Sequence alignment for CL0538

PF14610

E7KR15_YEASL/143-348DDTYVSLNPIVRCTPNLYFNKGL.AKDIRSEP.FCTPYEN-SRWKVD---K.TYFVTWYTRFFTD...ENSGKVADKVRV
F2SX36_TRIRC/36-210ELTGDKPKEAQAC...SSEKD......LSIKP.FCSPHDQ-QEVYVD---D.TYYVTWLTSLV.........GSDSVVRV
G4UZV9_NEUT9/108-328AGVTDPRGDFLACLPQQ..........SLDEP.FCAPKRD-AILRPG---H.GYYITWNTLYF........ALPNQRVQI
F7VWB3_SORMK/105-312SGVADPRGEFLACLPQQ..........SRDEP.FCAPKRD-AILKPN---R.GYYITWNTLYF........GSPNQRVQI
F7VVQ9_SORMK/107-312QWNIT..GDYLACENVVQSLD.....DDDDKPLFCIPKRD-TVLRPG---K.GYYIVWDPSYF.......AEPAKETVGV
G2RFM8_THITE/101-302PTNDNGTAAFPPC....SNTD......GEFKP.FCRPKHN-DVYHPD---T.THYITWDTSIF.......SAPNSTTVKI
Q2HEH3_CHAGB/51-243PTNELGASAFSPC....SNTD......GEFKP.FCLPKQH-DIFYPG---A.TPYVTWDTTFF.......PDPNNTLVKV
G0SBV9_CHATD/37-238PKNEHRKDDFAAC....RNLD......GEFAP.FCLPRHG-DVYAWD---T.THYITWDPDYF........PTANTSLRL
B2AB99_PODAN/55-252DTTKLAGHEFAVC....HNLD......GDYKP.FCLPKHN-ETFNPG---V.LKYITWDPAFFSKG..HTHEKANHTVKI
Q7SHQ4_NEUCR/102-274FEKT.GSGAFEQC....HNKD......GPYAP.FCEPSHG-QNISIN---T.DQHITWDPEYF.........GHNTSIKI
K0KVS1_WICCF/158-358DQTYVSLNPLIRCTPDRYYKKGL.AKNIESAP.FCTPKEG-SQLKLG---K.TYFITWFSRFYP.....NS...VEKVRI
Q6BJD6_DEBHA/186-420DPTYHELNPIIRCTPDRYFKRGM.GKHVNSEP.FCTPHEN-QQLKMD---K.TYFITWFSRYF.........KDAKKVRV
G8YQZ0_PICSO/169-402DDPYARLNPVMRCTPDSYFKKGM.GKDVSSEP.FCTPHDN-QALKMD---E.TYFVTWYSKFF..........KSNNVKI
C5M6D3_CANTT/179-426DLETHLLSPLIRCTPDRYKKKGI.GRDKSTAP.FCTPKDN-SRLTMG---K.VYFITWYSRFF.......D.EDVKNVRI
M3HTK0_CANMX/180-423DLDTHLLSPLIRCTPDRYKKKGI.GRDKSTEP.ICTPKDN-AQLKMD---K.TYFITWYSRFF.......D.ANVKNVKI
Q5ALP3_CANAL/183-415DLENHLLSPIIRCTPDRYKKKGI.GRDKTTEP.FCTPKDD-ARLTKD---K.TYFVTWYSRFF.......DEKKVDKVRI
A5DUS0_LODEL/182-440DLEDHLLNPIIRCTPERYQKKGI.GRDKSTEP.FCTPKDD-VRLVMD---K.TYFITWYSRFF.......D.PEVEKVRI
G8BE66_CANPC/178-417DLEDHLLNPIIRCTPDRYKKKGI.AKDVLTEP.FCTPEDD-VRLILD---K.THFITWYSRYF.......A.PEVKKVRI
G3ALN4_SPAPN/171-413DQTNHKLSPLIRCTPDRYKKKGI.ARDKSTEP.FCTPKDD-VRLIKD---K.TYFVTWYSRFF.......N.KEVKNVKI
C4Y8N7_CLAL4/171-410DLTYKMLNPIIRCTPEFYKKKGM.AKDKSSEP.FCFPSDN-SNWKAD---K.TYFVTWYHRFF.......D.DEVKNVRL
G3BDP8_CANTC/194-413DQTYHELNPIIRCTPDSYFKKGL.SKDTSSAP.FCFPFDN-QVWYRD---K.TYFVTWYSHYF.........EGAEKVRL
A3LTE4_PICST/172-410DPYEHSLNPIIRCTPDLYRKKGV.AKDQSSEP.FCFPHDN-QQWKKE---Q.TYFITWYSRFF.......D.DEVENVKV
A5DPS3_PICGU/179-400DQTYHSLNPLIRCTPDYYKLKGV.AKDQSPEP.FCFPQDS-AQLKQE---K.TYFVTWFSRFF.......A.PEVKNVKL
W1Q7J0_OGAPD/172-397DETYVALNPLMRCTPDFYYKKGV.ARELSSEP.FCSPHEN-QKLFVG---K.TYFLTWFTRYFE......D...ATNVRI
C4QW75_PICPG/183-411DQTYVSLNPLIRCTPQFYHKKGL.AKHESSEP.ICFPHED-QKIKLG---K.VHFLSWYTHYFTEGDDDQEQTVVEKVKI
C5DCM9_LACTC/172-377DDTYVSLNPIIRCTPDRYFKKGP.AGDISSEP.FCTPKEN-KELKVD---N.TYFVSWYTKFFQK...PDTDETIENVQL
I2H836_TETBL/144-352DPTYVSLNPIIRCTPDRFFHKGL.AREIISDP.FCTPREN-VEWEIG---K.TYFITWYTHSLID...ESTDIVSPQARI
G8C1B3_TETPH/142-354DGTYVNLNPIIRCVPDRYFEKGK.AKNDKSAP.FCTPHEN-NELKVD---N.TYFLTWYTRFFLD...PNTNKYADKVKI
A7TP99_VANPO/141-347DDTYLKLNPIIRCAPDRYSEKGL.AKNIKSEP.FCTPREA-TEWRVG---R.TYFVSWFTRFFKN...EDTGKFAEKVRV
J6EF38_SACK1/143-348DDTYVSLNPIIRCTPHNYFFKGF.AKDISSEP.FCTPYHT-SRWKVG---E.TYFVTWYTRFFEH...EHSGEVADEVRV
G8ZQF2_TORDC/141-346DDTYVSLNPVIRCTPDRYFNKGI.SGDIPSEP.FCTPREN-VQWKVG---K.IYFATWYTHFFRD...EHSDEVIDEVRV
Q6FL99_CANGA/140-343DDTYVSLNPVIRCTPNRYVNKK...QDIVEGP.FCTPKEN-SRFKVG---S.TYFVTWFTKFFEE...PTTGKVADKVRL
H2ASP6_KAZAF/140-345DKTYVSLNPIIRCTPERYFMKGS.ANDISSQP.FCTPREN-TSWKVG---K.TYFVSWFTRFFED...EFSGEVVENVRV
G0VJF2_NAUCC/140-345DDTYISLNPIIRCTPDRYFYKGV.AKDIPSEP.FCTPREN-SMWKVG---K.TYFVSWYTRFLED...EHSGEVVDKVRI
J7R9B9_KAZNA/141-346DKTYVSLNPIGRCTPAGYFNKGL.SKDISSEP.FCTPREN-VLWKVD---K.TYFVSWYTHFFRD...ENSDKVIDRVRV
S6EMF2_ZYGB2/143-349DDTYTSLNPLIRCTPQRYFNKGL.TQNVPSDP.FCTPHED-SMWHVG---K.TYFLTWYTHFFKD...EHSNEVADRVRV
C5E3Y8_ZYGRC/144-350DETYTSLNPIVRCTPKRYFNKGH.SKNIPSEP.FCTPHED-SIWNVG---K.TYFLTWYTHFFRD...EHSNEVVERVRI
Q6CII5_KLULA/141-345DLTYLSLNPVIRCTPDRYFNKGL.AKDETSAP.FCTPKEN-ADLKVD---K.TYFVSWFTRFFEN....DDGVKEDEVRV
G8JRZ2_ERECY/140-345DDAYVSLNPIIRCTPERYFHKGD.AKDIPSEP.FCTPMEN-KDWQVG---K.TYFVSWYTRFFRD...EVKESTVEQVRV
Q759Y9_ASHGO/138-340DDTYTSLNPLIRCTPDRYFNKGL.AKDVSSAP.FCTPREH-VDWYAG---Q.TYFITWYTHFFWD...KALDAPAEQARV
G0V7C8_NAUCC/126-332DKTYISLNPIIRCTPERFFNKMAGYNDDTSEP.FCTPHEN-VKWVVG---S.TYFVTWYTRSF.........PDIIKVRI
Q6C7P0_YARLI/176-370DPIEASFNPVERCTPEKFIKVK....KQRVGP.WCSPQYG-KGVMLD---H.VHWFTWYTREF.........PDAEKVRL
B6JVR8_SCHJY/4-173SQLLL...FFVACFSFVTRS.......RAEFT.FLTPSDG-SRWAIS---N.TYSISWDNN...........TDVEFVNL
B6K6T0_SCHJY/56-228TKTKTAPTTVFDCRSASYI........ASDVP.ICKPTDG-VRWVKD---K.SYLIQWDPYYF..........GTENINL
YJH4_SCHPO/59-231TTKGLPTNAYYNCVPSKYI........QSDIP.MCAPNQG-DRWVKG---R.KYKVSWDPLYF..........GVDNLLM
S9VUT8_SCHCR/61-233TYKGLPTDAYYNCHPQKYF........QSNMP.ICFPTPD-SRWVKG---K.PYRVSWDPYYF..........GVDELRL
K0KK07_WICCF/110-307YPSPAAVPPVLRCFGDRVPEDG...NDKYGYP.FCTALNG-TEMIVG---E.TYWITWDPTYW.......GGDDITRVKL
C4QWF6_PICPG/111-305FPTPDAVPPVLRCMNDRVPPD.....NTMAYP.FCVQ.NG-TEFLIG---E.TYWITWDPSYW.......GGDDITRVKL
Q6CIA6_YARLI/116-314YPQSTDTPPVLGCWGDRLPEDN...EKLPGYP.FCSPHNG-TELVAG---E.TYWVTWDPSYW.......GGDDIAQVKL
W1QAS6_OGAPD/112-323YPTPLAAPPVLRCMNERVP........SSSNP.LCIS.NA-TSFVAG---E.TYWITWNPLYWNP...DNDDDGISKVQL
Q6BZL9_DEBHA/112-314FPTPLAAPPVLRCMGDRV.........ADGNP.FCIG.EG-AEFVVD---E.TYWITWDPLYFNP...DNDSEGISKVKI
W1QBS4_OGAPD/90-282PSPTGGAPPVLRCMNERADES......NSGYP.FCIA.NG-TEMLVG---E.TYWITWDPEYW.......GSDDIVRVRL
R4XDW1_TAPDE/79-247RPT..GLPSSLYCQSGYV.........NATGP.FCFPNNG-TQQIKG---K.QYSITWNPDYA.........PKCADVYV
C0NMX3_AJECG/43-218APSDGNGVYPPECHVER..........DSKYP.FCLPKNG-SEVLTE---Q.IYYVTWDSDLF.........PGNSTITI
C4JRR4_UNCRE/96-271PAAQPTDSDVKACH...ADTE......SAIYP.FCEPTNG-QEVYVD---E.SYYVTWDVDAF.........KINSTVQI
C5FUR6_ARTOC/94-268EATGERPKEAQACS...SEND......LSVKP.FCSPHDQ-QEVYAE---DT.YYATWLPSLL.........DPNATVKV
A1CHY8_ASPCL/61-233RNITPTTVDFPIC....TDLK......GPLAP.FCLPEDG-ANVTVD---A.TYYVTWNADFY.........PLNTTITI
Q4WPU1_ASPFU/105-277TDISSFSGDFPIC....TDLN......GPIAP.FCLPKDG-ADVTAD---A.TYYVTWNADFY.........PLNATITI
B8N0W6_ASPFN/54-226QTNNASPDDFPVC....TDID......GPFAP.FCLPQDG-ADVIVD---A.TYYVTWNADFY.........PLNASITI
Q0CZH9_ASPTN/60-232HTGKTSPGEFPMC....TEEN......TPFPP.FCLPHHG-ADVTVD---A.TYYVTWNADFY.........PANAKITI
A2QJ97_ASPNC/58-230RRSSPTPGDFPIC....RDPR......GAARP.FCLPEDG-ANVTVG---G.TYYITWDADFY.........PLNATITI
V5GAK7_BYSSN/48-220TNPRPYAGDFPVC....TEFD......KPYSP.FCLPKDG-SNVTVG---S.TYYVTWNPDYY.........PVNATITI
G1WZ94_ARTOA/154-335SEDGEPTSFLPTCDASRYQGG......GKYAP.FCLPNNE-TNLYLG---E.TYYVTWDPLYWG......EDGGNNTVEI
D5GJC4_TUBMM/82-276SDGDQSDNVVARCDSSKYELGKT.GNVQPWVP.FCAPHNG-TEWWVD---G.NYYVTWNPKHW.........TRNSTVKI
S3D288_GLAL2/86-258LPTATGGGSFEVC....FNMD......KQYAP.FCKPENG-SDVYVG---E.TYYVTWDTRFF........PVKNASVLV
M7UCH7_BOTF1/126-298VPTSTGGGAFEIC....HNLK......GKFAP.FCKPDNG-SSVYVD---E.TYYVTWDTQYF........AGSNNSVFI
L8GC21_PSED2/77-244QQTQAGGSSFDVC....HNKD......GPNAP.FCVPTNG-THLEPG---S.TYYITWDTSAFP.....GNAS....VFV
R8BN65_TOGMI/97-270ATDKAGAGSFSVC....HNKD......GVNAP.FCQPSAN-STLNPG---K.TYYITWDPTFF........SAANTSILV
M7T6A2_EUTLA/72-242TPTGDVSGEFAVC....SNKD......GDRAP.WCFPTEG-AMLVPG---K.TYYFIWDAGYF.........TSNDTIRV
G4N739_MAGO7/92-273GGSN.GQGAFPLCKAAA..........EAKTP.LCLPKDG-SILNPG---I.TYYVTWDPTFL.......KNATNTTVTI
J3NI78_GAGT3/85-259ADANSKAGAFPIC....HNKA......GSGAP.FCFPSPG-SQVHPE---T.TYYITWDPAFF........PSSNTTIVV
S3DAU9_OPHP1/88-263ATATNGGGSFPVC....SNVD......GNLAP.FCAPSDG-STLNPG---E.TYYITWDTKFF.......SSYPNSTVIL
U7Q5H4_SPOS1/87-262ATATNGAGSFPVC....NNAN......GDLAP.FCAPSNG-TTLNPG---I.TYYVTWDPSFF.......SAMPNTTVII
F0XN07_GROCL/70-257ATATNGAGAFPVC....QNTA......GAQAP.FCAPSDG-STLNPG---G.TYYITWDPTYF.......ASTPNTSVVI
T0LYK6_COLGC/98-275ADHKNGQGAFAPC....SNSD......GDFAP.FCDPAKG-STLYTD---T.TYYVTWDSSVLI.....KGNQTDVRVKI
N4V5Y8_COLOR/97-274ANGKNGAGAFAPC....SNTD......GDFAP.FCDPEKG-STLYTE---S.TYYVTWDSSVLI.....KGNQTDVRVKI
E3QIV8_COLGM/98-275ADSKSGAGAFAPC....NNAN......GDFSP.FCDPVKD-SELFVD---G.TYYVTWDPTVLI.....KGNKTNVHVKI
C7YI59_NECH7/103-283ATGKHGEGVFTRC....HNKD......GSNAP.FCSPYEN-STLTTG---K.TYFITWDPDYFEDK.NADNTTAAMMVFA
N4TUU6_FUSC1/103-282ATGKHGEGVFARC....YNKD......GDNAP.FCSPYAN-STLDVK---N.TYFVTWDPDYFNKTKSSDNST..LMVTA
A0A016PKX7_GIBZA/103-281ATGKHGEGVFSRC....YNKD......GDNAP.FCSPYAN-STLDAR---R.TYFVTWDPDYFNKTKASDNST..LMITP
G9MI93_HYPVG/76-257ATSSNNDGVFSRC....YNKD......GEDAP.FCTPYKN-STLTTG---N.TYYITWDPDYYNKT.SVPKSNSTYEITV
G9P9M5_HYPAI/91-271ATSKNNDGVFSRC....YNKD......GKDAP.FCTPYTN-SSLLTG---S.TYYITWDPDYYNKT..NFKTNTTYEITV
G0RMV7_HYPJQ/90-271ATSKDGEGVFSRC....YNKD......GDDAP.FCSPYNA-STLLTG---N.TYYITWDPDYYNKT.GVKTSNSTYEITV
M1W790_CLAP2/102-282TNAKTYEGSFSRC....YNKN......GQYAP.FCRPTHN-SSIYVD---Y.TYYVTWDPDWFNQ...TEQFSKTGFVSL
E9EC26_METAQ/105-276TNAGTNQGSFSRC....YNKN......GPYAP.FCRPSYN-SSIYTG---N.TYY........T.....ATLNSTYFVSV
G3JNR1_CORMM/103-282ATNNKGTGAFTLC....SKKD......SSLDP.FCRPRVN-STLEPG---N.VYYLTWDPEHYA.....SKLNESYSLTV
L2FIS3_COLGN/71-235TAEAQGGGAFVLCNPAAGSG.......GLAQP.FCATA..-......---.....VTWDASLF........PSTNTVVQV
N4VIV2_COLOR/67-241TADSKGEGAFLLCGSAAGSN.......GLAQP.FCAPSKD-SELEGG---K.TYFVTWDASLF........PSPNTVVQV
E3Q7V2_COLGM/73-250TADAKGAGSFLLCNQAAGSG.......GLDEP.FCSPKVD-SELEGG---R.TYWITWDTALF........PSPKTMIQI
H1V1D4_COLHI/73-245TADAQGAGXFLLCNQAAGSG.......GLSQP.FCSPKGN-SELEGG---K.TYWVTWDAALF........PSPNTMVQV
G2X1H8_VERDV/74-237TAFSDGSGAFLVCDEASGSG.......GLYFP.FCASEKD-KEVAAG---S.TYF.....KYF........EDPGRGVVV
C9SDE3_VERA1/93-290TDSDGGRGVFNVCMDNAN.........SEIAP.FCQPRAR-SELYVK---E.PYYITWDSSGF.......GADLNTVANI
N4VPP0_COLOR/101-271SNTKGYGGVFSVCNNNP..........GPDGP.FCQPRRG-STLYVE---T.TYYITWDTSFF........QDPDTPIGI
E3Q9B7_COLGM/100-269SNARGYGGAFPVCNNRV..........GNDSP.FCFPRRG-NTLHVE---S.TYYITWDTTFF........ADPATPIVI
U7PRC0_SPOS1/91-269ATGPGTAGAFMACHVGESLVA......DAHAP.FCQPRAG-SQIATN---H.TYYVVWDPSGF.........AANQTVEV
R8BXA7_TOGMI/105-275ATGTGVAGAFVQCSNYQ..........GVDAP.FCLPRAG-SVLAAG---K.TYYVTWDPTIF........ANENQTLQV
J3NQ86_GAGT3/103-279STGSPGGGVMLKCQHYV..........GIDAP.LCAPYRG-SLLNPG---T.TYYLTWYVDFF.......GSNPDQDIEV
G4N0X6_MAGO7/103-276SDYGMQRGAFLVCESYY..........GQDMP.FCTPKRG-SMLNPK---W.AYYITWNPQHF........AHQDDKLKI
F0X8Q1_GROCL/88-255AATSSGAGAFLTC....SNYQ......GYFKP.FCQPGDG-SELAPG---S.SYYVTWDTTFF.........YTGATVEI

PF10342

Q5B872_EMENI/24-116---------------------------------TE.PTAN.STFAAG....STITVKWTTVD.....TDP.......SYF
Q5B820_EMENI/22-115---------------------------------TE.PEKG.AEIDPS....SSFTVKWDSVS.....TDP.......SSF
Q5B5Y1_EMENI/34-126---------------------------------LA.PGLQ.EQVPAG....KPYTITWDP.......TTE.......GSV
B8NI76_ASPFN/21-113---------------------------------NK.PGAN.STYAAG...ST.VTVNWSTVD.....TDP.......TEI
E3Q5K2_COLGM/21-113---------------------------------TS.PSIN.STVTKG...SS.YELTWKAVD.....TDP.......SAF
Q2UIS7_ASPOR/22-115---------------------------------TS.PKKG.EDVDLS...KS.FTVKWDAVD.....TDP.......SSF
B8N4F3_ASPFN/22-112---------------------------------TS.PQNG.DKVDFS...K.PYTVKWTTVP.....SDP.......EQV
A2RAR3_ASPNC/34-123---------------------------------LT.PELN.QVVPAG...K.PFEITWDP.......TTS.......GTV
B8MDX6_TALSN/31-120---------------------------------IV.PSAG.AQFTAG...TT.TTLTWNP.......TTS.......GTI
B6QM89_PENMQ/27-116---------------------------------SS.PGAN.VVFEAG...TT.TTLTWKP.......TTP.......GPV
B6H8T2_PENCW/22-115---------------------------------TE.PAKN.DEVDVS...GS.FTVKWSSVS.....TDA.......STV
E9EW85_METRA/26-120---------------------------------YA.PTPN.EKITAG...ST.FTITWKAPA.....KYS......EGTV
A7EGI4_SCLS1/28-121---------------------------------SV.PTNG.QVVKVG...DV.LDITWAPN......AVS.......GTV
Q0D1Y4_ASPTN/25-114---------------------------------NI.PTEG.YTFTAG...K.PTTLTWQP.......TTE.......GSV
B6HCY9_PENCW/34-123---------------------------------VA.PGLN.EIVPEG...KT.YTIKWQPS.......TT.......GPI
B6HHI6_PENCW/26-115---------------------------------SI.PTEG.YTFKVG...E.PTALTWKP.......TTG.......GTV
A2QKG4_ASPNC/25-128---------------------------------ID.PAAG.TVIRAG...DE.FTAHWRDSG.....TLPRL..ASLVQY
Q0CR38_ASPTN/36-125---------------------------------LT.PGLN.ELVPVG...Q.PYDITWTP.......TTE.......GTV
A2QVV0_ASPNC/26-118---------------------------------TQ.PQNG.DQVDFS...K.PYTIKWTTVA.....SDP.......SNF
C1H4S8_PARBA/33-122---------------------------------SR.PGLL.ELVPVG...Q.PYTITWQP.......STP.......GKV
Q7S2L6_NEUCR/26-121---------------------------------SN.PYAG.EKVLAG...L.PCEIKWAPSS......DPK....FQGTV
B8N159_ASPFN/34-123---------------------------------YT.PGLN.EAVPVG...K.PYAITWGP.......TTE.......GTV
D5GFD8_TUBMM/26-114---------------------------------IK.PDGS.APLAAG...DT.VTITWTP.......TTS.......GPI
A1CRU4_ASPCL/33-122---------------------------------LK.PGLN.EQVSAG...KS.YTIEWTP.......TTE.......GTV
D5GM66_TUBMM/42-127---------------------------------NV.PPGG..TIASG...SG.ITIRWTP.......STP.......GPV
F2PZN6_TRIEC/32-120---------------------------------TT.PGLG.ERVTVG...QV.FTISWKP.......TTQ.......KPV
Q0CHH6_ASPTN/24-127---------------------------------TT.PTVD.TVLKAG...DV.VTVHWKDSGIPPRISEL.......TQY
C5FT49_ARTOC/32-121---------------------------------MT.PGLD.QQVPVG...K.PFSITWQP.......TTH.......GRV
B2AAC8_PODAN/29-122---------------------------------SK.PSFD.EVIPAG...KA.YDIAWAPTE.....EFP.......EAI
Q2H7L4_CHAGB/21-113---------------------------------TS.PSKN.DVVDPS...KG.VTVKWSTVN.....TDP.......SKA
Q7SAW7_NEUCR/22-114---------------------------------TN.PKKN.DVVDPS...SG.VEVKWSTVS.....TDP.......KSA
C5FWV4_ARTOC/24-110---------------------------------SF.TSFP.SSLQAG...K.PCEITWTGG......NPQ.......APV
A2R6F8_ASPNC/22-109---------------------------------TQ.PTSG.TEWDFS...T.PKTIKFTSDA.....NDP.......SVI
E4UYI9_ARTGP/25-109---------------------------------TS...FP.SGLTAG...Q.PFTVTWTGGN.....ADL........PV
A1CAW6_ASPCL/34-123---------------------------------LQ.PGLN.ERVAAG...KQ.YTIKWTP.......TTE.......GPI
A1CSI8_ASPCL/24-127---------------------------------TV.PAFG.TSFKSG...DV.VTAHWKELG.....TSPRI..SELTHY
B8NC02_ASPFN/24-127---------------------------------IA.PARG.TIMKAG...DV.VTAHWKDSG.....ESPRI..SELVQY
Q5KDL8_CRYNJ/23-123---------------------------------ES.PTKD.TVWESG...TSSQTVEWEAVD.....TDP.......TSF
Q6C361_YARLI/23-112---------------------------------SQ.PQPG.DELHAG...DA.FVIRWNA.......TTD.......GQV
B6GZR8_PENCW/21-113---------------------------------TS.PRMG.ERIDPD...M.PLTIKWQSVS.....TDP.......DTF
F2PGU7_TRIEC/23-112---------------------------------SV.PPGG.YRFSAG...T.PTVLTWKP.......TTP.......GTV
A7EUB0_SCLS1/23-127---------------------------------AA.PAAG.AVETAG...TA.FTVTWADSGDAPSIADI.......STY
A5DZ86_LODEL/24-129---------------------------------TS.PESG.DSFAASGGTAA.VKLEWKDSDD...SD.SDLSLDNVKTY
E3Q6D6_COLGM/28-123---------------------------------YK.PTSN.QKVNAG...TS.LTIEWDAPD.....AFK......DVTV
E4V0G9_ARTGP/32-120---------------------------------FT.PGSQ.ELVPAG...S.PYTISWKP.......TTQ.......RPV
C5MA15_CANTT/26-134---------------------------------TS.PSSG.DSYSGSSGSAS.VKIAWDDSDD..SDS.DKSL.DNVKSY
C1H1P3_PARBA/23-108---------------------------------SF.TSFP.DNVQVG...E.PVTVTWTGG.......TG.......APV
D4AQH0_ARTBC/23-112---------------------------------LV.PPGG.YQFNTR...E.PTVLNWQP.......TTP.......GTV
C7YHH8_NECH7/28-122---------------------------------FK.PEAW.QSVAAG...QS.FQITWDAPA.....KYA......GQLV
C4Y066_CLAL4/23-125---------------------------------SN.PSTG.QTFDGSDGTAT.VSVKWIDDG.....NDQVPL.KDVEKY
B6QKW0_PENMQ/38-129---------------------------------YT.PDTT.HPVTLD...A.PYQITWDP.......TTP.......GPV
D5G4J1_TUBMM/33-122---------------------------------SK.PGLG.EIVPAG...S.PYTITWNP.......TTG.......GTV
B6K4G1_SCHJY/20-108---------------------------------TA.PATN.AVIQEG...GGVYTVSWNNQS.......G.......SSV
Q6C605_YARLI/30-115---------------------------------SS.PGAN.TKISPG...EN.FYITWVADP......AI.......QAI
C9SIL5_VERA1/23-107---------------------------------TN.TQADFAAISAG...ED.FTLTWSGA........E.......GPV
B6H0V5_PENCW/27-112---------------------------------TSWPK...EPLEPG...K.PVTLTWTGA......TPD.......EPV
D4AU53_ARTBC/24-118---------------------------------QA.PQAL.AVLDAT...S.PLDIEWSFPE....NATSFL...LGTDY
B2AYJ8_PODAN/22-108---------------------------------TN...SN.YDVVVG...E.PFTLRWDS........AE.......GNV
ADG2_SCHPO/23-113---------------------------------NV.PSSS.DVWTSG...HI.EPLEWSVVS.....TDP.......LQA
B6K5U7_SCHJY/24-125---------------------------------TS.PLSS.SVFTAT...TG.ITVAWQGSTAGAPISQL.......GAT
F2PGP2_TRIEC/26-109---------------------------------....SFP.ENLKTG...DS.FTATWIGGD......PQ.......APF
F4R679_MELLP/25-115---------------------------------...PSAA.SYWVQF...ST.NTISWSQGS.....GDP.......PVV
A0A0D2X9S1_FUSO4/29-122---------------------------------.T.PTNW.EEVSAG...KT.LEITWQAKP.....KYS......GEKI
YA880_ASPFU/20-112---------------------------------TS.PKKD.QDVDLS...EK.TTIEWSSVS.....SDP.......SSF
Q4X259_ASPFU/23-126---------------------------------TV.PTIG.TNFKGG...DV.VTVHWCESG.....QPPRI..SELSQY
W1QB36_OGAPD/25-129---------------------------------.S.PSSG.DTFTVDGSTVK.FNVTFKDDGESPSIKDA.......LSF

PF14610

E7KR15_YEASL/143-348HLSYVKENPVEKGNYKRD................................................IPATFFSSEW...I
F2SX36_TRIRC/36-210GLDYVNVSMNEG........................................................LNAWLSRE...T
G4UZV9_NEUT9/108-328LVQTADVSFS...QDSSSSSSPKPV..................................TPTLPHFSI...........L
F7VWB3_SORMK/105-312LLQTANVDESVAGRIVPELYSNTS....................................APLPTFPI...........L
F7VVQ9_SORMK/107-312RIEFLQAD............................................................KSIIHMDLLVKS
G2RFM8_THITE/101-302IGFYVFNDTVIPTTGPPS................................................GEEEAFSSDD...L
Q2HEH3_CHAGB/51-243VGFYTNITVPSDDPADDTHK............................................DFEDAEAFSSET...I
G0SBV9_CHATD/37-238IGFYTSEFPNITSADEAEHKNKPLP..................................GPPAHDLGGEQAFTTDS...I
B2AB99_PODAN/55-252IGFYLTPESDT.........................................................HQAFDSGE...I
Q7SHQ4_NEUCR/102-274VAFYDQKGT...........................................................DQAFATDY...M
K0KVS1_WICCF/158-358HLSYVKESIRDKGMHKRD................................................VESAFFTSEW...I
Q6BJD6_DEBHA/186-420HLSFLKESARQKGLKRSLEDDSESEQNLT..........................KRSSLEKGATIKESSFFYSDW...L
G8YQZ0_PICSO/169-402HASFLKETLRQKGMKRSNISFDDEADLDK..........................RSSLLEKGASISEKSFFSTDW...I
C5M6D3_CANTT/179-426HLNYISEKWTQKGLKKRDDNSTEEFVEDDDTTEDIV............EASEIKRRSSVLEQGGKISS.NFFKSDP...I
M3HTK0_CANMX/180-423HLSHIRESLKQKGLKKRSDNETEEIVQEDDIVEE................ETVIKRSSVLELGGKISESSFYSSPW...I
Q5ALP3_CANAL/183-415HLSNIKESLKQKGLKKRDEQTNQEFDKR............................SKVLEMGGKVTDFSFFTSDW...I
A5DUS0_LODEL/182-440LFSNIKESFRQKGLKKRDFGEAGQDVSGGHKDNDNDNEENEEEGTDVIDYTPFDKRSKVLEHGGKVQN.SFYASDW...V
G8BE66_CANPC/178-417HLSNVKESAKQKGFKKRDLDDLNEADDIDYTP....................FDKRSKVLEHGGKVKE.GFFVSEW...V
G3ALN4_SPAPN/171-413HLSHIKESLRQKGLKKRDDEAAEEEVKEEVTDE.................IVLSKRSAVLEHGGKVTELSFYTSDW...V
C4Y8N7_CLAL4/171-410HLSYVRESLRQKGLKRDEVMNSTVSVDKYS........................KRSSVMEKGGSLDGKSFFVSDW...V
G3BDP8_CANTC/194-413HLSVIKPSLKDHGLK.KRSAIMD......................................KGGKITIPSFFTTDW...V
A3LTE4_PICST/172-410HLSYVKESAHQKGFKKREISENVENENAGPSN....................LSKRSAIIDKGGVVEQVSFYSSDW...L
A5DPS3_PICGU/179-400HLTYVKEHHMYKG...TKRSEVM.....................................DKGGQAHANSFFTSDW...I
W1Q7J0_OGAPD/172-397HYAFLKESAKEQGLVKRDLVDLGPPVKPKT.......................KNIDHSQEHKGGALPGTFFTSDW...F
C4QW75_PICPG/183-411HFAYLKPSAQKKDMRKREIPNVPKVIP.............................AENYETFQGDIPGTFFSSEW...I
C5DCM9_LACTC/172-377HLFYVKESIKDKGLKKRD................................................LKAAFFSSGW...L
I2H836_TETBL/144-352HLSYVKESPKDVRYRKRDG.............................................SIPTATFFMSKW...V
G8C1B3_TETPH/142-354HLTYVAEDPYEKGYHNKKRTD.........................................ESTEDGTTFFSSEW...L
A7TP99_VANPO/141-347HLMEVPMEAKEKGYHNKR...............................................STNDVVHSSDW...L
J6EF38_SACK1/143-348HLSYVKESYADKGNYKRD................................................VKGAFFSYDW...I
G8ZQF2_TORDC/141-346HLSYVKERESEKFQVKRD................................................IPATFFSSEW...M
Q6FL99_CANGA/140-343HISYVKEKAREKGYHRRA................................................LPATFYTSEW...F
H2ASP6_KAZAF/140-345HLSYVKEKASEKGFHKRD................................................IPATFFSSEW...L
G0VJF2_NAUCC/140-345HLSYVKEKASEKGYHKRD................................................IPATFFSSEW...V
J7R9B9_KAZNA/141-346HLSYVREKADEKGFHKRD................................................IKGTFFSSEW...L
S6EMF2_ZYGB2/143-349HMAYVKEKANEKGMLKRE...............................................PPSATFFKSEW...I
C5E3Y8_ZYGRC/144-350HMAYIREKSNEKGVLKRD...............................................APSATFFHSEW...I
Q6CII5_KLULA/141-345HLSYVQEKAHDKGYAKRE................................................MKATFFSSEW...L
G8JRZ2_ERECY/140-345HLSYVQETAYQRGFAKRD................................................IKATFFSSEW...I
Q759Y9_ASHGO/138-340MLYYVKKGQLRQ...KRE................................................PIKPFFRGQW...I
G0V7C8_NAUCC/126-332HLSFVKESMEEIGMYKRDDTD..........................................KQPPQLLFFSSEW...I
Q6C7P0_YARLI/176-370HCAYIQGKALHKREIED..................................................SSVFHITEW...V
B6JVR8_SCHJY/4-173ALEYTDGDREVITQSG...................................................P...........I
B6K6T0_SCHJY/56-228VLSYKNSTGLVAVEKK...............................................................L
YJH4_SCHPO/59-231VVSYLNDSGLIAATKK...............................................................V
S9VUT8_SCHCR/61-233VLSYQNHSGLIAIDKK...............................................................I
K0KK07_WICCF/110-307ELKAYPQTGAG.........................................................DTLFETPY...L
C4QWF6_PICPG/111-305QIRAYPLKDDE.........................................................DPVFVTDW...I
Q6CIA6_YARLI/116-314ILRSLPTGTDD.........................................................LM.FETEP...F
W1QAS6_OGAPD/112-323RLRSYSEDTNS.........................................................SAFYTTDY...S
Q6BZL9_DEBHA/112-314KVRPFPNNEST.........................................................SPIETSDW...L
W1QBS4_OGAPD/90-282STNAYPSVDGD.........................................................ESLFTSDY...V
R4XDW1_TAPDE/79-247AMTYYGNENGQQVTSA...................................................R...........L
C0NMX3_AJECG/43-218GLNYANSSENEG........................................................VSAYTSDR...T
C4JRR4_UNCRE/96-271NLDYVNTTQNEG........................................................RSAYASDR...I
C5FUR6_ARTOC/94-268GMDYVNLTANEG........................................................PLAFISSK...T
A1CHY8_ASPCL/61-233EMRYANSTQGDS..........................................................AYTSER...T
Q4WPU1_ASPFU/105-277ELRYANSSQGDS..........................................................AFTSEK...T
B8N0W6_ASPFN/54-226EMRYSNSTVGDS..........................................................AFTSEK...T
Q0CZH9_ASPTN/60-232ELRYANSTQGDS..........................................................AFTSGQ...T
A2QJ97_ASPNC/58-230ELRYADSVEGDS..........................................................TFTSDR...T
V5GAK7_BYSSN/48-220ELRYCTPLEGDS..........................................................AFTSDR...T
G1WZ94_ARTOA/154-335MANYQEDPEFPERG......................................................RVAFDSGV...T
D5GJC4_TUBMM/82-276ILNYANPGRGGKVAKLW..................................................E...........T
S3D288_GLAL2/86-258QANYVNTSGG..........................................................VQAFQSPP...T
M7UCH7_BOTF1/126-298QANYVNASGGG.........................................................VQAFQSAP...T
L8GC21_PSED2/77-244LGNYFNASVGG.........................................................EQAFQSDT...L
R8BN65_TOGMI/97-270QGDYINSTTGEIE.......................................................TQAFASSK...L
M7T6A2_EUTLA/72-242EGNFTNTTTGENM.......................................................DQAFKSSK...L
G4N739_MAGO7/92-273TTTYYNMTTALLVNE.....................................................TITPSSTDELAI
J3NI78_GAGT3/85-259FGSRRNATTGALSK......................................................EDAFASSP...L
S3DAU9_OPHP1/88-263TGNLYNETTGEIT.......................................................TQAFSSNT...L
U7Q5H4_SPOS1/87-262TGNFFNDTTGAIT.......................................................TQAFSSGT...L
F0XN07_GROCL/70-257TGNLFNASTGAIV.......................................................QQAFSSGT...L
T0LYK6_COLGC/98-275KGKEVNGTTVG.........................................................DIVFNKDTESSQ
N4V5Y8_COLOR/97-274KGKEVNGTTVG.........................................................DVVFNKDTESSN
E3QIV8_COLGM/98-275QGKAVNGTTVG.........................................................DTVLNDDTDKTN
C7YI59_NECH7/103-283RLDIYNTTSEEYQKE.....................................................GDDFDQ.....V
N4TUU6_FUSC1/103-282RLDLYNRTSESWVK......................................................YKEFTDSA...V
A0A016PKX7_GIBZA/103-281RLNFFNGTSKKWEK......................................................YQDFTDSA...V
G9MI93_HYPVG/76-257RLDYLNRTSNEWVK......................................................LKTFDDQR...V
G9P9M5_HYPAI/91-271RLDYLNRTSNEWVK......................................................LESFDDNK...V
G0RMV7_HYPJQ/90-271RLDFLNKTSNEFVK......................................................LKTFDQDR...V
M1W790_CLAP2/102-282RINYFNGTTGEQSD......................................................RDIFDQA....Y
E9EC26_METAQ/105-276RLDYLNTTSNEYVL......................................................LETIDKS....V
G3JNR1_CORMM/103-282QVKQQNRTTKEWVF......................................................LTDFDQTH...V
L2FIS3_COLGN/71-235QGDYGVTSTIKEP.......................................................GHGFSSLE...I
N4VIV2_COLOR/67-241QGDFGVTDTIGA........................................................GHGFTSQS...L
E3Q7V2_COLGM/73-250QGDFNATDTIEP........................................................GHGFTSLL...L
H1V1D4_COLHI/73-245QGDYGVTKTIEA........................................................GHGFTSQM...M
G2X1H8_VERDV/74-237EGALTNHDGVIE........................................................DQAFSSGP...I
C9SDE3_VERA1/93-290VGLAVTRQSGTPTNAEPNFI...........................................INDTT...........I
N4VPP0_COLOR/101-271VGYDVSNTGSMDA.......................................................APAFSVTN...I
E3Q9B7_COLGM/100-269IGFDVDNGVTDS........................................................APAFSVTN...L
U7PRC0_SPOS1/91-269QSAYASVDTNAR........................................................GEGFSSAP...L
R8BXA7_TOGMI/105-275QGEYAD..............................................................GEGFASSD...M
J3NQ86_GAGT3/103-279QVSYDGGPVLLTDK.................................................................M
G4N0X6_MAGO7/103-276EVVYDDSRADVIAQS................................................................V
F0X8Q1_GROCL/88-255GVQYNTTGSVS...........................................................DFASKT...I

PF10342

Q5B872_EMENI/24-116SLYLWNFVS...W.PPSY..------------------------------------------------IAL..ALD---V
Q5B820_EMENI/22-115DLYLVNNAV...Y.PSVE..------------------------------------------------KKI..ASD---V
Q5B5Y1_EMENI/34-126SLVLLRGPS..TN.VQPL..------------------------------------------------YAI..AEN---I
B8NI76_ASPFN/21-113SLYLWNFVS...W.PPSY..------------------------------------------------VPL..ARN---V
E3Q5K2_COLGM/21-113SIFLVNFVN...W.PPSY..------------------------------------------------TLL..AEN---I
Q2UIS7_ASPOR/22-115DLYIVNNAV...Y.PSVE..------------------------------------------------QKI..ASD---V
B8N4F3_ASPFN/22-112NIVLKNQTS.......SE..------------------------------------------------KEI..AKN---V
A2RAR3_ASPNC/34-123SLVLLRGPS..TN.VVPI..------------------------------------------------QTI..VED---I
B8MDX6_TALSN/31-120SLRLQWGAT...TVATDG..------------------------------------------------VVI..ASA---I
B6QM89_PENMQ/27-116TLRLQWGSV..AG.PNDG..------------------------------------------------VVL..AAS---I
B6H8T2_PENCW/22-115DIVLVNNAV...Y.PPVE..------------------------------------------------EKI..ASG---I
E9EW85_METRA/26-120KIELIGGAT..QN..TQVPL------------------------------------------------ADI..ASG---V
A7EGI4_SCLS1/28-121TIKLLEGAT.PAT.LNYD..------------------------------------------------PVI.VAHS---I
Q0D1Y4_ASPTN/25-114TLRLQWGSV..LT.ADSG..------------------------------------------------SVI..AQG---I
B6HCY9_PENCW/34-123SLVLLRGPS..NN.VVPL..------------------------------------------------KTL..AES---I
B6HHI6_PENCW/26-115SLILQWGAV..MT.GNSG..------------------------------------------------TVI..ASS---I
A2QKG4_ASPNC/25-128DLYLCAGGD...T.VGSH..------------------------------------------------EDI..ALL---A
Q0CR38_ASPTN/36-125SLVLLRGPS..TN.VVPL..------------------------------------------------ETL..VVG---I
A2QVV0_ASPNC/26-118TIMLVNMNS...Q.PTVS..------------------------------------------------KKI..A.N---V
C1H4S8_PARBA/33-122SLLLLRGPS..NN.VKYL..------------------------------------------------DTI..ADS---V
Q7S2L6_NEUCR/26-121RIDVLGGTT.PQT.LDKV..------------------------------------------------GTV..ASG---V
B8N159_ASPFN/34-123SLVLLRGES..TN.MQTL..------------------------------------------------ETI..AEQ---I
D5GFD8_TUBMM/26-114TLKFRQGPS...NDLKDV..------------------------------------------------TTI..VAG---A
A1CRU4_ASPCL/33-122SLVLLRGPS..TN.VVPI..------------------------------------------------DTL..AEA---I
D5GM66_TUBMM/42-127TLILRRGDG..NN.LATV..------------------------------------------------TNI..ASE---I
F2PZN6_TRIEC/32-120SIMLLHGCP..QN.CNPI..------------------------------------------------ATL..AEG---I
Q0CHH6_ASPTN/24-127DLYLCAGED..LTGLNEE..------------------------------------------------IAL.LMKD---V
C5FT49_ARTOC/32-121SILLLRGPS..TN.VRPI..------------------------------------------------SVI..AES---I
B2AAC8_PODAN/29-122TIKLYGGKA.RNS.LDVV..------------------------------------------------ATI..ASG---V
Q2H7L4_CHAGB/21-113HLVLVNMAS..GH.TPFS..------------------------------------------------KDL..G.E---I
Q7SAW7_NEUCR/22-114HLVLVNMAS..GH.TPYT..------------------------------------------------KDL..G.A---V
C5FWV4_ARTOC/24-110TITLRKGES..TN.LKDV..------------------------------------------------AVL..TSS---A
A2R6F8_ASPNC/22-109SIILRTQDG......SFQ..------------------------------------------------TKL..ADN---V
E4UYI9_ARTGP/25-109TITLRHGPS..DD.LKDV..------------------------------------------------SIL..TSS---A
A1CAW6_ASPCL/34-123SLVLLRGPS..TN.VVPL..------------------------------------------------ETL..AEG---I
A1CSI8_ASPCL/24-127DLYLYAGGE...T.ADTQ..------------------------------------------------MEI..ASL---I
B8NC02_ASPFN/24-127DLYLCAGGD...T.LGSQ..------------------------------------------------ENL..AIL---I
Q5KDL8_CRYNJ/23-123EIQLVNQAG...YLTNSP..------------------------------------------------VTL..VAN---Q
Q6C361_YARLI/23-112ALVLLQGKS..DN.LSPV..------------------------------------------------LTI..SEG---L
B6GZR8_PENCW/21-113TIELVNQNV...Y.PPTT..------------------------------------------------TIV..AED---I
F2PGU7_TRIEC/23-112TLKLHMSSD..IT.PQNG..------------------------------------------------RVL..VAH---L
A7EUB0_SCLS1/23-127SLAVCAGSSSGAD.IKVI..------------------------------------------------TTV..SAT---V
A5DZ86_LODEL/24-129TISLCTGSN..SA.IQCL..------------------------------------------------DPS..IDQ---E
E3Q6D6_COLGM/28-123SISLIGGAT..QG.GQVP.L------------------------------------------------LDI..VSG---I
E4V0G9_ARTGP/32-120SVMLLHGCP..KN.CMPV..------------------------------------------------ATL..AEG---I
C5MA15_CANTT/26-134TILLCTGPDEDNN.IQCL.E------------------------------------------------TAL..VSS---Q
C1H1P3_PARBA/23-108TITLRKGPR..ED.LRDV..------------------------------------------------QVL..TTS---.
D4AQH0_ARTBC/23-112TLKLQMSSD..IT.PHSG..------------------------------------------------LVL..AAH---L
C7YHH8_NECH7/28-122TISLIGGDS.QNT.QVPI..------------------------------------------------KDI..ATG---V
C4Y066_CLAL4/23-125SIVLCTGPN..NN.IKPV..------------------------------------------------KSY..TTS---L
B6QKW0_PENMQ/38-129ALVLCKGPS..TN.CEPI..------------------------------------------------LTI..ADQ---V
D5G4J1_TUBMM/33-122TLLLLRGPS..NN.VVPL..------------------------------------------------YPI..VEM---A
B6K4G1_SCHJY/20-108TLTLYRGSN..GA.LTAV..------------------------------------------------DTI..ASG---V
Q6C605_YARLI/30-115TLSLVKDGQ.......KV..------------------------------------------------LDI..APG---Q
C9SIL5_VERA1/23-107TILLKTGPS..DD.LTTV..------------------------------------------------ETI..TTG---E
B6H0V5_PENCW/27-112TILLRQGNA..GN.LQDV..------------------------------------------------KPI..TGQ---A
D4AU53_ARTBC/24-118SIWLCAGGNEDNT.HLFK..------------------------------------------------GTI..LSN---P
B2AYJ8_PODAN/22-108KISLYKGTA..GN.ENSF..------------------------------------------------KPVEVLTT---T
ADG2_SCHPO/23-113NVWLINEVE...Y.PPTS..------------------------------------------------RYI..M.T---I
B6K5U7_SCHJY/24-125TFYLCSGST..AS.STTL..------------------------------------------------MTL..TAG---I
F2PGP2_TRIEC/26-109DVLLCQGPS..GD.LHDV..------------------------------------------------ETV..CSG---V
F4R679_MELLP/25-115SLQIVNPNH..NL.LNGA..------------------------------------------------FSI..AEY---V
A0A0D2X9S1_FUSO4/29-122SISLIGGAT..QNTQVPI..------------------------------------------------KTI..ATG---I
YA880_ASPFU/20-112DIYLVKMNS...Y.PPVN..------------------------------------------------KLV..AEN---V
Q4X259_ASPFU/23-126DLSLYAGGD...K.ADTQ..------------------------------------------------YEV..AVL---I
W1QB36_OGAPD/25-129TLLLMTGPN..ND.IEQR..------------------------------------------------ASL..ASS---I

PF14610

E7KR15_YEASL/143-348D-NDN----GLMPVEV----RD--EWLQD......Q.FDR.........R....IVVSVQPIYISDEDFDP...LQYGIL
F2SX36_TRIRC/36-210P-NNH----SYVAIQM----KP--EWLKG......EKRNN.........LTF..FLDEFPEGK................G
G4UZV9_NEUT9/108-328P-ADQ----GFALLPL----PK--SFLGS......SSSYP........IIRLNITMAVWASGNYDED...........AP
F7VWB3_SORMK/105-312P-ADQ----GFAFFPL----TR--FVLPF......SDSQAF......QLTRLNITMAIWASGNYDED...........AP
F7VVQ9_SORMK/107-312N-ADR----GFAYWYI----DD--SWWSQ......YQPWTFRERHNPTGVNISLILYNLDEVRS...............E
G2RFM8_THITE/101-302P-AGW----GFYQWRV----ER--SLLTT......PSLSA.........ANVTLRMVALSHSGDGSSGDGS..SSSSAGT
Q2HEH3_CHAGB/51-243S-ALW----GFYQWHP----EG--SLLSR......PSVDQ.........ANITLRLVALPANGQ...............A
G0SBV9_CHATD/37-238S-AAW----GFYQWHL----DK--SLLNS......KKLRS.........ANITICMVYLAPDSP...............R
B2AB99_PODAN/55-252S-CAW----GFYQWSI----TQ--DLINANPLWNEKPGNKAKHFKQNTPTTITLRMAALPEDGS...............P
Q7SHQ4_NEUCR/102-274S-SGW----GYYEWNV----KK--NLFSP......KQYKKQ......HALNITIGFGAKNHNDH...............R
K0KVS1_WICCF/158-358E-NID----GYYPLEI----QE--DWLLG......K.FEQ........Q.....VGISIQPESIPDDEFNL...LKDATV
Q6BJD6_DEBHA/186-420D-VEE----GMFPVTI----LE--EWFGK......KDWYR........K.....VLISLQPDNVDDEEFDY...TKDAVI
G8YQZ0_PICSO/169-402P-NSK----GIYPFTI----DP--KWFGP......KDWSR........K.....VLLTIQPDDVDIGELDY...MKNSVV
C5M6D3_CANTT/179-426D-VDV----GWFALDI----SP--DWFDK......E.YWR........K.....VLVTVVPEGYEDREDYD..VFQNSIV
M3HTK0_CANMX/180-423S-NDQ----GFYPIYI----NE--SWFGS......E.YWR........K.....VLLSIQPEDVSDEEFNI...FDNSVV
Q5ALP3_CANAL/183-415S-NDQ----GYFPLYI----DE--NWFGS......E.YWR........K.....VLISIQPDNIPDEEFNV...LQNSIV
A5DUS0_LODEL/182-440R-NED----GMLPVTI----LE--EWIGN......DVYEK........K.....VLISIQPDNIPDDEFNV...LENSIV
G8BE66_CANPC/178-417S-NED----GFYPLTI----IQ--DWFPK......NVYEK........K.....VLISLQPDNVPDDEFNV...LTDSIV
G3ALN4_SPAPN/171-413S-NEQ----GFFPLYI----DE--KWFGD......E.YWR........K.....VLLSIQPDNVADEDFDH...KKNSLV
C4Y8N7_CLAL4/171-410A-KDE----GLLPITV----DP--EWIGD......D.FYR........K.....ISISLQPDTVDDEEFDR...MKNFVV
G3BDP8_CANTC/194-413D-NDD----GMLALEV----IE--EFFPK......DAMER........K.....VLLSIQPNTVTDEDFDL...LKNSLV
A3LTE4_PICST/172-410K-KSQ----GYFPVTV----DE--KWIGD......NDYYR........K.....VLISLQPDNIPEEDFDF...LEHSLV
A5DPS3_PICGU/179-400E-NDK----GFYPLTI----DP--EWLTM......KEPFR........K.....VMLSLQPDNVSDEDFDP...QANFIV
W1Q7J0_OGAPD/172-397V-NRD----GFFPIEV----LD--TWLGK......R.QSK........A.....VLIAVQPDTVDDEEFSL..IESAHVV
C4QW75_PICPG/183-411P-NTD----GYFPIEV----KE--EWLKG......K.QFR........L.....VFIGIQPESVSDEDYDL..LNGSGVM
C5DCM9_LACTC/172-377K-NVD----GIYPLEL----TA--DFLDG......A.YDR........K.....VLLAIQPDNIRDDEFNP...WEHYVL
I2H836_TETBL/144-352D-NVD----GVMPMEL----KE--DWLQG......R.YER........L.....IMVSVQPSHIADEDFDP...MDNGVM
G8C1B3_TETPH/142-354D-NVD----GVFPLVP----QV--DWLAG......T.FER........K.....IMISIQPNYITDADFSL...FENGLF
A7TP99_VANPO/141-347K-NLE----GIYPITP----ED--AWLEG......E.HEK........K.....FVISVQPDYISDEDFDP...LEYGIF
J6EF38_SACK1/143-348K-NVD----GLQAVEV----KE--DWLQG......E.FER........S.....IVVSVQPRYIPEDEFDP...LQNGVV
G8ZQF2_TORDC/141-346R-NDE----GMLGIEI----MQ--EWLDD......Y.RTR........K.....VVLSVQPINIPDDEFDP...LEHGVL
Q6FL99_CANGA/140-343H-NVD----GLYAIEP----EN--DWLGK......E.YER........R.....VVISIQPDYIPDDEFDP...LEHGVL
H2ASP6_KAZAF/140-345K-NVD----GMYGIEI----DG--DWLQG......Q.YER........K.....IVVSVQPSNIPDEEFNP...LENGVL
G0VJF2_NAUCC/140-345K-NAD----GIYPIEI----DE--DWLQG......Q.YER........R.....VVVSVQPFNVPDDEFNP...LLNGVL
J7R9B9_KAZNA/141-346K-NVD----GMLPVTV----DE--KWLQG......Y.YER........K.....IIVSVQPENVPDDEFNP...LLNGVM
S6EMF2_ZYGB2/143-349K-NVD----GVFPVEV----LH--EWLQG......V.RTR........K.....VVISVQPEYVPDEEFDP...LLYGVF
C5E3Y8_ZYGRC/144-350K-NAD----GVYPIEI----LH--EWLQG......V.RTR........K.....IVISVQPETVSDAEFDP...LTHGVF
Q6CII5_KLULA/141-345K-NLD----GMYPLEV----RE--EWLQG......S.YNK........K.....VVVSVQPKSVPDDEFDP...LEHGVV
G8JRZ2_ERECY/140-345D-NID----GLYPITV----DE--DWLQG......K.PRR........S.....VVVSVQPSTVSDEEFNP...LEFGVL
Q759Y9_ASHGO/138-340K-NID----GLFAITI----DE--EWLQG......Q.GTR........Q.....LMLTVQPSTVADEEFDP...VEHGIL
G0V7C8_NAUCC/126-332D-NFN----GIYPITV----DE--DWMMD......K.YER........K.....IMVSIQPSDIKDEEFDP...FDNGIT
Q6C7P0_YARLI/176-370S-NTW----GVYPMEI----EE--EWLDG......EYEQK..............VAVAIQPDYMDDDEITDDYLLKNSTF
B6JVR8_SCHJY/4-173P-TNQ----SHWRVQV----KK--KWLQG......ANN...........LTA..RIVAVPQQP................N
B6K6T0_SCHJY/56-228N-NYK----GEITLKV----NK--DWLHD......DDNQT.........ITV..DLETTGTN.................N
YJH4_SCHPO/59-231Q-NSK----GEIMLKA----NK--GWLHD......DSFQN.........VTI..DLVTISEN.................N
S9VUT8_SCHCR/61-233K-NKD----GEISIKA----SD--KWLHD......DFVQN.........MTV..NLITNNEG.................N
K0KK07_WICCF/110-307S-NSD----AYYPLTI----TS--SMIK........NEGY.........FWL..IISPLTTSTTKA............TN
C4QWF6_PICPG/111-305S-NAD----GYYIFES----KA--SNMRT......GSAGW.........GFL..NITPQTTSETKA............TY
Q6CIA6_YARLI/116-314A-NRK----GYYPLEI----QR--SWTNN......GGY...........FFI..NIAPLTRPDTKA............KN
W1QAS6_OGAPD/112-323P-NSD----GYIALTI----DS--DWIDE......GNDGW.........VQI..VLTPFLDNDDLS............SK
Q6BZL9_DEBHA/112-314E-NKD----GFYAWTI----ES--SDIDS......DMDGY.........AQI..YLSPFRTSDTDS............EE
W1QBS4_OGAPD/90-282I-NNN----GYYAWEV----KS--SYRRS......GTEGY.........CWL..LITPQLDSTSNA............KH
R4XDW1_TAPDE/79-247P-NSL----GFWNYTV----AG--DWLNG......HSSQY.........AQL..QLLPYNCGNG...............T
C0NMX3_AJECG/43-218E-NSY----GFVTIQM----DK--VWLHG......ESRNN.........LSI..YLVEYDPASKE..............R
C4JRR4_UNCRE/96-271P-NKI----GFVTLQM----DK--IWLRD......ESRNN.........LTL..YLLNYDLATED..............H
C5FUR6_ARTOC/94-268P-SSY----GYVTITM----KK--DWLKG......EKRNN.........LTM..YLDELLPGK................D
A1CHY8_ASPCL/61-233D-NSY----GYLPLHM----QK--EWLQG......KHYNV.........LTL..YIIELDPTSGN..............R
Q4WPU1_ASPFU/105-277D-NSY----GYISLPM----QK--EWLQG......KPYNA.........LTL..YIIELDPTSGS..............R
B8N0W6_ASPFN/54-226D-NSY----GYLPLHM----RK--EWLQE......KAHND.........LTF..YLIELNPASGT..............R
Q0CZH9_ASPTN/60-232V-NSY----GYLPVHM----QS--DWLQG......KPQNA.........LTL..YIIELEPTSDQ..............R
A2QJ97_ASPNC/58-230D-NSY----GYTHIHM----QQ--EWLQG......KQQNP.........LTL..YIIELDSVSDK..............R
V5GAK7_BYSSN/48-220E-NSY----GYISLKM----RQ--EWLQG......KPRNN.........LTL..YIIENEPTSNQ..............R
G1WZ94_ARTOA/154-335L-NKI----GFITFYV----DP--EKYSA......G.............VVIHWSMKRIGVLANT..............E
D5GJC4_TUBMM/82-276A-NSF----GLINIEP----SK--DWLVN......RTAFDDGNKRTVENQTMYFTIADDSPSGT...............Q
S3D288_GLAL2/86-258T-NAY----GFYAWTI----DK--EWLRG......KGSNN...........ITLYIVPLNPLAN...............E
M7UCH7_BOTF1/126-298S-NNL----GFIAWTI----DK--SWLKN......MKFNN.........VTLFFTPTQKT...................D
L8GC21_PSED2/77-244S-GSR----GWYALNA----LE--AWKQG......SKENY.........IDL..FLATAT...................G
R8BN65_TOGMI/97-270S-AAW----AFYALAV----DT--RLMQG......KKS...........VNISLTIAALAPGAS...............T
M7T6A2_EUTLA/72-242E-AKD----GFWTCNI----EK--DFMQA...................DTNLTLQISVFGSGGN...............T
G4N739_MAGO7/92-273P-FSR----GFYAWPV----GW--QILQP......GRPE..........MNVTLTLTTTTRHLNTT.............I
J3NI78_GAGT3/85-259P-VNK----AFYAWPV----DR--EIMQH...........T......AGVNISIGFRTLPMTNS...............S
S3DAU9_OPHP1/88-263A-SGW----SFYAWNV----DK--ALLKG......VSSKG.........VNISISMSYLSSGN................S
U7Q5H4_SPOS1/87-262A-AGW----SFYAWDV----EK--SLLSG......ATSAG.........VNIRISMAYLSTGN................N
F0XN07_GROCL/70-257A-AGW----SFYAWSV----DA--SLLKG......AGSAG.........VNVSLSMVYLTGSSSQANTSA....SVSSSQ
T0LYK6_COLGC/98-275L-AAY----GYYAWTV----SS--GLIPK......GQDN..........ATIELLMTYTINGV................A
N4V5Y8_COLOR/97-274P-AAW----GYYAWHI----DG--NLIPS......GQDN..........TTIELLLQYTVNGV................A
E3QIV8_COLGM/98-275P-AAW----GYYAWNV----DG--SLIPS......GQDN..........ATIELVMSYTIDNI................A
C7YI59_NECH7/103-283P-AAF----GFWPFNV----KD--SYRKF......GGDHN.........ISITLYSQRNHTA.................E
N4TUU6_FUSC1/103-282P-AAW----GYWPFDV----KQ--DYMKY......SPYN..........ISITLYSNSNNSL.................E
A0A016PKX7_GIBZA/103-281P-AAW----GYWPFDA----KS--DYIKH......SHN...........ISLTLYSNSNNSL.................E
G9MI93_HYPVG/76-257P-ASW----GFWPLQV----KS--DMLQG......EKLNN.........ISITLLVAPRGSN.................D
G9P9M5_HYPAI/91-271P-ASW----GFWPLKV----KK--DYLMG......EKTNN.........ITITLLSAPRGSN.................D
G0RMV7_HYPJQ/90-271P-TSW----GVFPLKV----TG--DMLKG......QKTNN.........VTITLQVAPRGSK.................D
M1W790_CLAP2/102-282P-ASY----GFLPFKV----ES--RYLKG......QRSNN.........VTLQLVGHEIQNTTA...............P
E9EC26_METAQ/105-276P-AKW----GYFPFAV----DG--KYLKG.....QKHTNN.........VTITLMGHDTENSIA...............Y
G3JNR1_CORMM/103-282P-AKQ----GYFPFAV----GD--KLLDG......HDSNN.........ITVTLQRRLNSTIGD...............P
L2FIS3_COLGN/71-235P-ASV----GFFEWAV----LG--YDMPA......GEA...........MDVQLFLAIPAANGS...............I
N4VIV2_COLOR/67-241P-ASQ----GFFEWDV----IG--YNMPP......GEA...........LDVQLYLAVPASNGT...............I
E3Q7V2_COLGM/73-250P-ASQ----GHFAWAA----AG--YNMAP......NEA...........LEVRLFLAITANNGT...............I
H1V1D4_COLHI/73-245P-ASQ----GHFAWAA----VG--YNMAP......NES...........LDVQLVLAVPATNGT...............I
G2X1H8_VERDV/74-237V-ASE----GFYAWTI----SE--TDPKS......WKQMD.........VQL..YLVYENGTS................A
C9SDE3_VERA1/93-290V-LGR----GYYAWTP----SE--ADLKG......STDFH........NVSL..MLQFVSSESN...............E
N4VPP0_COLOR/101-271R-GGT----GWAYWTP----NS--RDLEE......KSSNN.........MTL..IMMYNDPLTD...............E
E3Q9B7_COLGM/100-269N-GGD----GWLPWTP----RV--KDLEG......RKSNN.........MTI..FLVYSDPLTG...............R
U7PRC0_SPOS1/91-269A-ATS----GFYAWTV----PS--ALVTLYGGAAGH.............VNVTLALAYNSSTSN...............S
R8BXA7_TOGMI/105-275A-ASA----GFYAWSI----DR--DLLST......QNTEA.........LVVSLRLAYFDSNEDSEN...........SV
J3NQ86_GAGT3/103-279P-ASV----GFYAWSV----PA--DFLERNGGGRAA.............VEVTWSINFGAPDGSK..............S
G4N0X6_MAGO7/103-276R-ASV----GYYAWII----PE--DMLTK......FNTTA.........MNASIKYNYQSHDSSEF.............N
F0X8Q1_GROCL/88-255D-ASQ----GFYVWTI----ES--SFLTT......LGASSV.......DATI..YASYTDTSN................N

PF10342

Q5B872_EMENI/24-116P.SAD....ESHTVQI....PC..DTNPE---------------------------------------------------
Q5B820_EMENI/22-115D.TSE....GSYTVDG....VS..GLENG---------------------------------------------------
Q5B5Y1_EMENI/34-126G.NS.....GHYEWTP....ST..ELEPD---------------------------------------------------
B8NI76_ASPFN/21-113P.TAD....QSYSVQI....PC..DTNPE---------------------------------------------------
E3Q5K2_COLGM/21-113E.TSA....GAVSVDV....PC..SASNS---------------------------------------------------
Q2UIS7_ASPOR/22-115D.SSK....GSYDVSG....LS..DLTNG---------------------------------------------------
B8N4F3_ASPFN/22-112K.TSD....GKYTIDS....IW..DIETG---------------------------------------------------
A2RAR3_ASPNC/34-123D.NS.....GSYSWTP....ST..TLEPD---------------------------------------------------
B8MDX6_TALSN/31-120K.NT.....GSYEWDV....PS..NIPKE---------------------------------------------------
B6QM89_PENMQ/27-116T.NI.....GSFVWQV....PF..NIPQQ---------------------------------------------------
B6H8T2_PENCW/22-115D.TSK....GSYTASG....LK..DVTDG---------------------------------------------------
E9EW85_METRA/26-120K.NSA....ESYSWKV....DA..SLGDK---------------------------------------------------
A7EGI4_SCLS1/28-121N.NLD....GQYKWTV....PA..SVGSF---------------------------------------------------
Q0D1Y4_ASPTN/25-114A.NS.....GHYTWTP....PA..NLAAQ---------------------------------------------------
B6HCY9_PENCW/34-123P.NS.....GEFKWTP....GS..DLEAD---------------------------------------------------
B6HHI6_PENCW/26-115A.N.D....GSYTWDV....PS..NLAAQ---------------------------------------------------
A2QKG4_ASPNC/25-128K.NALFAKGNSVTFKI....DS..EVGGN---------------------------------------------------
Q0CR38_ASPTN/36-125P.NT.....GSYKWTP....GT..ELEPD---------------------------------------------------
A2QVV0_ASPNC/26-118K.TSD....SKYTVDK....VV..GIPVA---------------------------------------------------
C1H4S8_PARBA/33-122S.NT.....GTYIWTP....PT..SLEGD---------------------------------------------------
Q7S2L6_NEUCR/26-121D.SSK....GSYKWMV....DA..HLGKA---------------------------------------------------
B8N159_ASPFN/34-123P.NN.....GKFEWTP....ST..SLEAD---------------------------------------------------
D5GFD8_TUBMM/26-114D.NS.....GSYSWTV....PK..DTPSG---------------------------------------------------
A1CRU4_ASPCL/33-122P.NS.....GHFVWTP....ST..KLDDD---------------------------------------------------
D5GM66_TUBMM/42-127P.NS.....GSYDWTP....SE..SLPVG---------------------------------------------------
F2PZN6_TRIEC/32-120P.NS.....GSLPWTP....EA..DLVDD---------------------------------------------------
Q0CHH6_ASPTN/24-127AFARG....NSVSFKI....DP..ALGAD---------------------------------------------------
C5FT49_ARTOC/32-121E.NT.....GSFSWTP....PT..DLEND---------------------------------------------------
B2AAC8_PODAN/29-122D.SAE....GTYSWDV....PA..DLGSA---------------------------------------------------
Q2H7L4_CHAGB/21-113D.LSA....GSFKVSE.....K..DVPSD---------------------------------------------------
Q7SAW7_NEUCR/22-114D.LTK....GSVIISE.....K..DVPND---------------------------------------------------
C5FWV4_ARTOC/24-110T.G......GRYTFTP....ST..SLVNG---------------------------------------------------
A2R6F8_ASPNC/22-109K.TST....GEYTTQP....NP..SISNG---------------------------------------------------
E4UYI9_ARTGP/25-109T.G......GSYTFTP....ST..SLVSG---------------------------------------------------
A1CAW6_ASPCL/34-123P.NS.....GSFSWTP....SS..TLEPD---------------------------------------------------
A1CSI8_ASPCL/24-127R.DGMFARGNSVSFKI....DPHFGGSQT---------------------------------------------------
B8NC02_ASPFN/24-127K.DGVFARGNSVSFKI....DPAVGGNEP---------------------------------------------------
Q5KDL8_CRYNJ/23-123S.TGDTGTTNSATVTY....PD..GAWPT---------------------------------------------------
Q6C361_YARLI/23-112D.NR.....GAVRWLV....PS..DLPDG---------------------------------------------------
B6GZR8_PENCW/21-113D.SSK....GSYTVNA....KTFTGVDDG---------------------------------------------------
F2PGU7_TRIEC/23-112E.NS.....GAYTFLP....SS..DLTQG---------------------------------------------------
A7EUB0_SCLS1/23-127SMGST....LTTTVTV....PA..TSGES---------------------------------------------------
A5DZ86_LODEL/24-129K.LSS....KSQTINI....DS..TDVPN---------------------------------------------------
E3Q6D6_COLGM/28-123P.NSA....KAYTWAI....PS..NLGKD---------------------------------------------------
E4V0G9_ARTGP/32-120P.NT.....GSLPWTP....ST..SLVGD---------------------------------------------------
C5MA15_CANTT/26-134T.IDS....HETTVKI....DN..TLVPN---------------------------------------------------
C1H1P3_PARBA/23-108..GKG....GSFTWTP....DS..DLANG---------------------------------------------------
D4AQH0_ARTBC/23-112E.NT.....GTFTFLP....PP..DLMQN---------------------------------------------------
C7YHH8_NECH7/28-122S.NDA....EAYSWAV....DA..SLGDK---------------------------------------------------
C4Y066_CLAL4/23-125S.GSE....TGYELSI....KA..SDVPN---------------------------------------------------
B6QKW0_PENMQ/38-129P.NS.....GEFTWTP.....S..GLEPS---------------------------------------------------
D5G4J1_TUBMM/33-122P.NT.....GTYTWTP....AT..DLEAD---------------------------------------------------
B6K4G1_SCHJY/20-108T.NS.....GTYAWNV....PN..YYPTA---------------------------------------------------
Q6C605_YARLI/30-115A.N.D....GKFTWPV....PY..DLEAG---------------------------------------------------
C9SIL5_VERA1/23-107S.G......ESFTWSV....PT..TLVS.---------------------------------------------------
B6H0V5_PENCW/27-112..KG.....GTFTWTP....DD..SVKKA---------------------------------------------------
D4AU53_ARTBC/24-118V...Q....TTAEVDP....NA..GSEYP---------------------------------------------------
B2AYJ8_PODAN/22-108S.GAS....GSFTYTP....TD..SLN..---------------------------------------------------
ADG2_SCHPO/23-113N.TFD....ENATFPA.....L..DLSPG---------------------------------------------------
B6K5U7_SCHJY/24-125S.PG.....TTTTFTSGEIDPA..KGPSG---------------------------------------------------
F2PGP2_TRIEC/26-109T.GF......SCIFTL....PP..SLPSG---------------------------------------------------
F4R679_MELLP/25-115K.ASL....ESYTVTN....VT...LLVG---------------------------------------------------
A0A0D2X9S1_FUSO4/29-122D.NDA....ASYSWAI....DS..TLGTE---------------------------------------------------
YA880_ASPFU/20-112K.TSE....GSYTIDG....VS...ADNG---------------------------------------------------
Q4X259_ASPFU/23-126K.NGLFTRGNSVSIRI....DP..GVGGN---------------------------------------------------
W1QB36_OGAPD/25-129T.LSDL.DDDTYQASV....AA..SVGAD---------------------------------------------------

PF14610

E7KR15_YEASL/143-348LYITKGSKVFKPTKEQL.............................ALDDAGITNDQWYYVALSIPTVV.VVFFV.FMYF
F2SX36_TRIRC/36-210KVHHNGPTISLVNKPPV............................HHPPPPPTPTPKPLGLLIGLPLGL.GAVFL.ILLG
G4UZV9_NEUT9/108-328TEAKQGPLVYVTNGYQSDDVDDEDGNHDG....DDSDDDDDDDNDDGLVGDPGGLSKGKKIAISVPVAIVSLLVLGGLIA
F7VWB3_SORMK/105-312TEIKQGPLVYVTNDYDSDSDD....................ASDDEDDLVSSPGLSTGKKIAISVPVAIVSLLVLGGLIA
F7VVQ9_SORMK/107-312KGLIPGPVVWVTDKEDLFAEDEDD.............WPTTPAPAPAPAPDSDMSSTQKTVAIAVPITF.VGLLL.LVIM
G2RFM8_THITE/101-302ARWFAGPTVTVRYRPAP...........................PPRPARKAKTPADTAALYVALPLVF.GFAAL.VIAG
Q2HEH3_CHAGB/51-243AQWHSGPTVNLRWKPKAP..........................KKKKPGHTPTRADDDVLYVALPLVF.GFAAI.MIAG
G0SBV9_CHATD/37-238STWVQGPTVILKKAKKKT..........................KVAPEKPKRPPSEEPVLVIALPIVM.VVSAF.IIFM
B2AB99_PODAN/55-252AEWHQGPTVQIVKPKKG............................PNKSDGKRHPADDQVLYVALPTVA.FFLMA.IVMS
Q7SHQ4_NEUCR/102-274VHWVRGPTVTIVRT...............................RRFHEHKNELPDGAALYIGIPAIV.GFVLL.VSCG
K0KVS1_WICCF/158-358FKILKGPKVAKKNKETRKLEDEG................ISDDSA.............YYIMMSIPSVV.AVAAI.GMYI
Q6BJD6_DEBHA/186-420VEIIKGAVVSKGQFADLKKLEEK................WKNDGM.NVEYEDSSPYEKYYIMMAVPSCV.ALFGL.GMYI
G8YQZ0_PICSO/169-402ISIEKGAKVSKEHLTDLKKLEEK................WKNQHL.NVEIDEGPGYEKYIVMMTIPTCV.CVFGL.FMYL
C5M6D3_CANTT/179-426IEIWKGVKVGKGHLEDLKRLEEK................YANRHIYDIEVEEGINFDEYMMMIALPTCV.VLAAL.GMWL
M3HTK0_CANMX/180-423VEIWKGSKVSKDHLTDLKKLEEK................YANRHMYDFEVEEGIDFEKYMMMIGLPTCV.VIAAF.GMWL
Q5ALP3_CANAL/183-415VEIWKGVKVSKDHLTDLKKLEEK................YANRHMHDIEVEEGVDFEKYMIMMGLPTCV.LIAGF.GMWL
A5DUS0_LODEL/182-440VEFWKGSKVGKEDLLDLKKLEEK................YANRHMQIE.VEEGIDYEKYIVMITLPMCV.VIAAF.GMWL
G8BE66_CANPC/178-417VEFWKGAKVGKGEFADLQRQEEK................HVNKYLTGDNIEEGIDYEEYIVMMTLPTCV.VIAAF.GMWL
G3ALN4_SPAPN/171-413VEIWKGAKVSKEHLQDLKKLEEK................HAQAYLGDVEIEEGIDYEKYMIMITMPTCV.IIAAF.GMYL
C4Y8N7_CLAL4/171-410VEIAKGAKVAKGHLEDIKKQEERE..............RLKAELGDDYVVEEGIDYEKYMVMMSLPLCV.LVAAF.GMYL
G3BDP8_CANTC/194-413LTLNKPGKVYKGHNEDLDYLDEK................QRMKNL.NVEIDEGLDYEKYFAIMGIPLFV.VALAM.GMYL
A3LTE4_PICST/172-410IEISKGSKVSKEHLVDLKKLEEK................YNNPGYE.V.LDEGVDFEKYYVMMTMPTCV.ILAAF.LMYI
A5DPS3_PICGU/179-400IEIAKGAKVGKEHLLDLKKLEEK................WDKADIDGV.YDEGPNMEKYLIMMTMPTCV.AIAGL.LMYF
W1Q7J0_OGAPD/172-397VHFQKRAVVAKNSKLDKELQDRT................GSNDNV.............YYVIMSVPTVV.IIAVF.GMYV
C4QW75_PICPG/183-411VQFAKGAVVSKTTKQDMAIQESP................RTGDDM.............YYIIMTMPTVV.VLAVC.FMYL
C5DCM9_LACTC/172-377FRMIMGPRVAKTTKQQKALQDAG................ISDDTW.............YYVALSIPTVV.VIACV.AMYF
I2H836_TETBL/144-352IRMRLGARVVKQDRDAIAMRDAG................MTGEKW.............YYVLMAIPTAV.VVALF.GMYF
G8C1B3_TETPH/142-354VYIIQGSRVFKQSKEQRELEQAG................LHGKKW.............YYIAISIPSAV.LVSVF.CMYL
A7TP99_VANPO/141-347VYILLQSRVYKHSKEQIALENAG................LTGTKW.............YYIALSMPAAV.AVALF.CMYV
J6EF38_SACK1/143-348LHITKGSRVFKPTKEQLALDEAG................ITNGQW.............YYVALSIPTVV.VIFFV.FMYF
G8ZQF2_TORDC/141-346IYIDQGSKVFKPTKDQLALEKAG................ITDNHW.............LYVAITMPTVV.VIALV.MMYF
Q6FL99_CANGA/140-343LYLIKGTKVAKKTKDELRLEDAG................ISDDTW.............YYVALTIPTLV.VVALV.FMYF
H2ASP6_KAZAF/140-345LYMIQGSKVSKYSKEELALQDAG................ISNDKW.............YYVALSIPTMV.IFALV.CIYF
G0VJF2_NAUCC/140-345LYIMMGSKVGKTTKEEWALIDAG................ISDEKW.............YYVAITIPTIV.VVVVV.FLYF
J7R9B9_KAZNA/141-346VNMLLGSKVAKTTKEEWARQDAG................IYDREW.............YYVALSIPTVV.VIAIV.AIYF
S6EMF2_ZYGB2/143-349VFLDEGSKVFKHTKEELALRDAG................ITDDKW.............YYVAISIPTMV.ILSLV.LMYF
C5E3Y8_ZYGRC/144-350VYLDEGSRVYKQTNKELALNDAG................ITDDKW.............YYVVVSIPTAV.IVALV.LMYF
Q6CII5_KLULA/141-345INIILGSKVFKTTKEQLALEDQG................ITDDTW.............YYVAMTIPTAV.LFAVV.FMYF
G8JRZ2_ERECY/140-345IKILRGSKVFKTTKEELALQDAG................IHHRPW.............YYVILTVPTIV.AFTIA.VMYF
Q759Y9_ASHGO/138-340VRLALPNRVFKAGKQDLKMLDSG................MTDETW.............YYLLLTLPTIV.VFVAA.LVYF
G0V7C8_NAUCC/126-332LHLKVPTKIYKNTKQYWEKEEQG................IRDDRW.............LRVAITVPIII.LFVCL.IVYV
Q6C7P0_YARLI/176-370VRFRRGAIVQKKDKGRLDLDKN..................EEGMM..............ITIITIPSVV.VIFAC.IYVL
B6JVR8_SCHJY/4-173PTVQLGPTVLLAETFYFV.........................WYVETSPAFQQNNMDKGIAIGLSVAL.LGCVG.IVLA
B6K6T0_SCHJY/56-228VTLITGPTVNLASALTEE.........................EKAAEDAALYGHKRNLKAAIIVPAIF.LVIIL.AACI
YJH4_SCHPO/59-231MTLLTGPRILLAKDLDSA.........................TAAAENAAFYGPRRNIKAAIAVPSVI.LGLIL.VALV
S9VUT8_SCHCR/61-233ATFVSGPNITLVKSLDPH.........................ELYMEDQEFYAPKRNLKAAIAVPSIF.LGIIL.MLLL
K0KK07_WICCF/110-307VGEKSGPLLRAINSKSDAITTINR.............VPSDNGHTSTKSSGSGSNAKTIAPAVVIPVIA.VIGI..AIFV
C4QWF6_PICPG/111-305VGTKSGPLVRILTSKSEADFAIS...............RVPSDNGLSKSKGSSNNAKVIAPAVAIPVVV.LIFV..GFGV
Q6CIA6_YARLI/116-314VGTKSGPIVRAIMSKNDGITTVSRL............PSENSLQPGKKHSGGGIGKGGIAAAVVVPVVV.VILLS.GLGF
W1QAS6_OGAPD/112-323YSSYKGPAVKLVSSQGSIERVPSDNGSSSSSSSSTTSSSTSTATSTSKSSSHKSKASVIAPAVVVPVVV.VGLVG.GIAA
Q6BZL9_DEBHA/112-314EDTAIGPVVRLISSKGDAYTKISRVPS........DNNDENDSSDKKDDGGSSNKAKIIVPAVVVPVFS.IFLIA.GAVF
W1QBS4_OGAPD/90-282TGTTYGPLIRIIEHESDAYTTIT...............RKPSDNG.ATTTSSKSKAKIIVPAVVVPVVVLGFLIA.GIVW
R4XDW1_TAPDE/79-247VDPSSGPIVELLNKAPV..............................TAVPATSRSEILGLSIGLPLAL.IAFVG.TAAF
C0NMX3_AJECG/43-218AKTVAGPIISLTNKPGK............................HYPPPPPTAVPNKLGLMIGLPVAL.GVIFV.VLLG
C4JRR4_UNCRE/96-271SIKKAGPMISLTKKPVQ............................HYPPPPPSKPN.KLGLAVGLPISL.AVVFI.IACG
C5FUR6_ARTOC/94-268RIHHIGPTISLVNKPPM............................HYPPPPPTPAPKPLGLLIGLPLGL.GAVVL.ILLG
A1CHY8_ASPCL/61-233ASARQGPTVVLHPRPVE............................HYKPPPQIPFN.KKALYVGLPVSL.GVVIA.VVAG
Q4WPU1_ASPFU/105-277ASARQGPTVILHPKPVE............................HYKPSPRTPFN.RTALLIGLPVSL.GVVIA.AVAG
B8N0W6_ASPFN/54-226ASIRKGPRITLHPKPVE............................HYKPSPPMTFN.KRALFIGLPVSL.SVIIV.VVAG
Q0CZH9_ASPTN/60-232ASARQGPTIMLHPKAVE............................HYQPPPPLPMN.KLALYVGLPLSL.AVVVL.VVAG
A2QJ97_ASPNC/58-230ASARRGPTVVLHPKPVQ............................HLLSPPPTSFN.KLALYIGLPVSL.SVVIL.VVAG
V5GAK7_BYSSN/48-220ASYRQGPRVELMHRQVE............................HYKPPPPTPYN.KLGLILGLPISV.SAVLL.VVAG
G1WZ94_ARTOA/154-335KSFRFGPWVRISKEPIH.............................HPQPSVRPPVSTIGLAVGLPLAA.LFIVA.VIAG
D5GJC4_TUBMM/82-276PNVETGPTIILTSRPSPA..........................PIDKSPSNRPPVSILGLAVGLPVVF.VFVVG.TILS
S3D288_GLAL2/86-258PMSYSGPILRVTNRPP.............................NYYRQPLAKAPKGQDLYIALPVVF.GFIIL.CLIG
M7UCH7_BOTF1/126-298VISVQGPTLMVTTSPAP............................EPYRQPPSKAPHGASLYIALPTIL.AFIVL.VVGG
L8GC21_PSED2/77-244GKRLPGPRIAIGTAP..............................EEVEFKPTQVPKGPALYIALPAVF.GFIIL.CVCG
R8BN65_TOGMI/97-270MTAYTGPTIRIAEP...............................QAYQQEKTKAPTGPALYIGLPTVL.GFVVV.CLIG
M7T6A2_EUTLA/72-242TQTIEGPKLYVSTP...............................VPYTSTNYNTPNGPALYIGLPTIF.GFIIV.CLVG
G4N739_MAGO7/92-273VAEHHGPVVLVEKE...............................KSFRQPDTPTPAGPEIYIGLPVIL.GFVLL.MVFG
J3NI78_GAGT3/85-259HAPVRGPDVFVTKL...............................QPFRQPPSTAPSGAELYIGLPIIF.GFITL.MLVG
S3DAU9_OPHP1/88-263STHVRGPVVHVAKK...............................EPYRQPPAELPSGAALYIGLPAVF.LFIIV.MVIG
U7Q5H4_SPOS1/87-262STHVAGPVVTVANP...............................QPYRQKPAEAPSGMALYIGLPCIL.GFVAL.MLIG
F0XN07_GROCL/70-257SAVVQGPVVTVAKP...............................SAALPELTKAPTGPALYIGLPAVF.GFIIV.VLAG
T0LYK6_COLGC/98-275QTDITGPQVLVSKR...............................ATYHPEGAKIPKGQELYIALPTVF.GFLII.CLIG
N4V5Y8_COLOR/97-274KEDITGPQVLVAKR...............................PTFHPQPSKLPKGAELYIALPAVF.GFIFI.CLIG
E3QIV8_COLGM/98-275QTDITGPRVLVVKR...............................PQFHPQPTKIPKGAELYIALPTVF.GLIVI.AVIG
C7YI59_NECH7/103-283KKKASTIYLNVASP...............................QLPAHKEPKVPHGQTLVIALPVVL.GSIFL.LLIG
N4TUU6_FUSC1/103-282KTKSSSLYLNLNDQ...............................NFPEKSHEKLPEGQTLTIALPVVF.GSLFL.LIVG
A0A016PKX7_GIBZA/103-281KTESTTLFLYLQDQ...............................DFPEKANEKLPEGQTLIIALPVVF.GCLLL.LIIG
G9MI93_HYPVG/76-257KNSSIALPVAFAPP...............................GLPENPEPQVPKGHTLSIALPVAF.GCIIF.IVIG
G9P9M5_HYPAI/91-271KNSSIALPVLFEKP...............................ALPQNSKTELPTGHTLSIALPLAF.GCFVF.IVVG
G0RMV7_HYPJQ/90-271SNSSIPLHVAFQDP...............................ALPSNPEPQVPKGRTLSIALPVAL.GSVLF.IVIG
M1W790_CLAP2/102-282TNKTVELPVVITTA...............................PLDPTPPTPVPEGQTLLIALPVTF.GVIVL.LLVG
E9EC26_METAQ/105-276NNKSIPLPVVVSGP...............................PLDPTAPSNAPKGKTLTIALPVTL.GVIAL.ILVG
G3JNR1_CORMM/103-282DDVTAAYPLTVTRF...............................KFPATAPNNGAVGHSLTIALPVVF.GTILL.LVVG
L2FIS3_COLGN/71-235VARNAGPKVRVISNNRT...............................SINDPVRRKVNVLGIVLPIVF.GVLSL.CGIG
N4VIV2_COLOR/67-241AARDKGPRVRIVNKRSR................................LDPLRRRKSTVFGIILPVIF.GLLSL.GGIG
E3Q7V2_COLGM/73-250TGRHGGPRVRVVNRSRK.............................DSGERGRGRRGPNVLAIVLPLVL.GGLAL.GGIG
H1V1D4_COLHI/73-245TGRHVGPKVRIVNRSRG..................................PPRRRGPNVFGIVLPIVF.GVLSL.GGIG
G2X1H8_VERDV/74-237RNRISGPKLSITPPKQK......................................SSFQLSFVILPVSF.ILLAL.VVAA
C9SDE3_VERA1/93-290LTNVTGPTITLLPARANIPEEHSD..............DDDDDDDDDDDDDDDKNGGPNVLAIVLPLVF.AVLAI.AGLA
N4VPP0_COLOR/101-271QKNVTGPVFTIVPPLD..................................DPDSGSSPNLLAILLPVIL.ITLAI.VAVM
E3Q9B7_COLGM/100-269EMNKTGPVFTLQAALGT..................................EAFSTRPDLLPILLPVIL.ISLAI.ATVM
U7PRC0_SPOS1/91-269LLRLAGPSVLVTNHVVL.................................PHQHRHHVGTVAIAVPVII.GAAVL.ALLG
R8BXA7_TOGMI/105-275RTLDYGPNITISGVADV..................................SSGGGHPNTVAIAVPVVI.GLVAI.LFAG
J3NQ86_GAGT3/103-279IIHGEGPTVTITREQML............................VDDGLPKGAGGSLAALAIAVPVVVIVLLVL.GLGG
G4N0X6_MAGO7/103-276EIRGNGPRVVITEDVMW............................SMYNTGGNGSPGPISTVVVVPIVV..VLFI.ALGI
F0X8Q1_GROCL/88-255AERATGPAVVITSAKHS..................................LSSGHHVSALAVALPVVL.GLAAI.VLLC

PF10342

Q5B872_EMENI/24-116--------------------------------------------------W....G..YQLSAI.NGTN-------V.YI
Q5B820_EMENI/22-115--------------------------------------------------G....G..YQINLFSNSGH-------N.TG
Q5B5Y1_EMENI/34-126--------------------------------------------------V....T.HYGLLLV.VESG-------PNKG
B8NI76_ASPFN/21-113--------------------------------------------------W....G..YQISAI.NGTN-------V.YI
E3Q5K2_COLGM/21-113--------------------------------------------------Y....G..YQFNAI.NGTN-------V.YV
Q2UIS7_ASPOR/22-115--------------------------------------------------K....G..YQINFLSNSAK-------N.SG
B8N4F3_ASPFN/22-112--------------------------------------------------T....G..YQFNFISNSTK-------N.TG
A2RAR3_ASPNC/34-123--------------------------------------------------T....T.HYGILLV.VEGT-------...G
B8MDX6_TALSN/31-120--------------------------------------------------S....D..YFIRIS.SDAD-------S..S
B6QM89_PENMQ/27-116--------------------------------------------------P....N..YFVRIS.DDKD-------P..N
B6H8T2_PENCW/22-115--------------------------------------------------S....G..FQINLISTEAK-------N.TG
E9EW85_METRA/26-120--------------------------------------------------A....V..YGLVIR.YESD-------P..T
A7EGI4_SCLS1/28-121--------------------------------------------------E....T..YGIAII.LDSD-------V..N
Q0D1Y4_ASPTN/25-114--------------------------------------------------P....D..YTIEII.DDSD-------T..S
B6HCY9_PENCW/34-123--------------------------------------------------T....T.HYGLLLV.VEGT-------...G
B6HHI6_PENCW/26-115--------------------------------------------------P....D..YTIRIV.SDDD-------S..N
A2QKG4_ASPNC/25-128--------------------------------------------------D....ANAYFLRIAASGPD-------A..S
Q0CR38_ASPTN/36-125--------------------------------------------------T....T.HYGLLLV.VEGT-------...G
A2QVV0_ASPNC/26-118--------------------------------------------------N....G..YQLNAESNTTH-------N.TG
C1H4S8_PARBA/33-122--------------------------------------------------E...SG..YGIQIV.VEGT-------...G
Q7S2L6_NEUCR/26-121--------------------------------------------------N....T..YGIQIT.LESN-------E..K
B8N159_ASPFN/34-123--------------------------------------------------V....T.HYGLLLV.VEGT-------...G
D5GFD8_TUBMM/26-114--------------------------------------------------A....N..YAIQIG.DDKT-------...T
A1CRU4_ASPCL/33-122--------------------------------------------------V....T.HYGLLLV.VEGT-------...G
D5GM66_TUBMM/42-127--------------------------------------------------D....D..YSIQII.SGSA-------S...
F2PZN6_TRIEC/32-120--------------------------------------------------N....A..YGLLIV.VEGT-------...G
Q0CHH6_ASPTN/24-127--------------------------------------------------VP..EA..YFLKMV.SSGP-------D.AF
C5FT49_ARTOC/32-121--------------------------------------------------H....T.HYGIQII.VEGT-------...G
B2AAC8_PODAN/29-122--------------------------------------------------V....V..YGIRID.SETN-------S..T
Q2H7L4_CHAGB/21-113--------------------------------------------------G....G..YQFNFESTETQ-------N.TG
Q7SAW7_NEUCR/22-114--------------------------------------------------S....D..FQFNFQSVDPL-------N.QG
C5FWV4_ARTOC/24-110--------------------------------------------------P....D..YALQIS.QGGE-------I...
A2R6F8_ASPNC/22-109--------------------------------------------------S....D..YEIEII.DSSG-------E...
E4UYI9_ARTGP/25-109--------------------------------------------------T....D..YALQIS.QGSE-------I...
A1CAW6_ASPCL/34-123--------------------------------------------------T....S.QYGLLLV.VEGT-------...G
A1CSI8_ASPCL/24-127--------------------------------------------------N....A..YFLKMV.SFGP-------E.AF
B8NC02_ASPFN/24-127--------------------------------------------------N....A..YFLKMVASGPD-------A..H
Q5KDL8_CRYNJ/23-123--------------------------------------------------G...VA..FQINLVSTDAK-------N.SG
Q6C361_YARLI/23-112--------------------------------------------------D....N..YALRIN.PVEN-------A..D
B6GZR8_PENCW/21-113--------------------------------------------------K....G..YQINFL.SPTS-------...G
F2PGU7_TRIEC/23-112--------------------------------------------------G....K..YTIQIL.DDSD-------P..N
A7EUB0_SCLS1/23-127--------------------------------------------------V....TNAYFMRMIATAKA-------G.GT
A5DZ86_LODEL/24-129--------------------------------------------------G....Y..YYFQIYTVFTN-------G.AD
E3Q6D6_COLGM/28-123--------------------------------------------------A....F..YGLVIK.SEAN-------P.SV
E4V0G9_ARTGP/32-120--------------------------------------------------S....A..YGLLIV.VEGT-------...G
C5MA15_CANTT/26-134--------------------------------------------------G....Y..YYFQIYTVFNS-------G.GV
C1H1P3_PARBA/23-108--------------------------------------------------N....N..YALQIS.QGTD-------V...
D4AQH0_ARTBC/23-112--------------------------------------------------G....L..YTVQII.DDND-------P..S
C7YHH8_NECH7/28-122--------------------------------------------------N....V..YGLVIK.LESN-------P..E
C4Y066_CLAL4/23-125--------------------------------------------------G....E..YFVQVFAKVKN-------G.YT
B6QKW0_PENMQ/38-129--------------------------------------------------ATSAGG..YGIMLI.DYAT-------E...
D5G4J1_TUBMM/33-122--------------------------------------------------V....S.RYGIQLI.DDAT-------...G
B6K4G1_SCHJY/20-108--------------------------------------------------D....D..YLIQIS.ADGV-------E...
Q6C605_YARLI/30-115--------------------------------------------------S....D..YSIEIT.TFNG-------D...
C9SIL5_VERA1/23-107--------------------------------------------------G....Q..YAFEIN.DGTE-------P...
B6H0V5_PENCW/27-112--------------------------------------------------D....T..YAFQIK.QKDQ-------T...
D4AU53_ARTBC/24-118--------------------------------------------------N....G..YFLEAVLNGMQ-------G...
B2AYJ8_PODAN/22-108--------------------------------------------------G....D..YAFVIE.DESE-------D...
ADG2_SCHPO/23-113--------------------------------------------------Y....G..YQISFT.SIRD-------D.SV
B6K5U7_SCHJY/24-125--------------------------------------------------K....Y..YFITAK.TTYQ-------N.AD
F2PGP2_TRIEC/26-109--------------------------------------------------S....D..YALKLS.QGDE-------V...
F4R679_MELLP/25-115--------------------------------------------------D....G..YQVQMV.NSTN-------A.TQ
A0A0D2X9S1_FUSO4/29-122--------------------------------------------------N....V..YGLVLK.LESN-------P..E
YA880_ASPFU/20-112--------------------------------------------------S....G..YQINFVSRDPQ-------N.TG
Q4X259_ASPFU/23-126--------------------------------------------------EA..NA..YFLKMV.ASGP-------E.AF
W1QB36_OGAPD/25-129--------------------------------------------------G....Y..YYVQIYADYGS-------E.SY

PF14610

E7KR15_YEASL/143-348FLYVNGKNR.DFT
F2SX36_TRIRC/36-210LCFGMKHQR.RIG
G4UZV9_NEUT9/108-328FAVWGYRRKGAVP
F7VWB3_SORMK/105-312FAVWGYRKNGTVP
F7VVQ9_SORMK/107-312YVHRKRKER.NGT
G2RFM8_THITE/101-302TFFWNRQARGALG
Q2HEH3_CHAGB/51-243TFCWNRQLR.RIG
G0SBV9_CHATD/37-238LSCWNRNIR.RIG
B2AB99_PODAN/55-252TLCCNRGVR.RID
Q7SHQ4_NEUCR/102-274TCLMNRKLR.RIG
K0KVS1_WICCF/158-358FVWITGNDR.DIT
Q6BJD6_DEBHA/186-420FVMINNKNI.DLS
G8YQZ0_PICSO/169-402FVLVNRRYI.DLS
C5M6D3_CANTT/179-426FVRINK..I.DLS
M3HTK0_CANMX/180-423FVKINK..V.DLS
Q5ALP3_CANAL/183-415FVTINK..I.DLS
A5DUS0_LODEL/182-440FVTINR..V.DLS
G8BE66_CANPC/178-417FVRINR..F.DLS
G3ALN4_SPAPN/171-413FVTWNR..V.DLS
C4Y8N7_CLAL4/171-410FVLLNKRNT.DLS
G3BDP8_CANTC/194-413FVKVNK..V.DLS
A3LTE4_PICST/172-410FVYMNK..V.DLS
A5DPS3_PICGU/179-400FVMVNKKNT.DLS
W1Q7J0_OGAPD/172-397FLYINRKHR.DLS
C4QW75_PICPG/183-411FLYLKRNQR.DVS
C5DCM9_LACTC/172-377FLYLNRSHR.DIH
I2H836_TETBL/144-352FLHLNRGTR.DIS
G8C1B3_TETPH/142-354FIRINKGYR.DFS
A7TP99_VANPO/141-347FLRINKGNR.EFS
J6EF38_SACK1/143-348FLYANGNNR.DFT
G8ZQF2_TORDC/141-346FLYANGRYR.DFS
Q6FL99_CANGA/140-343FLYLNKGNR.DFS
H2ASP6_KAZAF/140-345FLHYNGKYR.DFS
G0VJF2_NAUCC/140-345FLHVNGRYR.DFS
J7R9B9_KAZNA/141-346FLQLNGKNR.DFS
S6EMF2_ZYGB2/143-349FINANRSQR.DFS
C5E3Y8_ZYGRC/144-350FIIANRRYS.DFS
Q6CII5_KLULA/141-345FVQLNARYR.DFS
G8JRZ2_ERECY/140-345LSQCTGKYR.DFS
Q759Y9_ASHGO/138-340FLQWNRRYT.DFS
G0V7C8_NAUCC/126-332SITLGNRRI.NIA
Q6C7P0_YARLI/176-370FTQITAGAR.AIP
B6JVR8_SCHJY/4-173IHFTTQHLR.KIR
B6K6T0_SCHJY/56-228YHAHTKDTW.RYW
YJH4_SCHPO/59-231YYAYRKDTW.KIY
S9VUT8_SCHCR/61-233YHTYRRDTW.RIF
K0KK07_WICCF/110-307VWFLNKQKK.SVS
C4QWF6_PICPG/111-305YWYINKQKK.QGL
Q6CIA6_YARLI/116-314LYYRQKKTK.QQQ
W1QAS6_OGAPD/112-323YIFMARNRR.KVK
Q6BZL9_DEBHA/112-314YYLLKKRKN.AIN
W1QBS4_OGAPD/90-282YF...RRMHGKTS
R4XDW1_TAPDE/79-247VMWWNKGHR.QIP
C0NMX3_AJECG/43-218LYFGMKKNR.RIG
C4JRR4_UNCRE/96-271LCIGMRKHR.RIG
C5FUR6_ARTOC/94-268LCIGMKQHR.RIG
A1CHY8_ASPCL/61-233LFFGMRRSR.SIG
Q4WPU1_ASPFU/105-277LAFGMRKSR.KTG
B8N0W6_ASPFN/54-226LFFGMRESR.RIG
Q0CZH9_ASPTN/60-232LFFGMRDSR.RVA
A2QJ97_ASPNC/58-230LYFGMRESR.RID
V5GAK7_BYSSN/48-220LYFGMRKNR.RIG
G1WZ94_ARTOA/154-335LHFCNKDKR.SIG
D5GJC4_TUBMM/82-276LHFCMKSKR.TVG
S3D288_GLAL2/86-258GFFWNRHAR.RIG
M7UCH7_BOTF1/126-298TWYCNRKRR.SIG
L8GC21_PSED2/77-244GFWWNRHAR.VIG
R8BN65_TOGMI/97-270TCIWNRKTR.KIA
M7T6A2_EUTLA/72-242TCIWNRKAR.HIN
G4N739_MAGO7/92-273TCVWNRNAR.RID
J3NI78_GAGT3/85-259TLVWGKKYR.NIG
S3DAU9_OPHP1/88-263TCIWNKRHR.HID
U7Q5H4_SPOS1/87-262TCIWNHRTR.RIG
F0XN07_GROCL/70-257TFLWNRHHR.HIG
T0LYK6_COLGC/98-275GCLWNRKTR.QIG
N4V5Y8_COLOR/97-274GCLWNRSRR.KVG
E3QIV8_COLGM/98-275GCLWNRSTR.KIG
C7YI59_NECH7/103-283VCLWNRKTR.RIG
N4TUU6_FUSC1/103-282GFLWNRKTR.RIG
A0A016PKX7_GIBZA/103-281GFLWNRKTR.HIG
G9MI93_HYPVG/76-257LFLWNRKTR.RIE
G9P9M5_HYPAI/91-271LFMWNRKSR.RIE
G0RMV7_HYPJQ/90-271VFLWNRSAR.RIH
M1W790_CLAP2/102-282VSLWNRQAR.RIE
E9EC26_METAQ/105-276GCLWNRKTR.RIE
G3JNR1_CORMM/103-282LALWNRKTR.RIH
L2FIS3_COLGN/71-235WFVWWYGRR.KGM
N4VIV2_COLOR/67-241WFIWWYGRR.KGM
E3Q7V2_COLGM/73-250WFVWWYGRR.RGM
H1V1D4_COLHI/73-245WFVWWYGRR.KGM
G2X1H8_VERDV/74-237IFVTVRIRKRRVA
C9SDE3_VERA1/93-290AFCLFRRKR.RGA
N4VPP0_COLOR/101-271LWLYYRRRR.RHA
E3Q9B7_COLGM/100-269LWLYIRRHR.RHA
U7PRC0_SPOS1/91-269FCVWSYRHHGHLP
R8BXA7_TOGMI/105-275LCFWSWRRHGHVL
J3NQ86_GAGT3/103-279FCFWSWRKK.GVV
G4N0X6_MAGO7/103-276YCFWSYRKK.ALV
F0X8Q1_GROCL/88-255FCAWSWRRYGRVL

PF10342

Q5B872_EMENI/24-116IYAQGERFT---V
Q5B820_EMENI/22-115ILAQSEQFN---V
Q5B5Y1_EMENI/34-126AYQWSTQFG---I
B8NI76_ASPFN/21-113IYAQGDRFT---V
E3Q5K2_COLGM/21-113IYAQTPKFS---I
Q2UIS7_ASPOR/22-115ILAQSQQFN---V
B8N4F3_ASPFN/22-112ILAQSQIFN---V
A2RAR3_ASPNC/34-123QYQYSVQFG---I
B8MDX6_TALSN/31-120IVNYSARFD---I
B6QM89_PENMQ/27-116FVNYSPRFA---I
B6H8T2_PENCW/22-115ILAQSEQFD---V
E9EW85_METRA/26-120IFQYSNPFH---I
A7EGI4_SCLS1/28-121TFQWSFPFK---I
Q0D1Y4_ASPTN/25-114EVNYLPRFT---V
B6HCY9_PENCW/34-123QYQYSTQFG---I
B6HHI6_PENCW/26-115DYNYIGRFT---V
A2QKG4_ASPNC/25-128VVNYSDRFT---L
Q0CR38_ASPTN/36-125QYQWSTQFG---I
A2QVV0_ASPNC/26-118ILSQSQQFN---V
C1H4S8_PARBA/33-122QYQYSTQFG---I
Q7S2L6_NEUCR/26-121VFQYSFPFH---I
B8N159_ASPFN/34-123QYQYSTQFG---I
D5GFD8_TUBMM/26-114DVNYTPLLT---V
A1CRU4_ASPCL/33-122QYQWSTQFG---V
D5GM66_TUBMM/42-127..NYSPKFG---I
F2PZN6_TRIEC/32-120EYQYSTQFG---V
Q0CHH6_ASPTN/24-127TINYSHRFS---I
C5FT49_ARTOC/32-121QYQYSTQFG---V
B2AAC8_PODAN/29-122RFQWGNPFT---I
Q2H7L4_CHAGB/21-113ILAQSEQFE---V
Q7SAW7_NEUCR/22-114ILAQSEQFE---V
C5FWV4_ARTOC/24-110..NYTGLFT---I
A2R6F8_ASPNC/22-109.LAVSPTFT---V
E4UYI9_ARTGP/25-109..NYTGLFT---I
A1CAW6_ASPCL/34-123QYQYSTQFG---V
A1CSI8_ASPCL/24-127AINFSERFT---L
B8NC02_ASPFN/24-127VINFSDRFT---L
Q5KDL8_CRYNJ/23-123ILAQSEQFN---I
Q6C361_YARLI/23-112DVNYTGQFK---I
B6GZR8_PENCW/21-113ILAQSQQFR---V
F2PGU7_TRIEC/23-112QYNFTPTFM---V
A7EUB0_SCLS1/23-127VTVYSDRFS---I
A5DZ86_LODEL/24-129TIHYSPRFK---L
E3Q6D6_COLGM/28-123DFQYSNPFH---I
E4V0G9_ARTGP/32-120EYQYSTNFG---I
C5MA15_CANTT/26-134TIHYSPRFK---L
C1H1P3_PARBA/23-108..NYGSLFS---I
D4AQH0_ARTBC/23-112KYNFTPSFM---V
C7YHH8_NECH7/28-122VFQYSNPFK---I
C4Y066_CLAL4/23-125IH.YTNRFK---L
B6QKW0_PENMQ/38-129AYQYTTQFG---V
D5G4J1_TUBMM/33-122KYQYTTQFG---V
B6K4G1_SCHJY/20-108.SSYSKYFT---L
Q6C605_YARLI/30-115NVNYSPNFT---I
C9SIL5_VERA1/23-107..NYSVQFP---L
B6H0V5_PENCW/27-112..NYTALLK---G
D4AU53_ARTBC/24-118...YSYRFT---L
B2AYJ8_PODAN/22-108PRNFSPAFP---L
ADG2_SCHPO/23-113IYAQSGTFY---I
B6K5U7_SCHJY/24-125VYYYSDYFT---I
F2PGP2_TRIEC/26-109..NYTGLFT---V
F4R679_MELLP/25-115VYASSGTFS---V
A0A0D2X9S1_FUSO4/29-122VFQYSFPFK---I
YA880_ASPFU/20-112ILAQSQQFK---V
Q4X259_ASPFU/23-126AINFSNRFT---L
W1QB36_OGAPD/25-129TIHYTDRFK---L

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window