------QICHNFER.G..NCRYGP--RCRFIHVE-----------------
O02289_CAEEL/653-679-----------------------------------EPCDFFAATG..SCPFGD--ACHQSHSI-----------------
PIE1_CAEEL/99-125-----------------------------------RLCDAFRREG..YCPYND--NCTYAHGQ-----------------
C3H26_ARATH/45-71-----------------------------------RDCQFFLRTG..QCGYGN--SCRYNHPL-----------------
UNK_DROME/273-299-----------------------------------TKCNDVQQAG..YCPRSV--FCAFAHVE-----------------
C3H32_ARATH/290-316-----------------------------------PECQYYLKTG..DCKFGT--SCKFHHPR-----------------
Q9VZ55_DROME/246-272-----------------------------------LRCRNFDRDG..TCKYGP--KCRFAHLP-----------------
O45289_CAEEL/89-115-----------------------------------SLCGFHRRGQ..KCAYGE--KCKFAHSV-----------------
MEX5_CAEEL/315-343-----------------------------------KLCKNFARGGTGFCPYGL--RCEFVHPT-----------------
C3H32_ARATH/46-72-----------------------------------PDCAYYMRTG..VCGYGN--RCRYNHPR-----------------
C3H26_ARATH/262-288-----------------------------------AECRFFMNTG..TCKYGD--DCKYSHPK-----------------
Q9U2U0_CAEEL/21-47-----------------------------------VNCSFFFKTG..ACRHGD--KCSRAHHT-----------------
YTH1_SCHPO/77-103-----------------------------------PPCHFYAERG..WCSNGE--ECLYLHLD-----------------
Z3H7B_HUMAN/771-797-----------------------------------DLCI.HAQNG.RKCQYVG--NCSFAHSP-----------------
C3H26_ARATH/130-156-----------------------------------KPCPYYMQTG..LCRFGV--ACKFHHPH-----------------
U2AF1_SCHPO/143-169-----------------------------------EACCRQHETS..ECQRGG--LCNFMHAK-----------------
C3H2_ARATH/123-149-----------------------------------EVCPEFRRGG..DCSRGD--DCEFAHGV-----------------
U2AF1_DROME/151-177-----------------------------------EACCRQYEMG..ECTRSG--FCNFMHLK-----------------
CTH1_YEAST/243-269-----------------------------------KPCINWSKLG..YCPYGK--RCCFKHGD-----------------
U2AF1_SCHPO/13-39-----------------------------------VNCSFYYKIG..ACRHGE--RCSRKHVK-----------------
C3H43_ARATH/205-231-----------------------------------VECPYYMRNG..SCKYGA--ECKFNHPD-----------------
C3H33_ARATH/132-158-----------------------------------VDCAYFLRTG..HCKFGG--TCKFNHPQ-----------------
ZFS1_SCHPO/327-353-----------------------------------EPCKNWQISG..TCRYGS--KCQFAHGN-----------------
C3H43_ARATH/159-185-----------------------------------IDCKYYFRTG..GCKYGE--TCRFNHTI-----------------
RN113_CAEEL/176-202-----------------------------------DICKDYKETG..FCTFGD--SCKFVHDR-----------------
O18251_CAEEL/69-95-----------------------------------ALCKTFQLTK..ACSYGE--QCKFAHSV-----------------
U2AFA_ARATH/13-39-----------------------------------VNCPFYFKIG..ACRHGD--RCSRLHNR-----------------
TTP_MOUSE/96-122-----------------------------------ELCRTYSESG..RCRYGA--KCQFAHGL-----------------
Q20155_CAEEL/199-225-----------------------------------ELCRSWMDHG..RCNYGE--RCQYAHGE-----------------
C3H33_ARATH/86-112-----------------------------------PECEYYLKTG..TCKFGV--TCKFHHPR-----------------
U2AFL_MOUSE/158-184-----------------------------------PSCPFYNKTG..ACRFGN--RCSRKHDF-----------------
C3H32_ARATH/91-117-----------------------------------PPCQFYLKTG..TCKFGA--SCKFHHPK-----------------
CPSF4_BOVIN/63-88-----------------------------------VVCKHWLR.G..LCKKGD--QCEFLHEY-----------------
LEE1_YEAST/88-113-----------------------------------VPCK.FFKMG..NCQAGS--SCPFSHSP-----------------
A8WGZ9_XENTR/142-168-----------------------------------ELCHKFYLYG..ECPYGS--RCNFIHHP-----------------
B6AGW8_CRYMR/601-626-----------------------------------ALCRHWMR.G..YCWLEA--DCKFAHGE-----------------
K1PQ11_CRAGI/114-139-----------------------------------ELCRPFEESG..HCKYGD--KCQFAHG.-----------------
Q28DF9_XENTR/134-159-----------------------------------ERCRLWRSPG..GCPYGA--RCHFQHPK-----------------
C3H28_ARATH/144-170-----------------------------------RICNKWQTTG..YCPFGS--HCHFAHGP-----------------

PF14608

I3KDP8_ORENI/551-569------------------------------------QCKTFPN..--.CKFGD..KCLFVHP------------------
Q297C0_DROPS/920-938------------------------------------PCKSFPN..--.CKFAD..KCMYSHP------------------
Q55BM8_DICDI/293-311------------------------------------QCLLFPN..--.CTYGD..KCLYIHP------------------
E3LKF3_CAERE/509-527------------------------------------PCKNFPN..--.CTFGT..RCLFIHP------------------
A7RGB7_NEMVE/26-44------------------------------------PCRTFPN..--.CPYGK..SCMFVHP------------------
C3YGV8_BRAFL/535-553------------------------------------PCRNFPK..--.CKYGE..KCLFIHP------------------
G4VBK2_SCHMA/517-535------------------------------------PCQLFPR..--.CKFGA..TCTFVHP------------------
A0CQL8_PARTE/62-83------------------------------------LCKNFELTG--FCKFGD..ECSFAHG------------------
A5AP98_VITVI/106-127------------------------------------ICNKFNTPE--GCKFGD..KCHFAHG------------------
K7IQZ9_NASVI/973-991------------------------------------LCSSFPA..--.CKFGE..KCAYMHP------------------
N4TDU0_FUSC1/396-413------------------------------------DCKFFPN..--.C.QNP..QCPFKHP------------------
A7RGB7_NEMVE/84-101------------------------------------LCKYFPA..--.C.TRL..KCPFHHP------------------
A0A023BBH5_GRENI/182-200------------------------------------QCVNWPH..--.CNFGD..ECFYIHP------------------
K4DD74_SOLLC/140-161------------------------------------DCAHYMQTR--TCKFGD..SCKFDHP------------------
A7EXH5_SCLS1/388-405------------------------------------DCIYFPN..--.C.KNA..NCPFRHP------------------
I1CPT5_RHIO9/261-280------------------------------------ICRDFPN..--.C.PNKANECMFIHP------------------
F4PBR7_BATDJ/444-461------------------------------------QCRNYPD..--.C.ADP..FCLFYHP------------------
T1JIC4_STRMM/1608-1625------------------------------------QCKFYPK..--.C.SNL..NCSFYHP------------------
Q2TYR2_ASPOR/158-175------------------------------------ACRDGAN..--.C.MVD..KCKFFHP------------------
C5G125_ARTOC/402-419------------------------------------ICRYFPH..--.C.TNP..KCAFKHP------------------
K4AUB9_SOLLC/221-241------------------------------------ICENFTKS.--TCTFGE..KCHFAHG------------------
Q23AS1_TETTS/216-234------------------------------------PCTFFPT..--.CKYGS..QCINKHP------------------
A8N2N5_COPC7/171-189------------------------------------PCRYFPA..--.CRYGP..QCMFAHP------------------
I4YE26_WALSC/127-145------------------------------------PCRFFPG..--.CRYGS..ECIFMHP------------------
F4PBR7_BATDJ/364-382------------------------------------PCVWYPN..--.CPDGP..NCMFLHP------------------
B7P524_IXOSC/479-497------------------------------------KCRYWPA..--.CKNGD..RCPYHHP------------------
F1N567_BOVIN/655-672------------------------------------LCRYFPA..--.C.KKM..ECPFYHP------------------
E7NHK1_YEASO/436-453------------------------------------DCRFGVN..--.C.KNI..YCLFRHP------------------
S2IZS8_MUCC1/280-297------------------------------------PCKFFPY..--.C.SNP..VCPYIHP------------------
J3NZI5_GAGT3/422-439------------------------------------DCRFYPN..--.C.TNP..HCTFRHP------------------
U4LUG0_PYROM/355-372------------------------------------ACKFGLN..--.C.TKA..ECAFGHP------------------
C5E402_ZYGRC/413-430------------------------------------DCKFGID..--.C.RNP..NCLFRHP------------------
Q6C5Z5_YARLI/409-426------------------------------------PCKYGVN..--.C.ANN..NCIFSHP------------------
M0S017_MUSAM/56-75------------------------------------DCWYWLNG.--NC.LNP..KCSFRHP------------------
I1CPT5_RHIO9/341-358------------------------------------PCKNGDN..--.C.TRP..GCHFLHP------------------
W5MWI0_LEPOC/688-705------------------------------------ICRFFPD..--.C.RKL..DCQFYHP------------------
W1QK89_OGAPD/386-403------------------------------------DCKFGVN..--.C.KNA..KCPYKHP------------------
G8YKR4_PICSO/262-279------------------------------------ACKFGKN..--.C.SNE..ACQFGHP------------------
K1XJA7_MARBU/545-562------------------------------------QCRWGSD..--.C.TNP..NCTFVHP------------------
D5GFG7_TUBMM/315-332------------------------------------PCKFAAN..--.C.TKP..ECPFAHP------------------
K7IQZ9_NASVI/1012-1029------------------------------------KCKYHPY..--.C.MKP..GCPFSHP------------------
G8B5V7_CANPC/375-392------------------------------------QCKYGMN..--.C.TNY..KCVRRHA------------------
R7YUC6_CONA1/423-440------------------------------------ECKYWPY..--.C.SNP..ACPFKHP------------------
Q75E99_ASHGO/412-429------------------------------------PCKFGAE..--.C.RNA..HCLFQHP------------------
Q6C5Z5_YARLI/366-383------------------------------------QCKFNNY..--.C.TNP..KCRFRHA------------------
W5J6C8_ANODA/1223-1240------------------------------------LCKYYPH..--.C.SNT..QCPFYHP------------------
D7LXW5_ARALL/56-77------------------------------------DCIYFLRTG--VCGYGS..RCRFNHP------------------
E5SGZ2_TRISP/337-357------------------------------------PCKFFPIG.--DCRKGE..RCRYSHA------------------
G7E314_MIXOS/472-492------------------------------------PCTFWGDN.--RCRNGD..ECPFGHP------------------
D3AZW6_POLPA/279-296------------------------------------PCKFGPT..--.C.ANF..SCPYNHP------------------
A5DFH1_PICGU/282-299------------------------------------ICKFGIL..--.C.SKE..LCPFGHP------------------
G4TBK1_PIRID/435-452------------------------------------PCKFGIH..--.C.TRA..DCMFSHP------------------
U6GYR7_EIMAC/502-519------------------------------------KCRYGQN..--.C.QNP..SCNFLHP------------------
U9T7M9_RHIID/466-483------------------------------------PCKFGFN..--.C.RRP..DCAYAHP------------------
E1FV39_LOALO/733-750------------------------------------PCKYGGK..--.C.ANA..SCSFKHP------------------
G4TBK1_PIRID/326-343------------------------------------LCKFGVN..--.C.TNA..LCRWSHP------------------
G7E245_MIXOS/298-315------------------------------------ICKFGTK..--.C.KDA..FCRFSHP------------------
F4WPJ0_ACREC/915-932------------------------------------KCKFGLS..--.C.TKL..GCVFSHP------------------
A3GFH6_PICST/357-374------------------------------------PCREGAN..--.C.KRY..DCVFAHP------------------
Q55BM8_DICDI/314-331------------------------------------PCKFGIN..--.C.TNV..DCVYNHP------------------
Q6CKL1_KLULA/399-416------------------------------------QCKFGPK..--.C.TNK..NCPKRHA------------------
A5DVN2_LODEL/459-476------------------------------------PCRLGAN..--.C.TNV..SCTFAHP------------------
Q5KPH9_CRYNJ/454-471------------------------------------QCRFGDR..--.C.TRA..DCKFLHP------------------
C7YLG2_NECH7/237-254------------------------------------DCKFGQD..--.C.RRK..DCKFAHP------------------
S8BX70_DACHA/370-387------------------------------------KCAFGIN..--.C.KNK..KCTQSHP------------------
A0DW37_PARTE/236-253------------------------------------QCKHGIH..--.C.KNP..QCSYDHP------------------
E4V1U6_ARTGP/1106-1123------------------------------------DCRHGSE..--.C.INL..KCSFKHP------------------
A5DFH1_PICGU/378-395------------------------------------PCRDGAS..--.C.TKP..YCYFSHP------------------
J4VXD4_BEAB2/318-335------------------------------------PCSFGAA..--.C.KNR..KCVGRHP------------------
J4HSX7_FIBRA/488-505------------------------------------PCRYGAG..--.C.TRP..NCSFTHP------------------
B8P1F0_POSPM/511-528------------------------------------PCRFGSA..--.C.TRA..TCPFQHP------------------
C4QYX4_PICPG/377-394------------------------------------QCRFGKS..--.C.RNY..KCPRRHA------------------
C7YLG2_NECH7/153-170------------------------------------PCQFGGD..--.C.TTP..GCTFGHP------------------
Q2TYR2_ASPOR/116-133------------------------------------LCRNGAG..--.C.RKL..GCTFAHP------------------
Q2TYR2_ASPOR/137-154------------------------------------DCRYGVG..--.C.TNT..LCSFKHP------------------
E4V1U6_ARTGP/1004-1021------------------------------------PCRRGSA..--.C.TQP..DCTFRHP------------------
I2FVU5_USTH4/481-498------------------------------------QCRFGLG..--.C.TRK..ECYYAHP------------------
A0A023BBH5_GRENI/203-220------------------------------------PCRYGIN..--.C.PNV..ACNYTHP------------------
U5GXY5_USTV1/360-377------------------------------------ICKHGVD..--.C.SKP..QCPYSHP------------------
T1JIC4_STRMM/1627-1644------------------------------------PCRYGLS..--.C.TQS..GCSFFHP------------------
F4Q9D5_DICFS/419-436------------------------------------DCRYGKD..--.C.TNA..SCIFQHP------------------
U9T7M9_RHIID/382-399------------------------------------PCRFGSE..--.C.AQP..KCRYSHP------------------
C7YLG2_NECH7/195-212------------------------------------KCRHGAG..--.C.KSK..NCKFSHP------------------

PF16131

G3JQI7_CORMM/42-148...KAKGRCNIATDAGYTKAD..NQPGS.......FFCVSFARGV---CAKGV--DCEYLHRLP......GAYD..IF.G
G1XUG1_ARTOA/44-153...HAEGRCNVAKDSGYTKAD..RVPGS.......YFCLFFARGL---CPHGH--QCEYLHRLP......TIHD..LF.N
F2PPW7_TRIEC/55-163...PAESRCNIAKDSGYTRAD..KITGS.......FFCIFFARGL---CPKGH--ECEYLHRLP......GIHD..LF.N
G8BCZ4_CANPC/12-123...RSKYRVKVTRDQGYTRAR..DA..S.......PVCLFFSRGC---CYMGS--NCKYLHNLP......SKST..YQ.N
G8JM53_ERECY/9-119...VNPYRLDADQDSGLTQGE..QEGEV.......FFCVYFSKGM---CCMGK--RCRYLHHIP......DEED.VAK.L
CWC2_CANAL/15-120...KSKYRVRISTDQGFTKAN..KN..T.......HICLFFSRGC---CYLGS--KCQYFHRLP......KESD..NF.K
D3AYH7_POLPA/48-153...VSDARCNVLKDCGKTRAS....KDS.......YFCLHFARGR---CVNGV--ECTYLHRVP......TPND.....D
G0SXB9_RHOG2/20-129...KAQTRVNVKQDAGYTRAD..ASGQK.......YICLYFARGC---CPYGH--ECSYLHRLP......PKAH.VLP.D
Q4U9J8_THEAN/101-218...PAMYTCDPELDSGYTRAN...SKHSVDDSGTKFICLFFAKGC---CSQGS--KCNYLHRVP......ILED.EYFLD
A5DU75_LODEL/15-122...RSKFRVNISNDQGYTRAR..KG..D.......PICLFFSRGC---CYQGS--NCKYFHRLP......ISSD..IK.D
B3L6B6_PLAKH/424-543...VARFKCNPSTDSGYTKAD..KNLTSK.....QFFCIYFARGC---CAYGH--NCLYRHRIP......NEND.ELQFE
G8BZZ9_TETPH/2-112...VNPYRLEPLLHSGTTIGD..KTSNN.......FFCLFFAKGM---CCLGK--KCTYKHHVP......AEED.NLS.L
A7AT19_BABBO/152-268...PAMYKCDPERDTGYTRGS...SKNTLDDCGTKYCCLFFAKGC---CTLGS--KCNYLHRVP......TVED.EFFLD
CWC2_YARLI/56-165...KADGRCSIARDSGYTRAD..KVPGS.......YFCLYFARGL---CTQGH--KCEFLHRLP......VLTD..MF.S
A4RQW4_OSTLU/78-192SAVKAVTRCAPILDAGVTKGD..GAGTT.......AVCYHFARGC---CTSGE--ACEYLHRLP......TAFD.....D
A9V616_MONBE/22-132...PAETRCDSAKDAGRTRGS..NNSQA.......YLCYRFARGC---CHLGE--KCSFLHDIP......SEEF.....E
F2UEH1_SALR5/17-130...PATTRCSLVKDAGYTKAR..QASGA.......FICYKFAKGC---CPLGA--NCTYLHDLP......DAQF.....D
E7Q1M5_YEASB/4-114...VSPFALQPQLHSGKTRGD..NDGQL.......FFCLFFAKGM---CCLGP--KCEYLHHIP......DEED.IGK.L
I1BWV1_RHIO9/1-119KLYRPKYKVNIARDSGETTGS..RNPNA.......YFCLFFAKGM---CTQGP--RCAMWHRIP......TKDD.VI..E
B6K822_SCHJY/43-151...KSETRCVIERDSGYTKAD..KVLGS.......YFCLFFARGM---CSEGS--HCIYLHRLP......TEND..IF.N
F4PVC4_DICFS/45-150...VSETRCNLLKDCGRTRAG....KGS.......YFCLHFSKGR---CVNGV--DCTFLHRVP......TPED.....D
B2B7B7_PODAN/48-156...HAKGRCNIALDSGYTKAD..GHPGA.......FFCLYFARGV---CHKGQ--DCDYLHRLP......GPYD..IF.P
F0ZDH1_DICPU/40-145...ISETRCNVLKDCGKTRAG....KNA.......YFCCHFSKGR---CVNGA--DCTFLHRVP......TPED.....D
C5DIA0_LACTC/7-117...VSPYRLDVDLHQGNTKGD..KARQP.......FFCLYFCKGM---CCMGK--RCEYLHHVP......DTED.IAR.L
A0DPK2_PARTE/224-334...SALTRMHPDIDSGYTKADLYEKFST.......YFCLFFARGC---CAEGV--NCRYYHRIP......TMDE.CEQID
A0A016Q1H0_GIBZA/45-153...KAKSRCNVSKDSGYTKAD..TIPGS.......FFCLRFARGI---CPKGQ--DCDFLHRLP......GTYD..HF.N
C5MD14_CANTT/16-121...KSKYRVNLSNDEGYTKAS..KG..S.......PICLFFSQGC---CYLGS--KCNYFHRLP......NDSD..DF.K
C4Y4T6_CLAL4/2-107...KSRFRVNIKRDSGYTKAS..SN..S.......PICLFFARGC---CYKGK--KCSYLHRLP......SESD..FG.I
E1ZMU0_CHLVA/14-126...ASAYRCHPKIDSGWTRGE..GSGVE.......YCCLYFARGI---CHHGH--SCDFLHRLP......TAQD.....E
G8YAD9_PICSO/11-116...KSKFRVNIKKDVGYTKAS..GQ..S.......PICLFFARGC---CYLGK--KCKYLHRLP......TEND..YF.P
CWC2_KLULA/5-115...VTPYSLDPENDSGITKGD..KEGRI.......HFCLYFAKGM---CCLGK--NCRYLHHIP......EPDD.FAR.L
B6HND7_PENCW/57-163...PAPGRCNIARDSGYTRAD..RIPGS.......FFCIHFARGV---CVKGQ--DCEYLHRLP......TIHD..MF.N
A5DF02_PICGU/28-132...KSKFRVNIKNDTGYTKAG..TN..S.......PICLFFARGC---CYQGR--KCNYAHRIP......TDLD..YY.P
E9E222_METAQ/37-143...KAKGRCIIATDAGYTTAD..NVSGS.......YFCLRFARGI---CPRGQ--DCTNLHRLP......GTFD..LF.N
B6AJG7_CRYMR/20-128...PAQTRCNPIKDIGWTKAD..TEPGNN....LPSFCLYFARGC---CTNGA--SCKYYHHLP......TRED.....D
F9XH34_ZYMTI/45-159...QAKGRCNVALDSGYTKGD..KVPGT.......YFCLFFARGL---CPKGQ--DCEYLHRLPNSRKDAGLGD..IF.P
F4RVB5_MELLP/42-153...KSKTRCKISTDAGYTRAD..GGNNA.......YCCLYFARGC---CPYGW--ECSYLHRLP......PPQS.VLP.D
D2V8Q1_NAEGR/25-134...PAESRCNIKTDAGWTVGC..TLKDS.......VFCLFFAHGR---CAEGA--ECKYLHRIP......TTSD.....A
Q4Y0R8_PLACH/160-274...VAKYKCNPSKDSGYTKAD..KSYANK.....PYFCIYFARGC---CAYGH--NCLYRHRVP......TEND.ELEFE
CWC2_SCHPO/45-153...KSETRCVISRDSGYTKAD..KNPGS.......FFCLYFARGM---CSEGS--KCEYLHRLP......KDTD..FF.N
G0VCN6_NAUCC/4-115...VNPFKLEPTLHSGLTLGD..KEGSR.......VFCLYFAKGM---CCLGK--KCHYLHHVP......DEED.NLK.L
G7E837_MIXOS/15-124...KSQTRCVIATDAGYTRAD..GGRNN.......YCCLYFARGC---CPLGS--ECEFLHRLP......LPQH.KLP.D
CWC2_CANGA/7-112...VSVHRLDPERDSGVTRGD..SSGTW.......KFCLYFARGL---CALGH--KCEYLHHIP......EQSD.FDRYL
Q8I3V8_PLAF7/525-641...VAKYKCNPTKDSGYTKAD..KSYTSK.....QYFCIYFARGC---CAYGH--NCLYKHRIP......NEND.ELEFE
A3LNL2_PICST/17-124...KSKFRTNIKKDSGYTRAR..PG..S.......SICLFFSRGC---CYLGK--KCPYYHRIP......IDSD..YF.K
C4R2K8_PICPG/1-110...HSKTRCNIERDSGYTKAD..KEQSP.......FFCLYFSRGA---CCLGK--KCEYLHRLP......KETD.SWI.P
C5DPF7_ZYGRC/5-115...VSPFRLDPKLHSGKTLGD..KQETQ.......FFCLYFAKGM---CCLGK--KCQYMHHVP......ENED.MLR.L
A7SHW9_NEMVE/102-217...ESETRCCLATDAGFTKAT..ILEQSGN...KHYYCIYFAKGC---CHLGA--ECGFIHSIP......TEKD.....V
G0WBM3_NAUDC/3-114...VNPYRLEPNVHSGRTLGD..KEDNC.......FFCLYFAKGM---CCLGK--KCTYLHHIP......DEED.YRK.L
G3AFX9_SPAPN/15-120...QSKFKVNIKRDSGYTKAQ..TR..S.......PICLFFARGC---CYRGK--SCPYFHRLP......LPTD..YT.P
B3RVJ1_TRIAD/118-230...PATTRCVLKRDAGYTKAN..LMDNRES...RHYWCIYFARGC---CHLGS--ECTYYHTIP......LEND.....N
G0RHN9_HYPJQ/48-154...KAKGRCNIARDSGYTKAD..SVAGS.......YFCLFFARGL---CPRGA--DCMYLHRLP......GPYD..VS.A
D8FGE1_ASHGO/9-119...VNPYKLEPELHAGTTRGD..KQGQI.......YFCIYFSKGM---CCMGK--KCEYLHHVP......DDED.VAR.L
G2XE84_VERDV/45-163...HAKGPLQRRQRHGIHKEP.IKVVGS.......FFCLFFARGI---CPKGQ--DCEYLHRLP......GIHD..IF.N
G8ZNV4_TORDC/7-117...VNPYRLDPERHSGLTRGD..KEGAQ.......FFCLYFAKGM---CCLGK--RCHYMHHIP......EDKD.IAR.L
F8PXK7_SERL3/15-124...KSQTRCNIRKDAGLTRAN..TTGIK.......YCCLFFSRGC---CPYGW--ECEYLHTLP......DPLK.ALP.D
F4PB39_BATDJ/15-117...KAAHRCILERDAGKTKAG.......K....KGLFCLHFARGC---CSKGN--DCTFLHRIP......MPGD..RT.E
A7THZ4_VANPO/9-119...VNPYRLEPNLHSGVSRGD..LEGNK.......FFCLYFAKGL---CCLGK--KCTYKHHIP......EEED.TIQ.L
G4TI12_PIRID/19-128...KSQTRCNIRTDTGWTRAE..KTGMK.......YCCLYFARGC---CPYGY--ECNYRHRLP......DPTQ.TLP.D
D8MAN1_BLAHO/150-263...PATTRCNVARDAGYTRAD..KAAAEGK...EAWFCIHFARGC---CAKGS--ACEYYHRIP......IPAD.....L
C4LW00_ENTHI/23-126...GNMTRCCIKTDAGITKSK....EES.......PICLHFALGK---CFKGK--ECLYKHQLP......QEEE..EK.H
D0MSU9_PHYIT/135-244...PATTRCNLERDAGKTKADVVSKANR.......YFCVHFARGM---CARGA--ECSYYHRLP......SAAD.ETRIG
E5AB62_LEPMJ/104-211...AAQGRCNVARDSGYTKAD..KTPGS.......YFCLFFARGI---CPKGV--DCEYLHRLP......TVTD..IF.P
CWC2_CRYNJ/13-120...HSQTRCIISRDAGYTRAD..ATGNK.......YCCLFFARGC---CPYGY--ECQYLHRLP......LPSH.QLP.D
Q23MM8_TETTS/193-302...PAETRCNTELDSGYTKADLTDRYSA.......YYCHHWAKGC---CSEGQ--NCRYFHRVP......SLAE.CMTID
CWC2_MAGO7/39-146...AAKGRCNVAKDSGYTKAD..QTTGS.......YFCLFFARGV---CPKGQ--DCEYLHRLP......TLHD..LY.S
V4ZEL8_TOXGO/132-245...TAPYKCNPKRDAGYTRANVDAAGEH.......FFCIFFAKGG---CYLGK--DCRFRHSIP......TADDEGHL.E
W1QI95_OGAPD/2-115...HARHRCHPAKDAGYTKAD..KHVEPGSVNRDKFICLYFARGY---CTNGK--NCDYLHRLP......TDMD..FF.P

PF15663

G1KZ30_ANOCA/1-109S..NK.DDCYFYYYSTCSKGNNCPFRHCEAALGNETVCVLWKEGR---CFRSV---CQFRHMEINKKRSEIPCYWEKQPL
D2A082_TRICA/4-108ESPKKNNDCYFYYYSTCAKGDNCTFRHEPSALGCETMCSFWKEGK---CLNVH---CNFRHMELRKNRKAIPCYWESQPG
H1A4D2_TAEGU/1-110S..SQGDDCYFYFYSTCNKGDSCSFRHCEAALGSETVCTLWQEGR---CFRNI---CRFRHMEIDVRKILILIFFHCILL
H2RKG4_TAKRU/1-109T..NRGDDCYFFYYSTCTKGDSCPFRHCEAAL.SETVCTLWQEGR---CFRNT---CKFRHMEITHNRKEIPCYWENQAT
H9JJ34_BOMMO/1-111ESPRKFNDCYFYYYSTCTKGDNCVFRHEPSALGCETMCTAWQQGK---CTDKR---CKLRHMELRKNRKQIPCYWENQPG
H2M3R3_ORYLA/1-110T..NHGDDCYFFYYSTCTKGDSCPFRHCEAAMGNETVCNLWQEGR---CFRPT---CKFRHMEITKNRKEIPCYWENQPA
E2AA72_CAMFO/20-132EHNHKNLDCYFFYYSTCKKGDFCPYRHEPSALGCETTCTYWQQGN---CLNEH---CNFRHMELKKNRKSIPCYWETQPG
G5BC32_HETGA/1-110S..NRGEDCYFFFYSTCTKGNMCPFRHCKAALGNETVCPLWEEGR---CFQPL---CRYRHMRIDKKSSEISHYWENQPR
I1EXH3_AMPQE/43-148N..PTAEDCYFYFYSTCSKGDKCQFRHCSAAIGNEEICQLWKEGK---CKRQA---CAFRHSNSNRQRASIPCYWENQPS
F1QNW1_DANRE/1-111T..LQGDDCYFFYYSTCTKGDSCPFRHCEAAMGSETVCNLWQEQR---CFRNV---CKFRHMEIDKNRKEIACYWENQPA
E5S922_TRISP/1-100S..LHGDDCYFFFYSKCTKGDRCPFRHSKSALGTEIVCQAWLQGR---CRKAG---CGYRHMKNGKTRSTTPCYWENQPG
H2N430_PONAB/1-109P..NQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGR---CFRQV---CRFRHMEIDKKRSEIPCYWENQPT

PF00642

Q9VUH9_DROME/327-353--------------------------------------
ZC3H3_HUMAN/668-694--------------------------------------
C3H5_ARATH/375-403--------------------------------------
U2AFB_ORYSJ/149-174--------------------------------------
C3H24_ARATH/80-106--------------------------------------
HELZ_HUMAN/179-205--------------------------------------
C3H34_ARATH/308-334--------------------------------------
C3H34_ARATH/101-127--------------------------------------
C3H34_ARATH/149-175--------------------------------------
C3H34_ARATH/354-380--------------------------------------
C3H32_ARATH/137-163--------------------------------------
CPSF4_BOVIN/91-116--------------------------------------
TISB_HUMAN/153-179--------------------------------------
C3H42_ARATH/131-156--------------------------------------
C3H26_ARATH/308-334--------------------------------------
ZFS1_SCHPO/365-391--------------------------------------
ZMAT5_HUMAN/52-78--------------------------------------
Q9W6Q9_TAKRU/169-195--------------------------------------
Z3H7B_HUMAN/903-929--------------------------------------
MEX6_CAEEL/274-301--------------------------------------
C3H43_ARATH/393-419--------------------------------------
O18251_CAEEL/112-138--------------------------------------
C3H43_ARATH/111-137--------------------------------------
Q10954_CAEEL/207-233--------------------------------------
Q9VV48_DROME/418-444--------------------------------------
TRM1_HUMAN/601-626--------------------------------------
CWC24_YEAST/139-165--------------------------------------
Q20155_CAEEL/237-263--------------------------------------
C3H32_ARATH/336-362--------------------------------------
CTH1_YEAST/205-231--------------------------------------
Q9U2V1_CAEEL/89-115--------------------------------------
U2AFL_HUMAN/172-198--------------------------------------
PIE1_CAEEL/185-210--------------------------------------
O02289_CAEEL/653-679--------------------------------------
PIE1_CAEEL/99-125--------------------------------------
C3H26_ARATH/45-71--------------------------------------
UNK_DROME/273-299--------------------------------------
C3H32_ARATH/290-316--------------------------------------
Q9VZ55_DROME/246-272--------------------------------------
O45289_CAEEL/89-115--------------------------------------
MEX5_CAEEL/315-343--------------------------------------
C3H32_ARATH/46-72--------------------------------------
C3H26_ARATH/262-288--------------------------------------
Q9U2U0_CAEEL/21-47--------------------------------------
YTH1_SCHPO/77-103--------------------------------------
Z3H7B_HUMAN/771-797--------------------------------------
C3H26_ARATH/130-156--------------------------------------
U2AF1_SCHPO/143-169--------------------------------------
C3H2_ARATH/123-149--------------------------------------
U2AF1_DROME/151-177--------------------------------------
CTH1_YEAST/243-269--------------------------------------
U2AF1_SCHPO/13-39--------------------------------------
C3H43_ARATH/205-231--------------------------------------
C3H33_ARATH/132-158--------------------------------------
ZFS1_SCHPO/327-353--------------------------------------
C3H43_ARATH/159-185--------------------------------------
RN113_CAEEL/176-202--------------------------------------
O18251_CAEEL/69-95--------------------------------------
U2AFA_ARATH/13-39--------------------------------------
TTP_MOUSE/96-122--------------------------------------
Q20155_CAEEL/199-225--------------------------------------
C3H33_ARATH/86-112--------------------------------------
U2AFL_MOUSE/158-184--------------------------------------
C3H32_ARATH/91-117--------------------------------------
CPSF4_BOVIN/63-88--------------------------------------
LEE1_YEAST/88-113--------------------------------------
A8WGZ9_XENTR/142-168--------------------------------------
B6AGW8_CRYMR/601-626--------------------------------------
K1PQ11_CRAGI/114-139--------------------------------------
Q28DF9_XENTR/134-159--------------------------------------
C3H28_ARATH/144-170--------------------------------------

PF14608

I3KDP8_ORENI/551-569--------------------------------------
Q297C0_DROPS/920-938--------------------------------------
Q55BM8_DICDI/293-311--------------------------------------
E3LKF3_CAERE/509-527--------------------------------------
A7RGB7_NEMVE/26-44--------------------------------------
C3YGV8_BRAFL/535-553--------------------------------------
G4VBK2_SCHMA/517-535--------------------------------------
A0CQL8_PARTE/62-83--------------------------------------
A5AP98_VITVI/106-127--------------------------------------
K7IQZ9_NASVI/973-991--------------------------------------
N4TDU0_FUSC1/396-413--------------------------------------
A7RGB7_NEMVE/84-101--------------------------------------
A0A023BBH5_GRENI/182-200--------------------------------------
K4DD74_SOLLC/140-161--------------------------------------
A7EXH5_SCLS1/388-405--------------------------------------
I1CPT5_RHIO9/261-280--------------------------------------
F4PBR7_BATDJ/444-461--------------------------------------
T1JIC4_STRMM/1608-1625--------------------------------------
Q2TYR2_ASPOR/158-175--------------------------------------
C5G125_ARTOC/402-419--------------------------------------
K4AUB9_SOLLC/221-241--------------------------------------
Q23AS1_TETTS/216-234--------------------------------------
A8N2N5_COPC7/171-189--------------------------------------
I4YE26_WALSC/127-145--------------------------------------
F4PBR7_BATDJ/364-382--------------------------------------
B7P524_IXOSC/479-497--------------------------------------
F1N567_BOVIN/655-672--------------------------------------
E7NHK1_YEASO/436-453--------------------------------------
S2IZS8_MUCC1/280-297--------------------------------------
J3NZI5_GAGT3/422-439--------------------------------------
U4LUG0_PYROM/355-372--------------------------------------
C5E402_ZYGRC/413-430--------------------------------------
Q6C5Z5_YARLI/409-426--------------------------------------
M0S017_MUSAM/56-75--------------------------------------
I1CPT5_RHIO9/341-358--------------------------------------
W5MWI0_LEPOC/688-705--------------------------------------
W1QK89_OGAPD/386-403--------------------------------------
G8YKR4_PICSO/262-279--------------------------------------
K1XJA7_MARBU/545-562--------------------------------------
D5GFG7_TUBMM/315-332--------------------------------------
K7IQZ9_NASVI/1012-1029--------------------------------------
G8B5V7_CANPC/375-392--------------------------------------
R7YUC6_CONA1/423-440--------------------------------------
Q75E99_ASHGO/412-429--------------------------------------
Q6C5Z5_YARLI/366-383--------------------------------------
W5J6C8_ANODA/1223-1240--------------------------------------
D7LXW5_ARALL/56-77--------------------------------------
E5SGZ2_TRISP/337-357--------------------------------------
G7E314_MIXOS/472-492--------------------------------------
D3AZW6_POLPA/279-296--------------------------------------
A5DFH1_PICGU/282-299--------------------------------------
G4TBK1_PIRID/435-452--------------------------------------
U6GYR7_EIMAC/502-519--------------------------------------
U9T7M9_RHIID/466-483--------------------------------------
E1FV39_LOALO/733-750--------------------------------------
G4TBK1_PIRID/326-343--------------------------------------
G7E245_MIXOS/298-315--------------------------------------
F4WPJ0_ACREC/915-932--------------------------------------
A3GFH6_PICST/357-374--------------------------------------
Q55BM8_DICDI/314-331--------------------------------------
Q6CKL1_KLULA/399-416--------------------------------------
A5DVN2_LODEL/459-476--------------------------------------
Q5KPH9_CRYNJ/454-471--------------------------------------
C7YLG2_NECH7/237-254--------------------------------------
S8BX70_DACHA/370-387--------------------------------------
A0DW37_PARTE/236-253--------------------------------------
E4V1U6_ARTGP/1106-1123--------------------------------------
A5DFH1_PICGU/378-395--------------------------------------
J4VXD4_BEAB2/318-335--------------------------------------
J4HSX7_FIBRA/488-505--------------------------------------
B8P1F0_POSPM/511-528--------------------------------------
C4QYX4_PICPG/377-394--------------------------------------
C7YLG2_NECH7/153-170--------------------------------------
Q2TYR2_ASPOR/116-133--------------------------------------
Q2TYR2_ASPOR/137-154--------------------------------------
E4V1U6_ARTGP/1004-1021--------------------------------------
I2FVU5_USTH4/481-498--------------------------------------
A0A023BBH5_GRENI/203-220--------------------------------------
U5GXY5_USTV1/360-377--------------------------------------
T1JIC4_STRMM/1627-1644--------------------------------------
F4Q9D5_DICFS/419-436--------------------------------------
U9T7M9_RHIID/382-399--------------------------------------
C7YLG2_NECH7/195-212--------------------------------------

PF16131

G3JQI7_CORMM/42-148PNI......DCFGR------------------------
G1XUG1_ARTOA/44-153PNI......DSFGR------------------------
F2PPW7_TRIEC/55-163PNV......DCFGR------------------------
G8BCZ4_CANPC/12-123QAK......DCFGR------------------------
G8JM53_ERECY/9-119AMKSD..VLDCFGR------------------------
CWC2_CANAL/15-120PTQ......DCFGR------------------------
D3AYH7_POLPA/48-153KRLVL..THDIFGR------------------------
G0SXB9_RHOG2/20-129ASL......DVFGR------------------------
Q4U9J8_THEAN/101-218TSV......DIFGR------------------------
A5DU75_LODEL/15-122ETR......DCFGR------------------------
B3L6B6_PLAKH/424-543QTI......DIFGR------------------------
G8BZZ9_TETPH/2-112SMSTD..VLDCFGR------------------------
A7AT19_BABBO/152-268SGV......DIFGR------------------------
CWC2_YARLI/56-165PTT......DCFGR------------------------
A4RQW4_OSTLU/78-192AKNHM..MFDIFGR------------------------
A9V616_MONBE/22-132KDIPV..SRDCFGR------------------------
F2UEH1_SALR5/17-130RELDR..VRDCFGR------------------------
E7Q1M5_YEASB/4-114ALRTE..VLDCFGR------------------------
I1BWV1_RHIO9/1-119TTI......DCFGR------------------------
B6K822_SCHJY/43-151ANV......DCFGR------------------------
F4PVC4_DICFS/45-150KKLSL..TYDIFGR------------------------
B2B7B7_PODAN/48-156QNV......DCFGR------------------------
F0ZDH1_DICPU/40-145KRLEI..THDIFGR------------------------
C5DIA0_LACTC/7-117SLRSD..VMDCFGR------------------------
A0DPK2_PARTE/224-334NSK......DVFGR------------------------
A0A016Q1H0_GIBZA/45-153PNV......DCFGR------------------------
C5MD14_CANTT/16-121QTQ......DCFGR------------------------
C4Y4T6_CLAL4/2-107PTQ......DCFGR------------------------
E1ZMU0_CHLVA/14-126ERHRTDYSHDIFGR------------------------
G8YAD9_PICSO/11-116PTQ......DCFGR------------------------
CWC2_KLULA/5-115ALHSS..ALDCFGR------------------------
B6HND7_PENCW/57-163PNM......DCFGR------------------------
A5DF02_PICGU/28-132PTQ......DCFGR------------------------
E9E222_METAQ/37-143PNV......DCFGR------------------------
B6AJG7_CRYMR/20-128DGLSP..MYDIFGR------------------------
F9XH34_ZYMTI/45-159SNV......DCFGR------------------------
F4RVB5_MELLP/42-153ASL......DVFGR------------------------
D2V8Q1_NAEGR/25-134SRIPI..TKDCFGR------------------------
Q4Y0R8_PLACH/160-274STM......DIFGR------------------------
CWC2_SCHPO/45-153ANV......DCFGR------------------------
G0VCN6_NAUCC/4-115K.GND..VLDCFGR------------------------
G7E837_MIXOS/15-124ASR......DCFGR------------------------
CWC2_CANGA/7-112VEGTP..LLDCFGR------------------------
Q8I3V8_PLAF7/525-641ASV......DIFGR------------------------
A3LNL2_PICST/17-124PTQ......DCFGR------------------------
C4R2K8_PICPG/1-110HTL......DCFGR------------------------
C5DPF7_ZYGRC/5-115AAKTD..VLDCFGR------------------------
A7SHW9_NEMVE/102-217GRFGL..AQDCFGR------------------------
G0WBM3_NAUDC/3-114SLKSD..ILDCFGR------------------------
G3AFX9_SPAPN/15-120TTQ......DCFGR------------------------
B3RVJ1_TRIAD/118-230RKIDL..AHDVFGR------------------------
G0RHN9_HYPJQ/48-154PNV......DIFGR------------------------
D8FGE1_ASHGO/9-119VMKSE..VLDCFGR------------------------
G2XE84_VERDV/45-163PNI......DCFGR------------------------
G8ZNV4_TORDC/7-117SMKTD..ILDCFGR------------------------
F8PXK7_SERL3/15-124SSK......DCFAR------------------------
F4PB39_BATDJ/15-117TTL......DCFGR------------------------
A7THZ4_VANPO/9-119NLKTG..VLDCFGR------------------------
G4TI12_PIRID/19-128TAK......DCFAR------------------------
D8MAN1_BLAHO/150-263KNIKL..DRDCFGR------------------------
C4LW00_ENTHI/23-126LGVI....KDIFGR------------------------
D0MSU9_PHYIT/135-244MMH......DCFGR------------------------
E5AB62_LEPMJ/104-211SNI......DCFGR------------------------
CWC2_CRYNJ/13-120NSR......DCFGR------------------------
Q23MM8_TETTS/193-302NSR......DVFGR------------------------
CWC2_MAGO7/39-146PNV......DCFGR------------------------
V4ZEL8_TOXGO/132-245WGH......DVFGR------------------------
W1QI95_OGAPD/2-115HTV......DCFGR------------------------

PF15663

G1KZ30_ANOCA/1-109GCQKLNCAFHHTKGRFVDGLFLPPSK.TAIPNAFEPPE
D2A082_TRICA/4-108GCLKPHCPFLHQSPK........PAAANESHESKTDSG
H1A4D2_TAEGU/1-110GDFCFSSVLLLNLQLYPQILCCFSFA.ATLPSPPEAAE
H2RKG4_TAKRU/1-109GCQKPHCAFFHEKPRYIDGVFVSPDK.SEFTSQGEAVE
H9JJ34_BOMMO/1-111GCRKIHCPFMHKNPEART.DGIAPSQPAPPVHACLN.E
H2M3R3_ORYLA/1-110GCQKPHCAFFHEKPRCIQGLFVPPDQ.MVLPGQNKNEE
E2AA72_CAMFO/20-132GCRKPHCPFLHASPRNITNDPINPVKTTEVATKSPNQE
G5BC32_HETGA/1-110GNQKLSCAFHRDRGPSVGDLFLPPSK.TMVPSALPSPE
I1EXH3_AMPQE/43-148GCLKSHCPFKHFKPRP.....SPPSKEERVKECIKISN
F1QNW1_DANRE/1-111GCQKPHCAFHHEKPRIINGNYLAPDKGQVARKDNEEAP
E5S922_TRISP/1-100GCLKQHCVFMHLKPRD...........KSLSAADYSPP
H2N430_PONAB/1-109GCQKLNCAFHHNRGRYVDGLFLPPSK.TVLPTVPESP.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window