Sequence alignment for CL0538

PF14610

Q6C7P0_YARLI/176-370DPIEASFNPVERCTPEKFIK...VKKQR...VGPWCSP-QYG-KGVMLD---H.VHW.FTWYTREF.........PDAEK
Q6BJD6_DEBHA/186-420DPTYHELNPIIRCTPDRYFKRGMGKHVN...SEPFCTP-HEN-QQLKMD---K.TYF.ITWFSRYF.........KDAKK
C5M6D3_CANTT/179-426DLETHLLSPLIRCTPDRYKKKGIGRDKS...TAPFCTP-KDN-SRLTMG---K.VYF.ITWYSRFF........DEDVKN
Q5AM42_CANAL/183-415DLENHLLSPIIRCTPDRYKKKGIGRDKT...TEPFCTP-KDD-ARLTKD---K.TYF.VTWYSRFF.......DEKKVDK
A5DUS0_LODEL/182-440DLEDHLLNPIIRCTPERYQKKGIGRDKS...TEPFCTP-KDD-VRLVMD---K.TYF.ITWYSRFF........DPEVEK
C4Y8N7_CLAL4/171-410DLTYKMLNPIIRCTPEFYKKKGMAKDKS...SEPFCFP-SDN-SNWKAD---K.TYF.VTWYHRFF........DDEVKN
A5DPS3_PICGU/179-400DQTYHSLNPLIRCTPDYYKLKGVAKDQS...PEPFCFP-QDS-AQLKQE---K.TYF.VTWFSRFF........APEVKN
A3LTE4_PICST/172-410DPYEHSLNPIIRCTPDLYRKKGVAKDQS...SEPFCFP-HDN-QQWKKE---Q.TYF.ITWYSRFF........DDEVEN
M9N441_ASHG1/138-340DDTYTSLNPLIRCTPDRYFNKGLAKDVS...SAPFCTP-REH-VDWYAG---Q.TYF.ITWYTHFF...WDKALDAPAEQ
A7TP99_VANPO/141-347DDTYLKLNPIIRCAPDRYSEKGLAKNIK...SEPFCTP-REA-TEWRVG---R.TYF.VSWFTRFF...KNEDTGKFAEK
C5E3Y8_ZYGRC/144-350DETYTSLNPIVRCTPKRYFNKGHSKNIP...SEPFCTP-HED-SIWNVG---K.TYF.LTWYTHFF...RDEHSNEVVER
C5DCM9_LACTC/172-377DDTYVSLNPIIRCTPDRYFKKGPAGDIS...SEPFCTP-KEN-KELKVD---N.TYF.VSWYTKFF...QKPDTDETIEN
Q6CII5_KLULA/141-345DLTYLSLNPVIRCTPDRYFNKGLAKDET...SAPFCTP-KEN-ADLKVD---K.TYF.VSWFTRFF....ENDDGVKEDE
A0A023ZDK8_YEASX/143-348DDTYVSLNPIVRCTPNLYFNKGLAKDIR...SEPFCTP-YEN-SRWKVD---K.TYF.VTWYTRFF...TDENSGKVADK
Q6FL99_CANGA/140-343DDTYVSLNPVIRCTPNRYVN..KKQDIV...EGPFCTP-KEN-SRFKVG---S.TYF.VTWFTKFF...EEPTTGKVADK
C4QW75_PICPG/183-411DQTYVSLNPLIRCTPQFYHKKGLAKHES...SEPICFP-HED-QKIKLG---K.VHF.LSWYTHYFTEGDDDQEQTVVEK
W1Q7J0_OGAPD/172-397DETYVALNPLMRCTPDFYYKKGVARELS...SEPFCSP-HEN-QKLFVG---K.TYF.LTWFTRYF.........EDATN
Q6CIA6_YARLI/116-315YPQSTDTPPVLGCWGDR.....LPEDNEKLPGYPFCSP-HNG-TELVAG---E.TYW.VTWDPSYW.......GGDDIAQ
W1QBS4_OGAPD/90-284PSPTGGAPPVLRCMNER.....ADESNS...GYPFCI.-ANG-TEMLVG---E.TYW.ITWDPEYW.........GSDDI
C4QWF6_PICPG/111-306FPTPDAVPPVLRCMNDR.....VPPDNT..MAYPFCV.-QNG-TEFLIG---E.TYW.ITWDPSYW.......GGDDITR
W1QAS6_OGAPD/112-323YPTPLAAPPVLRC.........MNERVP.SSSNPLCI.-SNA-TSFVAG---E.TYW.ITWNPLYW...NPDNDDDGISK
Q6BZL9_DEBHA/112-314FPTPLAAPPVLRCM........GDRVAD...GNPFCI.-GEG-AEFVVD---E.TYW.ITWDPLYF..NPDND.SEGISK
B6K6T0_SCHJY/56-228TKTKTAPTTVFDCRSASY....IASDVP......ICKP-TDG-VRWVKD---K.SYL.IQWDPYYF..........GTEN
YJH4_SCHPO/59-231TTKGLPTNAYYNCVPSKY....IQSDIP......MCAP-NQG-DRWVKG---R.KYK.VSWDPLYF..........GVDN
Q7S5T5_NEUCR/122-331SGATDPRGEFLAC.........LPQQSL...DEPFCAP-KRD-AILRPG---Q.GYY.ITWNTLYF........ALPNQR
B6JVR8_SCHJY/5-173....QLLLFFVACFSF......VTRSRA...EFTFLTP-SDG-SRWAIS---N.TYS.ISWDNN...........TDVEF
YOSH_SCHPO/1-172MKFFLGSALFLILTF.......INLVRA...EFEFITP-AED-SRWARG---F.TYA.VKWKQ............PTEQF
C9SDE3_VERA1/93-290TDSDGGRGVFNVCM........DNANSE...IAPFCQP-RAR-SELYVK---E.PYY.ITWDSSGF....GADLNTVANI
D5GJC4_TUBMM/82-276SDGDQSDNVVARCDSSKYELGKTGNVQP...WVPFCAP-HNG-TEWWVD---G.NYY.VTWNPKHW.........TRNST
F2SX36_TRIRC/94-268ELTGDKPKEAQACS........SEKDLS...IKPFCSP-HDQ-QEVYVD---D.TYY.VTWLTSLV.........GSDSV
C5FUR6_ARTOC/94-268EATGERPKEAQACS........SENDLS...VKPFCSP-HDQ-QEVYAE---D.TYY.ATWLPSLL.........DPNAT
Q0CZH9_ASPTN/60-232HTGKTSPGEFPMC.........TEENTP...FPPFCLP-HHG-ADVTVD---A.TYY.VTWNADFY.........PANAK
A2QJ97_ASPNC/58-230RRSSPTPGDFPIC.........RDPRGA...ARPFCLP-EDG-ANVTVG---G.TYY.ITWDADFY.........PLNAT
B8N0W6_ASPFN/54-226QTNNASPDDFPVC.........TDIDGP...FAPFCLP-QDG-ADVIVD---A.TYY.VTWNADFY.........PLNAS
A1CWS2_NEOFI/48-220TNTSSFSGDFPIC.........TDLNGP...IAPFCLP-KDG-ADVTVD---A.TYY.VTWNADFY.........PLNAT
A1CHY8_ASPCL/61-233RNITPTTVDFPIC.........TDLKGP...LAPFCLP-EDG-ANVTVD---A.TYY.VTWNADFY.........PLNTT
C5GFR3_AJEDR/44-218DSDKNGVYP.PECH........VQRESK....YPFCLP-KNK-TEVFTG---D.IYY.VTWDSDAF.........PPNST
A6RAV9_AJECN/100-274PSDGNGVYP.PECH........VGRDSK....YPFCLP-KNE-SEVLTE---Q.IYY.VTWDSDLF.........PGNST
C5PCW4_COCP7/75-251SPPEPTDSDVEACH........ADEGSP...GYPFCKP-HVG-QELYVD---DVPHP.VTWDVDAF.........GINST
C4JRR4_UNCRE/96-271PAAQPTDSDVKACH........ADTESA...IYPFCEP-TNG-QEVYVD---E.SYY.VTWDVDAF.........KINST
E3Q7V2_COLGM/73-251TADAKGAGSFLLCNQA......AGSGGL...DEPFCSP-KVD-SELEGG---R.TYW.ITWDTALF........PSPKTM
C9SEG2_VERA1/74-242TAFSDGSGAFLVC.........DEASGSSELYSPFCAS-EKD-KEVAAG---S.TYF.ITWDAEHF........EDPGRG
E3Q9B7_COLGM/100-269SNARGYGGAFPVC.........NNRVGN...DSPFCFP-RRG-NTLHVE---S.TYY.ITWDTTFF........ADPATP
C7YI59_NECH7/103-283ATGKHGEGVFTRC.........HNKDGS...NAPFCSP-YEN-STLTTG---K.TYF.ITWDPDYF.EDKNADNTTAAMM
E9EC26_METAQ/105-276TNAGTNQGSFSRC.........YNKNGP...YAPFCRP-SYN-SSIYTG---N.TYYTATLNSTYF..............
F0X8Q1_GROCL/88-255AATSSGAGAFLTC.........SNYQGY...FKPFCQP-GDG-SELAPG---S.SYY.VTWDTTFF.........YTGAT
Q2HEH3_CHAGB/51-243PTNELGASAFSPC.........SNTDGE...FKPFCLP-KQH-DIFYPG---A.TPY.VTWDTTFF.......PDPNNTL
B2AB99_PODAN/55-252DTTKLAGHEFAVC.........HNLDGD...YKPFCLP-KHN-ETFNPG---V.LKY.ITWDPAFF..SKGHTHEKANHT
E3QIV8_COLGM/98-275ADSKSGAGAFAPC.........NNANGD...FSPFCDP-VKD-SELFVD---G.TYY.VTWDPTVL.....IKGNKTNVH
F0XN07_GROCL/70-257ATATNGAGAFPVC.........QNTAGA...QAPFCAP-SDG-STLNPG---G.TYY.ITWDPTYF.......ASTPNTS

PF10342

Q5B872_EMENI/24-116----------------------------------TE.P.TAN.STFAAG....-STITVKWTTVD.....TDP.......
Q5B820_EMENI/22-115----------------------------------TE.P.EKG.AEIDPS....-SSFTVKWDSVS.....TDP.......
Q5B5Y1_EMENI/34-126----------------------------------LA.P.GLQ.EQVPAG....-KPYTITWDP.......TTE.......
B8NI76_ASPFN/21-113----------------------------------NK.P.GAN.STYAAG...S-T.VTVNWSTVD.....TDP.......
E3Q5K2_COLGM/21-113----------------------------------TS.P.SIN.STVTKG...S-S.YELTWKAVD.....TDP.......
Q2UIS7_ASPOR/22-115----------------------------------TS.P.KKG.EDVDLS...K-S.FTVKWDAVD.....TDP.......
B8N4F3_ASPFN/22-112----------------------------------TS.P.QNG.DKVDFS...K-.PYTVKWTTVP.....SDP.......
A2RAR3_ASPNC/34-123----------------------------------LT.P.ELN.QVVPAG...K-.PFEITWDP.......TTS.......
B8MDX6_TALSN/31-120----------------------------------IV.P.SAG.AQFTAG...T-T.TTLTWNP.......TTS.......
B6QM89_PENMQ/27-116----------------------------------SS.P.GAN.VVFEAG...T-T.TTLTWKP.......TTP.......
B6H8T2_PENCW/22-115----------------------------------TE.P.AKN.DEVDVS...G-S.FTVKWSSVS.....TDA.......
E9EW85_METAR/26-120----------------------------------YA.P.TPN.EKITAG...S-T.FTITWKAPA.....KYS......E
A7EGI4_SCLS1/28-121----------------------------------SV.P.TNG.QVVKVG...D-V.LDITWAPN......AVS.......
Q0D1Y4_ASPTN/25-114----------------------------------NI.P.TEG.YTFTAG...K-.PTTLTWQP.......TTE.......
B6HCY9_PENCW/34-123----------------------------------VA.P.GLN.EIVPEG...K-T.YTIKWQPS.......TT.......
B6HHI6_PENCW/26-115----------------------------------SI.P.TEG.YTFKVG...E-.PTALTWKP.......TTG.......
A2QKG4_ASPNC/25-128----------------------------------ID.P.AAG.TVIRAG...D-E.FTAHWRDSG.....TLPRL..ASL
Q0CR38_ASPTN/36-125----------------------------------LT.P.GLN.ELVPVG...Q-.PYDITWTP.......TTE.......
A2QVV0_ASPNC/26-118----------------------------------TQ.P.QNG.DQVDFS...K-.PYTIKWTTVA.....SDP.......
C1H4S8_PARBA/33-122----------------------------------SR.P.GLL.ELVPVG...Q-.PYTITWQP.......STP.......
Q7S2L6_NEUCR/26-121----------------------------------SN.P.YAG.EKVLAG...L-.PCEIKWAPSS......DPK....FQ
B8N159_ASPFN/34-123----------------------------------YT.P.GLN.EAVPVG...K-.PYAITWGP.......TTE.......
D5GFD8_TUBMM/26-114----------------------------------IK.P.DGS.APLAAG...D-T.VTITWTP.......TTS.......
A1CRU4_ASPCL/33-122----------------------------------LK.P.GLN.EQVSAG...K-S.YTIEWTP.......TTE.......
D5GM66_TUBMM/42-127----------------------------------NV.P.PGG..TIASG...S-G.ITIRWTP.......STP.......
F2PZN6_TRIEC/32-120----------------------------------TT.P.GLG.ERVTVG...Q-V.FTISWKP.......TTQ.......
Q0CHH6_ASPTN/24-127----------------------------------TT.P.TVD.TVLKAG...D-V.VTVHWKDSGIPPRISEL.......
C5FT49_ARTOC/32-121----------------------------------MT.P.GLD.QQVPVG...K-.PFSITWQP.......TTH.......
B2AAC8_PODAN/29-122----------------------------------SK.P.SFD.EVIPAG...K-A.YDIAWAPTE.....EFP.......
Q2H7L4_CHAGB/21-113----------------------------------TS.P.SKN.DVVDPS...K-G.VTVKWSTVN.....TDP.......
Q7SAW7_NEUCR/22-114----------------------------------TN.P.KKN.DVVDPS...S-G.VEVKWSTVS.....TDP.......
C5FWV4_ARTOC/24-110----------------------------------SF.T.SFP.SSLQAG...K-.PCEITWTGG......NPQ.......
A2R6F8_ASPNC/22-109----------------------------------TQ.P.TSG.TEWDFS...T-.PKTIKFTSDA.....NDP.......
E4UYI9_ARTGP/25-109----------------------------------TS....FP.SGLTAG...Q-.PFTVTWTGGN.....ADL.......
A1CAW6_ASPCL/34-123----------------------------------LQ.P.GLN.ERVAAG...K-Q.YTIKWTP.......TTE.......
A1CSI8_ASPCL/24-127----------------------------------TV.P.AFG.TSFKSG...D-V.VTAHWKELG.....TSPRI..SEL
B8NC02_ASPFN/24-127----------------------------------IA.P.ARG.TIMKAG...D-V.VTAHWKDSG.....ESPRI..SEL
Q5KDL8_CRYNJ/23-123----------------------------------ES.P.TKD.TVWESG...T-SSQTVEWEAVD.....TDP.......
Q6C361_YARLI/23-112----------------------------------SQ.P.QPG.DELHAG...D-A.FVIRWNA.......TTD.......
B6GZR8_PENCW/21-113----------------------------------TS.P.RMG.ERIDPD...M-.PLTIKWQSVS.....TDP.......
F2PGU7_TRIEC/23-112----------------------------------SV.P.PGG.YRFSAG...T-.PTVLTWKP.......TTP.......
A7EUB0_SCLS1/23-127----------------------------------AA.P.AAG.AVETAG...T-A.FTVTWADSGDAPSIADI.......
A5DZ86_LODEL/24-129----------------------------------TS.P.ESG.DSFAASGGTA-A.VKLEWKDSDD...SD.SDLSLDNV
E3Q6D6_COLGM/28-123----------------------------------YK.P.TSN.QKVNAG...T-S.LTIEWDAPD.....AFK......D
E4V0G9_ARTGP/32-120----------------------------------FT.P.GSQ.ELVPAG...S-.PYTISWKP.......TTQ.......
C5MA15_CANTT/26-134----------------------------------TS.P.SSG.DSYSGSSGSA-S.VKIAWDDSDD..SDS.DKSL.DNV
C1H1P3_PARBA/23-108----------------------------------SF.T.SFP.DNVQVG...E-.PVTVTWTGG.......TG.......
D4AQH0_ARTBC/23-112----------------------------------LV.P.PGG.YQFNTR...E-.PTVLNWQP.......TTP.......
C7YHH8_NECH7/28-122----------------------------------FK.P.EAW.QSVAAG...Q-S.FQITWDAPA.....KYA......G
C4Y066_CLAL4/23-125----------------------------------SN.P.STG.QTFDGSDGTA-T.VSVKWIDDG.....NDQVPL.KDV
B6QKW0_PENMQ/38-129----------------------------------YT.P.DTT.HPVTLD...A-.PYQITWDP.......TTP.......
C0SAH3_PARBP/23-126----------------------------------TA.P.PAG.SVLKGG...S-V.LNVEWRHLG.....NDTES..LAS
D5G4J1_TUBMM/33-122----------------------------------SK.P.GLG.EIVPAG...S-.PYTITWNP.......TTG.......
B6K4G1_SCHJY/20-108----------------------------------TA.P.ATN.AVIQEG...G-GVYTVSWNNQS.......G.......
Q6C605_YARLI/30-115----------------------------------SS.P.GAN.TKISPG...E-N.FYITWVADP......AI.......
C9SIL5_VERA1/23-107----------------------------------TN.T.QADFAAISAG...E-D.FTLTWSGA........E.......
B6H0V5_PENCW/27-112----------------------------------TSWP.K...EPLEPG...K-.PVTLTWTGA......TPD.......
D4AU53_ARTBC/24-118----------------------------------QA.P.QAL.AVLDAT...S-.PLDIEWSFPE....NATSFL...LG
B2AYJ8_PODAN/22-108----------------------------------TN....SN.YDVVVG...E-.PFTLRWDS........AE.......
ADG2_SCHPO/23-113----------------------------------NV.P.SSS.DVWTSG...H-I.EPLEWSVVS.....TDP.......
Q4PEA8_USTMA/91-187----------------------------------TF.PNSNG.GYWVTN...Y-T.NTLNWKANS.....SDP.......
B6K5U7_SCHJY/24-125----------------------------------TS.P.LSS.SVFTAT...T-G.ITVAWQGSTAGAPISQL.......
F2PGP2_TRIEC/26-109----------------------------------.....SFP.ENLKTG...D-S.FTATWIGGD......PQ.......
F4R679_MELLP/25-115----------------------------------...P.SAA.SYWVQF...S-T.NTISWSQGS.....GDP.......
J9MCN7_FUSO4/29-122----------------------------------.T.P.TNW.EEVSAG...K-T.LEITWQAKP.....KYS......G
YA880_ASPFU/20-112----------------------------------TS.P.KKD.QDVDLS...E-K.TTIEWSSVS.....SDP.......
Q4X259_ASPFU/23-126----------------------------------TV.P.TIG.TNFKGG...D-V.VTVHWCESG.....QPPRI..SEL
W1QB36_OGAPD/25-129----------------------------------.S.P.SSG.DTFTVDGSTV-K.FNVTFKDDGESPSIKDA.......

PF14610

Q6C7P0_YARLI/176-370VRLHCAYIQGKALHKR-EIED--S.................................................SVFHITE
Q6BJD6_DEBHA/186-420VRVHLSFLKESARQKG-LKRS--L.........................EDDSESEQNLTKRSSLEKGATIKESSFFYSD
C5M6D3_CANTT/179-426VRIHLNYISEKWTQKG-LKKR--D............DNSTEEFVEDDDTTEDIVEASEIKRRSSVLEQGGKISSNFFKSD
Q5AM42_CANAL/183-415VRIHLSNIKESLKQKG-LKKR--D...........................EQTNQEFDKRSKVLEMGGKVTDFSFFTSD
A5DUS0_LODEL/182-440VRILFSNIKESFRQKG-LKKR--DFGEAGQDVSGGHKDNDNDNEENEEEGTDVIDYTPFDKRSKVLEHGGKVQNSFYASD
C4Y8N7_CLAL4/171-410VRLHLSYVRESLRQKG-LKRD--E.......................VMNSTVSVDKYSKRSSVMEKGGSLDGKSFFVSD
A5DPS3_PICGU/179-400VKLHLTYVKEHHMYKG-TKRS--E.......................................VMDKGGQAHANSFFTSD
A3LTE4_PICST/172-410VKVHLSYVKESAHQKG-FKKR--E...................ISENVENENAGPSNLSKRSAIIDKGGVVEQVSFYSSD
M9N441_ASHG1/138-340ARVMLYYVKKGQLRQK-REPI--K..................................................PFFRGQ
A7TP99_VANPO/141-347VRVHLMEVPMEAKEKG-YHNK--R..............................................STNDVVHSSD
C5E3Y8_ZYGRC/144-350VRIHMAYIREKSNEKG-VLKR--D..............................................APSATFFHSE
C5DCM9_LACTC/172-377VQLHLFYVKESIKDKG-LKKR--D...............................................LKAAFFSSG
Q6CII5_KLULA/141-345VRVHLSYVQEKAHDKG-YAKR--E...............................................MKATFFSSE
A0A023ZDK8_YEASX/143-348VRVHLSYVKENPVEKG-NYKR--D...............................................IPATFFSSE
Q6FL99_CANGA/140-343VRLHISYVKEKAREKG-YHRR--A...............................................LPATFYTSE
C4QW75_PICPG/183-411VKIHFAYLKPSAQKKD-MRKR--E.............IPNVPKVIPAENYETFQ...............GDIPGTFFSSE
W1Q7J0_OGAPD/172-397VRIHYAFLKESAKEQG-LVKR--D......................LVDLGPPVKPKTKNIDHSQEHKGGALPGTFFTSD
Q6CIA6_YARLI/116-315VKLILRSLPTGTDD..-....--...................................................LMFETE
W1QBS4_OGAPD/90-284VRVRLSTNAYPSVDGD-E...--...................................................SLFTSD
C4QWF6_PICPG/111-306VKLQIRAYPLKDDED.-....--...................................................PVFVTD
W1QAS6_OGAPD/112-323VQLRLRSYSEDTNSS.-....--...................................................AFYTTD
Q6BZL9_DEBHA/112-314VKIKVRPFPNNESTS.-....--...................................................PIETSD
B6K6T0_SCHJY/56-228INLVLSYKNSTG....-....--...................................................LVAVEK
YJH4_SCHPO/59-231LLMVVSYLNDSG....-....--...................................................LIAATK
Q7S5T5_NEUCR/122-331VQILLQTANVPDSLSQ-DSSS--S.........................................SSSPKPVTPTLPHFS
B6JVR8_SCHJY/5-173VNLALEYTDGDRE...-....--...................................................VITQSG
YOSH_SCHPO/1-172VEIALQYADSNNT...-....--...................................................LITSSG
C9SDE3_VERA1/93-290VGLAVTRQSGTPTNAE-P...--...................................................NFIIND
D5GJC4_TUBMM/82-276VKIILNYANPGRGGKV-....--......................................................AKL
F2SX36_TRIRC/94-268VRVGLDYVNVSMNEGL-....--...................................................NAWLSR
C5FUR6_ARTOC/94-268VKVGMDYVNLTANEGP-....--...................................................LAFISS
Q0CZH9_ASPTN/60-232ITIELRYANSTQGD..-....--...................................................SAFTSG
A2QJ97_ASPNC/58-230ITIELRYADSVEGD..-....--...................................................STFTSD
B8N0W6_ASPFN/54-226ITIEMRYSNSTVGD..-....--...................................................SAFTSE
A1CWS2_NEOFI/48-220ITIELRYANSSQGD..-....--...................................................SAFTSE
A1CHY8_ASPCL/61-233ITIEMRYANSTQGD..-....--...................................................SAYTSE
C5GFR3_AJEDR/44-218ITVGLNYANSSEKAGV-....--...................................................SAYTSD
A6RAV9_AJECN/100-274ITIGLNYANSSENEGV-....--...................................................SAYTSD
C5PCW4_COCP7/75-251VIITLEFVNVSESESK-....--...................................................LAYTSE
C4JRR4_UNCRE/96-271VQINLDYVNTTQNEGR-....--...................................................SAYASD
E3Q7V2_COLGM/73-251IQIQGDFNATDTIEPG-....--...................................................HGFTSL
C9SEG2_VERA1/74-242VVVEGALTNHDGVIED-....--...................................................QAFSSG
E3Q9B7_COLGM/100-269IVIIGFDVDNGVTDSA-....--...................................................PAFSVT
C7YI59_NECH7/103-283VFARLDIYNTTSEEYQ-K...--...................................................EGDDFD
E9EC26_METAQ/105-276VSVRLDYLNTTSNEYV-....--...................................................LLETID
F0X8Q1_GROCL/88-255VEIGVQYNTTGSV...-....--...................................................SDFASK
Q2HEH3_CHAGB/51-243VKVVGFYTNITVPSDD-PADD--T...........................................HKDFEDAEAFSSE
B2AB99_PODAN/55-252VKIIGFYLTPESDTH.-....--...................................................QAFDSG
E3QIV8_COLGM/98-275VKIQGKAVNGTTVGDT-VL..--...................................................NDDTDK
F0XN07_GROCL/70-257VVITGNLFNASTGAIV-Q...--...................................................QAFSSG

PF10342

Q5B872_EMENI/24-116SYFSLYLWNFVS...W.PPSY..I--------------------------------------------------AL..AL
Q5B820_EMENI/22-115SSFDLYLVNNAV...Y.PSVE..K--------------------------------------------------KI..AS
Q5B5Y1_EMENI/34-126GSVSLVLLRGPS..TN.VQPL..Y--------------------------------------------------AI..AE
B8NI76_ASPFN/21-113TEISLYLWNFVS...W.PPSY..V--------------------------------------------------PL..AR
E3Q5K2_COLGM/21-113SAFSIFLVNFVN...W.PPSY..T--------------------------------------------------LL..AE
Q2UIS7_ASPOR/22-115SSFDLYIVNNAV...Y.PSVE..Q--------------------------------------------------KI..AS
B8N4F3_ASPFN/22-112EQVNIVLKNQTS.......SE..K--------------------------------------------------EI..AK
A2RAR3_ASPNC/34-123GTVSLVLLRGPS..TN.VVPI..Q--------------------------------------------------TI..VE
B8MDX6_TALSN/31-120GTISLRLQWGAT...TVATDG..V--------------------------------------------------VI..AS
B6QM89_PENMQ/27-116GPVTLRLQWGSV..AG.PNDG..V--------------------------------------------------VL..AA
B6H8T2_PENCW/22-115STVDIVLVNNAV...Y.PPVE..E--------------------------------------------------KI..AS
E9EW85_METAR/26-120GTVKIELIGGAT..QN..TQVPLA--------------------------------------------------DI..AS
A7EGI4_SCLS1/28-121GTVTIKLLEGAT.PAT.LNYD..P--------------------------------------------------VI.VAH
Q0D1Y4_ASPTN/25-114GSVTLRLQWGSV..LT.ADSG..S--------------------------------------------------VI..AQ
B6HCY9_PENCW/34-123GPISLVLLRGPS..NN.VVPL..K--------------------------------------------------TL..AE
B6HHI6_PENCW/26-115GTVSLILQWGAV..MT.GNSG..T--------------------------------------------------VI..AS
A2QKG4_ASPNC/25-128VQYDLYLCAGGD...T.VGSH..E--------------------------------------------------DI..AL
Q0CR38_ASPTN/36-125GTVSLVLLRGPS..TN.VVPL..E--------------------------------------------------TL..VV
A2QVV0_ASPNC/26-118SNFTIMLVNMNS...Q.PTVS..K--------------------------------------------------KI..A.
C1H4S8_PARBA/33-122GKVSLLLLRGPS..NN.VKYL..D--------------------------------------------------TI..AD
Q7S2L6_NEUCR/26-121GTVRIDVLGGTT.PQT.LDKV..G--------------------------------------------------TV..AS
B8N159_ASPFN/34-123GTVSLVLLRGES..TN.MQTL..E--------------------------------------------------TI..AE
D5GFD8_TUBMM/26-114GPITLKFRQGPS...NDLKDV..T--------------------------------------------------TI..VA
A1CRU4_ASPCL/33-122GTVSLVLLRGPS..TN.VVPI..D--------------------------------------------------TL..AE
D5GM66_TUBMM/42-127GPVTLILRRGDG..NN.LATV..T--------------------------------------------------NI..AS
F2PZN6_TRIEC/32-120KPVSIMLLHGCP..QN.CNPI..A--------------------------------------------------TL..AE
Q0CHH6_ASPTN/24-127TQYDLYLCAGED..LTGLNEE..I--------------------------------------------------AL.LMK
C5FT49_ARTOC/32-121GRVSILLLRGPS..TN.VRPI..S--------------------------------------------------VI..AE
B2AAC8_PODAN/29-122EAITIKLYGGKA.RNS.LDVV..A--------------------------------------------------TI..AS
Q2H7L4_CHAGB/21-113SKAHLVLVNMAS..GH.TPFS..K--------------------------------------------------DL..G.
Q7SAW7_NEUCR/22-114KSAHLVLVNMAS..GH.TPYT..K--------------------------------------------------DL..G.
C5FWV4_ARTOC/24-110APVTITLRKGES..TN.LKDV..A--------------------------------------------------VL..TS
A2R6F8_ASPNC/22-109SVISIILRTQDG......SFQ..T--------------------------------------------------KL..AD
E4UYI9_ARTGP/25-109.PVTITLRHGPS..DD.LKDV..S--------------------------------------------------IL..TS
A1CAW6_ASPCL/34-123GPISLVLLRGPS..TN.VVPL..E--------------------------------------------------TL..AE
A1CSI8_ASPCL/24-127THYDLYLYAGGE...T.ADTQ..M--------------------------------------------------EI..AS
B8NC02_ASPFN/24-127VQYDLYLCAGGD...T.LGSQ..E--------------------------------------------------NL..AI
Q5KDL8_CRYNJ/23-123TSFEIQLVNQAG...YLTNSP..V--------------------------------------------------TL..VA
Q6C361_YARLI/23-112GQVALVLLQGKS..DN.LSPV..L--------------------------------------------------TI..SE
B6GZR8_PENCW/21-113DTFTIELVNQNV...Y.PPTT..T--------------------------------------------------IV..AE
F2PGU7_TRIEC/23-112GTVTLKLHMSSD..IT.PQNG..R--------------------------------------------------VL..VA
A7EUB0_SCLS1/23-127STYSLAVCAGSSSGAD.IKVI..T--------------------------------------------------TV..SA
A5DZ86_LODEL/24-129KTYTISLCTGSN..SA.IQCL..D--------------------------------------------------PS..ID
E3Q6D6_COLGM/28-123VTVSISLIGGAT..QG.GQVP.LL--------------------------------------------------DI..VS
E4V0G9_ARTGP/32-120RPVSVMLLHGCP..KN.CMPV..A--------------------------------------------------TL..AE
C5MA15_CANTT/26-134KSYTILLCTGPDEDNN.IQCL.ET--------------------------------------------------AL..VS
C1H1P3_PARBA/23-108APVTITLRKGPR..ED.LRDV..Q--------------------------------------------------VL..TT
D4AQH0_ARTBC/23-112GTVTLKLQMSSD..IT.PHSG..L--------------------------------------------------VL..AA
C7YHH8_NECH7/28-122QLVTISLIGGDS.QNT.QVPI..K--------------------------------------------------DI..AT
C4Y066_CLAL4/23-125EKYSIVLCTGPN..NN.IKPV..K--------------------------------------------------SY..TT
B6QKW0_PENMQ/38-129GPVALVLCKGPS..TN.CEPI..L--------------------------------------------------TI..AD
C0SAH3_PARBP/23-126TLFDLKLCAGGNREDS.YDCF..M--------------------------------------------------FI..AR
D5G4J1_TUBMM/33-122GTVTLLLLRGPS..NN.VVPL..Y--------------------------------------------------PI..VE
B6K4G1_SCHJY/20-108SSVTLTLYRGSN..GA.LTAV..D--------------------------------------------------TI..AS
Q6C605_YARLI/30-115QAITLSLVKDGQ.......KV..L--------------------------------------------------DI..AP
C9SIL5_VERA1/23-107GPVTILLKTGPS..DD.LTTV..E--------------------------------------------------TI..TT
B6H0V5_PENCW/27-112EPVTILLRQGNA..GN.LQDV..K--------------------------------------------------PI..TG
D4AU53_ARTBC/24-118TDYSIWLCAGGNEDNT.HLFK..G--------------------------------------------------TI..LS
B2AYJ8_PODAN/22-108GNVKISLYKGTA..GN.ENSF..K--------------------------------------------------PVEVLT
ADG2_SCHPO/23-113LQANVWLINEVE...Y.PPTS..R--------------------------------------------------YI..M.
Q4PEA8_USTMA/91-187SFFSVQLLNANS..SQ.LNGN..F--------------------------------------------------QI..GN
B6K5U7_SCHJY/24-125GATTFYLCSGST..AS.STTL..M--------------------------------------------------TL..TA
F2PGP2_TRIEC/26-109APFDVLLCQGPS..GD.LHDV..E--------------------------------------------------TV..CS
F4R679_MELLP/25-115PVVSLQIVNPNH..NL.LNGA..F--------------------------------------------------SI..AE
J9MCN7_FUSO4/29-122EKISISLIGGAT..QNTQVPI..K--------------------------------------------------TI..AT
YA880_ASPFU/20-112SSFDIYLVKMNS...Y.PPVN..K--------------------------------------------------LV..AE
Q4X259_ASPFU/23-126SQYDLSLYAGGD...K.ADTQ..Y--------------------------------------------------EV..AV
W1QB36_OGAPD/25-129LSFTLLLMTGPN..ND.IEQR..A--------------------------------------------------SL..AS

PF14610

Q6C7P0_YARLI/176-370W.VS-NTW----GVYPMEI----EE--E.......WL....DGEYE....Q--KVAVAIQPDYMDD.DEI..TDDYLLK.
Q6BJD6_DEBHA/186-420W.LD-VEE----GMFPVTI----LE--E.......WF....GKKDW...YR--KVLISLQPDNVDD.EEF..DY...TK.
C5M6D3_CANTT/179-426P.ID-VDV----GWFALDI----SP--D.......WF....DKEYW....R--KVLVTVVPEGYEDREDY..DV...FQ.
Q5AM42_CANAL/183-415W.IS-NDQ----GYFPLYI----DE--N.......WF....GSEYW....R--KVLISIQPDNIPD.EEF..NV...LQ.
A5DUS0_LODEL/182-440W.VR-NED----GMLPVTI----LE--E.......WI....GNDVY...EK--KVLISIQPDNIPD.DEF..NV...LE.
C4Y8N7_CLAL4/171-410W.VA-KDE----GLLPITV----DP--E.......WI....GDDFY....R--KISISLQPDTVDD.EEF..DR...MK.
A5DPS3_PICGU/179-400W.IE-NDK----GFYPLTI----DP--E.......WL....TMKEP...FR--KVMLSLQPDNVSD.EDF..DP...QA.
A3LTE4_PICST/172-410W.LK-KSQ----GYFPVTV----DE--K.......WI....GDNDY...YR--KVLISLQPDNIPE.EDF..DF...LE.
M9N441_ASHG1/138-340W.IK-NID----GLFAITI----DE--E.......WL....QGQGT....R--QLMLTVQPSTVAD.EEF..DP...VE.
A7TP99_VANPO/141-347W.LK-NLE----GIYPITP----ED--A.......WL....EGEHE....K--KFVISVQPDYISD.EDF..DP...LE.
C5E3Y8_ZYGRC/144-350W.IK-NAD----GVYPIEI----LH--E.......WL....QGVRT....R--KIVISVQPETVSD.AEF..DP...LT.
C5DCM9_LACTC/172-377W.LK-NVD----GIYPLEL----TA--D.......FL....DGAYD....R--KVLLAIQPDNIRD.DEF..NP...WE.
Q6CII5_KLULA/141-345W.LK-NLD----GMYPLEV----RE--E.......WL....QGSYN....K--KVVVSVQPKSVPD.DEF..DP...LE.
A0A023ZDK8_YEASX/143-348W.ID-NDN----GLMPVEV----RD--E.......WL....QDQFD....R--RIVVSVQPIYISD.EDF..DP...LQ.
Q6FL99_CANGA/140-343W.FH-NVD----GLYAIEP----EN--D.......WL....GKEYE....R--RVVISIQPDYIPD.DEF..DP...LE.
C4QW75_PICPG/183-411W.IP-NTD----GYFPIEV----KE--E.......WL....KGKQF....R--LVFIGIQPESVSD.EDY..DL...LNG
W1Q7J0_OGAPD/172-397W.FV-NRD----GFFPIEV----LD--T.......WL....GKRQS....K--AVLIAVQPDTVDD.EEF..SL...IES
Q6CIA6_YARLI/116-315P.FA-NRK----GYYPLEI----QR--S.......WT....NNGGY.....--.FFINIAPLTRPD.TKAKNVG...TK.
W1QBS4_OGAPD/90-284Y.VI-NNN----GYYAWEV----KS--S.......YR....RSGTE..GYC--WLLITPQLDSTSN.AKH..TG...TT.
C4QWF6_PICPG/111-306W.IS-NAD----GYYIFES----KA--S.......NM....RTGSA....G--WGFLNITPQTTSE.TKATYVG...TK.
W1QAS6_OGAPD/112-323Y.SP-NSD----GYIALTI----DS--D.......WI....DEGND....G--WVQIVLTPFLDND.DLSSKYS...SY.
Q6BZL9_DEBHA/112-314W.LE-NKD----GFYAWTI----ES--S.......DI....DSDMD....G--YAQIYLSPFRTSD.TDSEEED...TA.
B6K6T0_SCHJY/56-228K.LN-NYK----GEITLKV----NK--D.......WL....HDDDN....Q--TITVDLETTGTNN......VT...LI.
YJH4_SCHPO/59-231K.VQ-NSK----GEIMLKA----NK--G.......WL....HDDSF....Q--NVTIDLVTISENN......MT...LL.
Q7S5T5_NEUCR/122-331I.LP-ADQ----GFALLPL----PR--S.......FL....GSSSS....H--QIIRLNITMAVWASGNYDEDAPTETK.
B6JVR8_SCHJY/5-173P.IP-TNQ----SHWRVQV----KK--K.......WL....QGANN....L--TARIVAVPQQPNP.TVQ..........
YOSH_SCHPO/1-172V.IP-SNQ----TYWMVKI----DK--K.......WL....MKMDN....I--TARVVAVPQNGTASTVY..........
C9SDE3_VERA1/93-290TTIV-LGR----GYYAWTP----SE--A.......DL....KGSTD...FH--NVSLMLQFVSSESNELT..NV......
D5GJC4_TUBMM/82-276WETA-NSF----GLINIEP----SK--D.......WL....VNRTAFDDGN--KRTVENQTMYFTIADDSPSGTQPNVE.
F2SX36_TRIRC/94-268E.TP-NNH----SYVAIQM----KP--E.......WL....KGEKR....N--NLTFFLDEFPEGK.GKV..HH......
C5FUR6_ARTOC/94-268K.TP-SSY----GYVTITM----KK--D.......WL....KGEKR....N--NLTMYLDELLPGK.DRI..HH......
Q0CZH9_ASPTN/60-232Q.TV-NSY----GYLPVHM----QS--D.......WL....QGKPQ....N--ALTLYIIELEPTS.DQR..AS...AR.
A2QJ97_ASPNC/58-230R.TD-NSY----GYTHIHM----QQ--E.......WL....QGKQQ....N--PLTLYIIELDSVS.DKR..AS...AR.
B8N0W6_ASPFN/54-226K.TD-NSY----GYLPLHM----RK--E.......WL....QEKAH....N--DLTFYLIELNPAS.GTR..AS...IR.
A1CWS2_NEOFI/48-220K.TD-NSY----GYISLPM----QK--E.......WL....QGKPY....N--ALTLYIIELDPTS.GSR..AS...AR.
A1CHY8_ASPCL/61-233R.TD-NSY----GYLPLHM----QK--E.......WL....QGKHY....N--VLTLYIIELDPTS.GNR..AS...AR.
C5GFR3_AJEDR/44-218R.RE-NSY----GFVTIQM----DK--V.......WL....QGESR....N--NLTVYIVEYNPGS.NER..AK...TV.
A6RAV9_AJECN/100-274R.TE-NSY----GFVTIQM----DK--A.......WL....HGELR....N--NLSVYLVEYDPAS.KER..AK...TV.
C5PCW4_COCP7/75-251P.RP-NKI----GFVDIKM----DK--S.......WL....RDKPR....N--NLTLHLINFVANN.EEH..RT...VK.
C4JRR4_UNCRE/96-271R.IP-NKI----GFVTLQM----DK--I.......WL....RDESR....N--NLTLYLLNYDLAT.EDH..SI...KK.
E3Q7V2_COLGM/73-251L.LP-ASQ----GHFAWAA----AG--Y.............NMAPNEALEV--RLFLAITANNGTITGRH..........
C9SEG2_VERA1/74-242P.IV-ASE----GFYAWTI----SE--T.............DPKRW....K--QMDVQLYLVYENG.TSARNRI......
E3Q9B7_COLGM/100-269N.LN-GGD----GWLPWTP----RV--K.......DL....EGRKS....N--NMTIFLVYSDPLTGREM..NK......
C7YI59_NECH7/103-283Q.VP-AAF----GFWPFNV----KD--S.......YR....KFGGD....H--NISITLYSQRNHTAEKK..........
E9EC26_METAQ/105-276KSVP-AKW----GYFPFAV----DG--K.......YL....KGQKH...TN--NVTITLMGHDTEN.SIAYNNK......
F0X8Q1_GROCL/88-255T.ID-ASQ----GFYVWTI----ES--S.......FL....TTLGA....S--SVDATIYASYTDT.SNNAERA......
Q2HEH3_CHAGB/51-243T.IS-ALW----GFYQWHP----EG--S.......LL....SRPSV....D--QANITLRLVALPANGQA..AQ...WH.
B2AB99_PODAN/55-252E.IS-CAW----GFYQWSI----TQ--DLINANPLWNEKPGNKAKHFKQNT--PTTITLRMAALPEDGSP..AE...WH.
E3QIV8_COLGM/98-275T.NP-AAW----GYYAWNV----DG--S.......LI....PSGQD....N--ATIELVMSYTIDNIAQT..DI......
F0XN07_GROCL/70-257T.LA-AGW----SFYAWSV----DA--S.......LL....KGAGS....A--GVNVSLSMVYLTG.SSSQANTSASVSS

PF10342

Q5B872_EMENI/24-116D-VP.SAD....ESHTVQI....PC..D-------------TNPEW....G..YQLSAI.NGTNV....YIIYA------
Q5B820_EMENI/22-115D-VD.TSE....GSYTVDG....VS..G-------------LENGG....G..YQINLFSNSGHN....TGILA------
Q5B5Y1_EMENI/34-126N-IG.NS.....GHYEWTP....ST..E-------------LEPDV....T.HYGLLLV.VESGPN...KGAYQ------
B8NI76_ASPFN/21-113N-VP.TAD....QSYSVQI....PC..D-------------TNPEW....G..YQISAI.NGTNV....YIIYA------
E3Q5K2_COLGM/21-113N-IE.TSA....GAVSVDV....PC..S-------------ASNSY....G..YQFNAI.NGTNV....YVIYA------
Q2UIS7_ASPOR/22-115D-VD.SSK....GSYDVSG....LS..D-------------LTNGK....G..YQINFLSNSAKN....SGILA------
B8N4F3_ASPFN/22-112N-VK.TSD....GKYTIDS....IW..D-------------IETGT....G..YQFNFISNSTKN....TGILA------
A2RAR3_ASPNC/34-123D-ID.NS.....GSYSWTP....ST..T-------------LEPDT....T.HYGILLV.VEGT......GQYQ------
B8MDX6_TALSN/31-120A-IK.NT.....GSYEWDV....PS..N-------------IPKES....D..YFIRIS.SDADS.....SIVN------
B6QM89_PENMQ/27-116S-IT.NI.....GSFVWQV....PF..N-------------IPQQP....N..YFVRIS.DDKDP.....NFVN------
B6H8T2_PENCW/22-115G-ID.TSK....GSYTASG....LK..D-------------VTDGS....G..FQINLISTEAKN....TGILA------
E9EW85_METAR/26-120G-VK.NSA....ESYSWKV....DA..S-------------LGDKA....V..YGLVIR.YESDP.....TIFQ------
A7EGI4_SCLS1/28-121S-IN.NLD....GQYKWTV....PA..S-------------VGSFE....T..YGIAII.LDSDV.....NTFQ------
Q0D1Y4_ASPTN/25-114G-IA.NS.....GHYTWTP....PA..N-------------LAAQP....D..YTIEII.DDSDT.....SEVN------
B6HCY9_PENCW/34-123S-IP.NS.....GEFKWTP....GS..D-------------LEADT....T.HYGLLLV.VEGT......GQYQ------
B6HHI6_PENCW/26-115S-IA.N.D....GSYTWDV....PS..N-------------LAAQP....D..YTIRIV.SDDDS.....NDYN------
A2QKG4_ASPNC/25-128L-AK.NALFAKGNSVTFKI....DS..E-------------VGGND....ANAYFLRIAASGPDA.....SVVN------
Q0CR38_ASPTN/36-125G-IP.NT.....GSYKWTP....GT..E-------------LEPDT....T.HYGLLLV.VEGT......GQYQ------
A2QVV0_ASPNC/26-118N-VK.TSD....SKYTVDK....VV..G-------------IPVAN....G..YQLNAESNTTHN....TGILS------
C1H4S8_PARBA/33-122S-VS.NT.....GTYIWTP....PT..S-------------LEGDE...SG..YGIQIV.VEGT......GQYQ------
Q7S2L6_NEUCR/26-121G-VD.SSK....GSYKWMV....DA..H-------------LGKAN....T..YGIQIT.LESNE.....KVFQ------
B8N159_ASPFN/34-123Q-IP.NN.....GKFEWTP....ST..S-------------LEADV....T.HYGLLLV.VEGT......GQYQ------
D5GFD8_TUBMM/26-114G-AD.NS.....GSYSWTV....PK..D-------------TPSGA....N..YAIQIG.DDKT......TDVN------
A1CRU4_ASPCL/33-122A-IP.NS.....GHFVWTP....ST..K-------------LDDDV....T.HYGLLLV.VEGT......GQYQ------
D5GM66_TUBMM/42-127E-IP.NS.....GSYDWTP....SE..S-------------LPVGD....D..YSIQII.SGSAS........N------
F2PZN6_TRIEC/32-120G-IP.NS.....GSLPWTP....EA..D-------------LVDDN....A..YGLLIV.VEGT......GEYQ------
Q0CHH6_ASPTN/24-127D-VAFARG....NSVSFKI....DP..A-------------LGADVP..EA..YFLKMV.SSGPD....AFTIN------
C5FT49_ARTOC/32-121S-IE.NT.....GSFSWTP....PT..D-------------LENDH....T.HYGIQII.VEGT......GQYQ------
B2AAC8_PODAN/29-122G-VD.SAE....GTYSWDV....PA..D-------------LGSAV....V..YGIRID.SETNS.....TRFQ------
Q2H7L4_CHAGB/21-113E-ID.LSA....GSFKVSE.....K..D-------------VPSDG....G..YQFNFESTETQN....TGILA------
Q7SAW7_NEUCR/22-114A-VD.LTK....GSVIISE.....K..D-------------VPNDS....D..FQFNFQSVDPLN....QGILA------
C5FWV4_ARTOC/24-110S-AT.G......GRYTFTP....ST..S-------------LVNGP....D..YALQIS.QGGEI........N------
A2R6F8_ASPNC/22-109N-VK.TST....GEYTTQP....NP..S-------------ISNGS....D..YEIEII.DSSGE.......LA------
E4UYI9_ARTGP/25-109S-AT.G......GSYTFTP....ST..S-------------LVSGT....D..YALQIS.QGSEI........N------
A1CAW6_ASPCL/34-123G-IP.NS.....GSFSWTP....SS..T-------------LEPDT....S.QYGLLLV.VEGT......GQYQ------
A1CSI8_ASPCL/24-127L-IR.DGMFARGNSVSFKI....DPHFG-------------GSQTN....A..YFLKMV.SFGPE....AFAIN------
B8NC02_ASPFN/24-127L-IK.DGVFARGNSVSFKI....DPAVG-------------GNEPN....A..YFLKMVASGPDA.....HVIN------
Q5KDL8_CRYNJ/23-123N-QS.TGDTGTTNSATVTY....PD..G-------------AWPTG...VA..FQINLVSTDAKN....SGILA------
Q6C361_YARLI/23-112G-LD.NR.....GAVRWLV....PS..D-------------LPDGD....N..YALRIN.PVENA.....DDVN------
B6GZR8_PENCW/21-113D-ID.SSK....GSYTVNA....KTFTG-------------VDDGK....G..YQINFL.SPTS......GILA------
F2PGU7_TRIEC/23-112H-LE.NS.....GAYTFLP....SS..D-------------LTQGG....K..YTIQIL.DDSDP.....NQYN------
A7EUB0_SCLS1/23-127T-VSMGST....LTTTVTV....PA..T-------------SGESV....TNAYFMRMIATAKAG....GTVTV------
A5DZ86_LODEL/24-129Q-EK.LSS....KSQTINI....DS..T-------------DVPNG....Y..YYFQIYTVFTNG....ADTIH------
E3Q6D6_COLGM/28-123G-IP.NSA....KAYTWAI....PS..N-------------LGKDA....F..YGLVIK.SEANP....SVDFQ------
E4V0G9_ARTGP/32-120G-IP.NT.....GSLPWTP....ST..S-------------LVGDS....A..YGLLIV.VEGT......GEYQ------
C5MA15_CANTT/26-134S-QT.IDS....HETTVKI....DN..T-------------LVPNG....Y..YYFQIYTVFNSG....GVTIH------
C1H1P3_PARBA/23-108S-...GKG....GSFTWTP....DS..D-------------LANGN....N..YALQIS.QGTDV........N------
D4AQH0_ARTBC/23-112H-LE.NT.....GTFTFLP....PP..D-------------LMQNG....L..YTVQII.DDNDP.....SKYN------
C7YHH8_NECH7/28-122G-VS.NDA....EAYSWAV....DA..S-------------LGDKN....V..YGLVIK.LESNP.....EVFQ------
C4Y066_CLAL4/23-125S-LS.GSE....TGYELSI....KA..S-------------DVPNG....E..YFVQVFAKVKNG....YTIH.------
B6QKW0_PENMQ/38-129Q-VP.NS.....GEFTWTP.....S..G-------------LEPSATSAGG..YGIMLI.DYATE......AYQ------
C0SAH3_PARBP/23-126G-RS.FGQ...GNSVSVPV....PA..N-------------IGGNEP..NA..YFLQMIIHIPQD.....PQPV------
D5G4J1_TUBMM/33-122M-AP.NT.....GTYTWTP....AT..D-------------LEADV....S.RYGIQLI.DDAT......GKYQ------
B6K4G1_SCHJY/20-108G-VT.NS.....GTYAWNV....PN..Y-------------YPTAD....D..YLIQIS.ADGVE.......SS------
Q6C605_YARLI/30-115G-QA.N.D....GKFTWPV....PY..D-------------LEAGS....D..YSIEIT.TFNGD......NVN------
C9SIL5_VERA1/23-107G-ES.G......ESFTWSV....PT..T-------------LVS.G....Q..YAFEIN.DGTEP........N------
B6H0V5_PENCW/27-112Q-A..KG.....GTFTWTP....DD..S-------------VKKAD....T..YAFQIK.QKDQT........N------
D4AU53_ARTBC/24-118N-PV...Q....TTAEVDP....NA..G-------------SEYPN....G..YFLEAVLNGMQG.........------
B2AYJ8_PODAN/22-108T-TS.GAS....GSFTYTP....TD..S-------------LN..G....D..YAFVIE.DESED......PRN------
ADG2_SCHPO/23-113T-IN.TFD....ENATFPA.....L..D-------------LSPGY....G..YQISFT.SIRDD....SVIYA------
Q4PEA8_USTMA/91-187A-LL.TAN....GTAQIFI....DR...-------------IP.SG....T..YSLLFV.NSSNYELDRPQVYY------
B6K5U7_SCHJY/24-125G-IS.PG.....TTTTFTSGEIDPA..K-------------GPSGK....Y..YFITAK.TTYQN....ADVYY------
F2PGP2_TRIEC/26-109G-VT.GF......SCIFTL....PP..S-------------LPSGS....D..YALKLS.QGDEV........N------
F4R679_MELLP/25-115Y-VK.ASL....ESYTVTN....VT...-------------LLVGD....G..YQVQMV.NSTNA....TQVYA------
J9MCN7_FUSO4/29-122G-ID.NDA....ASYSWAI....DS..T-------------LGTEN....V..YGLVLK.LESNP.....EVFQ------
YA880_ASPFU/20-112N-VK.TSE....GSYTIDG....VS...-------------ADNGS....G..YQINFVSRDPQN....TGILA------
Q4X259_ASPFU/23-126L-IK.NGLFTRGNSVSIRI....DP..G-------------VGGNEA..NA..YFLKMV.ASGPE....AFAIN------
W1QB36_OGAPD/25-129S-IT.LSDL.DDDTYQASV....AA..S-------------VGADG....Y..YYVQIYADYGSE....SYTIH------

PF14610

Q6C7P0_YARLI/176-370......NSTFVRFRRGAIVQKKD...........KGRLDLDK..................NEEGMMITIITIPSVVVIFA
Q6BJD6_DEBHA/186-420......DAVIVEIIKGAVVSKGQFA.........DLKKLEEK....WKNDGMN.VEYEDSSPYEKYYIMMAVPSCVALFG
C5M6D3_CANTT/179-426......NSIVIEIWKGVKVGKGHLE.........DLKRLEEK....YANRHIYDIEVEEGINFDEYMMMIALPTCVVLAA
Q5AM42_CANAL/183-415......NSIVVEIWKGVKVSKDHLT.........DLKKLEEK....YANRHMHDIEVEEGVDFEKYMIMMGLPTCVLIAG
A5DUS0_LODEL/182-440......NSIVVEFWKGSKVGKEDLL.........DLKKLEEK.....YANRHMQIEVEEGIDYEKYIVMITLPMCVVIAA
C4Y8N7_CLAL4/171-410......NFVVVEIAKGAKVAKGHLE.........DIKKQEER..ERLKAELGDDYVVEEGIDYEKYMVMMSLPLCVLVAA
A5DPS3_PICGU/179-400......NFIVIEIAKGAKVGKEHLL.........DLKKLEEK....WDKADIDGV.YDEGPNMEKYLIMMTMPTCVAIAG
A3LTE4_PICST/172-410......HSLVIEISKGSKVSKEHLV.........DLKKLEEK......YNNPGYEVLDEGVDFEKYYVMMTMPTCVILAA
M9N441_ASHG1/138-340......HGILVRLALPNRVFKAGKQ.........DLKMLDSG.................MTDETWYYLLLTLPTIVVFVA
A7TP99_VANPO/141-347......YGIFVYILLQSRVYKHSKE.........QIALENAG.................LTGTKWYYIALSMPAAVAVAL
C5E3Y8_ZYGRC/144-350......HGVFVYLDEGSRVYKQTNK.........ELALNDAG.................ITDDKWYYVVVSIPTAVIVAL
C5DCM9_LACTC/172-377......HYVLFRMIMGPRVAKTTKQ.........QKALQDAG.................ISDDTWYYVALSIPTVVVIAC
Q6CII5_KLULA/141-345......HGVVINIILGSKVFKTTKE.........QLALEDQG.................ITDDTWYYVAMTIPTAVLFAV
A0A023ZDK8_YEASX/143-348......YGILLYITKGSKVFKPTKE.........QLALDDAG.................ITNDQWYYVALSIPTVVVVFF
Q6FL99_CANGA/140-343......HGVLLYLIKGTKVAKKTKD.........ELRLEDAG.................ISDDTWYYVALTIPTLVVVAL
C4QW75_PICPG/183-411......SGVMVQFAKGAVVSKTTKQ.........DMAIQESP.................RTGDDMYYIIMTMPTVVVLAV
W1Q7J0_OGAPD/172-397......AHVVVHFQKRAVVAKNSKL.........DKELQDRT.................GSNDNVYYVIMSVPTVVIIAV
Q6CIA6_YARLI/116-315......SGPIVRAIMSKNDGITTVSRLPSENSLQPGKKHSGG.................GIGKGGIAAAVVVPVVVVILL
W1QBS4_OGAPD/90-284......YGPLIRIIEHESDAYTTITR........KPSDNGAT..................TTSSKSKAKIIVPAVVVPVV
C4QWF6_PICPG/111-306......SGPLVRILTSKSEADFAISRVPS.....DNGLSKSK...............GSSNNAKVIAPAVAIPVVVLIFV
W1QAS6_OGAPD/112-323......KGPAVKLVSSQGSIERVPSDNGS.....SSSSSSSTTSSSTSTATSTSKSSSHKSKASVIAPAVVVPVVVVGLV
Q6BZL9_DEBHA/112-314......IGPVVRLISSKGDAYTKISRVPSDNNDENDSSDKKD.............DGGSSNKAKIIVPAVVVPVFSIFLI
B6K6T0_SCHJY/56-228......TGPTVNLASALTEEEKAAE.........DAALYGHK...................RNLKAAIIVPAIFLVIILA
YJH4_SCHPO/59-231......TGPRILLAKDLDSATAAAE.........NAAFYGPR.....................RNIKAAIAVPSVILGLI
Q7S5T5_NEUCR/122-331......QGPLVYVTNGYQSDDVD...........DDDDNDDG............LVGDPGDLSKGKKIAISVPVAIVSLL
B6JVR8_SCHJY/5-173......LGPTVLLAETFYFVWYVET.........SPAFQQNN...................MDKGIAIGLSVALLGCVGI
YOSH_SCHPO/1-172......VGPQVLLANTFYWKMVVDV.........SPAFSVN...................PIDKKLAIGLSVGLSCCILI
C9SDE3_VERA1/93-290......TGPTITLLPARANIPEEHSDDDDDDDDDDDDDDDDK.................NGGPNVLAIVLPLVFAVLAIA
D5GJC4_TUBMM/82-276......TGPTIILTSRPSPAPID...........KSPSNRPP..................VSILGLAVGLPVVFVFVVGT
F2SX36_TRIRC/94-268......NGPTISLVNKPPVHH.............PPPPPTPT..................PKPLGLLIGLPLGLGAVFLI
C5FUR6_ARTOC/94-268......IGPTISLVNKPPMHY.............PPPPPTPA..................PKPLGLLIGLPLGLGAVVLI
Q0CZH9_ASPTN/60-232......QGPTIMLHPKAVEHY.............QPPPPLP...................MNKLALYVGLPLSLAVVVLV
A2QJ97_ASPNC/58-230......RGPTVVLHPKPVQHL.............LSPPPTS...................FNKLALYIGLPVSLSVVILV
B8N0W6_ASPFN/54-226......KGPRITLHPKPVEHY.............KPSPPMT...................FNKRALFIGLPVSLSVIIVV
A1CWS2_NEOFI/48-220......QGPTVILHPKPVEHY.............KPSPQTP...................FNRTALLIGLPVSLGVVIAV
A1CHY8_ASPCL/61-233......QGPTVVLHPRPVEHY.............KPPPQIP...................FNKKALYVGLPVSLGVVIAV
C5GFR3_AJEDR/44-218......AGPMISLINKPGKHH.............PPPPPTPV..................PDKAGLTIGLPVALGVFFLI
A6RAV9_AJECN/100-274......AGPIISLTNKPGKHY.............PPPPPTAV..................PNKLGLMIGLPVALGVIFVV
C5PCW4_COCP7/75-251......IGPTFSLTKKPVQHY.............PPPPPSK...................PNKLGLMVGLPVALVVVFFI
C4JRR4_UNCRE/96-271......AGPMISLTKKPVQHY.............PPPPPSK...................PNKLGLAVGLPISLAVVFII
E3Q7V2_COLGM/73-251......GGPRVRVVNRSRK...............DSGERGRG.................RRGPNVLAIVLPLVLGGLALG
C9SEG2_VERA1/74-242......SGPKLSI.....................TPPKQKSS....................FQLSFVILPVSFICLALM
E3Q9B7_COLGM/100-269......TGPVFTLQA...................ALGTEAFS..................TRPDLLPILLPVILISLAIA
C7YI59_NECH7/103-283......KASTIYLNVASPQ...............LPAHKEPK.................VPHGQTLVIALPVVLGSIFLL
E9EC26_METAQ/105-276......SIPLPVVVSGPPL...............DPTAPSNA..................PKGKTLTIALPVTLGVIALI
F0X8Q1_GROCL/88-255......TGPAVVITS...................AKHSLSSG..................HHVSALAVALPVVLGLAAIV
Q2HEH3_CHAGB/51-243......SGPTVNLRWKPKAPKK............KKPGHTPT.................RADDDVLYVALPLVFGFAAIM
B2AB99_PODAN/55-252......QGPTVQIVKPKKGPN.............KSDGKRHP..................ADDQVLYVALPTVAFFLMAI
E3QIV8_COLGM/98-275......TGPRVLVVKRPQFHP.............QPTKI.....................PKGAELYIALPTVFGLIVIA
F0XN07_GROCL/70-257SQSAVVQGPVVTVAKPSA................ALPELTKA..................PTGPALYIGLPAVFGFIIVV

PF10342

Q5B872_EMENI/24-116------QGERFTV-------------------------------------------------------------------
Q5B820_EMENI/22-115------QSEQFNV-------------------------------------------------------------------
Q5B5Y1_EMENI/34-126------WSTQFGI-------------------------------------------------------------------
B8NI76_ASPFN/21-113------QGDRFTV-------------------------------------------------------------------
E3Q5K2_COLGM/21-113------QTPKFSI-------------------------------------------------------------------
Q2UIS7_ASPOR/22-115------QSQQFNV-------------------------------------------------------------------
B8N4F3_ASPFN/22-112------QSQIFNV-------------------------------------------------------------------
A2RAR3_ASPNC/34-123------YSVQFGI-------------------------------------------------------------------
B8MDX6_TALSN/31-120------YSARFDI-------------------------------------------------------------------
B6QM89_PENMQ/27-116------YSPRFAI-------------------------------------------------------------------
B6H8T2_PENCW/22-115------QSEQFDV-------------------------------------------------------------------
E9EW85_METAR/26-120------YSNPFHI-------------------------------------------------------------------
A7EGI4_SCLS1/28-121------WSFPFKI-------------------------------------------------------------------
Q0D1Y4_ASPTN/25-114------YLPRFTV-------------------------------------------------------------------
B6HCY9_PENCW/34-123------YSTQFGI-------------------------------------------------------------------
B6HHI6_PENCW/26-115------YIGRFTV-------------------------------------------------------------------
A2QKG4_ASPNC/25-128------YSDRFTL-------------------------------------------------------------------
Q0CR38_ASPTN/36-125------WSTQFGI-------------------------------------------------------------------
A2QVV0_ASPNC/26-118------QSQQFNV-------------------------------------------------------------------
C1H4S8_PARBA/33-122------YSTQFGI-------------------------------------------------------------------
Q7S2L6_NEUCR/26-121------YSFPFHI-------------------------------------------------------------------
B8N159_ASPFN/34-123------YSTQFGI-------------------------------------------------------------------
D5GFD8_TUBMM/26-114------YTPLLTV-------------------------------------------------------------------
A1CRU4_ASPCL/33-122------WSTQFGV-------------------------------------------------------------------
D5GM66_TUBMM/42-127------YSPKFGI-------------------------------------------------------------------
F2PZN6_TRIEC/32-120------YSTQFGV-------------------------------------------------------------------
Q0CHH6_ASPTN/24-127------YSHRFSI-------------------------------------------------------------------
C5FT49_ARTOC/32-121------YSTQFGV-------------------------------------------------------------------
B2AAC8_PODAN/29-122------WGNPFTI-------------------------------------------------------------------
Q2H7L4_CHAGB/21-113------QSEQFEV-------------------------------------------------------------------
Q7SAW7_NEUCR/22-114------QSEQFEV-------------------------------------------------------------------
C5FWV4_ARTOC/24-110------YTGLFTI-------------------------------------------------------------------
A2R6F8_ASPNC/22-109------VSPTFTV-------------------------------------------------------------------
E4UYI9_ARTGP/25-109------YTGLFTI-------------------------------------------------------------------
A1CAW6_ASPCL/34-123------YSTQFGV-------------------------------------------------------------------
A1CSI8_ASPCL/24-127------FSERFTL-------------------------------------------------------------------
B8NC02_ASPFN/24-127------FSDRFTL-------------------------------------------------------------------
Q5KDL8_CRYNJ/23-123------QSEQFNI-------------------------------------------------------------------
Q6C361_YARLI/23-112------YTGQFKI-------------------------------------------------------------------
B6GZR8_PENCW/21-113------QSQQFRV-------------------------------------------------------------------
F2PGU7_TRIEC/23-112------FTPTFMV-------------------------------------------------------------------
A7EUB0_SCLS1/23-127------YSDRFSI-------------------------------------------------------------------
A5DZ86_LODEL/24-129------YSPRFKL-------------------------------------------------------------------
E3Q6D6_COLGM/28-123------YSNPFHI-------------------------------------------------------------------
E4V0G9_ARTGP/32-120------YSTNFGI-------------------------------------------------------------------
C5MA15_CANTT/26-134------YSPRFKL-------------------------------------------------------------------
C1H1P3_PARBA/23-108------YGSLFSI-------------------------------------------------------------------
D4AQH0_ARTBC/23-112------FTPSFMV-------------------------------------------------------------------
C7YHH8_NECH7/28-122------YSNPFKI-------------------------------------------------------------------
C4Y066_CLAL4/23-125------YTNRFKL-------------------------------------------------------------------
B6QKW0_PENMQ/38-129------YTTQFGV-------------------------------------------------------------------
C0SAH3_PARBP/23-126------NSQRFTL-------------------------------------------------------------------
D5G4J1_TUBMM/33-122------YTTQFGV-------------------------------------------------------------------
B6K4G1_SCHJY/20-108------YSKYFTL-------------------------------------------------------------------
Q6C605_YARLI/30-115------YSPNFTI-------------------------------------------------------------------
C9SIL5_VERA1/23-107------YSVQFPL-------------------------------------------------------------------
B6H0V5_PENCW/27-112------YTALLKG-------------------------------------------------------------------
D4AU53_ARTBC/24-118------YSYRFTL-------------------------------------------------------------------
B2AYJ8_PODAN/22-108------FSPAFPL-------------------------------------------------------------------
ADG2_SCHPO/23-113------QSGTFYI-------------------------------------------------------------------
Q4PEA8_USTMA/91-187------TSSSFEV-------------------------------------------------------------------
B6K5U7_SCHJY/24-125------YSDYFTI-------------------------------------------------------------------
F2PGP2_TRIEC/26-109------YTGLFTV-------------------------------------------------------------------
F4R679_MELLP/25-115------SSGTFSV-------------------------------------------------------------------
J9MCN7_FUSO4/29-122------YSFPFKI-------------------------------------------------------------------
YA880_ASPFU/20-112------QSQQFKV-------------------------------------------------------------------
Q4X259_ASPFU/23-126------FSNRFTL-------------------------------------------------------------------
W1QB36_OGAPD/25-129------YTDRFKL-------------------------------------------------------------------

PF14610

Q6C7P0_YARLI/176-370CIYVLF...TQITAG...ARAIP
Q6BJD6_DEBHA/186-420LGMYIF...VMINNK...NIDLS
C5M6D3_CANTT/179-426LGMWLF.....VRIN...KIDLS
Q5AM42_CANAL/183-415FGMWLF.....VTIN...KIDLS
A5DUS0_LODEL/182-440FGMWLF.....VTIN...RVDLS
C4Y8N7_CLAL4/171-410FGMYLF...VLLNKR...NTDLS
A5DPS3_PICGU/179-400LLMYFF...VMVNKK...NTDLS
A3LTE4_PICST/172-410FLMYIF.....VYMN...KVDLS
M9N441_ASHG1/138-340ALVYFF...LQWNRR...YTDFS
A7TP99_VANPO/141-347FCMYVF...LRINKG...NREFS
C5E3Y8_ZYGRC/144-350VLMYFF...IIANRR...YSDFS
C5DCM9_LACTC/172-377VAMYFF...LYLNRS...HRDIH
Q6CII5_KLULA/141-345VFMYFF...VQLNAR...YRDFS
A0A023ZDK8_YEASX/143-348VFMYFF...LYVNGK...NRDFT
Q6FL99_CANGA/140-343VFMYFF...LYLNKG...NRDFS
C4QW75_PICPG/183-411CFMYLF...LYLKRN...QRDVS
W1Q7J0_OGAPD/172-397FGMYVF...LYINRK...HRDLS
Q6CIA6_YARLI/116-315SGLGFL.....YYRQKKTKQQQM
W1QBS4_OGAPD/90-284VLGFLIAGIVWYFRRMHGKTSLA
C4QWF6_PICPG/111-306GFGVYW....YINKQ..KKQGLN
W1QAS6_OGAPD/112-323GGIAAY...IFMARN...RRKVK
Q6BZL9_DEBHA/112-314AGAVFY...YLLKKR...KNAIN
B6K6T0_SCHJY/56-228ACIYHA.....HTKD...TWRYW
YJH4_SCHPO/59-231LVALVY....YAYRK..DTWKIY
Q7S5T5_NEUCR/122-331VLGGLFAFAVWGYRK...KGAVP
B6JVR8_SCHJY/5-173VLAIHF.....TTQH...LRKIR
YOSH_SCHPO/1-172VLFLHF.....ATRR...ERRIL
C9SDE3_VERA1/93-290GLAAFC.....LFRR...KRRGA
D5GJC4_TUBMM/82-276ILSLHF.....CMKS...KRTVG
F2SX36_TRIRC/94-268LLGLCF.....GMKH...QRRIG
C5FUR6_ARTOC/94-268LLGLCI.....GMKQ...HRRIG
Q0CZH9_ASPTN/60-232VAGLFF.....GMRD...SRRVA
A2QJ97_ASPNC/58-230VAGLYF.....GMRE...SRRID
B8N0W6_ASPFN/54-226VAGLFF.....GMRE...SRRIG
A1CWS2_NEOFI/48-220VVGLAF.....GMRK...SRKTS
A1CHY8_ASPCL/61-233VAGLFF.....GMRR...SRSIG
C5GFR3_AJEDR/44-218LLGLCF.....GMRK...SRRIG
A6RAV9_AJECN/100-274LLGLYF.....GMKK...NRRIG
C5PCW4_COCP7/75-251ACGLCI.....GMRK...HRRIG
C4JRR4_UNCRE/96-271ACGLCI.....GMRK...HRRIG
E3Q7V2_COLGM/73-251GIGWFV....WWYGR...RRGMF
C9SEG2_VERA1/74-242VAAVFV....TVRIR...KRRAA
E3Q9B7_COLGM/100-269TVMLWL.....YIRR...HRRHA
C7YI59_NECH7/103-283LIGVCL.....WNRK...TRRIG
E9EC26_METAQ/105-276LVGGCL.....WNRK...TRRIE
F0X8Q1_GROCL/88-255LLCFCA....WSWRR...YGRVL
Q2HEH3_CHAGB/51-243IAGTFC.....WNRQ...LRRIG
B2AB99_PODAN/55-252VMSTLC.....CNRG...VRRID
E3QIV8_COLGM/98-275VIGGCL.....WNRS...TRKIG
F0XN07_GROCL/70-257LAGTFL.....WNRH...HRHIG

PF10342

Q5B872_EMENI/24-116-----------------------
Q5B820_EMENI/22-115-----------------------
Q5B5Y1_EMENI/34-126-----------------------
B8NI76_ASPFN/21-113-----------------------
E3Q5K2_COLGM/21-113-----------------------
Q2UIS7_ASPOR/22-115-----------------------
B8N4F3_ASPFN/22-112-----------------------
A2RAR3_ASPNC/34-123-----------------------
B8MDX6_TALSN/31-120-----------------------
B6QM89_PENMQ/27-116-----------------------
B6H8T2_PENCW/22-115-----------------------
E9EW85_METAR/26-120-----------------------
A7EGI4_SCLS1/28-121-----------------------
Q0D1Y4_ASPTN/25-114-----------------------
B6HCY9_PENCW/34-123-----------------------
B6HHI6_PENCW/26-115-----------------------
A2QKG4_ASPNC/25-128-----------------------
Q0CR38_ASPTN/36-125-----------------------
A2QVV0_ASPNC/26-118-----------------------
C1H4S8_PARBA/33-122-----------------------
Q7S2L6_NEUCR/26-121-----------------------
B8N159_ASPFN/34-123-----------------------
D5GFD8_TUBMM/26-114-----------------------
A1CRU4_ASPCL/33-122-----------------------
D5GM66_TUBMM/42-127-----------------------
F2PZN6_TRIEC/32-120-----------------------
Q0CHH6_ASPTN/24-127-----------------------
C5FT49_ARTOC/32-121-----------------------
B2AAC8_PODAN/29-122-----------------------
Q2H7L4_CHAGB/21-113-----------------------
Q7SAW7_NEUCR/22-114-----------------------
C5FWV4_ARTOC/24-110-----------------------
A2R6F8_ASPNC/22-109-----------------------
E4UYI9_ARTGP/25-109-----------------------
A1CAW6_ASPCL/34-123-----------------------
A1CSI8_ASPCL/24-127-----------------------
B8NC02_ASPFN/24-127-----------------------
Q5KDL8_CRYNJ/23-123-----------------------
Q6C361_YARLI/23-112-----------------------
B6GZR8_PENCW/21-113-----------------------
F2PGU7_TRIEC/23-112-----------------------
A7EUB0_SCLS1/23-127-----------------------
A5DZ86_LODEL/24-129-----------------------
E3Q6D6_COLGM/28-123-----------------------
E4V0G9_ARTGP/32-120-----------------------
C5MA15_CANTT/26-134-----------------------
C1H1P3_PARBA/23-108-----------------------
D4AQH0_ARTBC/23-112-----------------------
C7YHH8_NECH7/28-122-----------------------
C4Y066_CLAL4/23-125-----------------------
B6QKW0_PENMQ/38-129-----------------------
C0SAH3_PARBP/23-126-----------------------
D5G4J1_TUBMM/33-122-----------------------
B6K4G1_SCHJY/20-108-----------------------
Q6C605_YARLI/30-115-----------------------
C9SIL5_VERA1/23-107-----------------------
B6H0V5_PENCW/27-112-----------------------
D4AU53_ARTBC/24-118-----------------------
B2AYJ8_PODAN/22-108-----------------------
ADG2_SCHPO/23-113-----------------------
Q4PEA8_USTMA/91-187-----------------------
B6K5U7_SCHJY/24-125-----------------------
F2PGP2_TRIEC/26-109-----------------------
F4R679_MELLP/25-115-----------------------
J9MCN7_FUSO4/29-122-----------------------
YA880_ASPFU/20-112-----------------------
Q4X259_ASPFU/23-126-----------------------
W1QB36_OGAPD/25-129-----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window