Sequence alignment for CL0539

PF14622

RM15_SCHPO/67-197DKSLREQIVTHKSY....K....H.....G....L..K....R....Y....NEPFVSVGNAV...ID..V....C....
B6JY03_SCHJY/37-168SDELNLQLLTHKSF....N....H.....G....Q..T....P....Y....NEGFRAIGRHA...LE..L....S....
Q7S1R6_NEUCR/117-265SEETKWLAVTHKSF....D....Y.....G....R..R....G....Y....NTRLAFLGRQI...IA..LETTRSILTS
Q2GMI6_CHAGB/267-400PDEIKWLAITHKSF....D....Q.....G....R..R....G....F....NTRLAYFANARDPPTQ..D....S....
F2QVA9_PICP7/51-190DNELLLQILTHKSF....A....H.....G....L..K....P....Y....NEKLSVIGFQL...LK..L....Q....
A8Q4V0_MALGO/115-263EETLVSHALTHESW....M....H.....G....M..Q....G....H....NRRLAFIGRRA...LKTYL....S....
B9W9P9_CANDC/72-210PDEIALQVITHKSF....G....N.....G....I..K....P....Y....NEKLAAMGSKL...LS..L....Y....
Q4P7G0_USTMA/113-257NPDLALRAVTHESY....L....N.....A....R..E....G....H....NRRFAFLGRRT...LK..L....LT..T
B1QQ64_CLOBO/21-154NEKLLDVALTHSSY....A....N.....G....K..KN..IK....Y....YERLEFLGDSV...LQ..L....I....
A5E1N1_LODEL/106-245DDV.ALQIITHKSF....G....N.....G....M..K....P....Y....NIKLSVMGSKL...LK..L....Y....
D5X4R4_THIK1/15-139DRKLFERALTHRSF....G..................A....D....H....NERLEFLGDSV...LN..L....S....
D0BJZ8_9LACT/21-153NENYLKEALTHSSY....A....N.....E....H..K....DCKGIY....NERIEFLGDAV...LE..L....F....
E0E418_9FIRM/25-155NKTYIQTALTHSSF....A....N.....E....H..KE..FN....Y....NERLEFLGDSV...LG..L....V....
B0AAQ8_9FIRM/24-157NKEYILEALTHSSY....S....N.....E....N..KN..YP....F....NERLEFLGDSV...LS..I....V....
C4Z0E7_EUBE2/19-151DISLLEVALTHSSYANEQK....K.....G....N..C....C....D....NERMEFLGDAV...LE..L....S....
RNC_BORA1/16-141DQALLEQALTHRS..........H.....G....A.......R....H....NERLEFLGDSV...LN..F....V....
F2MX01_PSEU6/18-139DQELMLLALTHRSY....A..........G............R....N....NERLEFLGDAI...LN..FVAGEA....
A5ZPT6_9FIRM/14-146NKKLLKQALTHSSY....A....NEK.KLG....K..L....G....C....NERLEFLGDAV...LE..L....I....
RNC_MESFL/16-146DSKIFSTALTHNSY....A....N.....E....T..KT..KE....T....YQRLEFLGDAV...LQ..M....Y....
RNC_LEIXX/20-149DPELLELALTHRSYA..YE....N.....G....G..I....P....N....NERLEFLGDSI...LG..Q....A....
E7P1S1_PSESG/18-139DQELMVLALTHRSF....A..........G............R....N....NERLEFLGDAI...LN..F....V....
RNC_CUPPJ/16-141KPELLQQALTHRSH....S..................A....Q....H....NERLEFLGDSV...LN..C....A....
RNC_THELT/22-156EPELLYNALCHSSY....A....HEQKQRG....R..K....DV..ES....NERLEFLGDAV...ID..L....L....
A7B5M4_RUMGN/41-173DFSLLEQAMMHSSY....T....N.....E....KHLE....K....YH..CNERLEFLGDAV...LE..L....V....
C8W586_DESAS/21-152DENLLWQALTHSSYV..YE....S.....G....SAAH....T....N....NQRLEFLGDAV...LE..L....L....
E4RLQ9_HALSL/23-154NKKLLQRALTHKSF....P....N.....E....N..K....N....LSIKDNERLEFLGDSV...LS..L....A....
C0CHF6_9FIRM/25-157DINLLKQAVTHSSYSNEKN....M.....G....K..L....G....C....NERLEFLGDAV...LE..V....I....
D4LHQ1_9FIRM/18-150AKSLLEQAMTHSSY....A....NEK.HLG....K..L....G....C....NERLEFLGDAV...LE..L....I....
D8DXQ2_PREBR/33-161DIKLYKQALMHKSI....M....HRN.SKG....K..P....V....N....NERLEFLGDAI...LD..A....I....
A4G6R8_HERAR/16-141DAVLMQQALTHRSH....S..................S....V....H....NERLEFLGDSI...LN..C....V....
C4V2U1_9FIRM/26-157DLSLLEEALTHPSY....V....NE..ARE....R..A....T....H....NERLEFLGDAV...LE..L....A....
E9RSL3_9FIRM/47-179KKELLQKAMMHSSYT.NEK....H.....M...KK..Q....D....C....NERLEFLGDAV...LE..L....T....
C5EV89_9FIRM/18-150DQSLFSQALTHSSY....A....N.....E....H..RLDHSR....C....NERLEFLGDAV...LE..I....V....
B7ANP9_9FIRM/26-158DVSLLKHALTHSSY....A....N.....ELRINK..T....G....N....NERLEFLGDAV...LE..L....V....
C0B4M7_9FIRM/39-171DSHLLRHAVTHSSYV.NEK....H.....M....K..K...AD....C....NERLEFLGDAV...LE..L....I....
C8NEF3_9LACT/21-153NEALLMEAMTHSSY....A....N.....E....H..K....EMKGIY....NERIEFLGDAV...LE..L....T....
E0TKT7_MYCHH/17-144DLSLYEQAFTHKSY....H....H.....V....RPNK....P....H....YEMLEFLGDSL...LN..L....Q....
C9L8J0_RUMHA/47-179NFDLLVNALTHSSY....A....NEH.HIA....Y..K....E....N....NERLEFLGDAV...LE..L....T....
B6BPF5_9PROT/18-138NTNLLIQSLTHKSH....N....S.............L....K....N....NEKIEFLGDRV...LG..L....V....
A1SLU8_NOCSJ/48-177DPELLERALTHRSFA..YE....N.....G....G..L....P....T....NERLEFLGDSV...LG..V....V....
Q2LVR4_SYNAS/22-153DITLLDNALVHRSY....V....N.....E....N..PS..LS....FA..DNERLEFLGDAV...LE..L....C....
E1T562_BURSG/16-140NAELLRQALTHRSH....S..................S....T....H....NERLEFLGDSV...LN..C....A....
C2KW20_9FIRM/24-156DQKLLLHALTHPSY....SNEMGH.....P....K..E....A....S....NQRLEFLGDAV...LE..L....V....
E8NDE2_MICTS/20-149DPELLSLALTHRSFA..YE....N.....G....G..I....P....H....NERLEFLGDSV...LG..Q....A....
B0M9W6_9FIRM/19-151DKKLLTTALTHSSY....A....N.....E....R..KLSRGK....D....NERLEFLGDAV...LE..L....I....
E4TJ04_CALNY/16-145NKELLIEALTHSSY....S....Y.....E....N..KL..CR....N....YERLEFLGDAV...LQ..L....I....
D4J805_9FIRM/20-152DENLLFTALTHSSY....A....N.....E....H..KLHKIH....H....NERLEFLGDAV...LE..V....V....
E8UCB0_TAYEM/16-140DIKLLNRALTHRSF....S....S..................T....H....NERLEFLGDSI...LN..F....S....
C3X4M2_OXAFO/22-146DAALLETAMTHRSY....S..................S....H....H....NERLEFLGDSL...LN.CV....T....
E7GKA5_CLOSY/18-150NRELLGRAMTHSSY....ANECHK.....S....K..L....E....C....NERLEFLGDAV...LE..I....V....
E3DQV9_HALPG/23-155NKFLLERALTHKSY....P....N.....E....N..R....H....LNLKDNERLEFLGDSV...LS..L....S....
A5WCD8_PSYWF/39-165DTSLAKLALTHRSF....D..........G....K..I....N....Y.....ERLEFLGDAL...LG..M....I....
D9R047_CLOSW/18-150DRHLMTQAMTHSSY....A....N.....E....H..RLNKLE....C....NERLEFLGDSV...LE..V....V....
C0ERZ0_9FIRM/20-152NKRTLALAMTHSSYA.NEQ....R.....G....R..R....K...AN....NERLEFLGDAV...LE..V....T....
C0FMS9_9FIRM/17-149QEKLLRQALTHSSFA.NEK....H.....L....R..K...HS....D....NERLEFLGDAV...LE..I....V....
D4CL61_9FIRM/17-149DRELLLHALTHPSY....SN..EQ.....GD..PK..E....A....S....NQRLEFLGDAV...LE..L....A....
RNC_PELTS/21-152DEGLLTRALTHSSF....T....Y.....E....N..R....QNGLEN....NQRLEFLGDAV...LE..L....A....
D9PK52_9ZZZZ/26-157NKSLIELAFIHRSYL.NEN....R.....G....E.VK....E....H....NERIEFLGDAV...LE..L....V....
C6Z037_9BACE/33-161DISIYEQALLHKSLSVKSE....K.....G....R..L....L....N....NERLEFLGDAI...LD..A....V....
A6BED1_9FIRM/22-154DFTLFTKAMIHSSY....A....N.....E....K..HL..PK....YE..CNERLEFLGDAV...LE..L....V....
A9KLR1_CLOPH/23-155EPGLLRQALTHSSF....A....N.....E....K..RLSKLA....N....NERLEFLGDAV...LE..L....T....
E8ULD9_STREJ/18-150DLNLLETAFTHTSY....A....N.....E....H..RLLKIS....H....NERLEFLGDAV...LQ..L....M....
D0MGH0_RHOM4/39-171NAALYEQALTHRSV....L....R.....G....Q..PDSHLH....S....NERLEFLGDAV...LG..F....V....
E9S866_RUMAL/20-147NDRLLYEALSHSSFA.NEN....K.....K....Q..R....H....S....NERLEFLGDSV...LS..I....V....
B4VPC8_9CYAN/19-151SDTLR.LALMHRSY....A....EQ...IG....E.SE....Q....N....NERLKFLGDAI...VN..L....V....
A8UFH9_9FLAO/33-161SKSLYIKAFTHRSM....NIKNKN.....G....N..A....I....N....YERLEFVGDAM...LS..S....V....
F2NYA2_TRES6/34-167NYSLLDLAFHHRSY....S....N.....E....N..T....S....YKRYNNERLEFLGDSV...LG..L....A....
D3PAP4_DEFDS/17-146NKSLLLEALTHSSYA..YE....K.....K....L..K....R....N....YERLEFLGDSV...LQ..L....I....
A1HN82_9FIRM/26-157DLGLLHQALVHTSY....AN.EVK.....G....G..V....E....H....NERLEFLGDAV...LE..L....I....
F0S2Z0_DESTD/19-149DKKLLKKALTHKSFS..FE....K.....D....S..E....E....N....YEVLEFLGDAV...IG..L....I....

PF00636

A4XJ79_CALS8/5-105-----------------------------------------------------LVYAYIGDAV---YE--L----Y----
C1KYH3_LISMC/13-114-----------------------------------------------------LALAYMGDAV---YE--K----F----
Q4WU14_ASPFU/35-122-----------------------------------------------------PRLAFLGDKV---VG--L----I----
RTL2_ARATH/93-203-----------------------------------------------------ERLEFIGDSA---IG--L----A----
DCL1_ASPFU/1291-1405-----------------------------------------------------QRLEFLGDSL---LD--M----V----
Y3330_ARATH/256-318-----------------------------------------------------KSLK...DVF---LK--H----S----
A6SJD6_BOTFB/200-296-----------------------------------------------------EGLAKLGETA---IR--L----V----
Q0F3I4_9PROT/44-134-----------------------------------------------------ERLEFLGDAV---LG--L----V----
RNC_WOLTR/54-144-----------------------------------------------------ERLEFLGDSI---LN--M----I----
A5CEW8_ORITB/60-150-----------------------------------------------------QRLEFLGDVI---LN--L----V----
A6DUU1_9RHOB/42-132-----------------------------------------------------QRLEFLGDRV---LG--L----V----
RNC_BRAJA/60-150-----------------------------------------------------QRLEFLGDHV---LG--L----V----
A5V2R4_SPHWW/51-141-----------------------------------------------------ERLEFLGDRV---LG--L----V----
RNC_SPHAL/39-129-----------------------------------------------------QRLEFLGDRV---LG--L----V----
RNC_RHIEC/47-137-----------------------------------------------------ERLEFLGDRV---LG--L----C----
A5FV46_ACICJ/38-128-----------------------------------------------------ERLEFIGDRV---LG--L----L----
A3Z4A6_9SYNE/40-129-----------------------------------------------------EQLEFLGDAV---LR--L----A----
Q4C1B8_CROWT/48-137-----------------------------------------------------QQLEFVGDSV---VR--L----V----
Q5MZ89_SYNP6/55-144-----------------------------------------------------DRLEFLGDAV---LR--L----A----
Q80UU5_MOUSE/475-564-----------------------------------------------------QRMEFLGDSI---MQ--L----V----
RNC_CAEEL/870-957-----------------------------------------------------QRLEWLGDSV---LQ--L----I----
Q6BCK1_TETTH/1224-1338-----------------------------------------------------DVLSFLGSII---FS--Q----I----
Q110R1_TRIEI/53-143-----------------------------------------------------QGLANLGYVV---FS--R----V----
A2QMS9_ASPNC/124-236-----------------------------------------------------DRLAFLGKRI---VQ--L----Q----
Q0TYG8_PHANO/64-174-----------------------------------------------------DRLAYLGRRI---VE--L----Q----
Q1XG54_CRYJA/71-157-----------------------------------------------------GALNVLGYNI---IQ--A----A----
Q9FYL8_ARATH/80-167-----------------------------------------------------KALSIFGTHI---IE--T----A----
DCL22_ASPNC/1111-1258-----------------------------------------------------RRLSFLGASV---LE--W----I----
Q2U0L3_ASPOR/1051-1198-----------------------------------------------------RRLSFLGAGI---IE--L----V----
RM03_SCHPO/83-189-----------------------------------------------------EKLWSIGKVF---GD--F----Y----
A7SJH8_NEMVE/129-224-----------------------------------------------------SKLALLGHNL---TS--Q----Y----
Q4PA03_USTMA/211-325-----------------------------------------------------AALATVGNSL---LG--M----L----
A2QRC1_ASPNC/121-242-----------------------------------------------------ESLATLGHDL---LT--H----Y----
RM44_PONAB/123-207-----------------------------------------------------QELSEQGTSF---SQ--T----C----
A6ZM86_YEAS7/153-272-----------------------------------------------------HGLNIMGKNL---LS--Y----H----
RM15_YEAST/105-208-----------------------------------------------------EKLNLLGAQF---LK--L----Q----
Q6FVA4_CANGA/96-187-----------------------------------------------------EKLNLLGSQY---LK--L----Q----
A3LPK0_PICST/184-273-----------------------------------------------------EKLSILGRSL---LE--L----L----
Q6BWD6_DEBHA/187-276-----------------------------------------------------AKLGLRGKRL---LE--F----A----
A5DES0_PICGU/186-275-----------------------------------------------------EKLVLHGRSL---LN--V----A----
A3GHW8_PICST/84-184-----------------------------------------------------EKLSAMGSKI---LN--L----Y----
Q0UQH0_PHANO/7-117-----------------------------------------------------AVDAYIGPKA---LA--I----V----
Q0CCZ5_ASPTN/48-132-----------------------------------------------------KSLALAGDAI---LR--Q----V----
A2C1X8_PROM1/20-117-----------------------------------------------------LQLAWLGDAV---WE--M----H----
A9B9W4_PROM4/20-117-----------------------------------------------------LQLAWLGDAV---WE--M----H----
Q7VCJ3_PROMA/20-117-----------------------------------------------------LQLAWLGDAI---WE--M----H----
B1X410_PAUCH/23-120-----------------------------------------------------LQLAWLGDAV---WE--L----H----
Q067M9_9SYNE/20-119-----------------------------------------------------LQLAWIGDAV---WE--L----H----
A3YYC2_9SYNE/20-117-----------------------------------------------------LQLAWLGDAV---WE--L----H----
A3Z7F5_9SYNE/21-118-----------------------------------------------------LQLAWLGDAV---WE--L----H----
A4CU57_SYNPV/21-118-----------------------------------------------------LQLAWLGDAV---WE--L----H----
Q0I9N3_SYNS3/20-117-----------------------------------------------------LQLAWLGDAV---WE--L----H----
Q7U7F7_SYNPX/20-117-----------------------------------------------------LQLAWLGDAV---WE--L----H----
B5IKV4_9CHRO/2-99-----------------------------------------------------LQLAWLGDAV---WE--L----H----
A8G4M5_PROM2/20-117-----------------------------------------------------IQLAWLGDSV---WE--L----H----
A5GTM3_SYNR3/12-109-----------------------------------------------------AQLAWLGDAV---WE--L----H----
B7KCP4_CYAP7/45-142-----------------------------------------------------ASLAYIGDAV---YE--L----Y----
B7K2P3_CYAP8/45-142-----------------------------------------------------AFLAYLGDAV---YE--L----Y----
D3EMY0_UCYNA/29-126-----------------------------------------------------AFLAYIGDAV---YE--L----Y----
A8YKZ5_MICAE/29-126-----------------------------------------------------ASLAYLGDAV---YE--L----Y----
B4VUK6_9CYAN/43-140-----------------------------------------------------AALAYLGDAV---YE--L----Y----
Q112N8_TRIEI/20-117-----------------------------------------------------SAWAYLGDAV---YE--L----Y----
A0YQT6_LYNSP/17-114-----------------------------------------------------ASWAYLGDAV---YE--L----Y----
B8HT79_CYAP4/37-134-----------------------------------------------------AALAYLGDAV---YE--L----Y----
A0ZGL0_NODSP/61-158-----------------------------------------------------LALAYIGDAI---YE--L----Y----
Q31LB9_SYNE7/26-123-----------------------------------------------------QALAYLGDAL---YE--F----H----
MRNC_SYNY3/28-125-----------------------------------------------------VALAYLGDAV---FE--L----Y----
B4WGA4_9SYNE/42-139-----------------------------------------------------ISLAYIGDAV---FE--L----Y----
B1XNV1_SYNP2/17-114-----------------------------------------------------ASLAYVGDAV---YE--L----Y----
MRNC_THEEB/23-120-----------------------------------------------------AALAYFGDAV---YE--L----F----
Q2JI20_SYNJB/24-121-----------------------------------------------------AALAYLGDAI---YE--L----H----
B7G3M0_PHATC/16-116-----------------------------------------------------TDLAYIGDVV---YE--L----F----
C6T3M8_SOYBN/105-207-----------------------------------------------------ATLAYIGDCI---YE--L----Y----
Q94F12_ARATH/98-200-----------------------------------------------------ASLAFIGDSI---YE--L----Y----
C0PKE8_MAIZE/108-210-----------------------------------------------------VSLAYLGDCI---YE--L----Y----
A9RYU0_PHYPA/18-120-----------------------------------------------------ASLAYLGDSI---YE--V----Y----
C1DXY5_MICSR/99-208-----------------------------------------------------VSFAFLGDAV---WE--L----Y----
Q014M6_OSTTA/451-557-----------------------------------------------------IALAFLGDAV---FE--L----Y----
A8J7A5_CHLRE/55-159-----------------------------------------------------LALAYLGDAV---WE--V----S----
A6GE80_9DELT/16-118-----------------------------------------------------KTLAWLGDAE---FE--R----E----
A6TWK4_ALKMQ/25-124-----------------------------------------------------LVLAYIGDAI---FE--V----Y----
A8MLB8_ALKOO/26-125-----------------------------------------------------LVLAYIGDAL---YE--V----F----
Q8XHQ6_CLOPE/20-120-----------------------------------------------------LQLALIGDGV---YE--V----F----
C1I8F8_9CLOT/21-121-----------------------------------------------------LQLALIGDGV---YE--I----Y----
A3DH39_CLOTH/26-125-----------------------------------------------------LVLAYIGDAV---YE--V----F----
MRNC_SYMTH/12-111-----------------------------------------------------LTLAYLGDAL---YE--A----F----
A5D5M2_PELTS/19-118-----------------------------------------------------LVLAYVGDAV---YE--L----A----
MRNC_MOOTA/10-109-----------------------------------------------------LALAYVGDAV---YE--L----L----
B0TC36_HELMI/34-133-----------------------------------------------------LALAYLGDAV---YE--L----W----
Q0AUF9_SYNWW/16-114-----------------------------------------------------VLLAYVGDAV---FE--L----A----
C0GIM8_9FIRM/8-106-----------------------------------------------------LMLAYVGDAV---FE--L----F----
Q045X7_LACGA/31-132-----------------------------------------------------LTLAYLGDGV---YE--V----Y----
Q3Y164_ENTFC/15-116-----------------------------------------------------LALAYVGDAI---YE--I----Y----
C8WTZ3_ALIAD/13-112-----------------------------------------------------LALAFLGDAV---WE--I----Y----
MRNC_STAA8/15-116-----------------------------------------------------LTLAYMGDAV---LD--Q----Y----
Q8ETZ8_OCEIH/12-114-----------------------------------------------------LALAYIGDSI---FE--L----Y----
B0MM93_9FIRM/17-116-----------------------------------------------------LTLAFFGDSV---YE--V----Y----
E6U8V4_ETHHY/21-120-----------------------------------------------------LALAFIGDAV---YE--L----L----
D4LDD2_RUMC1/15-114-----------------------------------------------------LALAFLGDSV---YE--C----M----
A6P055_9FIRM/19-118-----------------------------------------------------LGLAHLGDGV---FE--L----M----
A5KKA6_9FIRM/30-129-----------------------------------------------------IVLAYIGDCV---FD--L----I----
C5ENC6_9FIRM/5-104-----------------------------------------------------LVLAYIGDAV---YE--L----M----
D1VT13_9FIRM/26-124-----------------------------------------------------LALAYVGDAV---FE--L----L----
B7CDG4_9FIRM/9-110-----------------------------------------------------TSLAWIGDAV---MS--L----A----
B1C8Q3_9FIRM/18-117-----------------------------------------------------KELAYLGDSV---YE--V----N----
C9LVQ2_9FIRM/37-135-----------------------------------------------------LVLAYIGDAY---FH--L----F----
C4V0H2_9FIRM/37-135-----------------------------------------------------LVLAYIGDAY---FH--L----Y----
D4KFD3_9FIRM/37-135-----------------------------------------------------LVLAYVGDAY---YH--L----Y----
C0WE29_9FIRM/32-129-----------------------------------------------------IELAYIGDAV---FS--L----Y----
D1BMT8_VEIPT/47-145-----------------------------------------------------VMLAYIGDAV---YS--M----Y----
C9LMK9_9FIRM/35-133-----------------------------------------------------LTLAYIGDVC---WS--F----F----
D3LUV6_9FIRM/36-134-----------------------------------------------------ITLAFVGDAY---YA--L----F----
B9K831_THENN/17-112-----------------------------------------------------AVLAYVGDAV---LE--L----V----
D2C868_THENR/17-112-----------------------------------------------------AVLAYLGDAV---LE--L----I----
A6LJ32_THEM4/19-114-----------------------------------------------------DSLAYIGDAV---FN--L----Y----
A8F7A2_THELT/9-104-----------------------------------------------------STMAYIGDAI---YS--L----Y----
A9BJB7_PETMO/21-118-----------------------------------------------------ENFSYIGDAV---IG--L----I----
MRNC_KOSOT/20-117-----------------------------------------------------DSLSFVGDAV---YS--L----Y----
C1MLN8_MICPC/114-224-----------------------------------------------------LAYTYLGDAV---WE--L----Y----
C1FDU3_MICSR/76-186-----------------------------------------------------LAYTYLGDAV---WE--L----Y----
A4RR17_OSTLU/28-138-----------------------------------------------------LAFTYLGDAV---WE--L----Y----
D4CVS6_9FUSO/18-116-----------------------------------------------------LELAFIGDAI---WE--L----E----
C3WFU5_FUSMR/12-110-----------------------------------------------------VVLAYLGDSI---WE--L----N----
A7I5W5_METB6/51-140-----------------------------------------------------DAYSTLGDAV---LK--T----S----
A3CVM2_METMJ/43-132-----------------------------------------------------DALRTLGDAV---LK--T----I----
A7I515_METB6/44-134-----------------------------------------------------DPLATVGDAV---LG--A----V----
A3CRH2_METMJ/50-139-----------------------------------------------------DALATLGDAV---IN--V----A----
Q0UMM3_PHANO/145-228-----------------------------------------------------NRLALLGDRV---LS--L----A----
A4GHU1_9BACT/34-120-----------------------------------------------------ERLEFLGDAI---LN--L----Y----
RNC_MYCPN/56-141-----------------------------------------------------DRLEFLGDAL---ID--F----I----
A5Z824_9FIRM/49-157-----------------------------------------------------EVLEFIGDKA---LD--L----S----
A4E6T0_9ACTN/44-134-----------------------------------------------------ERLEFLGDSI---LG--A----V----
RNC_RHOBA/69-158-----------------------------------------------------ERLEFLGDSV---LG--L----T----
A2F201_TRIVA/412-500-----------------------------------------------------ERLEYLGDTV---LD--L----L----
A6GP51_9BURK/26-116-----------------------------------------------------ERLEFLGDSV---LN--C----A----
RM15_SCHPO/89-181-----------------------------------------------------EPFVSVGNAV---ID--V----C----
A6LNE7_THEM4/42-132-----------------------------------------------------ERLEFLGDSV---ID--I----L----
Q4A7X2_MYCH7/44-131-----------------------------------------------------EMLEFLGDSV---IN--Y----A----
A3EQH6_9BACT/58-148-----------------------------------------------------ERLEFLGDRV---IG--L----I----
RNC_CHLPN/45-135-----------------------------------------------------ERLEFLGDAV---LG--L----I----
RNC_LEPBJ/59-149-----------------------------------------------------ERLEFLGDSV---LG--L----V----
RNC_HAEI8/36-126-----------------------------------------------------ERLEFLGDSI---LN--F----T----
A1R7I4_ARTAT/40-130-----------------------------------------------------ERLEFLGDSI---LG--F----S----
A7A3Q3_BIFAD/75-166-----------------------------------------------------ERLEFLGDAV---LE--L----V----
Q3DNE4_STRAG/44-134-----------------------------------------------------ERLEFLGDAV---LQ--L----L----
Q14LC1_SPICI/52-142-----------------------------------------------------QRMEFLGDAI---LA--K----E----
RNC_MYCCT/40-130-----------------------------------------------------QRLEFLGDAI---LQ--M----Y----
D2BI67_DEHSV/54-144-----------------------------------------------------ERMEFLGDAV---LG--V----I----
A9B5J8_HERA2/42-132-----------------------------------------------------ERLEFLGDAL---LN--F----I----
Q1MQV2_LAWIP/41-131-----------------------------------------------------ERLEFLGDAV---LE--I----C----
RTL1_ORYSJ/62-168-----------------------------------------------------QRLEFLGDAA---LG--L----A----
RNC_MYXXD/55-145-----------------------------------------------------QRLEFLGDSV---VN--L----A----
Q1CTK8_HELPH/52-142-----------------------------------------------------ERLEFLGDAV---LG--L----V----
A9BIG2_PETMO/59-148-----------------------------------------------------ERLEFLGDAV---LE--L----V----
Q1IJU6_KORVE/51-141-----------------------------------------------------EQLEFIGDSV---LA--F----V----
RNC_BDEBA/44-134-----------------------------------------------------EKLEFLGDAV---LD--L----V----
A0YTK7_LYNSP/34-125-----------------------------------------------------ERLEFLGDAV---LG--F----L----
A3CSF0_METMJ/81-165-----------------------------------------------------ERLEFLGNYV---LD--F----V----
RNC1_SYNY3/35-125-----------------------------------------------------DRLEFLGDAV---LG--F----V----
A2RV16_DANRE/886-976-----------------------------------------------------ERLEFLGDAV---VE--F----L----
B3EKH3_CHLPB/78-168-----------------------------------------------------QRLEFLGDAV---LD--L----I----
A4BWV8_9FLAO/58-144-----------------------------------------------------ERLEFLGDSI---LG--A----V----
RNC_BACFN/59-145-----------------------------------------------------ERLEFLGDAI---LD--A----I----
A7K823_9PHYC/78-168-----------------------------------------------------ERLEFLGDSV---LG--F----L----
RNC_MYCS5/49-139-----------------------------------------------------ERLEFLGDSL---VG--F----L----
RNC_AQUAE/37-121-----------------------------------------------------ETLEFLGDAL---VN--F----F----
A4GK15_9BACT/37-125-----------------------------------------------------EVFEFLGDSV---LN--L----I----
Q83VA6_9MOLU/41-129-----------------------------------------------------ERLEFLGDSV---IN--F----F----
A5UJK3_METS3/37-127-----------------------------------------------------ERLEFLGDSV---LN--M----I----
RNC_PELUB/38-127-----------------------------------------------------EKIEFLGDRV---LG--L----I----
Q64AH3_9ARCH/53-141-----------------------------------------------------QTLEFLGDRV---LS--L----I----
RNC_MIMIV/351-441-----------------------------------------------------ERLQFLGDAV---IH--F----I----
RNC_MIMIV/65-149-----------------------------------------------------ERLEYLGDAI---FH--M----I----
Q8EW40_MYCPE/52-139-----------------------------------------------------QRLEFLGDAV---IS--K----L----
RNC_UREPA/43-140-----------------------------------------------------QRLEFLGDAC---VE--W----V----
RNC_MYCGA/469-556-----------------------------------------------------QRLEFLGDAI---IN--K----I----
Q4SZJ7_TETNG/259-381-----------------------------------------------------QRLEFLGDAI---LD--Y----L----
A7SKX2_NEMVE/37-156-----------------------------------------------------QRLEFLGDAL---LD--F----L----
A7IYQ4_9BRYO/1379-1492-----------------------------------------------------QRLEFVGDAV---LD--H----L----
DCL4_ARATH/1327-1436-----------------------------------------------------QRLEFLGDAV---LD--Y----L----
DCL4_ORYSJ/1249-1358-----------------------------------------------------QRLEFLGDAV---LE--Y----V----
A7SIA4_NEMVE/44-167-----------------------------------------------------EQLEFLGDAL---LD--Y----L----
Q2Q3U9_DROSI/1464-1620-----------------------------------------------------QELEFIGDAI---LD--F----L----
RTL3_ARATH/445-551-----------------------------------------------------QGLMFVGESA---LS--L----A----
RTL3_ORYSJ/76-183-----------------------------------------------------ERLEYLGDAV---LT--C----V----
DCR1_SCHPO/1120-1233-----------------------------------------------------QQLEFLGDAV---LD--Y----I----
A4VD87_TETTS/1607-1720-----------------------------------------------------QRLEFLGDAV---LD--L----I----
Q3SD86_PARTE/1582-1697-----------------------------------------------------ERLEFLGDSV---LD--S----V----
Q55FS1_DICDI/1250-1335-----------------------------------------------------QRLEYVGDAV---LD--F----F----
DCL_GIAIC/333-418-----------------------------------------------------QRLELLGDAV---LG--F----I----
DCL2_EMENI/1092-1250-----------------------------------------------------QRLEFLGDAV---LD--M----L----
DCL2_NEOFI/1134-1281-----------------------------------------------------QRLEYLGDAV---LD--M----V----
A7EYF3_SCLS1/1216-1363-----------------------------------------------------ERLEFLGDAI---LD--N----I----
DCL2_PHANO/1130-1270-----------------------------------------------------ERLEFLGDAV---LD--Y----I----
A5IYM8_MYCAP/40-130-----------------------------------------------------QTLEFLGDAI---LQ--F----Y----
RNC_MYCMO/47-135-----------------------------------------------------DILEFIGDAI---LQ--M----K----
Q57XF2_TRYB2/735-814-----------------------------------------------------EILEFIGDAI---MD--F----I----
Q3SE73_PARTE/554-687-----------------------------------------------------ERLEFFGDAI---LE--L----L----
Q6BCJ7_TETTH/1048-1163-----------------------------------------------------QILEFLGDAL---IE--I----L----
Q3SE70_PARTE/522-610-----------------------------------------------------DRLEFLGDAA---IE--L----L----
A2F201_TRIVA/593-691-----------------------------------------------------ERIEFIGDLI---VK--Y----S----
A0DYG6_PARTE/384-498-----------------------------------------------------ELLETLGDSI---LK--Y----L----
Q6CC90_YARLI/191-332-----------------------------------------------------ERLEFVGDSI---VN--N----I----
Q0UFS5_PHANO/190-279-----------------------------------------------------ERLEYLGDAY---IE--L----I----
Q6FQ28_CANGA/457-550-----------------------------------------------------ERLEFLGDSV---IN--S----I----
A6RQB2_BOTFB/172-263-----------------------------------------------------ERLEWVGDAY---IY--T----I----
A1CZL8_NEOFI/163-252-----------------------------------------------------DRLEILGDAY---IE--L----I----
Q152U6_SCHPM/172-262-----------------------------------------------------ERLEFLGDSF---FN--L----F----
A3LS79_PICST/241-330-----------------------------------------------------ERLEFLGDSV---LN--N----L----
Q4PCH5_USTMA/903-1023-----------------------------------------------------ERLEQLGDSI---VN--M----S----
Q3SE71_PARTE/360-463-----------------------------------------------------ENLELLGDSV---LK--Y----V----
Q0E579_SFAVA/192-324-----------------------------------------------------EYFEYIGDSV---IN--R----F----
Q9DSW1_9VIRU/45-139-----------------------------------------------------EFFEQLGDLT---IN--K----F----
Q5GAH0_9VIRU/44-137-----------------------------------------------------EALEIVGDGL---AG--C----F----
Q4KS72_ISKNV/58-156-----------------------------------------------------EWYEKLGDAI---IA--S----V----
A3CW87_METMJ/121-210-----------------------------------------------------GALAWIGDAA---LK--I----G----
Q6T445_LEIMA/391-483-----------------------------------------------------ERLEYIGDNC---WG--N----N----
Q27IU0_DROSI/1685-1862-----------------------------------------------------ERLETIGDSF---LK--Y----A----
DCR1_CAEEL/1348-1524-----------------------------------------------------ERFETIGDSF---LK--F----A----
DICER_DANRE/1295-1551-----------------------------------------------------ERLEMLGDSF---LK--H----A----
DCL2A_ORYSJ/1006-1124-----------------------------------------------------ESLETLGDSF---LK--Y----V----
Q2Q3V3_DROSI/1205-1377-----------------------------------------------------ERLEILGDSF---LK--L----C----
Q7Q073_ANOGA/1215-1375-----------------------------------------------------ERFEVLGDAF---LK--F----A----
DCL_GIAIC/646-734-----------------------------------------------------QKLELLGDAF---LK--C----S----
A2XBW0_ORYSI/1353-1498-----------------------------------------------------ERAELLGDAY---LK--W----V----
A6R2T0_AJECN/946-1054-----------------------------------------------------QRIEFLGDSI---LK--F----Q----
DCL2_PHANO/947-1054-----------------------------------------------------QRLEFLGDCI---LK--F----I----
DCL2_ASPCL/955-1060-----------------------------------------------------QRYEFLGDSI---LK--F----S----
DCL2_NEUCR/998-1113-----------------------------------------------------ERLEFIGDTI---LK--F----C----
Q6BCJ9_TETTH/1328-1487-----------------------------------------------------ERYEFLGDTV---LK--C----L----
A3LUF0_PICST/251-366-----------------------------------------------------SFLDGLGDLF---LA--H----E----
Q6BCJ7_TETTH/752-862-----------------------------------------------------ELLEVIGDVV---IK--Y----I----
Q5KKA7_CRYNJ/521-644-----------------------------------------------------ERLEILGDTL---LK--F----M----
Q3SE73_PARTE/363-464-----------------------------------------------------QNLEMLGDVV---IK--Y----L----
Q95ZG5_DICDI/926-1010-----------------------------------------------------QRLEFLGDSV---LK--I----T----
DCL1_ASPNC/1080-1192-----------------------------------------------------ERLEFLGDCF---LK--M----A----
DCR1_SCHPO/930-1038-----------------------------------------------------DRLEFYGDCF---LK--L----G----
Q3SD86_PARTE/1325-1459-----------------------------------------------------QVLEFLGDAN---LK--L----L----
Q0E5R5_MUCCI/1080-1190-----------------------------------------------------QRLEFLGDSV---LK--F----I----

PF11469

Q8U363_PYRFU/5-123-----------------------------------------------------KGLAKFGDSL---IN--FLYSLA----
Q5JE89_PYRKO/13-132-----------------------------------------------------KGLAKLGDSL---IN--LVFSLA----
A1RX42_THEPD/16-124-----------------------------------------------------KELARLGDSL---VN--FLVSAA----

PF14622

RM15_SCHPO/67-197.L.LN..........H.Y.L.-------ES............G.N.F..S..T.I.P.........S.YK--------D-
B6JY03_SCHJY/37-168.L.IN..........F.S.L.-------QQ............T.N.Q..L..K.G.V.........S.EM--------W-
Q7S1R6_NEUCR/117-265PV.LN..........E.P.I.-------VDKYGRTPYNHAALA.N.I..D..K.L.I.........Y.TQ--------P-
Q2GMI6_CHAGB/267-400.F.GR..........E.P.F.-------QD............P.A.L..ANVD.K.L.........N.VK--------Q-
F2QVA9_PICP7/51-190.S.SVHVISKPSDSPY.A.L.-------NG............K.N.F..D..C.L.G.........S.LL--------T-
A8Q4V0_MALGO/115-263.L.FF..........F.DIL.-------EH............A.R.RTNS..S.V.S.........D.VE--------Y-
B9W9P9_CANDC/72-210.F.AK..........Y.V.T.-------NQ...........PC.K.H..E..N.G.V.........E.GK--------N-
Q4P7G0_USTMA/113-257LY.LH..........A.R.L.-------QS............T.T.K..G..D.A.AHNYISRLLES.PT--------G-
B1QQ64_CLOBO/21-154.I.SE..........H.L.Y.-------QK............Y.E.D..K..KEG.E.........L.TR--------K-
A5E1N1_LODEL/106-245.T.AK..........Y.V.I.-------HQ............Q.S.TTPD..K.IKI.........E.GK--------D-
D5X4R4_THIK1/15-139.A.AA..........W.L.Y.-------HQ............A.A.R..Q..D.E.G.........Q.LS--------R-
D0BJZ8_9LACT/21-153.I.SN..........W.L.Y.-------RQ............M.P.T..K..K.E.G.........E.LT--------K-
E0E418_9FIRM/25-155.V.SD..........Y.L.F.-------RA............R.N.D..L..P.E.G.........K.LT--------R-
B0AAQ8_9FIRM/24-157.I.SD..........Y.L.F.-------KK...........ET.K.L..P..E.G.E.........L.TK--------I-
C4Z0E7_EUBE2/19-151.S.SD..........Y.I.Y.-------KN...........HA.E.M..A..E.G.K.........M.TR--------L-
RNC_BORA1/16-141.V.AA..........M.L.F.-------ER............Y.A.K..L..DEG.D.........L.SR--------V-
F2MX01_PSEU6/18-139.L.FN..........H.F.P.-------QA............R.E.G..Q..L.S.R.........L.R.--------.-
A5ZPT6_9FIRM/14-146.S.SD..........FLY.A.-------KF............T.Q.V..P..E.G.E.........L.TK--------K-
RNC_MESFL/16-146.V.SK..........FLY.L.-------NF............T.N.A..P..E.G.K.........L.TK--------T-
RNC_LEIXX/20-149.VTVK..........L.F.R.-------EN............P.G.L..D..E.G.E.........L.AK--------R-
E7P1S1_PSESG/18-139.A.GE..........A.L.F.-------ER............F.P.Q..A..R.E.G.........Q.LS--------R-
RNC_CUPPJ/16-141.V.AD..........M.L.F.-------GM...........FG.K.L..D..E.G.D.........L.SR--------V-
RNC_THELT/22-156.L.AE..........YLY.L.-------EF............P.E.A..S..E.G.V.........M.AK--------V-
A7B5M4_RUMGN/41-173.S.SE..........FLF.L.-------ES............P.K.V..S..E.G.K.........L.TK--------T-
C8W586_DESAS/21-152.V.SG..........Y.L.Y.-------SS............Y.P.E.CA..E.G.E.........L.TK--------L-
E4RLQ9_HALSL/23-154.V.ST..........Y.I.F.-------NK...........FS.D.F..P..E.G.E.........L.AK--------M-
C0CHF6_9FIRM/25-157.S.SE..........F.L.Y.-------QK............F.P.I..L.QE.G.E.........L.TK--------K-
D4LHQ1_9FIRM/18-150.S.SD..........F.L.Y.-------KK...........FR.N.N..Q..E.G.E.........L.TK--------K-
D8DXQ2_PREBR/33-161.V.GD..........I.V.Y.-------QH...........FP.G.K..R..E.G.F.........L.TN--------T-
A4G6R8_HERAR/16-141.V.AS..........L.L.F.-------DR............Y.S.K..I..D.E.G.........D.LS--------R-
C4V2U1_9FIRM/26-157.I.ST..........YLY.V.-------AY............P.H.C..S..E.G.E.........L.TK--------M-
E9RSL3_9FIRM/47-179.T.SE.........AL.F.F.-------DN............P.S.M..P..E.G.E.........L.TK--------T-
C5EV89_9FIRM/18-150.T.SD..........F.L.Y.-------HK...........YA.T.L..P..E.G.D.........L.TK--------I-
B7ANP9_9FIRM/26-158.S.SE..........Y.L.F.-------NE............H.K.D..V..N.E.G.........S.LS--------K-
C0B4M7_9FIRM/39-171.S.SE..........Y.LFF.-------EN............Q.T.M..P..E.G.E.........L.TK--------L-
C8NEF3_9LACT/21-153.I.SD..........W.L.F.-------RQ............FPH.F..Q..E.G.Q.........L.TK--------L-
E0TKT7_MYCHH/17-144.T.SL..........Y.I.F.-------KN............I.D.A..K..NEG.N.........A.TI--------L-
C9L8J0_RUMHA/47-179.S.SE..........F.L.FY-------QY............A.D.L..P..E.G.K.........L.TK--------K-
B6BPF5_9PROT/18-138.I.AK..........K.L.L.-------EI............YPD.E..K..E.G.I.........L.DK--------K-
A1SLU8_NOCSJ/48-177.V.TE.........TL.Y.L.-------KH............P.D.L..S..E.G.R.........L.AK--------L-
Q2LVR4_SYNAS/22-153.I.SD..........L.L.M.-------KA...........FP.D.Y..S..E.G.Q.........L.SK--------L-
E1T562_BURSG/16-140.V.AA..........L.L.F.-------QR...........FG.K.L..D..E.G.D.........L.SR--------V-
C2KW20_9FIRM/24-156.S.ST.........LL.Y.H.-------KK............P.V.I..Q..E.G.R.........M.TK--------L-
E8NDE2_MICTS/20-149.VTVR..........L.F.T.-------RH............P.D.L..D..E.G.Q.........L.AK--------R-
B0M9W6_9FIRM/19-151.M.SD..........Y.L.F.-------HT............YKD.E..P..E.G.K.........L.TK--------M-
E4TJ04_CALNY/16-145.V.SE..........Y.L.IF-------KY............K.D.F..D..E.G.M.........L.SR--------Y-
D4J805_9FIRM/20-152.S.SD..........F.L.F.-------KN...........FP.D.M..A..E.G.Q.........M.SK--------K-
E8UCB0_TAYEM/16-140.V.AS..........L.L.F.-------KK...........LK.D.Q..A..E.G.D.........L.TR--------I-
C3X4M2_OXAFO/22-146.A.IN..........L.Y.E.-------RY............A.A.L..N..E.G.S.........L.SR--------L-
E7GKA5_CLOSY/18-150.S.SD..........F.L.F.-------HK...........FP.D.M..P..E.G.D.........L.TK--------T-
E3DQV9_HALPG/23-155.I.ST..........Y.I.F.-------NK...........FS.D.F..P..E.G.D.........L.AK--------M-
A5WCD8_PSYWF/39-165.I.GE.........AL.Y.Y.-------QY............P.K.Q..D..E.G.R.........L.TR--------M-
D9R047_CLOSW/18-150.S.SD.........CL.Y.H.-------KY............P.E.K..P..E.G.D.........L.TK--------I-
C0ERZ0_9FIRM/20-152.I.SD..........Y.V.F.-------RE...........YP.G.Y..N..E.G.R.........L.TK--------L-
C0FMS9_9FIRM/17-149.S.SD..........F.L.Y.-------KA...........YP.D.K..S..E.G.D.........L.TK--------L-
D4CL61_9FIRM/17-149.A.SD..........F.L.Y.-------HR............V.P.V..I.QE.G.V.........M.TK--------L-
RNC_PELTS/21-152.V.SD..........Y.L.Y.-------RS............K.P.E..M..D.E.G.........D.LT--------K-
D9PK52_9ZZZZ/26-157.T.TE..........M.L.Y.-------KK............F.P.E..M..K.E.G.........E.MT--------A-
C6Z037_9BACE/33-161.V.AD..........I.V.Y.-------KR...........FE.G.K..R..E.G.F.........L.TN--------T-
A6BED1_9FIRM/22-154.S.SE..........F.L.F.-------HN............N.PKL..P..E.G.E.........L.TK--------T-
A9KLR1_CLOPH/23-155.T.SE..........W.L.F.-------EK............H.P.K..M..P.E.G.........D.LT--------K-
E8ULD9_STREJ/18-150.I.SK..........Y.L.Y.-------QK............Y.P.D..R.PE.G.E.........M.SK--------L-
D0MGH0_RHOM4/39-171.V.AA..........Y.L.Y.-------EH............FPD.R..N..E.G.F.........L.TR--------L-
E9S866_RUMAL/20-147.V.SD..........Y.I.F.-------EH............F.K.H..L..P.E.G.........E.LT--------K-
B4VPC8_9CYAN/19-151.I.TD..........Y.L.Y.-------HN............C.P.Y..L..E.V.S.........N.FK--------G-
A8UFH9_9FLAO/33-161.I.AA..........Y.L.F.-------EQ............V.P.H..G.DE.G.Y.........L.TK--------M-
F2NYA2_TRES6/34-167.T.AA..........F.L.Y.-------ND............M.S.Q..N..K.E.G.........DLAK--------I-
D3PAP4_DEFDS/17-146.V.TE..........Y.LVI.-------KY............K.E.F..K..E.G.V.........L.SK--------Y-
A1HN82_9FIRM/26-157.I.SE..........Y.L.Y.-------RN...........FP.E.L..P..E.G.E.........L.TK--------A-
F0S2Z0_DESTD/19-149.V.SE..........E.L.I.-------KR............F.P.T..K..T.E.G.........E.LS--------Q-

PF00636

A4XJ79_CALS8/5-105-V-RN----------K-V-IS.......EN..PDL.T........-.--.--P-Y-H---------Y-YL........K.
C1KYH3_LISMC/13-114-I-RE----------Y-L-L........AA..GKT.K........-.--.--P-N-Q---------L-HK........T.
Q4WU14_ASPFU/35-122-L-LD----------I-W-YR.......TE..TSC.A........-.--.--Q-G-Y---------S-RL..........
RTL2_ARATH/93-203-I-SN----------Y-L-YL.......TY..PSL.E........-.--.--P-H-D---------L-SL........L.
DCL1_ASPFU/1291-1405-C-VE----------D-L-FR.......RF..PDR.D........-.--.--P-Q-W---------L-SE........H.
Y3330_ARATH/256-318-I-SA----------Y-L-C.........................-.--.--.-G-H---------L-HS..........
A6SJD6_BOTFB/200-296-M-RE----------Q-F-YL........FSIPEVQA........-.--.--S-Q-I---------L-NR..........
Q0F3I4_9PROT/44-134-V-AE----------Y-L-HQ.......SF..PEE.P........-.--.--E-G-Q---------L-SR........M.
RNC_WOLTR/54-144-V-SA----------I-L-FR.......LF..PKE.K........-.--.--E-G-A---------L-AR........R.
A5CEW8_ORITB/60-150-I-SE----------T-L-FK.......NF..SHY.N........-.--.--E-G-K---------L-AK........S.
A6DUU1_9RHOB/42-132-M-AE----------A-L-LS.......QD..QGA.T........-.--.--E-G-Q---------L-AP........R.
RNC_BRAJA/60-150-V-SD----------M-L-YH.......AF..PNA.D........-.--.--E-G-E---------L-SK........R.
A5V2R4_SPHWW/51-141-A-GA----------W-L-FE.......LF..PDE.P........-.--.--E-G-K---------L-SR........R.
RNC_SPHAL/39-129-L-AS----------E-L-YT.......RF..PAA.S........-.--.--E-G-E---------M-SS........R.
RNC_RHIEC/47-137-I-AE----------L-L-FR.......TF..GTA.G........-.--.--E-G-E---------L-SV........R.
A5FV46_ACICJ/38-128-I-AE----------W-L-IE.......RF..PHE.R........-.--.--E-G-G---------L-GP........R.
A3Z4A6_9SYNE/40-129-A-TE----------F-I-AS.......TQ..PQL.P........-.--.--M-G-E---------R-SA........L.
Q4C1B8_CROWT/48-137-S-AE----------I-L-LE.......TY..PNE.L........-.--.--V-G-E---------F-AA........I.
Q5MZ89_SYNP6/55-144-I-AD----------F-L-DR.......HY..PDL.S........-.--.--V-G-D---------C-SA........L.
Q80UU5_MOUSE/475-564-A-TE----------Y-L-FI.......HF..PDH.H........-.--.--E-R-H---------L-TL........L.
RNC_CAEEL/870-957-V-SD----------F-L-YR.......RF..PYH.H........-.--.--E-G-H---------M-SL........L.
Q6BCK1_TETTH/1224-1338-V-LK----------R-L-YT.......RY..SQS.N........-.--.--P-N-E---------L-.D........I.
Q110R1_TRIEI/53-143-I-SK----------Y-L-SK.......NF..SSL.G........-.--.--K-A-T---------L-II........I.
A2QMS9_ASPNC/124-236-A-SL----------A-L-VQSPSNAANSATPDAYGRVPFTHPAL-D--S--L-D-N---------L-DY.........N
Q0TYG8_PHANO/64-174-T-SQ----------A-L-ISSP..QEAQAETDEFGRIPFQHPAL-I--G--L-Q-G---------L-SD.........E
Q1XG54_CRYJA/71-157-I-SL----------H-Y-VL.......NN..SAI.G........-.--.--S-G-D---------L-HS........K.
Q9FYL8_ARATH/80-167-V-SL----------Q-F-LA.......KD..IDI.S........-.--.--S-K-A---------L-GR........L.
DCL22_ASPNC/1111-1258-V-VS----------Y-L-HR.......HA..QVM.N........-.--.--P-Q-R---------M-QS........L.
Q2U0L3_ASPOR/1051-1198-V-VR----------Y-L-HR.......QK..SFT.S........-.--.--S-K-R---------L-QS........L.
RM03_SCHPO/83-189-V-LE----------Y-I-KC.......KY..PRL.P........-.--.--E-E-A---------V-HG........M.
A7SJH8_NEMVE/129-224-I-TE----------Y-L-CF.......KY..PNL.P........-.--.--S-E-G---------V-RQ........L.
Q4PA03_USTMA/211-325-A-TE----------H-L-HL.......RY..PNL.P........-.--.--T-R-V---------L-KA........A.
A2QRC1_ASPNC/121-242-T-SE----------Y-L-IC.......TYPRLPLTV........-.--.--.-.-.---------.-..........IF
RM44_PONAB/123-207-L-TQ----------F-L-ED.......EY..PDLPT........-.--.--E-G-I---------K-NL..........
A6ZM86_YEAS7/153-272-V-TK----------S-I-IQ.......KYPRLPTVV........-.--.--.-.-.---------.-..........LN
RM15_YEAST/105-208-T-CI----------H-S-LKNG..SPA.ESCENGQL........-.--.--S-L-Q---------F-SN........L.
Q6FVA4_CANGA/96-187-A-AM----------H-S-VG......P.................-.--.--E-N-S---------F-GN........L.
A3LPK0_PICST/184-273-L-YQ----------I-L-DE.......RFPNMYGEE........-.--.--.-.-.---------.-..........MF
Q6BWD6_DEBHA/187-276-L-IE----------I-L-DE.......KLPDIHEDD........-.--.--.-.-.---------.-..........LY
A5DES0_PICGU/186-275-L-LH----------L-L-DK.......KFPKAQAED........-.--.--.-.-.---------.-..........IE
A3GHW8_PICST/84-184-F-AK----------F-V-VEKPSQNELAINGKNLDVLG.....T-P--I--A-K-E---------L-AG..........
Q0UQH0_PHANO/7-117-A-KE----------W-G-IEA.....AHEPGGEVDPGYLQFKRI-Q--S--G-D-A---------L-PD........AF
Q0CCZ5_ASPTN/48-132-L-VD----------Y-G-RE........................-.--.--R-Q-T---------T-PG..........
A2C1X8_PROM1/20-117-Q-RL----------R-Y-C.................SS.....P-M--R--S-K-D---------L-HN........A.
A9B9W4_PROM4/20-117-Q-RL----------L-L-C.................RK.....P-A--K--S-K-E---------L-HK........T.
Q7VCJ3_PROMA/20-117-Q-RL----------R-L-C.................EK.....P-A--K--S-K-D---------L-HF........S.
B1X410_PAUCH/23-120-Q-RL----------Q-L-C.................QT.....P-C--C--S-K-D---------L-HS........A.
Q067M9_9SYNE/20-119-Q-RL----------R-L-G.................AR.....P-G--R--S-D-A---------L-HK........A.
A3YYC2_9SYNE/20-117-Q-RL----------R-H-C.................HQ.....A-G--R--P-D-E---------L-HQ........A.
A3Z7F5_9SYNE/21-118-Q-RL----------R-H-C.................RR.....P-G--R--S-D-D---------L-HR........A.
A4CU57_SYNPV/21-118-Q-RL----------R-H-C.................RR.....P-G--R--A-S-D---------L-HR........S.
Q0I9N3_SYNS3/20-117-Q-RL----------R-F-C.................KT.....P-G--R--S-Q-D---------L-HQ........A.
Q7U7F7_SYNPX/20-117-Q-RL----------R-F-C.................RS.....P-G--R--A-D-V---------L-HR........A.
B5IKV4_9CHRO/2-99-Q-RL----------N-R-C.................RE.....A-A--R--A-L-D---------L-HR........Q.
A8G4M5_PROM2/20-117-Q-RL----------R-H-V.................HY.....P-L--K--S-K-E---------L-HL........S.
A5GTM3_SYNR3/12-109-Q-RR----------G-L-V.................AH.....E-G--T--I-Q-E---------L-HK........R.
B7KCP4_CYAP7/45-142-V-RS----------V-Y-L.................LP.....P-R--R--L-S-D---------Y-HS........Q.
B7K2P3_CYAP8/45-142-I-RT----------Y-Y-L.................LP.....P-R--R--L-V-D---------Y-HN........Q.
D3EMY0_UCYNA/29-126-V-RT----------A-Y-L.................LP.....P-R--K--L-A-D---------Y-HN........Q.
A8YKZ5_MICAE/29-126-I-RT----------Y-Y-L.................LP.....P-Q--R--L-G-D---------Y-HA........Q.
B4VUK6_9CYAN/43-140-I-RR----------H-Y-L.................LP.....P-K--R--L-C-D---------Y-HD........Q.
Q112N8_TRIEI/20-117-I-RN----------Y-Y-L.................IP.....P-K--R--S-G-Y---------Y-HQ........L.
A0YQT6_LYNSP/17-114-I-RH----------F-Y-L.................IP.....P-K--R--S-Q-L---------Y-HQ........L.
B8HT79_CYAP4/37-134-I-RS----------R-C-L.................LP.....P-Q--R--L-R-D---------Y-HQ........R.
A0ZGL0_NODSP/61-158-V-RM----------F-Y-L.................LP.....I-Q--Q--T-K-T---------Y-HC........L.
Q31LB9_SYNE7/26-123-V-RL----------R-L-L.................LP.....A-Q--R--S-H-Q---------F-HQ........S.
MRNC_SYNY3/28-125-V-RC----------C-Y-L.................FP.....P-R--R--I-G-D---------F-HR........R.
B4WGA4_9SYNE/42-139-V-RS----------R-L-L.................IP.....A-Q--R--I-R-D---------Y-HH........Q.
B1XNV1_SYNP2/17-114-S-RC----------Y-F-L.................LP.....P-C--R--I-A-D---------Y-HG........K.
MRNC_THEEB/23-120-I-RL----------L-F-L.................TP.....P-Q--R--I-N-A---------Y-HR........Q.
Q2JI20_SYNJB/24-121-V-RR----------Q-R-L.................FP.....P-D--R--L-E-R---------Y-HQ........Q.
B7G3M0_PHATC/16-116-V-RS----------R-S-V.................WP.....P-K--R--T-S-D---------L-QT........D.
C6T3M8_SOYBN/105-207-A-RR----------H-F-L.................FP.....P-L--S--I-E-E---------Y-ND........R.
Q94F12_ARATH/98-200-A-RR----------H-F-L.................FP.....P-L--S--I-E-D---------Y-ND........R.
C0PKE8_MAIZE/108-210-A-RR----------H-F-F.................FP.....P-L--S--I-N-E---------Y-NK........R.
A9RYU0_PHYPA/18-120-V-RR----------H-F-L.................TP.....P-Q--K--V-D-V---------Y-NK........R.
C1DXY5_MICSR/99-208-V-RR----------A-F-F.................AP.....P-C--K--P-V-D---------Y-DL........K.
Q014M6_OSTTA/451-557-A-RG----------V-L-F.................YP.....P-A--K--P-L-D---------Y-DL........K.
A8J7A5_CHLRE/55-159-M-AA----------Q-A-VG...........ERDFSASMP..IT-V--S--P-A-G---------A-AA........I.
A6GE80_9DELT/16-118-V-RL----------R-L-A.................RRG....D-Y--S--V-D-R---------L-DK........A.
A6TWK4_ALKMQ/25-124-V-RN----------H-L-I.................TQT....K-M--L--V-G-A---------Y-HR........D.
A8MLB8_ALKOO/26-125-I-RN----------Y-L-I.................NEM....T-V--S--V-N-Q---------Y-HK........R.
Q8XHQ6_CLOPE/20-120-I-RN----------Y-I-L.................SEN...AG-L--S--A-H-K---------I-HV........K.
C1I8F8_9CLOT/21-121-I-RN----------F-I-L.................SNN...TE-L--S--A-H-K---------M-HV........K.
A3DH39_CLOTH/26-125-I-RT----------M-L-V.................SGG....N-V--P--V-H-V---------L-HK........R.
MRNC_SYMTH/12-111-V-RE----------R-L-L.................ERG....Y-V--R--V-N-D---------L-HR........H.
A5D5M2_PELTS/19-118-V-RS----------S-L-V.................NAG....L-V--R--V-N-R---------L-HD........E.
MRNC_MOOTA/10-109-V-RA----------H-L-V.................GRG....P-A--K--P-E-Q---------L-HR........E.
B0TC36_HELMI/34-133-V-RR----------T-L-I.................EVG....V-V--K--V-A-Q---------L-HK........Q.
Q0AUF9_SYNWW/16-114-V-RT----------R-L-A.................IQG....K-R--R--L-K-D---------L-HL........D.
C0GIM8_9FIRM/8-106-V-RQ----------K-L-S.................RQK....A-L--P--V-R-Q---------L-HR........R.
Q045X7_LACGA/31-132-I-RR----------H-L-V.................KGG....I-V--K--P-Q-M---------L-QR........Y.
Q3Y164_ENTFC/15-116-V-RD----------H-L-I.................DQG....E-T--K--P-N-K---------L-HR........A.
C8WTZ3_ALIAD/13-112-A-RN----------H-C-L.................NLG....I-L--R--P-R-D---------L-QR........Q.
MRNC_STAA8/15-116-V-RT----------Y-I-V.................LKL....K-S--K--P-N-K---------L-HQ........M.
Q8ETZ8_OCEIH/12-114-I-RE----------Y-L-L.................ERG....T-V--N--P-N-K---------L-HQ........S.
B0MM93_9FIRM/17-116-V-RE----------Q-I-V.................KLG....T-M--P--V-D-K---------L-HK........K.
E6U8V4_ETHHY/21-120-A-RG----------Q-V-L.................AGG....S-A--P--V-G-K---------L-HH........R.
D4LDD2_RUMC1/15-114-M-RS----------R-I-L.................GSA....N-M--P--N-A-K---------L-HN........L.
A6P055_9FIRM/19-118-V-RS----------W-L-C.................LHG....K-A--T--N-K-G---------L-HK........A.
A5KKA6_9FIRM/30-129-I-KM----------R-V-V.................GRG....G-R--Q--V-H-K---------L-HE........E.
C5ENC6_9FIRM/5-104-I-RS----------R-V-V.................NHG....S-M--Q--V-N-K---------M-HK........R.
D1VT13_9FIRM/26-124-V-RT----------M-V-L.................KG.....N-I--P--A-H-K---------L-HT........K.
B7CDG4_9FIRM/9-110-V-RE----------H-L-L.................SLG....F-R--K--A-H-V---------L-QK........K.
B1C8Q3_9FIRM/18-117-I-RK----------T-L-I.................RLG....I-R--G--V-K-D---------L-NK........M.
C9LVQ2_9FIRM/37-135-V-RT----------R-L-L.................SFE....Q-S--Q--V-H-V---------L-SD........F.
C4V0H2_9FIRM/37-135-V-RM----------R-L-L.................SYE....Q-T--Q--V-Q-G---------L-HA........F.
D4KFD3_9FIRM/37-135-I-RT----------R-L-L.................NFE....Q-S--R--V-H-L---------L-ND........F.
C0WE29_9FIRM/32-129-V-RK----------R-L-L.................PV.....S-G--H--V-Q-V---------L-HD........L.
D1BMT8_VEIPT/47-145-V-RE----------R-V-V.................QMN....I-T--K--V-Q-I---------L-HT........I.
C9LMK9_9FIRM/35-133-V-RK----------A-L-I.................DTG....I-Y--N--V-Q-I---------L-NS........L.
D3LUV6_9FIRM/36-134-L-RR----------R-L-T.................ALG....I-P--A--V-Q-V---------L-HA........L.
B9K831_THENN/17-112-F-RL----------K-F-A.................GN......-Y--K--I-S-T---------I-HE........R.
D2C868_THENR/17-112-F-RS----------R-F-T.................GD......-Y--R--M-S-V---------I-HE........R.
A6LJ32_THEM4/19-114-V-KL----------Y-Y-F.................KK......-T--S--V-R-K---------L-HK........N.
A8F7A2_THELT/9-104-C-KV----------K-S-L.................KL......-M--K--V-K-A---------I-HK........E.
A9BJB7_PETMO/21-118-Y-KV----------K-L-L.................KDG....R-I--K--T-R-D---------L-YE........K.
MRNC_KOSOT/20-117-F-RI----------K-T-L.................RSA....K-R--R--T-G-Y---------Q-HN........L.
C1MLN8_MICPC/114-224-A-RQ----------H-M-I..............LRSAEKAGRTS-P--C--G-T-V---------I-RP........QE
C1FDU3_MICSR/76-186-A-RR----------H-M-I..............LQRATVASLPY-S--T--N-V-V---------L-RP........QE
A4RR17_OSTLU/28-138-A-RQ----------H-M-I..............LKRVTSSESAS-T--S--G-R-A---------I-RP........QD
D4CVS6_9FUSO/18-116-I-RK----------Y-Y-L.................QF.....G-Y--N--I-P-T---------L-NK........H.
C3WFU5_FUSMR/12-110-I-RK----------Y-W-I.................SK.....G-L--N--L-R-N---------L-NR........K.
A7I5W5_METB6/51-140-L-IL----------F-L-ME...........KGLQE........-.--.--K-G-A---------I-TR........A.
A3CVM2_METMJ/43-132-L-CD----------L-L-MR...........SGYET........-.--.--K-G-E---------I-TI........K.
A7I515_METB6/44-134-V-AT----------R-L-YE...........SGIRD........-.--.--K-G-T---------L-TS........E.
A3CRH2_METMJ/50-139-V-VE----------A-V-VA...........GGAHD........-.--.--K-G-A---------I-SN........R.
Q0UMM3_PHANO/145-228-L-CE----------I-W-FQ...........TDH.P........-.--.--N-G-G---------Y-AL........M.
A4GHU1_9BACT/34-120-V-SE----------R-L-FN.......TY..GNL.K........-.--.--E-G-K---------L-TR........F.
RNC_MYCPN/56-141-V-AK----------K-L-FE.......LY..PNY.N........-.--.--E-G-M---------L-TR........T.
A5Z824_9FIRM/49-157-V-VK----------T-L-TDKYGHMISDE..PDYEDEDDEFYCE-Y--S--E-G-K---------L-TH........L.
A4E6T0_9ACTN/44-134-V-AR----------S-L-FE.......SY..PEF.D........-.--.--E-G-K---------L-TR........L.
RNC_RHOBA/69-158-V-CE----------W-L-FN.......EY..PEY.S........-.--.--E-G-D---------L-TK........I.
A2F201_TRIVA/412-500-F-GI----------S-V-FN.......GC..YNYAN........-.--.--E-G-L---------M-SE........L.
A6GP51_9BURK/26-116-A-SI----------L-L-FE.......TH..PDM.D........-.--.--E-G-K---------M-SR........V.
RM15_SCHPO/89-181-L-LN----------H-Y-LE........................-.--.--S-G-N---------F-ST........IP
A6LNE7_THEM4/42-132-V-CT----------I-L-YE.......QY..QTL.N........-.--.--E-G-T---------M-AQ........I.
Q4A7X2_MYCH7/44-131-V-SK----------V-I-YD.......NF..YKN..........-.--.--E-G-N---------S-TQ........I.
A3EQH6_9BACT/58-148-V-SE----------Y-L-LN.......TW..PSA.S........-.--.--E-G-D---------I-GQ........I.
RNC_CHLPN/45-135-V-TE----------H-L-FL.......LF..PSM.D........-.--.--E-G-T---------L-ST........A.
RNC_LEPBJ/59-149-A-AR----------S-L-FQ.......KY..PKA.S........-.--.--E-G-E---------L-SR........I.
RNC_HAEI8/36-126-I-AE----------A-L-YH.......QF..PRC.N........-.--.--E-G-E---------L-SR........M.
A1R7I4_ARTAT/40-130-V-TD----------S-L-YR.......EN..PSL.P........-.--.--E-G-E---------L-AK........R.
A7A3Q3_BIFAD/75-166-S-TE----------T-L-YK.......VH..PDM.N........-.--.--E-G-Q---------L-AK........M.
Q3DNE4_STRAG/44-134-I-SQ----------Y-L-FT.......KY..PQK.A........-.--.--E-G-D---------L-SK........L.
Q14LC1_SPICI/52-142-I-SL----------Y-L-FL.......SF..PDK.N........-.--.--E-G-E---------I-TN........L.
RNC_MYCCT/40-130-V-SK----------F-L-FF.......HY..SKL.G........-.--.--E-G-E---------L-TR........L.
D2BI67_DEHSV/54-144-F-AD----------R-L-YH.......DF..PDI.Q........-.--.--E-G-D---------L-TR........F.
A9B5J8_HERA2/42-132-C-GS----------F-L-FH.......EF..PEL.G........-.--.--E-G-D---------L-TK........T.
Q1MQV2_LAWIP/41-131-I-SE----------E-L-FK.......RH..PEA.R........-.--.--E-G-E---------L-TR........M.
RTL1_ORYSJ/62-168-F-AT----------I-F-YR.......DD..PGL.D........-.--.--Q-G-D---------L-TV........L.
RNC_MYXXD/55-145-V-SH----------R-L-MA.......RC..PGL.P........-.--.--E-G-D---------L-TK........M.
Q1CTK8_HELPH/52-142-I-GE----------L-L-YH.......KF..YQY.D........-.--.--E-G-K---------L-SK........L.
A9BIG2_PETMO/59-148-I-SE----------F-L-YN.......NY...HL.S........-.--.--E-G-E---------M-SK........A.
Q1IJU6_KORVE/51-141-T-SQ----------E-L-VK.......KF..PHF.Q........-.--.--E-G-E---------L-SK........L.
RNC_BDEBA/44-134-V-GE----------F-L-YE.......KF..PTD.T........-.--.--E-G-G---------L-SK........K.
A0YTK7_LYNSP/34-125-V-GE----------L-L-YT.......YY..PEELS........-.--.--E-A-K---------M-TR........L.
A3CSF0_METMJ/81-165-I-AD----------H-L-YG.......EYDLP............-.--.--P-G-E---------M-NR..........
RNC1_SYNY3/35-125-V-GR----------I-L-FE.......RY..PHF.T........-.--.--E-A-E---------L-TR........L.
A2RV16_DANRE/886-976-T-SV----------H-L-YH.......LF..PSL.E........-.--.--E-G-G---------L-AT........Y.
B3EKH3_CHLPB/78-168-I-SE----------L-L-YT.......VF..PES.D........-.--.--E-G-K---------L-SS........N.
A4BWV8_9FLAO/58-144-I-SA----------Y-L-YK.......EA..PKG.S........-.--.--E-G-Y---------L-TQ........M.
RNC_BACFN/59-145-V-GD----------I-V-YQ.......HF..EGK.R........-.--.--E-G-F---------L-TN........T.
A7K823_9PHYC/78-168-I-AR----------Y-L-YD.......VF..PGK.N........-.--.--E-G-V---------L-TR........L.
RNC_MYCS5/49-139-I-SD----------Y-C-VR.......EF..SSL.E........-.--.--P-G-E---------L-SR........L.
RNC_AQUAE/37-121-I-VD----------L-L-VQ.......YS..PNK.R........-.--.--E-G-F---------L-SP........L.
A4GK15_9BACT/37-125-I-SQ----------I-L-VE.......KF..SMD.D........-.--.--E-G-T---------L-SL........M.
Q83VA6_9MOLU/41-129-M-AS----------Y-L-YK...........NNKDD........-.--.--E-G-V---------M-TK........K.
A5UJK3_METS3/37-127-V-SE----------Y-L-YK.......QY..PDY.E........-.--.--E-G-K---------L-TK........L.
RNC_PELUB/38-127-I-AK----------K-L-LE.......LY..PDE.K........-.--.--E-G-V---------L-DK........K.
Q64AH3_9ARCH/53-141-L-AE----------E-L-FK.......LSKSASL.D........-.--.--E-G-K---------M-TF........L.
RNC_MIMIV/351-441-I-GE----------Y-L-FN.......KY..ADS.G........-.--.--E-G-Y---------L-TR........L.
RNC_MIMIV/65-149-I-TE----------Y-F-YH.......RY..NEE.N........-.--.--E-G-F---------L-TR........L.
Q8EW40_MYCPE/52-139-I-SE----------F-L-F........KN..KSL.D........-.--.--E-Q-K---------M-TE........I.
RNC_UREPA/43-140-I-SN----------F-I-FNYKIKDNEKM..RSL.D........-.--.--E-G-E---------M-TR........A.
RNC_MYCGA/469-556-V-AE----------Y-L-FN........H..SDS.S........-.--.--E-G-E---------M-TK........D.
Q4SZJ7_TETNG/259-381-I-TK----------H-L-YE.......DP..RQH.S........-.--.--P-G-V---------L-TD........L.
A7SKX2_NEMVE/37-156-V-TE----------L-I-YS.......RN..TNL.D........-.--.--P-G-E---------L-TD........L.
A7IYQ4_9BRYO/1379-1492-I-TR----------Y-L-FF.......KY..TNL.P........-.--.--P-G-R---------L-TD........L.
DCL4_ARATH/1327-1436-M-TS----------Y-F-FT.......VF..PKL.K........-.--.--P-G-Q---------L-TD........L.
DCL4_ORYSJ/1249-1358-I-TS----------Y-L-YS.......TY..PDI.K........-.--.--P-G-Q---------I-TD........L.
A7SIA4_NEMVE/44-167-V-TR----------H-V-LQ.......RF..PRL.S........-.--.--P-G-A---------I-TD........L.
Q2Q3U9_DROSI/1464-1620-I-SA----------Y-I-FE.......NN..TKM.N........-.--.--P-G-A---------L-TD........L.
RTL3_ARATH/445-551-F-TK----------H-L-YL.......TY..PML.E........-.--.--P-K-D---------L-SV........L.
RTL3_ORYSJ/76-183-V-SR----------E-V-FL.......TY..GQL.Q........-.--.--P-G-P---------L-TR........L.
DCR1_SCHPO/1120-1233-I-VQ----------Y-L-YK.......KY..PNA.T........-.--.--S-G-E---------L-TD........Y.
A4VD87_TETTS/1607-1720-I-VE----------Y-L-FN.......KF..PNS.D........-.--.--P-G-E---------L-TQ........M.
Q3SD86_PARTE/1582-1697-V-VE----------W-L-VK.......EF......N........-.--.--K-E-K---------V-ED........LA
Q55FS1_DICDI/1250-1335-V-SD----------F-L-YA.......TF..PLA.Q........-.--.--E-G-Q---------L-TD........Y.
DCL_GIAIC/333-418-V-TA----------R-L-LC.......LF..PDA.S........-.--.--V-G-T---------L-VE........L.
DCL2_EMENI/1092-1250-I-VD----------L-I-RA.......HH..VEC.Q........-.--.--Q-G-E---------M-TK........I.
DCL2_NEOFI/1134-1281-I-VS----------A-I-FN.......HP..IQR.P........-.--.--Q-G-D---------M-TK........I.
A7EYF3_SCLS1/1216-1363-I-VT----------A-M-WS.......YE..TEL.S........-.--.--H-F-Q---------M-HL........L.
DCL2_PHANO/1130-1270-I-SK----------R-L-HA.......HS..PEL.S........-.--.--H-Q-K---------M-HA........I.
A5IYM8_MYCAP/40-130-V-SA----------I-L-FN.......SF..KDK.N........-.--.--Q-G-Q---------L-TL........I.
RNC_MYCMO/47-135-S-SI----------F-I-FQ.......HF..QNI.T........-.--.--E-G-E---------A-SL........I.
Q57XF2_TRYB2/735-814-V-VS----------D-S-FLLGEPWHKDV...............-.--.--.-.-.---------.-............
Q3SE73_PARTE/554-687-V-IV----------N-V-HKECEKLYYNPRQQQLCR........-.--.--E-G-K---------I-TQKLLLCPGMLH
Q6BCJ7_TETTH/1048-1163-V-VS----------H-G-YHISRNRQKK.....INS........-.--.--P-Y-F---------F-CE........M.
Q3SE70_PARTE/522-610-V-IS----------Y-A-FRVAREKQQKNPNWSL.N........-.--.--P-G-L---------L-ST........W.
A2F201_TRIVA/593-691-L-IV----------S-Q-ME.......AF..PNA.T........-.--.--E-S-G---------M-SI........A.
A0DYG6_PARTE/384-498-A-TV----------S-V-SL.......GP..QNT.N........-.--.--E-N-I---------L-SD........Q.
Q6CC90_YARLI/191-332-L-TK----------I-I-YD.......VF..PGD.D........-.--.--Q-S-H---------L-SF........L.
Q0UFS5_PHANO/190-279-A-SR----------A-L-YN.......RF..PHV.D........-.--.--V-P-Q---------L-CS........W.
Q6FQ28_CANGA/457-550-M-TT----------I-I-YK.......SF..PNY.D........-.--.--A-G-Q---------M-TR........L.
A6RQB2_BOTFB/172-263-S-TL----------L-I-SQ.......TF..PAL.L........-.--.--P-G-K---------C-SQ........L.
A1CZL8_NEOFI/163-252-A-TR----------F-I-WS.......RF..EDI.S........-.--.--S-G-Q---------I-SQ........I.
Q152U6_SCHPM/172-262-T-TR----------I-I-FS.......KF..PQM.D........-.--.--E-E-S---------L-SK........L.
A3LS79_PICST/241-330-V-TL----------I-I-YD.......KF..PSA.S........-.--.--E-G-K---------L-TK........M.
Q4PCH5_USTMA/903-1023-S-RL----------L-A-YL.......SY..PDV.N........-.--.--E-G-S---------L-TR........L.
Q3SE71_PARTE/360-463-V-TV----------D-I-FR.......QY...ELLD........-.--.--E-G-E---------M-TS........L.
Q0E579_SFAVA/192-324-I-ID----------Y-I-RE.......NY..TDIHNIQ......-Q--D--I-G-V---------M-TK........L.
Q9DSW1_9VIRU/45-139-I-VS----------Y-M-SR.......RF..PQLRN........-.--.--R-N-G---------V-NV........LA
Q5GAH0_9VIRU/44-137-F-PI----------Y-F-IN.......RF..PQLNS........-.--.--A-E-G---------V-KL........VA
Q4KS72_ISKNV/58-156-M-PQ----------Y-Y-ME.......RFPKLAHDP........-.--.--S-A-A---------V-AR........T.
A3CW87_METMJ/121-210-L-LP----------A-I-WD...........PDIAK........-.--.--A-G-V---------L-TG........N.
Q6T445_LEIMA/391-483-I-SN----------R-I-LL.......LYPDQQWLY........-.--.--S-E-R---------C-ST........FT
Q27IU0_DROSI/1685-1862-I-TT----------Y-L-YI.......TY..ENV.H........-.--.--E-G-K---------L-SH........L.
DCR1_CAEEL/1348-1524-T-TD----------Y-L-YH.......TL..LDQ.H........-.--.--E-G-K---------L-SF........A.
DICER_DANRE/1295-1551-I-TT----------Y-L-FC.......TY..PDA.H........-.--.--E-G-R---------L-SY........M.
DCL2A_ORYSJ/1006-1124-T-TR----------H-L-FS.......EY...RLQH........-.--.--E-G-I---------L-TK........M.
Q2Q3V3_DROSI/1205-1377-A-TL----------Y-L-AS.......KY..SDW.N........-.--.--E-G-T---------L-TQ........V.
Q7Q073_ANOGA/1215-1375-V-SV----------Y-I-LF.......RH..TSW.H........-.--.--E-G-Y---------L-TT........C.
DCL_GIAIC/646-734-L-AL----------H-L-HA.......LH..PTL.T........-.--.--E-G-A---------L-TR........M.
A2XBW0_ORYSI/1353-1498-V-SR----------F-L-FL.......KY..PQK.H........-.--.--E-G-Q---------L-TR........M.
A6R2T0_AJECN/946-1054-T-TL----------Q-L-TA.......TN..LIW.H........-.--.--E-G-L---------L-SR........A.
DCL2_PHANO/947-1054-A-TV----------H-L-MA.......AN..PKW.P........-.--.--E-S-H---------L-TA........K.
DCL2_ASPCL/955-1060-V-SC----------Q-L-FF.......KH..PNW.H........-.--.--E-G-Y---------L-SE........G.
DCL2_NEUCR/998-1113-A-CL----------T-A-SALS...AHHSIVPNH.H........-.--.--E-R-L---------L-SQ........W.
Q6BCJ9_TETTH/1328-1487-S-ST----------Q-I-YF.......EH..PKS.M........-.--.--E-D-H---------L-HV........H.
A3LUF0_PICST/251-366-S-SK----------L-I-YELCRDGTMAVSNNTYHM........-.--.--.-.-.---------.-..........L.
Q6BCJ7_TETTH/752-862-S-SL----------Y-L-YL.......HL..PNQ.S........-.--.--E-N-A---------L-TM........I.
Q5KKA7_CRYNJ/521-644-T-TL----------H-F-YL.......LGGGADS..........-.--.--E-D-D---------M-NK........VW
Q3SE73_PARTE/363-464-T-SA----------M-L-FE..........DSKYKT........-.--.--E-N-T---------L-SS........A.
Q95ZG5_DICDI/926-1010-S-SL----------Y-L-FK.......KF..DNE.G........-.--.--E-G-L---------L-SK........K.
DCL1_ASPNC/1080-1192-T-SI----------A-L-FT.......QN..PDD.D........-.--.--E-F-D---------Y-HV........N.
DCR1_SCHPO/930-1038-A-SI----------T-V-FL.......KF..PDT.Q........-.--.--E-Y-Q---------L-HF........N.
Q3SD86_PARTE/1325-1459-S-SI----------E-V-FV.......QF..PFA..........-.--N--E-H-L---------L-HL........E.
Q0E5R5_MUCCI/1080-1190-T-ST----------Y-V-FV.......TL..PIS.N........-.--.--E-F-E---------L-TE........S.

PF11469

Q8U363_PYRFU/5-123-L-TE----------F-LGKPTGDRVPNASLAIALDL---------------T-G-----------L-SK--------NL
Q5JE89_PYRKO/13-132-L-SE----------Y-LGKPTGERVPNASLAIALEM---------------A-G-----------L-RH--------II
A1RX42_THEPD/16-124-L-T.----------L-IGRPTGVKVPGETLARAFLS---------------S-R-----------L-SK--------LG

PF14622

RM15_SCHPO/67-197--L.V.N...LR----S.PA........RL.A--EVA.K------------K----------------------------
B6JY03_SCHJY/37-168--L.Q.N...AC----R.PE........NI.N--KVA.E------------Q----------------------------
Q7S1R6_NEUCR/117-265--L...D...IM----D.KT........KI.A--RMG.I------------D----------------------------
Q2GMI6_CHAGB/267-400--P.M.D...VV----S.KD........KL.A--KLA.I------------D----------------------------
F2QVA9_PICP7/51-190--K...S...IG----N.HK........SL.A--RFA.K------------E----------------------------
A8Q4V0_MALGO/115-263--L.Q.N...LL----SSQQ........HV.D--DIA.S------------T----------------------------
B9W9P9_CANDC/72-210--L.D.V...LG----S.PMSRELPSLKTA.A--IFA.K------------L----------------------------
Q4P7G0_USTMA/113-257--V.D.S...IL----T.TH........RLGD--KIG.R------------E----------------------------
B1QQ64_CLOBO/21-154--R.A.I...IV----C.EN........SL.Y--EIA.K------------R----------------------------
A5E1N1_LODEL/106-245--L.T.KLGSLY----S.KELS...GRDAA.G--YFA.K------------V----------------------------
D5X4R4_THIK1/15-139--LRA.A...LV----R.AE........AL.A--EVA.R------------A----------------------------
D0BJZ8_9LACT/21-153--LRA.Q...IV----C.EE........SL.S--TLA.K------------E----------------------------
E0E418_9FIRM/25-155--LRA.N...VV----C.EE........SL.S--AVA.R------------K----------------------------
B0AAQ8_9FIRM/24-157--R.A.N...IV----C.EE........SL.S--EVS.K------------N----------------------------
C4Z0E7_EUBE2/19-151--R.A.S...IV----C.EP........TL.A--LCA.R------------A----------------------------
RNC_BORA1/16-141--R.A.N...LV----K.QA........SL.A--DIA.Q------------R----------------------------
F2MX01_PSEU6/18-139--..A.R...LV----K.GE........TL.A--VLA.R------------G----------------------------
A5ZPT6_9FIRM/14-146--R.A.S...LV----C.EP........SL.A--YCA.R------------Q----------------------------
RNC_MESFL/16-146--R.S.D...IV----R.QE........TL.S--EIA.K------------M----------------------------
RNC_LEIXX/20-149--R.A.S...LV----S.SV........AL.A--EVA.R------------G----------------------------
E7P1S1_PSESG/18-139--L.RAR...LV----K.GE........TL.A--LLA.R------------G----------------------------
RNC_CUPPJ/16-141--R.A.N...LV----K.QQ........AL.Y--EIA.Q------------M----------------------------
RNC_THELT/22-156--K.A.A...IA----S.EE........AL.A--QIA.R------------D----------------------------
A7B5M4_RUMGN/41-173--R.A.S...MV----C.EP........SL.A--FCA.R------------E----------------------------
C8W586_DESAS/21-152--R.A.A...IV----C.EP........SL.A--KVA.R------------Q----------------------------
E4RLQ9_HALSL/23-154--R.A.V...VV----S.AP........IL.A--EAA.K------------K----------------------------
C0CHF6_9FIRM/25-157--R.A.S...MV----C.EP........TL.A--LCA.R------------E----------------------------
D4LHQ1_9FIRM/18-150--R.A.S...MV----C.EK........SL.A--YCA.R------------E----------------------------
D8DXQ2_PREBR/33-161--R.S.K...LV----Q.RD........TL.N--KLA.Q------------E----------------------------
A4G6R8_HERAR/16-141--LRA.N...LV----K.QQ........SL.Y--EIA.Q------------R----------------------------
C4V2U1_9FIRM/26-157--R.A.S...LV----Q.SE........TL.A--RLA.R------------R----------------------------
E9RSL3_9FIRM/47-179--R.A.S...IV----C.EP........AL.A--FVA.K------------E----------------------------
C5EV89_9FIRM/18-150--R.A.S...IV----C.EP........TL.A--YCA.G------------D----------------------------
B7ANP9_9FIRM/26-158--L.R.A..SMV----C.EP........SL.A--FCA.R------------D----------------------------
C0B4M7_9FIRM/39-171--R.A.S...MV----C.EK........AL.A--FCA.R------------D----------------------------
C8NEF3_9LACT/21-153--R.A.Q...IV----C.ED........SL.S--LLA.K------------E----------------------------
E0TKT7_MYCHH/17-144--R.S.Q...IV----S.SV........SF.A--KIS.E------------K----------------------------
C9L8J0_RUMHA/47-179--R.A.S...IV----C.EP........TL.A--LCA.K------------E----------------------------
B6BPF5_9PROT/18-138--F.A.S...LV----N.KR........TC.L--EIA.K------------N----------------------------
A1SLU8_NOCSJ/48-177--R.A.A...VV----N.AR........AL.A--EVG.R------------R----------------------------
Q2LVR4_SYNAS/22-153--R.A.S...VV----N.EQ........PL.A--ELA.K------------K----------------------------
E1T562_BURSG/16-140--R.A.N...LV----K.QQ........SL.Y--ELA.Q------------A----------------------------
C2KW20_9FIRM/24-156--R.A.A...LV----C.ES........AL.A--VVA.K------------S----------------------------
E8NDE2_MICTS/20-149--R.A.G...VV----S.TI........AL.A--EVA.R------------G----------------------------
B0M9W6_9FIRM/19-151--R.A.S...LV----C.EP........TL.A--FCA.K------------D----------------------------
E4TJ04_CALNY/16-145--R.A.Y...FV----S.EE........FI.S--ELA.K------------Q----------------------------
D4J805_9FIRM/20-152--R.A.S...LV----C.EP........TL.A--YCA.R------------Q----------------------------
E8UCB0_TAYEM/16-140--R.A.S...YV----N.QD........TL.A--KIA.N------------N----------------------------
C3X4M2_OXAFO/22-146--R.S.S...LV----R.QQ........AL.Y--EIA.C------------K----------------------------
E7GKA5_CLOSY/18-150--R.A.S...MV----C.EP........TL.A--YCA.E------------E----------------------------
E3DQV9_HALPG/23-155--R.A.V...IV----S.AP........IL.A--EAA.K------------R----------------------------
A5WCD8_PSYWF/39-165--R.A.T...LV----R.QE........SL.V--VVA.Q------------K----------------------------
D9R047_CLOSW/18-150--R.A.S...IV----C.EP........TL.A--YCA.E------------S----------------------------
C0ERZ0_9FIRM/20-152--R.S.S...LV----C.EY........TL.A--ICA.R------------D----------------------------
C0FMS9_9FIRM/17-149--R.A.S...LV----C.EP........TL.A--ICT.R------------E----------------------------
D4CL61_9FIRM/17-149--R.A.A...LV----C.EP........TL.A--EAA.R------------K----------------------------
RNC_PELTS/21-152--LRA.S...VV----C.EP........SL.A--RVA.R------------E----------------------------
D9PK52_9ZZZZ/26-157--L.RSA...LV----N.TD........SL.S--KQA.S------------R----------------------------
C6Z037_9BACE/33-161--R.S.K...IV----Q.RE........TL.N--RLA.I------------E----------------------------
A6BED1_9FIRM/22-154--R.A.S...MV----C.EP........AL.A--FCA.R------------D----------------------------
A9KLR1_CLOPH/23-155--LRA.S...MV----C.EQ........TL.A--LCA.R------------E----------------------------
E8ULD9_STREJ/18-150--R.S.T...FV----R.EE........SL.A--GFS.R------------A----------------------------
D0MGH0_RHOM4/39-171--R.A.K...LV----N.RE........AL.A--QAA.R------------R----------------------------
E9S866_RUMAL/20-147--LRA.S...LV----C.EK........AL.F--EFS.H------------K----------------------------
B4VPC8_9CYAN/19-151--L.R.D..KLV----E.GQ........RL.T--KLW.Y------------Q----------------------------
A8UFH9_9FLAO/33-161--R.S.K...VV----S.RE........HL.N--ELG.K------------D----------------------------
F2NYA2_TRES6/34-167--K.A.N...VV----S.EQ........SL.A--PIAVE------------K----------------------------
D3PAP4_DEFDS/17-146--R.S.F...FV----S.ED........II.S--EIA.L------------K----------------------------
A1HN82_9FIRM/26-157--R.A.R...LV----C.EP........SL.A--QCA.S------------R----------------------------
F0S2Z0_DESTD/19-149--I.RAF...LV----S.EP........SL.S--ELA.K------------T----------------------------

PF00636

A4XJ79_CALS8/5-105..T-T-K---YV....K-AS--------SQ-A..IAI-K............K............................
C1KYH3_LISMC/13-114..A-T-K---FV....S-AK--------GQ-A..VAL-K............A............................
Q4WU14_ASPFU/35-122...-Q-D---YA....T-NK--------AM-A..HQA-I............R............................
RTL2_ARATH/93-203..R-A-A---NV....S-TE--------KL-A..RVS-L............N............................
DCL1_ASPFU/1291-1405..K-M-A---MV....S-NK--------FL-G..ALS-V............K............................
Y3330_ARATH/256-318...-.-.---.......-..--------..-...RFG-K............N............................
A6SJD6_BOTFB/200-296..I-L-S---RV....S-LS--------AY-P..TIA-S.........................................
Q0F3I4_9PROT/44-134..R-A-N---LV....C-RD--------SL-L..VVA-S............D............................
RNC_WOLTR/54-144..K-T-D---LV....C-GN--------TI-A..NVA-K............E............................
A5CEW8_ORITB/60-150..R-A-F---LV....C-NE--------SI-C..LIA-Q............K............................
A6DUU1_9RHOB/42-132..F-N-A---LV....R-KE--------AC-A..DVA-R............E............................
RNC_BRAJA/60-150..L-A-E---LV....R-KE--------SC-A..DVA-K............S............................
A5V2R4_SPHWW/51-141..L-N-A---IV....S-RE--------TC-A..DVG-R............A............................
RNC_SPHAL/39-129..L-H-V---LA....S-GA--------TC-A..AIA-Q............R............................
RNC_RHIEC/47-137..L-N-Q---LV....S-AE--------TC-A..AVA-D............E............................
A5FV46_ACICJ/38-128..L-A-H---LV....S-RQ--------SL-A..EIA-E............H............................
A3Z4A6_9SYNE/40-129..R-A-Q---LV....S-DQ--------WL-A..QLG-E............Q............................
Q4C1B8_CROWT/48-137..R-S-I---LV....S-DR--------TL-A..EFA-D............N............................
Q5MZ89_SYNP6/55-144..R-S-E---LG....S-DR--------TL-A..AIA-A............S............................
Q80UU5_MOUSE/475-564..R-S-S---LV....N-NR--------TQ-A..KVA-E............E............................
RNC_CAEEL/870-957..R-T-S---LV....S-NQ--------TQ-A..VVC-D............D............................
Q6BCK1_TETTH/1224-1338..F-M-E---IICCEQT-KS--------FL-S.....-............AK............................
Q110R1_TRIEI/53-143..E-S-D---LV....S-IK--------ML-S..EFA-K............D............................
A2QMS9_ASPNC/124-236.TK-S-F---LT....S-KT--------KL-S..ELA-H............K............................
Q0TYG8_PHANO/64-174.AQ-S-K---IL....D-KA--------RL-A..QIA-E............R............................
Q1XG54_CRYJA/71-157..I-S-E---LS....N-CT--------VL-S..KDA-F............D............................
Q9FYL8_ARATH/80-167..I-S-E---VS....N-..--------VE-S..SCA-L............DG...........................
DCL22_ASPNC/1111-1258..K-S-A---FT....N-NT--------FL-T..FIA-I............TF...........................
Q2U0L3_ASPOR/1051-1198..K-S-A---VT....N-NM--------FL-A..FLC-L............TF...........................
RM03_SCHPO/83-189..Q-N-G---WM....G-SK--------AL-S..QLA-T............I............................
A7SJH8_NEMVE/129-224..H-N-F---LT....N-RE--------TL-V..KVA-D............L............................
Q4PA03_USTMA/211-325..V-S-A---YV....G-PS--------TL-S..DVG-S............E............................
A2QRC1_ASPNC/121-242AAM-Y-A---YV....G-PK--------TL-A..AMA-R............E............................
RM44_PONAB/123-207..V-E-F---LT....G-ED--------VV-C..HVA-R............N............................
A6ZM86_YEAS7/153-272AAV-N-A---YI....S-EA--------VL-A..HIA-KYWGIEVETTSVLS............................
RM15_YEAST/105-208..G-T-K---FAKELTS-KN--------TA-C..TFV-K............L............................
Q6FVA4_CANGA/96-187..G-T-P---VSKGLVS-YQ--------TA-AEYVIA-K............N............................
A3LPK0_PICST/184-273VFR-H-K---LL....S-PG--------IL-T..KLA-F............G............................
Q6BWD6_DEBHA/187-276YLQ-F-K---LV....S-TS--------IL-T..KLA-F............G............................
A5DES0_PICGU/186-275SMK-V-R---LS....S-SV--------VL-T..KMA-M............G............................
A3GHW8_PICST/84-184..R-L-S---LGIFART-NN--------LN-S..TMF-W.........................................
Q0UQH0_PHANO/7-117TRQ-A-P---WAWNVTT-TH--------KI-T..KTD-E.........................................
Q0CCZ5_ASPTN/48-132..R-I-P---FR....N-PQ--------II-C..KLT-A............P............................
A2C1X8_PROM1/20-117..V-V-K---EV....N-AS--------SQ-A..KAI-T............K............................
A9B9W4_PROM4/20-117..V-V-S---RV....K-AE--------AQ-A..DAL-Q............M............................
Q7VCJ3_PROMA/20-117..V-V-S---LV....R-AE--------AQ-A..AAL-E............N............................
B1X410_PAUCH/23-120..V-V-K---RV....K-AT--------AQ-S..SAL-Q............K............................
Q067M9_9SYNE/20-119..V-V-A---EV....R-AD--------AQ-S..NLL-A............W............................
A3YYC2_9SYNE/20-117..V-V-A---RV....R-AQ--------AQ-A..QAL-Q............C............................
A3Z7F5_9SYNE/21-118..V-V-A---EV....K-AA--------AQ-A..DLL-E............R............................
A4CU57_SYNPV/21-118..V-V-A---EV....R-AD--------AQ-A..LAL-E............R............................
Q0I9N3_SYNS3/20-117..V-V-S---LV....R-AD--------AQ-A..AAL-E............K............................
Q7U7F7_SYNPX/20-117..V-V-A---KV....C-AE--------AQ-A..EAL-G............R............................
B5IKV4_9CHRO/2-99..V-V-A---SV....R-AD--------AQ-A..RQL-E............R............................
A8G4M5_PROM2/20-117..V-V-N---EV....K-AK--------SQ-S..KSL-S............Q............................
A5GTM3_SYNR3/12-109..A-V-A---LV....R-AE--------AQ-S..EAL-A............K............................
B7KCP4_CYAP7/45-142..V-V-A---QV....R-AE--------QQ-A..AHL-Q............T............................
B7K2P3_CYAP8/45-142..V-V-S---FV....R-AE--------TQ-A..ALL-E............Y............................
D3EMY0_UCYNA/29-126..V-V-A---QV....R-AE--------TQ-A..AAL-Q............Q............................
A8YKZ5_MICAE/29-126..V-V-G---KV....R-AE--------QQ-A..LDL-A............Q............................
B4VUK6_9CYAN/43-140..V-V-A---QV....R-AE--------SQ-A..NTL-R............S............................
Q112N8_TRIEI/20-117..V-V-S---QV....R-AE--------SQ-A..HQL-H............N............................
A0YQT6_LYNSP/17-114..V-V-S---QV....R-AE--------TQ-A..RHL-R............S............................
B8HT79_CYAP4/37-134..V-V-A---HV....R-AE--------AQ-A..EYL-R............S............................
A0ZGL0_NODSP/61-158..V-V-A---QV....R-AE--------TQ-A..LHL-R............S............................
Q31LB9_SYNE7/26-123..V-V-A---AV....R-AE--------RQ-A..ELL-V............S............................
MRNC_SYNY3/28-125..V-V-A---QV....R-AE--------QQ-A..QIL-T............T............................
B4WGA4_9SYNE/42-139..V-V-T---QV....K-AE--------QQ-S..HFV-D............L............................
B1XNV1_SYNP2/17-114..V-V-A---EV....R-AE--------TQ-A..QYL-T............L............................
MRNC_THEEB/23-120..V-V-A---HV....R-AE--------SQ-A..RYM-D............F............................
Q2JI20_SYNJB/24-121..V-V-R---RV....R-GS--------AQ-A..KLL-L............A............................
B7G3M0_PHATC/16-116..V-V-G---FV....R-AE--------FQ-S..RLL-A............Q............................
C6T3M8_SOYBN/105-207..V-M-A---VV....R-CE--------AQ-D..ALL-Q............K............................
Q94F12_ARATH/98-200..V-R-A---VV....R-CE--------AQ-Y..ALL-N............K............................
C0PKE8_MAIZE/108-210..V-M-D---VV....K-CE--------SQ-D..LLL-N............K............................
A9RYU0_PHYPA/18-120..V-M-D---LV....C-CE--------AQ-D..AML-Q............Q............................
C1DXY5_MICSR/99-208..T-K-R---AA....R-AE--------AQ-D..MVL-R............A............................
Q014M6_OSTTA/451-557..T-K-R---LA....R-AE--------AQ-D..YLL-R............L............................
A8J7A5_CHLRE/55-159..A-A-A---AA....T-DA--------SG-A..AAS-Q............L............................
A6GE80_9DELT/16-118..R-A-R---IV....N-AG--------AQ-A..ELL-A............E............................
A6TWK4_ALKMQ/25-124..A-I-G---YV....K-AQ--------SQ-A..TIV-R............T............................
A8MLB8_ALKOO/26-125..A-T-H---YV....R-AK--------AQ-S..HVV-H............A............................
Q8XHQ6_CLOPE/20-120..A-I-Q---YV....K-AK--------AQ-S..DII-N............A............................
C1I8F8_9CLOT/21-121..A-I-G---YV....K-AK--------SQ-S..AIM-H............N............................
A3DH39_CLOTH/26-125..S-I-A---YV....K-AK--------AQ-S..DIV-H............R............................
MRNC_SYMTH/12-111..A-L-R---YV....Q-AT--------AQ-A..AIL-H............H............................
A5D5M2_PELTS/19-118..A-V-K---YV....N-AG--------AQ-A..RLL-R............L............................
MRNC_MOOTA/10-109..A-L-K---YV....R-AT--------AQ-A..RVV-P............A............................
B0TC36_HELMI/34-133..A-V-E---IV....R-AA--------SQ-V..ALL-R............R............................
Q0AUF9_SYNWW/16-114..A-V-A---TV....R-AE--------SQ-A..QVL-R............Q............................
C0GIM8_9FIRM/8-106..A-T-R---LV....R-AE--------GQ-D..AAL-G............Q............................
Q045X7_LACGA/31-132..A-T-H---YV....S-AK--------AQ-A..GLI-T............K............................
Q3Y164_ENTFC/15-116..A-T-N---YV....S-AN--------AQ-A..FLI-Q............Q............................
C8WTZ3_ALIAD/13-112..A-T-R---YV....S-AV--------AQ-A..EAL-R............L............................
MRNC_STAA8/15-116..S-K-K---YV....S-AK--------SQ-A..QTL-E............Y............................
Q8ETZ8_OCEIH/12-114..A-T-S---YV....A-GK--------TQ-A..MVI-L............Y............................
B0MM93_9FIRM/17-116..A-V-Q---YV....N-AG--------FQ-S..YAY-D............V............................
E6U8V4_ETHHY/21-120..T-V-G---FV....R-AD--------AQ-A..QAA-H............V............................
D4LDD2_RUMC1/15-114..T-I-R---RV....C-AE--------YQ-S..AAV-D............V............................
A6P055_9FIRM/19-118..T-V-K---YV....A-AP--------AQ-A..AAA-E............K............................
A5KKA6_9FIRM/30-129..T-S-R---YV....Q-AS--------AQ-S..FMM-R............A............................
C5ENC6_9FIRM/5-104..S-A-G---LV....K-AG--------TQ-A..ALI-R............A............................
D1VT13_9FIRM/26-124..S-I-K---YV....Q-AK--------GQ-K..ELI-E............K............................
B7CDG4_9FIRM/9-110..N-A-V---IC....S-AK--------GQ-A..IML-N............K............................
B1C8Q3_9FIRM/18-117..S-M-N---YV....S-AL--------YQ-A..DIF-S............F............................
C9LVQ2_9FIRM/37-135..A-A-Q---IV....S-AV--------WQ-A..KAY-H............A............................
C4V0H2_9FIRM/37-135..S-A-Q---IV....S-AV--------WQ-A..RAY-R............G............................
D4KFD3_9FIRM/37-135..S-M-K---LV....S-AT--------LQ-A..QAY-K............A............................
C0WE29_9FIRM/32-129..A-A-R---MV....S-AV--------MQ-A..KAM-D............G............................
D1BMT8_VEIPT/47-145..V-T-E---FI....C-AK--------SQ-A..KVL-L............E............................
C9LMK9_9FIRM/35-133..A-S-E---MV....S-AR--------QQ-S..RIL-F............E............................
D3LUV6_9FIRM/36-134..A-A-E---FV....S-AK--------CQ-S..FVY-T............C............................
B9K831_THENN/17-112..V-K-E---WT....S-KH--------GQ-A..RML-E............S............................
D2C868_THENR/17-112..V-K-E---HT....S-KH--------GQ-A..WML-E............N............................
A6LJ32_THEM4/19-114..T-H-S---IV....N-RD--------HQ-A..LLL-D............K............................
A8F7A2_THELT/9-104..V-N-K---II....S-RE--------GQ-A..RSF-D............R............................
A9BJB7_PETMO/21-118..T-K-D---FL....S-AK--------AH-S..KFV-D............I............................
MRNC_KOSOT/20-117..T-L-L---YV....E-AK--------GQ-R..KAL-E............V............................
C1MLN8_MICPC/114-224ATK-L-N---WC....S-SV--------AM-S..DHL-A............R............................
C1FDU3_MICSR/76-186ATK-Q-G---WS....S-SI--------AM-C..GHL-R............R............................
A4RR17_OSTLU/28-138GVS-K-G---WC....S-AK--------AM-H..AHL-N............R............................
D4CVS6_9FUSO/18-116..V-K-S---KV....N-AR--------YQ-S..LIY-K............Q............................
C3WFU5_FUSMR/12-110..V-K-D---CV....N-AK--------RQ-S..ELY-R............E............................
A7I5W5_METB6/51-140..K-E-Q---LE....D-NA--------SL-A..QIG-R............R............................
A3CVM2_METMJ/43-132..K-S-T---IE....R-RP--------FL-A..ELG-R............R............................
A7I515_METB6/44-134..K-I-R---GV....N-RD--------KT-R..AFA-E............K............................
A3CRH2_METMJ/50-139..K-M-N---LV....N-MT--------RL-R..GLA-E............D............................
Q0UMM3_PHANO/145-228..S-S-Q---TV....S-RA--------AL-A..VTG-H............K............................
A4GHU1_9BACT/34-120..K-A-S---IV....S-RE--------NL-H..RVA-I............N............................
RNC_MYCPN/56-141..K-I-E---IV....K-GE--------NL-N..RIG-K............E............................
A5Z824_9FIRM/49-157..K-S-L---LV....R-KE--------YL-S..ARI-D............E............................
A4E6T0_9ACTN/44-134..K-V-S---LV....S-GA--------TL-S..EVS-H............E............................
RNC_RHOBA/69-158..K-S-A---VV....S-RR--------SC-G..KVA-C............K............................
A2F201_TRIVA/412-500..K-I-A---FV....K-NR--------TF-S..KIS-E............I............................
A6GP51_9BURK/26-116..R-S-H---LV....K-QD--------CL-A..MVG-R............N............................
RM15_SCHPO/89-181SYK-D-L---VNL..RS-PA--------RL-A..EVA-K............K............................
A6LNE7_THEM4/42-132..K-S-A---VT....S-ED--------IL-F..EIA-K............K............................
Q4A7X2_MYCH7/44-131..R-S-L---LT....S-TS--------SL-A..NAT-K............K............................
A3EQH6_9BACT/58-148..F-S-G---IV....S-TQ--------TL-A..SIA-R............R............................
RNC_CHLPN/45-135..R-A-S---LV....N-AK--------AC-C..RYT-T............M............................
RNC_LEPBJ/59-149..K-S-K---IV....S-TP--------IL-N..SIA-E............K............................
RNC_HAEI8/36-126..R-A-T---LV....R-EP--------TL-A..ILA-R............Q............................
A1R7I4_ARTAT/40-130..R-S-A---VV....S-TR--------AL-A..GIG-R............E............................
A7A3Q3_BIFAD/75-166..R-A-K---AV....S-EE--------SL-S..KIA-R............E............................
Q3DNE4_STRAG/44-134..R-S-M---IV....R-EE--------SL-A..GFS-R............L............................
Q14LC1_SPICI/52-142..R-S-K---IV....R-EG--------TL-A..ELV-R............R............................
RNC_MYCCT/40-130..R-S-S---TV....R-EE--------SL-S..RIA-K............D............................
D2BI67_DEHSV/54-144..R-S-L---LV....R-RE--------SL-V..RVA-L............G............................
A9B5J8_HERA2/42-132..R-A-M---LV....Q-TR--------TL-A..GLA-R............R............................
Q1MQV2_LAWIP/41-131..R-S-N---LV....N-TK--------ML-V..LLA-R............E............................
RTL1_ORYSJ/62-168..R-S-A---NV....S-TQ--------KL-A..RVA-V............R............................
RNC_MYXXD/55-145..R-A-R---VV....N-ED--------GL-A..RVA-R............T............................
Q1CTK8_HELPH/52-142..R-A-S---IV....S-AH--------GF-T..KLA-K............A............................
A9BIG2_PETMO/59-148..R-A-I---IG....S-EI--------IL-A..EVA-L............K............................
Q1IJU6_KORVE/51-141..R-A-Y---LV....S-AR--------HL-I..QTA-R............N............................
RNC_BDEBA/44-134..R-A-S---IV....N-EE--------VL-S..ELA-L............E............................
A0YTK7_LYNSP/34-125..R-A-A---LV....D-EQ--------QL-G..KFA-A............Q............................
A3CSF0_METMJ/81-165..R-L-Q---VT....R-NT--------KL-A..EIV-R............RQ...........................
RNC1_SYNY3/35-125..R-S-Q---LV....N-QN--------QL-A..YLA-R............F............................
A2RV16_DANRE/886-976..R-T-A---IV....Q-NQ--------HL-A..MLA-K............K............................
B3EKH3_CHLPB/78-168..R-A-K---IV....N-RK--------SL-A..GFA-G............K............................
A4BWV8_9FLAO/58-144..R-S-K---IV....S-RE--------HL-N..ELG-K............D............................
RNC_BACFN/59-145..R-S-K---IV....Q-RE--------TL-N..KLA-V............E............................
A7K823_9PHYC/78-168..R-V-K---FV....S-GK--------LL-S..KLA-H............Q............................
RNC_MYCS5/49-139..R-S-K---LV....D-KL--------AL-F..KIA-Q............K............................
RNC_AQUAE/37-121..K-A-Y---LI....S-EE--------FF-N..LLA-Q............K............................
A4GK15_9BACT/37-125..R-S-K---LV....S-RT--------TL-N..KIA-K............K............................
Q83VA6_9MOLU/41-129..R-A-Q---AV....C-VD--------SL-L..IYA-E............E............................
A5UJK3_METS3/37-127..R-A-N---YV....C-QT--------AL-I..YYS-H............E............................
RNC_PELUB/38-127..F-A-S---LV....N-KK--------KC-L..EIA-K............K............................
Q64AH3_9ARCH/53-141..K-A-E---LE....N-NL--------RL-A..EYG-E............N............................
RNC_MIMIV/351-441..R-C-K---LE....N-SE--------SL-F..FLA-K............Q............................
RNC_MIMIV/65-149..R-I-R---IE....R-GD--------SM-V..ELS-K............N............................
Q8EW40_MYCPE/52-139..R-K-N---LV....N-SE--------IF-K..KAS-E............E............................
RNC_UREPA/43-140..R-S-N---MV....R-SE--------IL-S..YAA-K............D............................
RNC_MYCGA/469-556..R-I-K---II....Q-SN--------TL-I..KAA-T............Q............................
Q4SZJ7_TETNG/259-381..R-S-A---LV....N-NT--------IF-A..SLA-V............K............................
A7SKX2_NEMVE/37-156..R-Q-A---LV....N-NN--------IF-A..EIA-V............K............................
A7IYQ4_9BRYO/1379-1492..R-A-A---AV....N-NE--------NF-A..RVA-V............K............................
DCL4_ARATH/1327-1436..R-S-L---SV....N-NE--------AL-A..NVA-V............S............................
DCL4_ORYSJ/1249-1358..R-S-L---AV....G-ND--------SL-A..YAA-V............E............................
A7SIA4_NEMVE/44-167..R-S-A---VV....N-NY--------SL-A..CLT-I............Q............................
Q2Q3U9_DROSI/1464-1620..R-S-A---LV....N-NT--------TL-A..CIC-V............R............................
RTL3_ARATH/445-551..R-D-A---NT....C-HD--------KY-A..CVA-V............K............................
RTL3_ORYSJ/76-183..R-A-A---NV....D-KE--------KL-A..RVA-V............V............................
DCR1_SCHPO/1120-1233..K-S-F---YV....C-NK--------SL-S..YIG-F............V............................
A4VD87_TETTS/1607-1720..K-T-S---LV....Q-NK--------TL-C..LIN-L............M............................
Q3SD86_PARTE/1582-1697LKK-Q-C---VV....C-NK--------AL-A..LVT-L............H............................
Q55FS1_DICDI/1250-1335..R-S-R---LV....R-NS--------NL-S..SIS-R............K............................
DCL_GIAIC/333-418..K-M-E---LV....R-NE--------AL-N..YLV-Q............T............................
DCL2_EMENI/1092-1250..K-H-A---IV....N-GH--------LL-A..FLC-M............QFKWAMPSPLTPSIDTGTETETEIISPPP
DCL2_NEOFI/1134-1281..K-H-A---VV....N-AN--------LL-A..FLC-M............ESATSEEKLDVAQT....SKDSFAVTTSQ
A7EYF3_SCLS1/1216-1363..R-S-A---LV....N-AD--------FL-A..FLC-M............EMSIEQYVTDLTEG....KDHQIHETHTR
DCL2_PHANO/1130-1270..R-T-A---TV....N-AS--------FL-A..FRL-F............ETTIDEETINK..........TSMRPESQ
A5IYM8_MYCAP/40-130..R-S-K---LV....C-TD--------SL-N..QIA-D............L............................
RNC_MYCMO/47-135..R-A-K---NV....C-SS--------GL-S..ELS-K............K............................
Q57XF2_TRYB2/735-814..N-T-K---LC....C-NE--------VL-A..TLI-P.........................................
Q3SE73_PARTE/554-687TAK-I-S---LL....D-SG--------FM-G..TMA-I............Y............................
Q6BCJ7_TETTH/1048-1163..K-S-L---LL....S-ND--------FM-S..RMA-ILNKFHYYALNISK............................
Q3SE70_PARTE/522-610..K-Q-Y---LL....G-NK--------FM-G..EQT-I............K............................
A2F201_TRIVA/593-691..S-S-F---LK....S-ND--------FL-G..KRA-Y............K............................
A0DYG6_PARTE/384-498..R-S-Q---IV....N-NN--------FI-G..KHL-FK.........YQY............................
Q6CC90_YARLI/191-332..R-G-Q---VI....A-NI--------VL-C..RWA-A............I............................
Q0UFS5_PHANO/190-279..R-E-R---LV....E-NV--------AL-A..KFS-E............A............................
Q6FQ28_CANGA/457-550..R-V-L---LV....S-NR--------RL-E..KWA-Y............L............................
A6RQB2_BOTFB/172-263..R-E-R---LV....K-NV--------TL-A..DFA-R............K............................
A1CZL8_NEOFI/163-252..R-E-L---LV....K-NE--------TL-S..EFA-T............L............................
Q152U6_SCHPM/172-262..R-A-K---FV....G-NE--------SA-D..KFA-R............L............................
A3LS79_PICST/241-330..R-S-Q---LI....D-NH--------TL-T..QFS-F............E............................
Q4PCH5_USTMA/903-1023..S-N-Y---PT....Q-NN--------FL-A..LLF-R............E............................
Q3SE71_PARTE/360-463..R-S-R---LI....M-NT--------FL-A..QLF-E............Q............................
Q0E579_SFAVA/192-324..R-S-I---YV....G-KW--------NL-S..KCC-V............S............................
Q9DSW1_9VIRU/45-139TLR-I-S---YG....S-KN--------VL-S..GLS-S............K............................
Q5GAH0_9VIRU/44-137RLK-I-N---YA....S-RK--------SF-A..AIA-G............S............................
Q4KS72_ISKNV/58-156..V-S-Q---LAITYQS-GT--------TM-S..TIA-Q............K............................
A3CW87_METMJ/121-210..R-K-A---YD....R-NS--------NL-A..RLC-D............R............................
Q6T445_LEIMA/391-483LVR-D-A---CE....M-NV--------NL-D..FVF-D............T............................
Q27IU0_DROSI/1685-1862..R-S-K---QV....A-NL--------NL-Y..RLG-R............R............................
DCR1_CAEEL/1348-1524..R-S-K---EV....S-NC--------NL-Y..RLG-K............K............................
DICER_DANRE/1295-1551..R-S-K---KV....S-NC--------NL-Y..RLG-K............K............................
DCL2A_ORYSJ/1006-1124..K-K-N---LI....S-NA--------AL-C..QLA-C............S............................
Q2Q3V3_DROSI/1205-1377..K-S-K---LV....S-NR--------NL-L..YCL-A............D............................
Q7Q073_ANOGA/1215-1375..K-G-R---MV....S-NR--------NL-L..YCA-M............G............................
DCL_GIAIC/646-734..R-Q-S---AE....T-NS--------VL-G..RLT-K............R............................
A2XBW0_ORYSI/1353-1498..R-Q-Q---MV....S-NM--------VL-Y..QYA-L............N............................
A6R2T0_AJECN/946-1054..K-D-T---VV....S-NK--------RL-S..YAA-I............E............................
DCL2_PHANO/947-1054..K-G-R---IV....S-NG--------FL-A..RAT-I............A............................
DCL2_ASPCL/955-1060..R-D-E---IV....Q-NP--------RL-T..KAA-L............D............................
DCL2_NEUCR/998-1113..K-D-K---LV....N-NV--------RL-C..RAS-R............D............................
Q6BCJ9_TETTH/1328-1487..R-T-I---II....Q-NR--------NL-A..QIA-V............K............................
A3LUF0_PICST/251-366..R-T-I---LA....T-NT--------LL-SKLTVA-Y............N............................
Q6BCJ7_TETTH/752-862..R-T-I---FI....N-NK--------YL-G..ISA-F............R............................
Q5KKA7_CRYNJ/521-644QDR-H-M---LI....S-NR--------TL-T..ANA-V............K............................
Q3SE73_PARTE/363-464..R-V-R---LI....T-NK--------HL-S..SIY-G............N............................
Q95ZG5_DICDI/926-1010..R-E-F---YT....K-NE--------YL-T..ELS-R............R............................
DCL1_ASPNC/1080-1192..R-M-C---LI....C-NK--------NL-F..NAA-V............D............................
DCR1_SCHPO/930-1038..R-K-K---II....S-NC--------NL-Y..KVA-I............D............................
Q3SD86_PARTE/1325-1459..R-A-R---IV....S-NE--------NL-R..KFS-I.........................................
Q0E5R5_MUCCI/1080-1190..R-M-R---MI....S-NT--------AL-F..KSA-I............Q............................

PF11469

Q8U363_PYRFU/5-123R.R-VDK---HA----K-GD--------YAEA--LIA-K------------A----------------------------
Q5JE89_PYRKO/13-132PPR-TDK---HG----K-GD--------IAEA--LFA-Y------------A----------------------------
A1RX42_THEPD/16-124KPR-..G---IA----P-GE--------AMEA--FLA-Y------------A----------------------------

PF14622

RM15_SCHPO/67-197--WN..........PET----ATQCILP..LKGPNS.PSSSS--------------------------------------
B6JY03_SCHJY/37-168--WG..........LQQ----VIRWKTP.KLRASVD.TKQSG--------------------------------------
Q7S1R6_NEUCR/117-265--FG..........LLT----VMRW.KP..RM.PED.LESSG--------------------------------------
Q2GMI6_CHAGB/267-400--VG..........LPE----VTRW.KP..RM.PEH.LEGSG--------------------------------------
F2QVA9_PICP7/51-190--KQ..........FDQ----LVFWKKR..DPTLED.PATSG--------------------------------------
A8Q4V0_MALGO/115-263--HHLGIVSAANLCLEK----VMRWHST.VRMDPVSGPQESG--------------------------------------
B9W9P9_CANDC/72-210--NN..........INE----IMFW.HT..RNSTLG.FESSG--------------------------------------
Q4P7G0_USTMA/113-257--LG..........LEN----VMRW.TPAVSDGQVG.PRETG--------------------------------------
B1QQ64_CLOBO/21-154--WD..........LGL----YLQM.....SKGEEL.TGGRE--------------------------------------
A5E1N1_LODEL/106-245--EN..........LNK----TMFW.VS..RDPTAS.FEASG--------------------------------------
D5X4R4_THIK1/15-139--ID..........LGR----FLRL.....GEGELQ.SGGAQ--------------------------------------
D0BJZ8_9LACT/21-153--CE..........LDK----YLLL.....GKGERA.SKGHE--------------------------------------
E0E418_9FIRM/25-155--IN..........LGD----HLFL.....GKGEKT.SGGSD--------------------------------------
B0AAQ8_9FIRM/24-157--IH..........LGK----YMLL.....GKG..E.EATGG--------------------------------------
C4Z0E7_EUBE2/19-151--IK..........LDT----FIRL.....GKGEEL.TGGRS--------------------------------------
RNC_BORA1/16-141--LE..........LSP----YLRL.......GEGE.MKSGG--------------------------------------
F2MX01_PSEU6/18-139--FE..........LGD----HLRL.......GSGE.LKSGG--------------------------------------
A5ZPT6_9FIRM/14-146--FG..........LPQ----YLLL.....GKGENM.TGGRN--------------------------------------
RNC_MESFL/16-146--ID..........LGK----IIRL.......GQGE.IKSKG--------------------------------------
RNC_LEIXX/20-149--IG..........LGE----YLLL.....GRGENQ.SGGRE--------------------------------------
E7P1S1_PSESG/18-139--FN..........LGE----YLRL.......GSGE.LKSGG--------------------------------------
RNC_CUPPJ/16-141--LQ..........LSE----VLRL.......GEGE.LKSGG--------------------------------------
RNC_THELT/22-156--IN..........LGR----YMFL.....GR..GE.EVSSG--------------------------------------
A7B5M4_RUMGN/41-173--IE..........LGS----YLLL.....GKGEEA.TGGRQ--------------------------------------
C8W586_DESAS/21-152--LN..........LGY----CLRM.......GKGE.ERSGG--------------------------------------
E4RLQ9_HALSL/23-154--LE..........LGR----YLFL.....GKGEEM.TGGRE--------------------------------------
C0CHF6_9FIRM/25-157--IR..........LDN----YLLL.....GHGEEN.TGGRK--------------------------------------
D4LHQ1_9FIRM/18-150--FG..........LPE----FILL.....GRGEEM.MGGRK--------------------------------------
D8DXQ2_PREBR/33-161--MG..........ITQ----LIL.........SNG.HSSSH--------------------------------------
A4G6R8_HERAR/16-141--LE..........LSQ----FLRL.......GEGE.LKSGG--------------------------------------
C4V2U1_9FIRM/26-157--LH..........LGA----HLRMGRG.EMLGGGA.ERQNN--------------------------------------
E9RSL3_9FIRM/47-179--LM..........LGS----YLLL.....GKGEEA.TGGRQ--------------------------------------
C5EV89_9FIRM/18-150--IR..........LGE----YLFL.....GKGEDA.TGGRG--------------------------------------
B7ANP9_9FIRM/26-158--IS..........LQK----YIML.....GKGEDA.TGGRQ--------------------------------------
C0B4M7_9FIRM/39-171--LE..........LGS----YLLL.....GKGEDA.TGGRF--------------------------------------
C8NEF3_9LACT/21-153--CS..........LNE----YLLL.......GKGE.TLSGG--------------------------------------
E0TKT7_MYCHH/17-144--LQ..........LSK----YLKV.....AKGSEE.ILNN.--------------------------------------
C9L8J0_RUMHA/47-179--IS..........LGD----YLLL.....GKGEEA.TGGRN--------------------------------------
B6BPF5_9PROT/18-138--IN..........LEK----YILT.....FN.LNN.KKIKI--------------------------------------
A1SLU8_NOCSJ/48-177--IG..........VGE----HVKL.....GRGEES.TGGRH--------------------------------------
Q2LVR4_SYNAS/22-153--CR..........IGS----FILL.....GKGEES.SGGRS--------------------------------------
E1T562_BURSG/16-140--LN..........ISE----GLRL.......GEGE.LRSGG--------------------------------------
C2KW20_9FIRM/24-156--LQ..........LSS----YLLL.....GKGEER.EGIQF--------------------------------------
E8NDE2_MICTS/20-149--IG..........LGQ----HVRL.....GRGEIL.TGGHD--------------------------------------
B0M9W6_9FIRM/19-151--LS..........LGD----YLLL.....SKGEDL.TGGRE--------------------------------------
E4TJ04_CALNY/16-145--ID..........LGN----FIRL.....GKGELN.SGGKD--------------------------------------
D4J805_9FIRM/20-152--IG..........LGK----YLML.....GKGEDM.GGGRN--------------------------------------
E8UCB0_TAYEM/16-140--LK..........LQD----LIKL.......GEGE.LKSGG--------------------------------------
C3X4M2_OXAFO/22-146--LE..........LSR----FLRL.......GEGE.LKAGG--------------------------------------
E7GKA5_CLOSY/18-150--LS..........LGK----YLLL.....GKGEEA.TGGRN--------------------------------------
E3DQV9_HALPG/23-155--IN..........LGQ----YLFL.....GKGEEM.TGGRE--------------------------------------
A5WCD8_PSYWF/39-165--LN..........LSS----YLILGVG.ERKGGGR.ERAS.--------------------------------------
D9R047_CLOSW/18-150--IR..........LGE----YLLL.....GKGEEA.TGGRG--------------------------------------
C0ERZ0_9FIRM/20-152--VE..........LGK----YLLL.....SRGEDA.TGGRE--------------------------------------
C0FMS9_9FIRM/17-149--ME..........LGK----YLFL.....GKGENL.TGGRN--------------------------------------
D4CL61_9FIRM/17-149--LS..........LGD----YLVL.....GRGEGR.EGIQL--------------------------------------
RNC_PELTS/21-152--LE..........LGT----CLYM.....GKGEER.SGGRD--------------------------------------
D9PK52_9ZZZZ/26-157--LE..........MEN----FLKM.....SKGEA..SSNKG--------------------------------------
C6Z037_9BACE/33-161--IG..........LDK----LIKY.TA..RQ.......SSH--------------------------------------
A6BED1_9FIRM/22-154--LD..........LGE----YLLL.....GKGEDA.TGGRK--------------------------------------
A9KLR1_CLOPH/23-155--LH..........LGN----YVFL.....GKGEDT.TGGRD--------------------------------------
E8ULD9_STREJ/18-150--CG..........FDR----FLRL.....GKGEEK.SGGRN--------------------------------------
D0MGH0_RHOM4/39-171--LG..........LGA----HVRLSEN..ME...R.AGGRD--------------------------------------
E9S866_RUMAL/20-147--FE..........LGK----YIFL.....GKGEEL.TGGRE--------------------------------------
B4VPC8_9CYAN/19-151--LG..........LGE----GYPF.LG..LTQERH.RLRLQ--------------------------------------
A8UFH9_9FLAO/33-161--LG..........LID----LVQSRIP..KS........NF--------------------------------------
F2NYA2_TRES6/34-167--MH..........IDK----YLVL.....GKGEEL.SGGRT--------------------------------------
D3PAP4_DEFDS/17-146--IR..........LND----FLML.......GKGE.IVSGG--------------------------------------
A1HN82_9FIRM/26-157--LG..........LGK----YLLL.......GKGE.AVSGG--------------------------------------
F0S2Z0_DESTD/19-149--VD..........LGS----YIYLGKG..EH......LSGG--------------------------------------

PF00636

A4XJ79_CALS8/5-105...........L...YE....RLDE-----NEKIIV-KRGRN......................................
C1KYH3_LISMC/13-114..MI.......A...EG....FLTE-----EEDRIA-KRGRN......................................
Q4WU14_ASPFU/35-122..LH.......L...DA....FAAP-----GPSQSQ-RATLG......................................
RTL2_ARATH/93-203..HG.......L...YS....FLRR-----NAPSLD-EKVKE..................FSEAVGKEDD..........
DCL1_ASPFU/1291-1405..LG.......F...HR....RIMA-----FSNPLQ-AQITH..................YVEEIETAQA..........
Y3330_ARATH/256-318...........L...KR....HHHS-----GGISLS-DNDLF......................................
A6SJD6_BOTFB/200-296.....................CIRP-----QPSIPM-...............................S...........
Q0F3I4_9PROT/44-134..WR.......L...SA....CLI.-----......-.......................VGDGERGEYG..........
RNC_WOLTR/54-144..IK.......L...GN....FII.-----......-.......................MNNSERCNGG..........
A5CEW8_ORITB/60-150..IN.......L...HK....YII.-----......-.......................MTANEEKCGG..........
A6DUU1_9RHOB/42-132..ID.......L...GG....VLK.-----......-.......................LGRSEMLSGG..........
RNC_BRAJA/60-150..LG.......L...LD....DIK.-----......-.......................LGSVGPSADA..........
A5V2R4_SPHWW/51-141..IG.......V...AT....HMK.-----......-.......................LGKQARDDGA..........
RNC_SPHAL/39-129..LD.......L...PA....LIR.-----......-.......................FGAQARSDGG..........
RNC_RHIEC/47-137..LN.......L...HL....YIR.-----......-.......................TGADVKKLTG..........
A5FV46_ACICJ/38-128..GG.......I...AG....LLS.-----......-.......................VSPGESRRGV..........
A3Z4A6_9SYNE/40-129..IG.......I...AR....WWQ.-----......-.......................IGAMASGDV...........
Q4C1B8_CROWT/48-137..YG.......L...DR....YLL.-----......-.......................MIDSVAQDK...........
Q5MZ89_SYNP6/55-144..YN.......L...ER....VLR.-----......-.......................VGKTAANDR...........
Q80UU5_MOUSE/475-564..LG.......M...QE....YAIT-----NDKTKR-PVALR......................................
RNC_CAEEL/870-957..LG.......F...TE....FVIK-----APYKTP-ELKL.......................................
Q6BCK1_TETTH/1224-1338..FK.......L...DQ....YFIY-----GIQYQQ-IFQK...................INHAANLKRQQNI.......
Q110R1_TRIEI/53-143..LK.......L...RQ....FSQL-----GKSYKW-KHKSE......................................
A2QMS9_ASPNC/124-236..YD.......M...QR........-----......-...............................V...........
Q0TYG8_PHANO/64-174..YG.......L...DK........-----......-...............................V...........
Q1XG54_CRYJA/71-157..LQ.......L...HD....LIKV-----APKINP-KKQS.......................................
Q9FYL8_ARATH/80-167DRLG.......L...GK....IIRV-----STKTDA-SNSA.......................................
DCL22_ASPNC/1111-1258HQVR.......E...QN....HIDV-----DDEHNV-HKNVTTCSIRLWDFLRLHSDALSTELSDFVQKSSEKADAIK..
Q2U0L3_ASPOR/1051-1198HWEK.......Q...HD....IIEV-----DSMGVP-SVIQTRGRVALYHFLRSQSDSLSDKVSSLVEDLTSQLHVIK..
RM03_SCHPO/83-189..WG.......L...EV....QRRE-----EGLQES-.......................FGKVLAKRAD..........
A7SJH8_NEMVE/129-224..TA.......L...PE....LIRT-----KHDLDS-.......................LKKEKHVEV...........
Q4PA03_USTMA/211-325..LG.......L...AA....Q...-----..NILR-.......................WNKQARAPGSGFTQNRG...
A2QRC1_ASPNC/121-242...........W.........GVEP-----HEDQTH-WRKSITSSV.........VYDNEFGDPVKGPKD..........
RM44_PONAB/123-207..LA.......V...EQ....LTLS-----EEFPV.-...........................................
A6ZM86_YEAS7/153-272...........R.........YLKM-----EPFEFT-LGRLKF................F....................
RM15_YEAST/105-208..HN.......L...DP....FIF.-----......-...............................W...........
Q6FVA4_CANGA/96-187...........L...EP....LVF.-----......-...............................W...........
A3LPK0_PICST/184-273.....................YNLV-----DPYKYN-LSSEI......................................
Q6BWD6_DEBHA/187-276.....................YNLA-----DNYKFH-FSKEM......................................
A5DES0_PICGU/186-275.....................YNLS-----QHLKHN-ISKEL......................................
A3GHW8_PICST/84-184.........................-----......-...........................................
Q0UQH0_PHANO/7-117.....................FGSE-----NAPPSP-HALAN......................................
Q0CCZ5_ASPTN/48-132.....................FMAD-----E.....-...............................I...........
A2C1X8_PROM1/20-117...........L...EP....FLTD-----TEKDFL-RKGRN......................................
A9B9W4_PROM4/20-117...........I...NV....FLTD-----LEKDFV-RRGRN......................................
Q7VCJ3_PROMA/20-117...........L...DY....YLTD-----LERKFV-RKGRN......................................
B1X410_PAUCH/23-120...........L...KP....LLEK-----DELDLI-RRGRN......................................
Q067M9_9SYNE/20-119...........L...EQH..DLLHD-----DELDLV-RRGRN......................................
A3YYC2_9SYNE/20-117...........L...EP....LLDE-----RERELV-RRGRN......................................
A3Z7F5_9SYNE/21-118...........L...DP....LLTD-----QERDWV-RRGRN......................................
A4CU57_SYNPV/21-118...........L...RP....MLTE-----FESDLV-RRGRN......................................
Q0I9N3_SYNS3/20-117...........L...EP....FLND-----QERDYV-RRGRN......................................
Q7U7F7_SYNPX/20-117...........L...DP....VLSE-----QERDLV-RRGRN......................................
B5IKV4_9CHRO/2-99...........L...DP....WLQS-----SERELV-RRARN......................................
A8G4M5_PROM2/20-117...........I...EH....LLNS-----NEIDLI-RRARN......................................
A5GTM3_SYNR3/12-109...........L...EP....LLNA-----EELDWV-RRGRN......................................
B7KCP4_CYAP7/45-142...........L...EP....YLTE-----TEQEIV-RQGRN......................................
B7K2P3_CYAP8/45-142...........L...KP....YLTD-----AEREIV-RRGRN......................................
D3EMY0_UCYNA/29-126...........L...QP....YLTE-----TEKDIV-RRGRN......................................
A8YKZ5_MICAE/29-126...........L...QP....YLTD-----QEKEIL-RRGRN......................................
B4VUK6_9CYAN/43-140...........L...EP....YLTE-----PELALL-RRGRN......................................
Q112N8_TRIEI/20-117...........L...KP....HLTD-----VELDIL-KRGRN......................................
A0YQT6_LYNSP/17-114...........L...EP....YLST-----AELEVV-RRGRN......................................
B8HT79_CYAP4/37-134...........L...RP....HLSN-----QELNLL-RQGRN......................................
A0ZGL0_NODSP/61-158...........L...TP....HLSP-----AELEIV-RRGRN......................................
Q31LB9_SYNE7/26-123...........L...LP....LLTA-----EELEIV-RRGRN......................................
MRNC_SYNY3/28-125...........L...LP....QLTD-----PEKEWV-RRGRN......................................
B4WGA4_9SYNE/42-139...........L...SP....VLTD-----AEKDIV-RRGRN......................................
B1XNV1_SYNP2/17-114...........L...EP....HLSE-----LERDIV-RRGRN......................................
MRNC_THEEB/23-120...........L...WE....YCTE-----TERSIF-RQGRN......................................
Q2JI20_SYNJB/24-121...........L...LP....HLNP-----EEQEIV-RWGRN......................................
B7G3M0_PHATC/16-116...........L...KED..VELSE-----KERQVL-SRGRN......................................
C6T3M8_SOYBN/105-207...........L...LES..NFLSD-----QERDVL-RWGKNI................V....................
Q94F12_ARATH/98-200...........L...VDD..DFLTK-----EERDIL-RWGKNL................G....................
C0PKE8_MAIZE/108-210...........L...LGE..DFLTE-----EERDIL-RWGRNI................V....................
A9RYU0_PHYPA/18-120...........L...LKG..DFLTD-----EERDVV-RWGKNI................E....................
C1DXY5_MICSR/99-208...........L...MDEADPFFTE-----EELAVV-RWGRN......................................
Q014M6_OSTTA/451-557...........L...VDG..GELSE-----DEISIV-KWGRN......................................
A8J7A5_CHLRE/55-159...........L.........VLTP-----AEADVL-RWGRN......................................
A6GE80_9DELT/16-118...........L...LAA..GVLDE-----AEEAVV-RRGRN......................................
A6TWK4_ALKMQ/25-124...........L...EA....ELSE-----EEWRVI-KKGRN......................................
A8MLB8_ALKOO/26-125...........L...ES....ELSE-----PEWTIV-KRGRN......................................
Q8XHQ6_CLOPE/20-120...........L...EG....ELKE-----DELYIY-KRGRN......................................
C1I8F8_9CLOT/21-121...........I...ED....TLTE-----DELYIY-KRGRN......................................
A3DH39_CLOTH/26-125...........I...MP....LLTE-----EELNIV-RRGRN......................................
MRNC_SYMTH/12-111...........L...MP....ALTE-----QEQDVV-RRGRN......................................
A5D5M2_PELTS/19-118...........L...EG....ILTE-----EEAEVV-RRGRN......................................
MRNC_MOOTA/10-109...........L...EE....YLTP-----AEKDIL-RRGRN......................................
B0TC36_HELMI/34-133...........I...EP....FLDD-----EEKEWV-RRGRN......................................
Q0AUF9_SYNWW/16-114...........I...LD....HLSE-----EEQDIV-RRGRN......................................
C0GIM8_9FIRM/8-106...........I...EP....LLSE-----EEAEIV-RRGRN......................................
Q045X7_LACGA/31-132...........M...QDL..KMLDE-----AELAAF-KRGRN......................................
Q3Y164_ENTFC/15-116...........ML.EEH....LLTE-----EEELYY-RRGRN......................................
C8WTZ3_ALIAD/13-112...........L...EP....MLTD-----AERDVI-RRGRN......................................
MRNC_STAA8/15-116...........LM.EQE....WFTD-----EEMDIL-KRGRN......................................
Q8ETZ8_OCEIH/12-114...........WLDVDG....FLTE-----EEQKVV-ARGRN......................................
B0MM93_9FIRM/17-116...........I...AD....ELTE-----EETEIF-KRGRN......................................
E6U8V4_ETHHY/21-120...........L...LP....LLDE-----AEIAVL-RRGRN......................................
D4LDD2_RUMC1/15-114...........I...LP....MLTE-----QEQTVL-RRGRN......................................
A6P055_9FIRM/19-118...........I...IP....LLTE-----EEGDVF-RRGRN......................................
A5KKA6_9FIRM/30-129...........I...QE....HLTE-----EEHAVY-RRGRN......................................
C5ENC6_9FIRM/5-104...........I...ED....LLTE-----EEHAVY-KRGRN......................................
D1VT13_9FIRM/26-124...........V...LQ....SLSE-----EELGVY-NRGKN......................................
B7CDG4_9FIRM/9-110...........M...MEE..DFFTE-----DEKTIL-ARGRN......................................
B1C8Q3_9FIRM/18-117...........L...KD....YFTE-----EEMKVA-LRGRN......................................
C9LVQ2_9FIRM/37-135...........I...EE....RLTE-----RERGIF-RRGRN......................................
C4V0H2_9FIRM/37-135...........I...AD....MLTE-----EEQTIY-RRARN......................................
D4KFD3_9FIRM/37-135...........I...KD....DLTE-----DEAYVF-KRGKN......................................
C0WE29_9FIRM/32-129...........I...EP....QLTE-----AEAVVV-RRGRN......................................
D1BMT8_VEIPT/47-145...........I...EN....TFTE-----DEQAIA-RRARN......................................
C9LMK9_9FIRM/35-133...........I...KE....LLSD-----RELKVC-KRARN......................................
D3LUV6_9FIRM/36-134...........L...QS....FLTE-----AEKSLC-RRSRN......................................
B9K831_THENN/17-112...........L...WN....LLTE-----EEREVV-KRAMN......................................
D2C868_THENR/17-112...........I...WN....LLGE-----KEREIV-KRAMN......................................
A6LJ32_THEM4/19-114...........I...LP....LLTE-----EEFSYV-KRGIN......................................
A8F7A2_THELT/9-104...........L...VE....LLSA-----EEFSLV-KRALN......................................
A9BJB7_PETMO/21-118...........V...LD....HLTP-----IEMQYY-KRAEN......................................
MRNC_KOSOT/20-117...........I...EK....FLSE-----EERIIV-RRGYN......................................
C1MLN8_MICPC/114-224...........L...LAD..GTITD-----DEISIL-EWGRN......................................
C1FDU3_MICSR/76-186...........L...LNG..TMITD-----DELTIL-EWGRD......................................
A4RR17_OSTLU/28-138...........L...LEQ..DLLTD-----QELAVL-KWGRD......................................
D4CVS6_9FUSO/18-116...........I...IE....ELDE-----EFKVIG-KRAKN......................................
C3WFU5_FUSMR/12-110...........I...FP....KLEE-----KFQMLG-NRSKN......................................
A7I5W5_METB6/51-140..LK.......I...RR....FVR.-----......-.......................LGRGEKD.L...........
A3CVM2_METMJ/43-132..FD.......L...QD....KIL.-----......-.......................VGEGARM.Q...........
A7I515_METB6/44-134..FQ.......L...HK....FIR.-----......-.......................WGKGEEKNK...........
A3CRH2_METMJ/50-139..LD.......L...AD....YVR.-----......-.......................WGKGEAAQR...........
Q0UMM3_PHANO/145-228..LG.......L...HL....SIL.-----......-.......................TGDGKGVT............
A4GHU1_9BACT/34-120..LE.......L...SN....HIK.-----......-.......................LGKGE...S...........
RNC_MYCPN/56-141..LN.......F...GN....FIK.-----......-.......................LGKGMPYT............
A5Z824_9FIRM/49-157..LK.......L...AP....FLIM-----SKGDLK-NNIDK......................................
A4E6T0_9ACTN/44-134..LG.......I...DD....III.-----......-.......................FGASETGTGA..........
RNC_RHOBA/69-158..LG.......L...DQ....CLI.-----......-.......................VGRGVTRNR...........
A2F201_TRIVA/412-500..LD.......L...KS....LLCT-----STPTNY-DLG........................................
A6GP51_9BURK/26-116..LL.......L...DQ....YLF.-----......-.......................LGAGELRSAK..........
RM15_SCHPO/89-181..WNPETATQCI.............-----......-...........................................
A6LNE7_THEM4/42-132..FN.......L...GK....YIL.-----......-.......................LGKGERRSRG..........
Q4A7X2_MYCH7/44-131..VG.......L...MN....YVL.-----......-.......................LGRGASE.I...........
A3EQH6_9BACT/58-148..MD.......L...GS....YMI.-----......-.......................LGKGSHSSGD..........
RNC_CHLPN/45-135..LG.......I...GD....YLL.-----......-.......................IGKGEKIQSE..........
RNC_LEPBJ/59-149..LN.......L...GE....YLL.-----......-.......................LGKGEKNSQG..........
RNC_HAEI8/36-126..FE.......L...GD....YMS.-----......-.......................LGSGELKNGG..........
A1R7I4_ARTAT/40-130..IG.......V...GE....FIY.-----......-.......................LGQGEKLTDG..........
A7A3Q3_BIFAD/75-166.KLH.......V...GP....YIL.-----......-.......................LGHGEAEQGG..........
Q3DNE4_STRAG/44-134..CG.......F...DH....YIK.-----......-.......................LGKGEEKSGG..........
Q14LC1_SPICI/52-142..MN.......W...AP....FLL.-----......-.......................LGKGEIKTKG..........
RNC_MYCCT/40-130..IN.......L...GQ....LIR.-----......-.......................LGHGELMTKG..........
D2BI67_DEHSV/54-144..IN.......L...GN....YLY.-----......-.......................LGRGEDVSKG..........
A9B5J8_HERA2/42-132..FN.......L...GS....YVQ.-----......-.......................ISRGEERAKA..........
Q1MQV2_LAWIP/41-131..LK.......L...NQ....YLL.-----......-.......................LARGEENQGG..........
RTL1_ORYSJ/62-168..RR.......L...YP....LLRR-----YNCAPQ-DHEVS..........................R...........
RNC_MYXXD/55-145..IP.......L...GD....LLL.-----......-.......................LGRGELMSGG..........
Q1CTK8_HELPH/52-142..IA.......L...QD....YLR.-----......-.......................VSSSEEISNG..........
A9BIG2_PETMO/59-148..LR.......L...DD....FIF.-----......-.......................LSKGEDKQGG..........
Q1IJU6_KORVE/51-141..LD.......L...GK....FLR.-----......-.......................LGRGEERSGG..........
RNC_BDEBA/44-134..MG.......L...NK....LMQ.-----......-.......................LGKGEALTGG..........
A0YTK7_LYNSP/34-125..LG.......I...GE....IMR.-----......-.......................LGKGAIKDGG..........
A3CSF0_METMJ/81-165.GLG.......I...DG....AVRR-----RGQPPT-...........................................
RNC1_SYNY3/35-125..LH.......I...AP....EIR.-----......-.......................LSQSLARDDG..........
A2RV16_DANRE/886-976..LE.......L...DR....FML.-----......-.......................YAHGPDLCR...........
B3EKH3_CHLPB/78-168..IS.......L...GE....HLL.-----......-.......................IGETADKINI..........
A4BWV8_9FLAO/58-144..LN.......L...IR....FVK.-----......-.......................SNIDQANV............
RNC_BACFN/59-145..IG.......L...DK....LIK.-----......-.......................YSTRSSSH............
A7K823_9PHYC/78-168..LG.......L...HE....FII.-----......-.......................MSQKGLYRCW..........
RNC_MYCS5/49-139..LK.......V...EQ....IIK.-----......-.......................TGPKKARNEV..........
RNC_AQUAE/37-121..LE.......L...HK....FIR.-----......-.......................IKRGKINE............
A4GK15_9BACT/37-125..LE.......L...DS....FIV.-----......-.......................KGDSLA..GQ..........
Q83VA6_9MOLU/41-129..IQ.......L...KK....YIY.-----......-.......................LGKGEKKRSV..........
A5UJK3_METS3/37-127..LG.......L...DK....HIK.-----......-.......................IYGDDSKITE..........
RNC_PELUB/38-127..IE.......L...EK....YIL.-----......-.......................VLNPKNKKI...........
Q64AH3_9ARCH/53-141..IG.......L...RN....YIRA-----NEKRED-IR.........................................
RNC_MIMIV/351-441..SD.......I...SS....YLL.-----......-.......................ISQNIEVLHG..........
RNC_MIMIV/65-149..LG.......L...NN....FVQ.-----......-.......................IYGISLND............
Q8EW40_MYCPE/52-139..LG.......L...LD....YAF.-----......-.......................IGKGINLEND..........
RNC_UREPA/43-140..LG.......L...TD....FLM.-----......-.......................IGVGLEQDQS..........
RNC_MYCGA/469-556..LE.......L...IN....YIR.-----......-.......................VGEGLKI.A...........
Q4SZJ7_TETNG/259-381..YD.......Y...HK....YFKA-----ISPELF-HVIDDFVQFQLEK.NEMQGMDSELRRSEEDEEK..........
A7SKX2_NEMVE/37-156..HG.......F...NK....SLFQ-----MSPEWF-NKIGVFVDHVKER.EARGIQDPFLTLSNDD.E...........
A7IYQ4_9BRYO/1379-1492..HS.......Y...HL....HLRH-----GSTALE-TQIRNFVND..........IHSELDKPGVNSFG..........
DCL4_ARATH/1327-1436..FS.......L...KR....FLFC-----ESIYLH-EVIEDYT..............NFLASSPLASGQ..........
DCL4_ORYSJ/1249-1358..KS.......I...HK....HLIK-----DSNHLT-SAISKFEM............YVKLSNSEKDLL...........
A7SIA4_NEMVE/44-167..RD.......F...HK....HMRS-----MSMALF-KVVRRFVRRLSEIEEKETRPDQLLLTTVEDGRG..........
Q2Q3U9_DROSI/1464-1620..HR.......L...HF....FILA-----ENEKLS-ETISKFVNFQESQGHRVTNYVHILLEEADVQPTPLDLDDELEL
RTL3_ARATH/445-551..KG.......I...YQ....SFIG-----SVPKPE-KMTTD..........................F...........
RTL3_ORYSJ/76-183..HG.......L...HH....FLRH-----KAPNLD-GQITD.................F........I...........
DCR1_SCHPO/1120-1233..LN.......L...HK....YIQH-----ESAAMC-DAIFEY...............QELIEAFRETASENP.......
A4VD87_TETTS/1607-1720..KG.......F...YK....FIIG-----SIQHNK-EEIELLLNN..........VEMFMGDTSLMYDT..........
Q3SD86_PARTE/1582-1697..YK.......L...DQ....FLLH-----PTLHK.-.......................VAHENHQTLNKIKQMYNE..
Q55FS1_DICDI/1250-1335..LC.......L...PP....T...-----......-.......................VSKG....I...........
DCL_GIAIC/333-418..LG.......L...PQ....LAE.-----......-.......................FSNNLVAK............
DCL2_EMENI/1092-1250KTLS.......L...YS....YLRY-----SPSRPL-PLHVEPESGSSNALTRHNLLCPSILHALNNTTAYPW.......
DCL2_NEOFI/1134-1281ESVE.......L...WR....FMRY-----...RGQ-NLNAARDASLAR....HRALRDEIASSLLHAPHYPW.......
A7EYF3_SCLS1/1216-1363RRFS.......L...VN....FLRH-----SSATFS-IYQKQALARH.......QELREEILAVIKTGDKFPW.......
DCL2_PHANO/1130-1270KR.A.......I...WQ....FLRS-----.GSPSL-NANRDNALRQH......EQVRDEIIIGLNEAARFPW.......
A5IYM8_MYCAP/40-130..LK.......L...KD....FLV.-----......-.......................LSSNVVATEV..........
RNC_MYCMO/47-135..LG.......L...SK....LLL.-----......-.......................ISKGSEH.L...........
Q57XF2_TRYB2/735-814..PG.......L...SE....ELSR-----VYDEV.-...........................................
Q3SE73_PARTE/554-687..HN.......F...HQ....YARN-----LPKEIQ-NSIKKA...............LALLRQDQFTD...........
Q6BCJ7_TETTH/1048-1163..YQ.......Q...DE....IIQ.-----......-.......................FIEDCNLNTK..........
Q3SE70_PARTE/522-610..MG.......L...KP....QVNE-----......-...........................................
A2F201_TRIVA/593-691..IG.......LIDLLS....IVRK-----......-...............................E...........
A0DYG6_PARTE/384-498..FG.......L...FH....YVRS-----LGHQTK-WFSP...................VLQNIHSNHIQPE.......
Q6CC90_YARLI/191-332..YG.......F...PS....KLRV-----ASSVLS-PEQLHILTVSILSPRTLGADANMWLVKYTFPGGYAAE......
Q0UFS5_PHANO/190-279..YG.......F...PDQLKRKVE.-----......-.......................FDKNSKAW............
Q6FQ28_CANGA/457-550..YG.......L...QK....HLL.-----......-.......................IRKSILNEML..........
A6RQB2_BOTFB/172-263..YG.......F...EK....RAK.-----......-.......................LPEDTIHPM...........
A1CZL8_NEOFI/163-252..YG.......L...DG....RAS.-----......-.......................VPQDLLNQP...........
Q152U6_SCHPM/172-262..YG.......F...DK....TLV.-----......-.......................LSYSAEKDQL..........
A3LS79_PICST/241-330..YG.......F...DK....RLK.-----......-.......................TKTDEEILK...........
Q4PCH5_USTMA/903-1023..CGLAARRDEL...CR....ELRG-----QHGHDD-D......................ASTTQKQACRKCT.......
Q3SE71_PARTE/360-463..LG.......L...QH....YIIN-----QDLHFK-QIRNPLV.............NDMISSDNKQLQ...........
Q0E579_SFAVA/192-324..IG.......L...NK....FIRC-----QYAGVD-GRKLQVY.............GHRFKRNNASGVQCQP.......
Q9DSW1_9VIRU/45-139..YG.......L...DK....LVRM-----TREESL-DKTKS......................................
Q5GAH0_9VIRU/44-137..LG.......F...WQ....HVKK-----PTDTVI-TPTS.......................................
Q4KS72_ISKNV/58-156..MG.......F...LK....WVVA-----HRDGAA-PASYK.................E....................
A3CW87_METMJ/121-210..WG.......L...YE....HRIH-----FDPDTP-RSTRK......................................
Q6T445_LEIMA/391-483...........L.........ELWH-----LLSTTA-HSRLG......................................
Q27IU0_DROSI/1685-1862..KR.......L...GE....YMIA-----TKFEPH-DNWLPPCYYVPKELEKALIEAKIPTHHWKLADLLDIKNLSSVQ
DCR1_CAEEL/1348-1524..LG.......I...PQ....LIVA-----NKFDAH-DSWLPPCYIPTCDFKAPNTDDAEEKDNEIERILDGQVIEEKPE
DICER_DANRE/1295-1551..KG.......L...PS....RMVV-----SIFDPP-VNWLPPGYVVNQDKSSTDKWDSDENKDLANGKASDDEDEDDDD
DCL2A_ORYSJ/1006-1124..SN.......L...VG....YIHA-----EEFNPR-DWIIPCLDYDE......RDNKKI........S...........
Q2Q3V3_DROSI/1205-1377..TD.......I...PK....KLNT-----ILFTPR-YTWVPPSISLPHNVLALWREKPGFANMIGPHNLRDLALDDEES
Q7Q073_ANOGA/1215-1375..YG.......L...PG....KIKA-----HPFDPK-NDWVPPLSTVPGAVRRAMVDANESPALLYNLKLTEEEIQSGVV
DCL_GIAIC/646-734...........F...PS....VVSE-----VIIESH-PKIQP......................................
A2XBW0_ORYSI/1353-1498..KT.......L...QS....YIQA-----DRFAPS-RWAAPGVLPVFDEESREYEPSIFDEESTGCELQKESYDD....
A6R2T0_AJECN/946-1054..AG.......L...DK....FILL-----DVFTGA-KWRPPYNKDHLE....SEEQGVA....................
DCL2_PHANO/947-1054..AG.......L...DR....FMIT-----KSFTGA-KWAPR.................Y........A...........
DCL2_ASPCL/955-1060..TG.......L...DA....FVIT-----KMFTPR-KWSAPLISER.......LERVAG....................
DCL2_NEUCR/998-1113..FG.......L...DE....YII.-----NSAASK-KWRPKFV..............ED........Y...........
Q6BCJ9_TETTH/1328-1487..KK.......I...FK....YILS-----SKIET.-...LSPIGIKYEI.AVDDDEQNQFQKEKEPDEYDKADQRNKNK
A3LUF0_PICST/251-366...........L...HKGLDDAIIA-----YRLESD-YLLNL.................H........T...........
Q6BCJ7_TETTH/752-862..NG.......L...QF....YVQT-----KRPSSY-DWRFNLF..............NL........N...........
Q5KKA7_CRYNJ/521-644..QG.......L...VK....YVRN-----KKFKVK-EWTPRDW.............ELDLLPGQFAPK...........
Q3SE73_PARTE/363-464...........L.........KLNA-----MNFKIN-SKKL...........................L...........
Q95ZG5_DICDI/926-1010..IG.......F...DY....ILR.-----......-.......................ITTIGDHS............
DCL1_ASPNC/1080-1192..KE.......I...YK....YIRS-----RGFSRH-TWYPEGLK............LLQ........G...........
DCR1_SCHPO/930-1038..CE.......L...PK....YALS-----TPLEIR-HWCPYG................F........Q...........
Q3SD86_PARTE/1325-1459...........I...HR....FFNC-----IKCTNF-DYSPPEFLLDKNTQELSEIQPEKQKENKENTKYQYTQ......
Q0E5R5_MUCCI/1080-1190..LR.......L...YE....YICS-----QNLPRR-FYRPPNY..............LC........K...........

PF11469

Q8U363_PYRFU/5-123---------------------WLMGLISEREAVEIIKKNLTP--------------------------------------
Q5JE89_PYRKO/13-132---------------------WLEKKITIEEAVEILSQNLDD--------------------------------------
A1RX42_THEPD/16-124---------------------WLKGSLSCEESVEMLYTGL..--------------------------------------

PF14622

RM15_SCHPO/67-197--------------------------------------------------------------------------------
B6JY03_SCHJY/37-168--------------------------------------------------------------------------------
Q7S1R6_NEUCR/117-265--------------------------------------------------------------------------------
Q2GMI6_CHAGB/267-400--------------------------------------------------------------------------------
F2QVA9_PICP7/51-190--------------------------------------------------------------------------------
A8Q4V0_MALGO/115-263--------------------------------------------------------------------------------
B9W9P9_CANDC/72-210--------------------------------------------------------------------------------
Q4P7G0_USTMA/113-257--------------------------------------------------------------------------------
B1QQ64_CLOBO/21-154--------------------------------------------------------------------------------
A5E1N1_LODEL/106-245--------------------------------------------------------------------------------
D5X4R4_THIK1/15-139--------------------------------------------------------------------------------
D0BJZ8_9LACT/21-153--------------------------------------------------------------------------------
E0E418_9FIRM/25-155--------------------------------------------------------------------------------
B0AAQ8_9FIRM/24-157--------------------------------------------------------------------------------
C4Z0E7_EUBE2/19-151--------------------------------------------------------------------------------
RNC_BORA1/16-141--------------------------------------------------------------------------------
F2MX01_PSEU6/18-139--------------------------------------------------------------------------------
A5ZPT6_9FIRM/14-146--------------------------------------------------------------------------------
RNC_MESFL/16-146--------------------------------------------------------------------------------
RNC_LEIXX/20-149--------------------------------------------------------------------------------
E7P1S1_PSESG/18-139--------------------------------------------------------------------------------
RNC_CUPPJ/16-141--------------------------------------------------------------------------------
RNC_THELT/22-156--------------------------------------------------------------------------------
A7B5M4_RUMGN/41-173--------------------------------------------------------------------------------
C8W586_DESAS/21-152--------------------------------------------------------------------------------
E4RLQ9_HALSL/23-154--------------------------------------------------------------------------------
C0CHF6_9FIRM/25-157--------------------------------------------------------------------------------
D4LHQ1_9FIRM/18-150--------------------------------------------------------------------------------
D8DXQ2_PREBR/33-161--------------------------------------------------------------------------------
A4G6R8_HERAR/16-141--------------------------------------------------------------------------------
C4V2U1_9FIRM/26-157--------------------------------------------------------------------------------
E9RSL3_9FIRM/47-179--------------------------------------------------------------------------------
C5EV89_9FIRM/18-150--------------------------------------------------------------------------------
B7ANP9_9FIRM/26-158--------------------------------------------------------------------------------
C0B4M7_9FIRM/39-171--------------------------------------------------------------------------------
C8NEF3_9LACT/21-153--------------------------------------------------------------------------------
E0TKT7_MYCHH/17-144--------------------------------------------------------------------------------
C9L8J0_RUMHA/47-179--------------------------------------------------------------------------------
B6BPF5_9PROT/18-138--------------------------------------------------------------------------------
A1SLU8_NOCSJ/48-177--------------------------------------------------------------------------------
Q2LVR4_SYNAS/22-153--------------------------------------------------------------------------------
E1T562_BURSG/16-140--------------------------------------------------------------------------------
C2KW20_9FIRM/24-156--------------------------------------------------------------------------------
E8NDE2_MICTS/20-149--------------------------------------------------------------------------------
B0M9W6_9FIRM/19-151--------------------------------------------------------------------------------
E4TJ04_CALNY/16-145--------------------------------------------------------------------------------
D4J805_9FIRM/20-152--------------------------------------------------------------------------------
E8UCB0_TAYEM/16-140--------------------------------------------------------------------------------
C3X4M2_OXAFO/22-146--------------------------------------------------------------------------------
E7GKA5_CLOSY/18-150--------------------------------------------------------------------------------
E3DQV9_HALPG/23-155--------------------------------------------------------------------------------
A5WCD8_PSYWF/39-165--------------------------------------------------------------------------------
D9R047_CLOSW/18-150--------------------------------------------------------------------------------
C0ERZ0_9FIRM/20-152--------------------------------------------------------------------------------
C0FMS9_9FIRM/17-149--------------------------------------------------------------------------------
D4CL61_9FIRM/17-149--------------------------------------------------------------------------------
RNC_PELTS/21-152--------------------------------------------------------------------------------
D9PK52_9ZZZZ/26-157--------------------------------------------------------------------------------
C6Z037_9BACE/33-161--------------------------------------------------------------------------------
A6BED1_9FIRM/22-154--------------------------------------------------------------------------------
A9KLR1_CLOPH/23-155--------------------------------------------------------------------------------
E8ULD9_STREJ/18-150--------------------------------------------------------------------------------
D0MGH0_RHOM4/39-171--------------------------------------------------------------------------------
E9S866_RUMAL/20-147--------------------------------------------------------------------------------
B4VPC8_9CYAN/19-151--------------------------------------------------------------------------------
A8UFH9_9FLAO/33-161--------------------------------------------------------------------------------
F2NYA2_TRES6/34-167--------------------------------------------------------------------------------
D3PAP4_DEFDS/17-146--------------------------------------------------------------------------------
A1HN82_9FIRM/26-157--------------------------------------------------------------------------------
F0S2Z0_DESTD/19-149--------------------------------------------------------------------------------

PF00636

A4XJ79_CALS8/5-105................................................................................
C1KYH3_LISMC/13-114................................................................................
Q4WU14_ASPFU/35-122................................................................................
RTL2_ARATH/93-203................................................................................
DCL1_ASPFU/1291-1405................................................................................
Y3330_ARATH/256-318................................................................................
A6SJD6_BOTFB/200-296................................................................................
Q0F3I4_9PROT/44-134................................................................................
RNC_WOLTR/54-144................................................................................
A5CEW8_ORITB/60-150................................................................................
A6DUU1_9RHOB/42-132................................................................................
RNC_BRAJA/60-150................................................................................
A5V2R4_SPHWW/51-141................................................................................
RNC_SPHAL/39-129................................................................................
RNC_RHIEC/47-137................................................................................
A5FV46_ACICJ/38-128................................................................................
A3Z4A6_9SYNE/40-129................................................................................
Q4C1B8_CROWT/48-137................................................................................
Q5MZ89_SYNP6/55-144................................................................................
Q80UU5_MOUSE/475-564................................................................................
RNC_CAEEL/870-957................................................................................
Q6BCK1_TETTH/1224-1338................................................................................
Q110R1_TRIEI/53-143................................................................................
A2QMS9_ASPNC/124-236................................................................................
Q0TYG8_PHANO/64-174................................................................................
Q1XG54_CRYJA/71-157................................................................................
Q9FYL8_ARATH/80-167................................................................................
DCL22_ASPNC/1111-1258................................................................................
Q2U0L3_ASPOR/1051-1198................................................................................
RM03_SCHPO/83-189................................................................................
A7SJH8_NEMVE/129-224................................................................................
Q4PA03_USTMA/211-325................................................................................
A2QRC1_ASPNC/121-242................................................................................
RM44_PONAB/123-207................................................................................
A6ZM86_YEAS7/153-272................................................................................
RM15_YEAST/105-208................................................................................
Q6FVA4_CANGA/96-187................................................................................
A3LPK0_PICST/184-273................................................................................
Q6BWD6_DEBHA/187-276................................................................................
A5DES0_PICGU/186-275................................................................................
A3GHW8_PICST/84-184................................................................................
Q0UQH0_PHANO/7-117................................................................................
Q0CCZ5_ASPTN/48-132................................................................................
A2C1X8_PROM1/20-117................................................................................
A9B9W4_PROM4/20-117................................................................................
Q7VCJ3_PROMA/20-117................................................................................
B1X410_PAUCH/23-120................................................................................
Q067M9_9SYNE/20-119................................................................................
A3YYC2_9SYNE/20-117................................................................................
A3Z7F5_9SYNE/21-118................................................................................
A4CU57_SYNPV/21-118................................................................................
Q0I9N3_SYNS3/20-117................................................................................
Q7U7F7_SYNPX/20-117................................................................................
B5IKV4_9CHRO/2-99................................................................................
A8G4M5_PROM2/20-117................................................................................
A5GTM3_SYNR3/12-109................................................................................
B7KCP4_CYAP7/45-142................................................................................
B7K2P3_CYAP8/45-142................................................................................
D3EMY0_UCYNA/29-126................................................................................
A8YKZ5_MICAE/29-126................................................................................
B4VUK6_9CYAN/43-140................................................................................
Q112N8_TRIEI/20-117................................................................................
A0YQT6_LYNSP/17-114................................................................................
B8HT79_CYAP4/37-134................................................................................
A0ZGL0_NODSP/61-158................................................................................
Q31LB9_SYNE7/26-123................................................................................
MRNC_SYNY3/28-125................................................................................
B4WGA4_9SYNE/42-139................................................................................
B1XNV1_SYNP2/17-114................................................................................
MRNC_THEEB/23-120................................................................................
Q2JI20_SYNJB/24-121................................................................................
B7G3M0_PHATC/16-116................................................................................
C6T3M8_SOYBN/105-207................................................................................
Q94F12_ARATH/98-200................................................................................
C0PKE8_MAIZE/108-210................................................................................
A9RYU0_PHYPA/18-120................................................................................
C1DXY5_MICSR/99-208................................................................................
Q014M6_OSTTA/451-557................................................................................
A8J7A5_CHLRE/55-159................................................................................
A6GE80_9DELT/16-118................................................................................
A6TWK4_ALKMQ/25-124................................................................................
A8MLB8_ALKOO/26-125................................................................................
Q8XHQ6_CLOPE/20-120................................................................................
C1I8F8_9CLOT/21-121................................................................................
A3DH39_CLOTH/26-125................................................................................
MRNC_SYMTH/12-111................................................................................
A5D5M2_PELTS/19-118................................................................................
MRNC_MOOTA/10-109................................................................................
B0TC36_HELMI/34-133................................................................................
Q0AUF9_SYNWW/16-114................................................................................
C0GIM8_9FIRM/8-106................................................................................
Q045X7_LACGA/31-132................................................................................
Q3Y164_ENTFC/15-116................................................................................
C8WTZ3_ALIAD/13-112................................................................................
MRNC_STAA8/15-116................................................................................
Q8ETZ8_OCEIH/12-114................................................................................
B0MM93_9FIRM/17-116................................................................................
E6U8V4_ETHHY/21-120................................................................................
D4LDD2_RUMC1/15-114................................................................................
A6P055_9FIRM/19-118................................................................................
A5KKA6_9FIRM/30-129................................................................................
C5ENC6_9FIRM/5-104................................................................................
D1VT13_9FIRM/26-124................................................................................
B7CDG4_9FIRM/9-110................................................................................
B1C8Q3_9FIRM/18-117................................................................................
C9LVQ2_9FIRM/37-135................................................................................
C4V0H2_9FIRM/37-135................................................................................
D4KFD3_9FIRM/37-135................................................................................
C0WE29_9FIRM/32-129................................................................................
D1BMT8_VEIPT/47-145................................................................................
C9LMK9_9FIRM/35-133................................................................................
D3LUV6_9FIRM/36-134................................................................................
B9K831_THENN/17-112................................................................................
D2C868_THENR/17-112................................................................................
A6LJ32_THEM4/19-114................................................................................
A8F7A2_THELT/9-104................................................................................
A9BJB7_PETMO/21-118................................................................................
MRNC_KOSOT/20-117................................................................................
C1MLN8_MICPC/114-224................................................................................
C1FDU3_MICSR/76-186................................................................................
A4RR17_OSTLU/28-138................................................................................
D4CVS6_9FUSO/18-116................................................................................
C3WFU5_FUSMR/12-110................................................................................
A7I5W5_METB6/51-140................................................................................
A3CVM2_METMJ/43-132................................................................................
A7I515_METB6/44-134................................................................................
A3CRH2_METMJ/50-139................................................................................
Q0UMM3_PHANO/145-228................................................................................
A4GHU1_9BACT/34-120................................................................................
RNC_MYCPN/56-141................................................................................
A5Z824_9FIRM/49-157................................................................................
A4E6T0_9ACTN/44-134................................................................................
RNC_RHOBA/69-158................................................................................
A2F201_TRIVA/412-500................................................................................
A6GP51_9BURK/26-116................................................................................
RM15_SCHPO/89-181................................................................................
A6LNE7_THEM4/42-132................................................................................
Q4A7X2_MYCH7/44-131................................................................................
A3EQH6_9BACT/58-148................................................................................
RNC_CHLPN/45-135................................................................................
RNC_LEPBJ/59-149................................................................................
RNC_HAEI8/36-126................................................................................
A1R7I4_ARTAT/40-130................................................................................
A7A3Q3_BIFAD/75-166................................................................................
Q3DNE4_STRAG/44-134................................................................................
Q14LC1_SPICI/52-142................................................................................
RNC_MYCCT/40-130................................................................................
D2BI67_DEHSV/54-144................................................................................
A9B5J8_HERA2/42-132................................................................................
Q1MQV2_LAWIP/41-131................................................................................
RTL1_ORYSJ/62-168................................................................................
RNC_MYXXD/55-145................................................................................
Q1CTK8_HELPH/52-142................................................................................
A9BIG2_PETMO/59-148................................................................................
Q1IJU6_KORVE/51-141................................................................................
RNC_BDEBA/44-134................................................................................
A0YTK7_LYNSP/34-125................................................................................
A3CSF0_METMJ/81-165................................................................................
RNC1_SYNY3/35-125................................................................................
A2RV16_DANRE/886-976................................................................................
B3EKH3_CHLPB/78-168................................................................................
A4BWV8_9FLAO/58-144................................................................................
RNC_BACFN/59-145................................................................................
A7K823_9PHYC/78-168................................................................................
RNC_MYCS5/49-139................................................................................
RNC_AQUAE/37-121................................................................................
A4GK15_9BACT/37-125................................................................................
Q83VA6_9MOLU/41-129................................................................................
A5UJK3_METS3/37-127................................................................................
RNC_PELUB/38-127................................................................................
Q64AH3_9ARCH/53-141................................................................................
RNC_MIMIV/351-441................................................................................
RNC_MIMIV/65-149................................................................................
Q8EW40_MYCPE/52-139................................................................................
RNC_UREPA/43-140................................................................................
RNC_MYCGA/469-556................................................................................
Q4SZJ7_TETNG/259-381................................................................................
A7SKX2_NEMVE/37-156................................................................................
A7IYQ4_9BRYO/1379-1492................................................................................
DCL4_ARATH/1327-1436................................................................................
DCL4_ORYSJ/1249-1358................................................................................
A7SIA4_NEMVE/44-167................................................................................
Q2Q3U9_DROSI/1464-1620PHANKCI.........................................................................
RTL3_ARATH/445-551................................................................................
RTL3_ORYSJ/76-183................................................................................
DCR1_SCHPO/1120-1233................................................................................
A4VD87_TETTS/1607-1720................................................................................
Q3SD86_PARTE/1582-1697................................................................................
Q55FS1_DICDI/1250-1335................................................................................
DCL_GIAIC/333-418................................................................................
DCL2_EMENI/1092-1250................................................................................
DCL2_NEOFI/1134-1281................................................................................
A7EYF3_SCLS1/1216-1363................................................................................
DCL2_PHANO/1130-1270................................................................................
A5IYM8_MYCAP/40-130................................................................................
RNC_MYCMO/47-135................................................................................
Q57XF2_TRYB2/735-814................................................................................
Q3SE73_PARTE/554-687................................................................................
Q6BCJ7_TETTH/1048-1163................................................................................
Q3SE70_PARTE/522-610................................................................................
A2F201_TRIVA/593-691................................................................................
A0DYG6_PARTE/384-498................................................................................
Q6CC90_YARLI/191-332................................................................................
Q0UFS5_PHANO/190-279................................................................................
Q6FQ28_CANGA/457-550................................................................................
A6RQB2_BOTFB/172-263................................................................................
A1CZL8_NEOFI/163-252................................................................................
Q152U6_SCHPM/172-262................................................................................
A3LS79_PICST/241-330................................................................................
Q4PCH5_USTMA/903-1023................................................................................
Q3SE71_PARTE/360-463................................................................................
Q0E579_SFAVA/192-324................................................................................
Q9DSW1_9VIRU/45-139................................................................................
Q5GAH0_9VIRU/44-137................................................................................
Q4KS72_ISKNV/58-156................................................................................
A3CW87_METMJ/121-210................................................................................
Q6T445_LEIMA/391-483................................................................................
Q27IU0_DROSI/1685-1862ICEMVREKADAL.................................................................GLE
DCR1_CAEEL/1348-1524NKTGWDIGGDV..................................................................SKS
DICER_DANRE/1295-1551EPEEAEVEPSKEDVNVEDDLEYYYEHIRFIDSMLIGSGAFGKKISLQPTDPGYEWKAPKKAHNSHFSPDGGADEFDYSSW
DCL2A_ORYSJ/1006-1124................................................................................
Q2Q3V3_DROSI/1205-1377LVKGNCSDI......................................................................K
Q7Q073_ANOGA/1215-1375AQA.............................................................................
DCL_GIAIC/646-734................................................................................
A2XBW0_ORYSI/1353-1498................................................................................
A6R2T0_AJECN/946-1054................................................................................
DCL2_PHANO/947-1054................................................................................
DCL2_ASPCL/955-1060................................................................................
DCL2_NEUCR/998-1113................................................................................
Q6BCJ9_TETTH/1328-1487KGNEEDGD........................................................................
A3LUF0_PICST/251-366................................................................................
Q6BCJ7_TETTH/752-862................................................................................
Q5KKA7_CRYNJ/521-644................................................................................
Q3SE73_PARTE/363-464................................................................................
Q95ZG5_DICDI/926-1010................................................................................
DCL1_ASPNC/1080-1192................................................................................
DCR1_SCHPO/930-1038................................................................................
Q3SD86_PARTE/1325-1459................................................................................
Q0E5R5_MUCCI/1080-1190................................................................................

PF11469

Q8U363_PYRFU/5-123--------------------------------------------------------------------------------
Q5JE89_PYRKO/13-132--------------------------------------------------------------------------------
A1RX42_THEPD/16-124--------------------------------------------------------------------------------

PF14622

RM15_SCHPO/67-197--------------------------------------------------F..EK..IYSSIVSGLVAVVYFQKGGVEAM
B6JY03_SCHJY/37-168--------------------------------------------------L..ER..VTFDTMLAIIGAVYMRKGARTAV
Q7S1R6_NEUCR/117-265--------------------------------------------------V..VV..VLNSTLFAIIGAISLEKGAAVAQ
Q2GMI6_CHAGB/267-400--------------------------------------------------L..TA..VLNTSLFAIIGAISLQHGAEVAQ
F2QVA9_PICP7/51-190--------------------------------------------------E..DT..VLGKTVLALIGAINLTHGKKVAT
A8Q4V0_MALGO/115-263--------------------------------------------------L..FK..VRGSCVEGLIGAIYHYKGAQVAQ
B9W9P9_CANDC/72-210--------------------------------------------------E..LK..VSGELLYSLVGAVNFFHGKNKAE
Q4P7G0_USTMA/113-257--------------------------------------------------L..FK..VRGVAVEALVGAIYHQKGASEAS
B1QQ64_CLOBO/21-154--------------------------------------------------R..VS..ILADCVESIIAAIYLDKGLDHAR
A5E1N1_LODEL/106-245--------------------------------------------------E..LK..VSGQLVHSLIGAINFYHGKDVAE
D5X4R4_THIK1/15-139--------------------------------------------------R..ES..ILADTVEALLGAIYLEAGFDTAQ
D0BJZ8_9LACT/21-153--------------------------------------------------N..PA..VLCDVFEAFVGAIYLDQGFEGAS
E0E418_9FIRM/25-155--------------------------------------------------R..DS..ILADATEAVIAAIYLDGGFDQAK
B0AAQ8_9FIRM/24-157--------------------------------------------------R..ERISILADALEAVIAAIYLDGGIKCAR
C4Z0E7_EUBE2/19-151--------------------------------------------------R..DS..IVSDACEAVIGAIYLDGGFANAK
RNC_BORA1/16-141--------------------------------------------------F..RRPSILADAVEALFGAVFLDAGFDAAR
F2MX01_PSEU6/18-139--------------------------------------------------YRRES..ILADTLEALIGAIYLDAG....M
A5ZPT6_9FIRM/14-146--------------------------------------------------R..DS..IVSDATEALLGAIYLDGGFEPAK
RNC_MESFL/16-146--------------------------------------------------Y..EKPSILSDVYEAVTAAIYLDQTEEVLI
RNC_LEIXX/20-149--------------------------------------------------K..AS..ILADTVEAVIGAVYLDAGGDEAT
E7P1S1_PSESG/18-139--------------------------------------------------FRRES..ILADALEALIGAIYLDAG....M
RNC_CUPPJ/16-141--------------------------------------------------F..RRPSILADALEAIVGAVFLDAGFEAAR
RNC_THELT/22-156--------------------------------------------------R..ERDSLLADMLEAVVAAVYID.GGLTAV
A7B5M4_RUMGN/41-173--------------------------------------------------R..PS..VTSDAMEALIGAIYLDGGFTNAK
C8W586_DESAS/21-152--------------------------------------------------R..ERPSILADSFEALLGAVYLDQGLEKTR
E4RLQ9_HALSL/23-154--------------------------------------------------R..DS..ILADSMEAIFGALYLDQGFTAAS
C0CHF6_9FIRM/25-157--------------------------------------------------R..DS..IVSDALEAVIGAIYLDGGLASAK
D4LHQ1_9FIRM/18-150--------------------------------------------------R..DS..IVSDGLESLIGAMYLDGGFEPAQ
D8DXQ2_PREBR/33-161--------------------------------------------------N..SY..VGGNAFEALVGAVYLDRGYNACM
A4G6R8_HERAR/16-141--------------------------------------------------F..RRPSILADTLEALFGAIFLDAGFNAAR
C4V2U1_9FIRM/26-157--------------------------------------------------L..EN..V....FEAVIGAVYLDRGWDAAY
E9RSL3_9FIRM/47-179--------------------------------------------------R..DS..ITSDAVEALIGAIYLDGGFASAK
C5EV89_9FIRM/18-150--------------------------------------------------R..NS..VVSDAMEALIGAIYLDGGFANAK
B7ANP9_9FIRM/26-158--------------------------------------------------R..DS..ITSDALEAVIGAIYLDGGFEPAK
C0B4M7_9FIRM/39-171--------------------------------------------------R..ES..ITSDALEALIGAIYLDGGFANAK
C8NEF3_9LACT/21-153--------------------------------------------------R..EKPAILCDVFEAFIGALYLDKGVNEVQ
E0TKT7_MYCHH/17-144--------------------------------------------------...TK..IKADILESLTAAIYLDQDKKTFE
C9L8J0_RUMHA/47-179--------------------------------------------------R..NS..IISDAMEALIGAIYLDGGFANAK
B6BPF5_9PROT/18-138--------------------------------------------------E..DK..IISDCCEALIGALYLDKGLNI..
A1SLU8_NOCSJ/48-177--------------------------------------------------K..AS..ILSDTVEAVIGAVHLS.GGFTTS
Q2LVR4_SYNAS/22-153--------------------------------------------------K..PS..ILANTMEAITAAVFLDGGFDRAY
E1T562_BURSG/16-140--------------------------------------------------F..RRPSILADTLEAVLGAVFLDGGFEAAQ
C2KW20_9FIRM/24-156--------------------------------------------------R..DS..VLSDALEAVIGAIYLDGGMKKAE
E8NDE2_MICTS/20-149--------------------------------------------------K..DS..ILADTMEAIIGATYLSAGPDAAT
B0M9W6_9FIRM/19-151--------------------------------------------------R..DS..ILSDAFEAVIGAVYLDQGFEEAR
E4TJ04_CALNY/16-145--------------------------------------------------R..PS..ILCDIFESIVAAMYLDGGYNEAR
D4J805_9FIRM/20-152--------------------------------------------------R..DS..ILSDALEAVIGSIYLDGGIEQAG
E8UCB0_TAYEM/16-140--------------------------------------------------F..KRPSILADAVEAIFGAIYIDSNIEQAQ
C3X4M2_OXAFO/22-146--------------------------------------------------F..KRPSILADAMEALFGAVFLDAGFETVK
E7GKA5_CLOSY/18-150--------------------------------------------------R..NS..VVSDAMEALIGAIYLDGGFASAK
E3DQV9_HALPG/23-155--------------------------------------------------R..DS..ILADTMEAIFGALYLDQSFKVVS
A5WCD8_PSYWF/39-165--------------------------------------------------.......ILADTVESLIGAIYLDSQSVDTV
D9R047_CLOSW/18-150--------------------------------------------------R..AS..IVSDAMEALIGAIYLDGGFANAK
C0ERZ0_9FIRM/20-152--------------------------------------------------R..DS..ILSDAFEALIGAIYLDGGMDRAR
C0FMS9_9FIRM/17-149--------------------------------------------------R..NS..ILSDALEAVIGAIYLDGGFEHAK
D4CL61_9FIRM/17-149--------------------------------------------------R..DS..VLSDAFEAVIGAIYLDGGFSAAQ
RNC_PELTS/21-152--------------------------------------------------R..PS..ILADAFEALLGAVYLDQGLEKAA
D9PK52_9ZZZZ/26-157--------------------------------------------------R..WH..ILANTFESVIGAIYLDFGYEQSK
C6Z037_9BACE/33-161--------------------------------------------------N..SY..MCGNAFEALVGAIYLDRGYRACK
A6BED1_9FIRM/22-154--------------------------------------------------R..ES..VTSDAMEALIGAIYLDGGFANAK
A9KLR1_CLOPH/23-155--------------------------------------------------R..DS..ILSDALESIIGAIYLDGGFANAK
E8ULD9_STREJ/18-150--------------------------------------------------R..DT..ILGDAFEAFLGALLLDKGEKTVE
D0MGH0_RHOM4/39-171--------------------------------------------------N..DS..ILSDAFEALVGAIYLDLGLEAAR
E9S866_RUMAL/20-147--------------------------------------------------R..AS..IVSDAMEAVIAAIYLDGG.LEA.
B4VPC8_9CYAN/19-151--------------------------------------------------N..HN..PFEEALIALVGAIHQDRGFSQAR
A8UFH9_9FLAO/33-161--------------------------------------------------G..NN..IHGNLFEALVGAIYLDKGYKFCE
F2NYA2_TRES6/34-167--------------------------------------------------K..KA..ILADAVEAVIGALYIDSGYESAE
D3PAP4_DEFDS/17-146--------------------------------------------------Y..TKPSILADIFESLLGAVYLDGGYNEAR
A1HN82_9FIRM/26-157--------------------------------------------------R..ERTSILADAFEAVIGAIYLDGGVSAAT
F0S2Z0_DESTD/19-149--------------------------------------------------R..EKSSILCDVFESLFGAIYLDGGFENAK

PF00636

A4XJ79_CALS8/5-105...................................VKSKTVPK.......NAKLSDYKYATALETLIGYLYLENN-----
C1KYH3_LISMC/13-114...................................AKSYTVPK.......NTDPGTYSMSTSFEAVLGYLYLAGE-----
Q4WU14_ASPFU/35-122.......................................................THGLGTEIEALVAATWIDSR-----
RTL2_ARATH/93-203...................LS..............VSYGGLVK...........APKVLADLFESLAGAVYVDVN-----
DCL1_ASPFU/1291-1405..................ESQ..............GAVDYWVV........AKDPPKCLPDMVEAYLGAIFVDSK-----
Y3330_ARATH/256-318......................................................QLNMRQSGAESTSNCSF...G-----
A6SJD6_BOTFB/200-296...................FR..............NIIELVKE......DTREDNTRIISRAVRAVIGAVYLDGG-----
Q0F3I4_9PROT/44-134...................IK..............SP...................SIVANAVEAVIGAVFEESG-----
RNC_WOLTR/54-144...................KR..............NL...................KNLENALEALIGAIYIDGG-----
A5CEW8_ORITB/60-150...................RS..............NK...................NNIENTMEAVIGAVYLDGG-----
A6DUU1_9RHOB/42-132...................RR..............KE...................ALLGDAMEAVIAAVYLDAG-----
RNC_BRAJA/60-150...................RL..............RK...................SVLGDICEAVIGAIFLDGG-----
A5V2R4_SPHWW/51-141...................VQ..............SD...................NVLGDVVEALIGALYLEGG-----
RNC_SPHAL/39-129...................RH..............SD...................NIAADAIEALIGALFLERG-----
RNC_RHIEC/47-137...................KR..............MM...................NVRADVVESLIAAIYLDGG-----
A5FV46_ACICJ/38-128...................RN..............RA...................TVLADALEALIGALYLDGG-----
A3Z4A6_9SYNE/40-129...................AG..............HA...................TLRAELSEALIGAIYAIGG-----
Q4C1B8_CROWT/48-137...................IG..............RV...................SWLADTFEAVLGALYLSTQ-----
Q5MZ89_SYNP6/55-144...................AG..............QQ...................SRLAEAFEALLGALYLSQR-----
Q80UU5_MOUSE/475-564.......................................................TKTLADLLESFIAALYIDKD-----
RNC_CAEEL/870-957........................................................KDKADLVEAFIGALYVDRG-----
Q6BCK1_TETTH/1224-1338................QSFRN..............IAT.NYNK...........DISILSQLFDSLVGAIYIDLQ-----
Q110R1_TRIEI/53-143......................................................KNKMLAQMFEALIGVIYLEFD-----
A2QMS9_ASPNC/124-236...................VR..............WCPRKPNN......LESSGMDLVLAHTMYAVIGAISLEKG-----
Q0TYG8_PHANO/64-174...................TR..............WTPKRADN......LQGSGIESVLMTSLYAIVGAIALERG-----
Q1XG54_CRYJA/71-157.........................................................ILCGCYRALFGAIGADAN-----
Q9FYL8_ARATH/80-167.........................................................ILCTGFRAIFGAIAIDAG-----
DCL22_ASPNC/1111-1258...........HELWEQRFYP..............WVRLRALG...........DMRVLSDIIQSIFGAVFIDSQ-----
Q2U0L3_ASPOR/1051-1198...........RDLWENGIYP..............WARLSVFR...........GLKVFSDIVQSVFGAIYIDSL-----
RM03_SCHPO/83-189..................PEM..............LRKPGEIY...........KDEAARRAILAILGGVYLHQG-----
A7SJH8_NEMVE/129-224....................T.................................KEDVISDAFLALIGAIYLDQG-----
Q4PA03_USTMA/211-325............GRGAAPRST..............NSATRTLL...........SRDVAADAMRAIVAVIFQEQG-----
A2QRC1_ASPNC/121-242..................PSE..............QSKQDVQN......TQGVTAEQANATFVRAVMGAIYLHAG-----
RM44_PONAB/123-207......................................................PPTVLQQTFFAVIGALLQSSG-----
A6ZM86_YEAS7/153-272...................................NNSLNSKDGIELITGKNFSETSALAMSVRSIIAAIWAVTE-----
RM15_YEAST/105-208....................K...............MRDPIKD......GHINGETTIFASVLNAFIGAILSTNG-----
Q6FVA4_CANGA/96-187....................K...............VSDPLND......GPIKGKSKVMSTVLNSFIGAILLQQG-----
A3LPK0_PICST/184-273..................................................DSNRKMEIFGKIFLSYVAGLSMDGY-----
Q6BWD6_DEBHA/187-276..................................................NLDDKLAKLSNIFLAYIGGLALDGY-----
A5DES0_PICGU/186-275..................................................SNEGKVLVLSTVFLAYLGALFSEGY-----
A3GHW8_PICST/84-184...................................KSYNYGVG......FETSGEMKVSAQMMYALVGAVTFVHG-----
Q0UQH0_PHANO/7-117..................................................SPVPSDEAGQSFVRALIGALHIHLG-----
Q0CCZ5_ASPTN/48-132...................QN..............TITQNPGQ......WGVVAGKNVMATTMEAIIGAVYYDSN-----
A2C1X8_PROM1/20-117....................................KAGRGPK.......NVDAATYAIATGFETIVGWLFLKNP-----
A9B9W4_PROM4/20-117....................................RVGRGSR.......KVEIATYAKATGFETLIGWLFLKDP-----
Q7VCJ3_PROMA/20-117....................................RVGRGSR.......KVNIAIYGKATGFETLIGWLFLKDP-----
B1X410_PAUCH/23-120....................................RAKRGPR.......NIDPAIYARATGFETMMGWLFLQNP-----
Q067M9_9SYNE/20-119....................................SAGRGPR.......RADAAVYGRATGFETMVGWLFLNNP-----
A3YYC2_9SYNE/20-117....................................RAGRGPR.......GGDPASYGRATGFETMVGWLFLRNP-----
A3Z7F5_9SYNE/21-118....................................RAGRGPR.......RGEASIYGRATGFETMVGWLFLQNP-----
A4CU57_SYNPV/21-118....................................RAGRGPR.......GGDPAAYGKATGFETMVGWLYLHNP-----
Q0I9N3_SYNS3/20-117....................................RAGRGPK.......RADAGIYGRATGFETMIGWLFLQNP-----
Q7U7F7_SYNPX/20-117....................................RAGRGPK.......RSDAAVYGLATGFETMVGWLYLNDP-----
B5IKV4_9CHRO/2-99....................................RAGRGPR.......GGDPAAYARATGFEALLGWLFLHDP-----
A8G4M5_PROM2/20-117....................................KTKRYPK.......SSNPSIYSRATGFETLIGWLFLKDP-----
A5GTM3_SYNR3/12-109....................................ACGRGPR.......RGDPSVYGRASGFETMVGWLYLNQP-----
B7KCP4_CYAP7/45-142....................................AATGRPR.......RLSPKLYQQATSLETLIGYLYLQDP-----
B7K2P3_CYAP8/45-142....................................AATGKPR.......RLSPEIYQQATSLETLIGYLYLHNQ-----
D3EMY0_UCYNA/29-126....................................ATNSHPR.......RLKPEVYQQATSLETLIGYLYLQDS-----
A8YKZ5_MICAE/29-126....................................AVTGKRR.......RLTAQVYQQASSLETLFGYLYLQDP-----
B4VUK6_9CYAN/43-140....................................AATGTSR.......RLNRKIYQQATSLETLLGYLYLTDP-----
Q112N8_TRIEI/20-117....................................AAFRKPK.......RLDPEVYQQATSLETLIGYLYLTDP-----
A0YQT6_LYNSP/17-114....................................AAVKGPK.......RIDQQTYQLATSLETLVGYLYLTDP-----
B8HT79_CYAP4/37-134....................................AASAGPK.......RVDPETYQQATSLETLLGYLYLTNP-----
A0ZGL0_NODSP/61-158....................................AASGRPK.......RVDPKIYQQATSLETLIGYLYLTDF-----
Q31LB9_SYNE7/26-123....................................AAGRVPR.......RLTAECYQQATGLETLLGYLYLCDP-----
MRNC_SYNY3/28-125....................................AATSTSR.......RANPELYQAASGLETLLGYLYLRDA-----
B4WGA4_9SYNE/42-139....................................ATTGKSR.......RARGQDYQKATGLESLIGFLYLTDQ-----
B1XNV1_SYNP2/17-114....................................AATGKPR.......RLSLAIYRQATGFEALVGYLYLTNP-----
MRNC_THEEB/23-120....................................AAADGPK.......RVAAKIYRQATGFEALLGYLYLTNP-----
Q2JI20_SYNJB/24-121....................................GCGRPPR.......HLPLADYQNASGLETVLGYLYLANP-----
B7G3M0_PHATC/16-116...................................AVSGSARN.......RRDPAAYQDATALEALLGYLYIADS-----
C6T3M8_SOYBN/105-207...................................SNKTKTKK.......RAGAAVYNRASSLETLVGYLYLTNV-----
Q94F12_ARATH/98-200...................................SARTRTRR.......RAGNAVYNKASSLETLIGYLYLTNG-----
C0PKE8_MAIZE/108-210...................................SSKTRTRK.......RAGIAVYNRASSLETLIGYLYLTNF-----
A9RYU0_PHYPA/18-120...................................TGQRRASR.......RAGSKAYSSASALETLIGYLYLTDH-----
C1DXY5_MICSR/99-208..................................GGSAGNTPSRLR.GKNKGGFAIYRNASALECVVGYLYISDG-----
Q014M6_OSTTA/451-557...................................AAYGNIPTRLK.GKGKGGHGTYRNASALECLVGYLYVADR-----
A8J7A5_CHLRE/55-159...................................AAVGSIPK.......SVSAGTYKKATAVEVLVAHLYLT.A-----
A6GE80_9DELT/16-118..................................TALRGAGHR.......RGTVREYRAATALEALMAWWLLGGQ-----
A6TWK4_ALKMQ/25-124...................................QKPATVPK.......NADLMDYKYATGFEALIGYLFYMGK-----
A8MLB8_ALKOO/26-125...................................QKSATVPK.......NADLTEYKYATGFEALLGYLFYIGQ-----
Q8XHQ6_CLOPE/20-120...................................AKSATVPK.......NANVRDYRNATGFEALVGYLYLTGK-----
C1I8F8_9CLOT/21-121...................................TKSATVPK.......NADVIDYRNATGFEALLGYLYLIGN-----
A3DH39_CLOTH/26-125...................................AKSATVPK.......NADITDYRYATGFESLLGFLYLKKD-----
MRNC_SYMTH/12-111...................................AKGHGAPK.......SADPAEYAASTGFEALVGYLYLAGQ-----
A5D5M2_PELTS/19-118...................................ARSPHAPR.......GAGVVEYRHSTALECLIGYLYLKGD-----
MRNC_MOOTA/10-109...................................ARPGHLPR.......TAAPAEYHSSTALESLLGYLYLQGD-----
B0TC36_HELMI/34-133...................................ADSGRSPR.......STDVATYRLSTGFECLVGYWSLARP-----
Q0AUF9_SYNWW/16-114....................................SRSTPPR.......HAEVHDYRMSTGFEALLGYTYLKGD-----
C0GIM8_9FIRM/8-106....................................TKSRVPK.......NADMAAYRRATGFEALLGWLYLNGE-----
Q045X7_LACGA/31-132...................................AKSHTHAK.......NTSINTYKLSTGFEAMFGYLDLLGK-----
Q3Y164_ENTFC/15-116...................................AKSHTSAK.......NADVTTYRVATGFEALMGYLHLTKQ-----
C8WTZ3_ALIAD/13-112...................................QKSSHTRR.......NVDVVVYRLATGFEALVGYLYATGE-----
MRNC_STAA8/15-116...................................AKSHTKAK.......NTDVQTYRKSSAIEAVIGFLYLEKR-----
Q8ETZ8_OCEIH/12-114...................................AKSGSVPK.......NISVQTYRYSTAFEALIGYHYMMKN-----
B0MM93_9FIRM/17-116...................................ATGNNVPR.......SSNPKDYRRATGMEALFGYLYLTGQ-----
E6U8V4_ETHHY/21-120...................................ANTAHVAK.......HADPIDYRYATGLEALFGYLYLTGR-----
D4LDD2_RUMC1/15-114...................................ATGNTVPK.......HADVQTYRRATALECLFGYLHLLGR-----
A6P055_9FIRM/19-118...................................TSPHSVPK.......AASRADYQTATALEALFGWLYLQGR-----
A5KKA6_9FIRM/30-129...................................TRSVSAAK.......NQSITDYRRATGFEALVGYLYLKKE-----
C5ENC6_9FIRM/5-104...................................AKSVTTAK.......NASVIDYRTATGLEALAGWLFLKER-----
D1VT13_9FIRM/26-124...................................SKPHTVAK.......NQTLGDYMEATGLEALFGYLYLLDR-----
B7CDG4_9FIRM/9-110...................................ATIHSKAK.......NATHKTYLEATALESMLGYLYLYGH-----
B1C8Q3_9FIRM/18-117...................................TKIKHSSK.......SVNISTYRLATALECVFGYLYLLDD-----
C9LVQ2_9FIRM/37-135....................................AKSHAPR.......RASVAEYHASTGFEALLGTLFLEKD-----
C4V0H2_9FIRM/37-135....................................TKSHAPR.......SASVADYHASTGFEALLGSLYIRHE-----
D4KFD3_9FIRM/37-135....................................AKSHAPR.......VASVHDYHISTGFEAVLGYLYLNKD-----
C0WE29_9FIRM/32-129....................................TKSTVPK.......SATVREYRQGTAFEALMGWLYLTGE-----
D1BMT8_VEIPT/47-145....................................SNVNVPK.......SSTVQEYRSSTAFEAVLGFLYETRQ-----
C9LMK9_9FIRM/35-133....................................THSTVPK.......SATVEEYRESTAFEGLLGYLYLSRQ-----
D3LUV6_9FIRM/36-134....................................AYSQVPK.......SASAAEYHNSTALEALIGYLVLDGQ-----
B9K831_THENN/17-112.....................................SKAAKR.......YGNDPLYRKSTGFEALVGYLFLKRD-----
D2C868_THENR/17-112.....................................SKAAKR.......HGNDPTYRKSTGFEALIGYLFLKRE-----
A6LJ32_THEM4/19-114.....................................SKGAGK.......YGNDPAYRKSTGFEVLIGFLYLKNE-----
A8F7A2_THELT/9-104.....................................SRAAKK.......YGNDIFYRKSTALEALIGYLYLKGN-----
A9BJB7_PETMO/21-118.....................................SNGAKK.......RGNDNDYRKSTGFEAVIGYLFLTKS-----
MRNC_KOSOT/20-117.....................................SRGARK.......RGDDENYKCATALEALVGYLFLKGR-----
C1MLN8_MICPC/114-224....................................FGHESRS.......GHKTLQHREASSLEALIAYWYLFDQ-----
C1FDU3_MICSR/76-186....................................YGHECRS.......RHNKVQHKEASALEALIAYWYLFDQ-----
A4RR17_OSTLU/28-138....................................FGHESRS.......GHKGDVHRDASALEALVAYLYLFES-----
D4CVS6_9FUSO/18-116...................................SNIKTFPK.......TCTVMEYKEATALEAVVGAMYLLNK-----
C3WFU5_FUSMR/12-110...................................GNIKTFPK.......SCSVQEYREATAFEALIAGFYIEGR-----
A7I5W5_METB6/51-140...................WK..............SGE.................DTILADTVEAIIGAVYLDSD-----
A3CVM2_METMJ/43-132...................KH..............NEE.................PNVIAETLEAIIGAMYLDGG-----
A7I515_METB6/44-134...................VW..............EQG.................SQAFDAAFEALIGAVFLDTR-----
A3CRH2_METMJ/50-139...................VW..............TSG..................RVLAECLEALVGAVYLDGG-----
Q0UMM3_PHANO/145-228.......................................................RDNIAETFEAIMGAVYVDSG-----
A4GHU1_9BACT/34-120...................LQ..............GN...................SILGNVLEALIGAIFLDSD-----
RNC_MYCPN/56-141.......................................................ETLFGDVLEALVAAIYEDLG-----
A5Z824_9FIRM/49-157......................................................NTSVKEDLFEAIIGAVTLDTL-----
A4E6T0_9ACTN/44-134...................RG..............LH...................SALENVYESLVGALYLDAG-----
RNC_RHOBA/69-158...................SY..............PK...................SLVSDVFEAVIAALYIDGG-----
A2F201_TRIVA/412-500.......................................................KKGSADLFEALFGAILLDSN-----
A6GP51_9BURK/26-116...................TI..............KD...................SIVADALEALFGAILLDSG-----
RM15_SCHPO/89-181...................................LPLKGPNS......PSSSSFEKIYSSIVSGLVAVVYFQKG-----
A6LNE7_THEM4/42-132...................SE..............KK...................SILADVVESLIAAIYLDSN-----
Q4A7X2_MYCH7/44-131...................RE..............NN...................KLKADIFESFCAAILLDQG-----
A3EQH6_9BACT/58-148...................RE..............NS...................SLLADTFESLAAAIYLEYG-----
RNC_CHLPN/45-135...................RG..............RL...................SAYANLFESILGAVYLDGG-----
RNC_LEPBJ/59-149...................KG..............RR...................KIAANLFESLVGAIYLDRG-----
RNC_HAEI8/36-126...................FR..............RE...................SILADCVEAIIGAMSLDQG-----
A1R7I4_ARTAT/40-130...................KN..............KA...................SILADTMEALIGATYLSND-----
A7A3Q3_BIFAD/75-166...................AD..............KS...................SILCDIVESLIGATFIQHG-----
Q3DNE4_STRAG/44-134...................RN..............RD...................TILGDLFEAFLGALLLDKG-----
Q14LC1_SPICI/52-142...................YE..............KN...................RILADIYESMIAALYLDLG-----
RNC_MYCCT/40-130...................YE..............KQ...................SILADIFEALTAAVYIDQN-----
D2BI67_DEHSV/54-144...................RF..............KP...................ANLAGAFEAVLAAIYIDKG-----
A9B5J8_HERA2/42-132...................RE..............RD...................NLLADAFEALLAAIALDGG-----
Q1MQV2_LAWIP/41-131...................RQ..............RN...................TLLADTMEAVFGAVFVDGD-----
RTL1_ORYSJ/62-168...................FT..............KSVEGPYS......GDPIEGPRVLADIVEAIVGAVYLDSK-----
RNC_MYXXD/55-145...................RE..............KN...................SVLADALEAVFGAVFLTSG-----
Q1CTK8_HELPH/52-142...................RE..............KP...................SILSSAFEALMAGVYLEAG-----
A9BIG2_PETMO/59-148...................RT..............KK...................SILSDTMEALFACIYLSCG-----
Q1IJU6_KORVE/51-141...................RS..............KS...................AILVDALEAVIAAIYLDGG-----
RNC_BDEBA/44-134...................AQ..............KP...................RLIASSFEAIVGALYLDGG-----
A0YTK7_LYNSP/34-125...................YQ..............NP...................ALLSDTFEAYIGAYYLDAG-----
A3CSF0_METMJ/81-165.......................................................DSIVADAFEALIGAIYLDRG-----
RNC1_SYNY3/35-125...................QS..............SP...................SILADVFESLLGAALLDRG-----
A2RV16_DANRE/886-976....................E..............SDL.................RHAMANCFEALIGAVYLEGG-----
B3EKH3_CHLPB/78-168...................QT..............ST...................SSLADAFEALIGALYLDKG-----
A4BWV8_9FLAO/58-144...................................GD...................NIHGNIFEALIGAIYLDKG-----
RNC_BACFN/59-145...................................NS...................YMYGNAFEAFIGAIYLDRG-----
A7K823_9PHYC/78-168...................HT..............NP...................KTLEDAFEALIGAIYLDLG-----
RNC_MYCS5/49-139...................LS..............SS...................NVLSDVVEALIAAIYLDQG-----
RNC_AQUAE/37-121........................................................TIIGDVFEALWAAVYIDSG-----
A4GK15_9BACT/37-125...................ET..............PE...................NILGNSLEAIFGAVYKESG-----
Q83VA6_9MOLU/41-129..................HNY...................................SIVTDAFEALFGAIYLDLG-----
A5UJK3_METS3/37-127...................NE..............VL...................SITADVFESFLGAIFLDQG-----
RNC_PELUB/38-127...................EI..............ED...................KIVADCLEALIGAIYLDKG-----
Q64AH3_9ARCH/53-141.......................................................PKVIADVFEAICGAIYLDTE-----
RNC_MIMIV/351-441...................RE..............NV...................NIIGGGLEAFVGALYLNIG-----
RNC_MIMIV/65-149........................................................HILEDIFESFIGAFYLNFG-----
Q8EW40_MYCPE/52-139...................TK...................................KIKADLFEAFAGAIFIDKG-----
RNC_UREPA/43-140...................AR..............ME...................KIYEDIFEAFIGAVAQDQG-----
RNC_MYCGA/469-556...................PL..............SP...................KILEDIFEAFIGAMYLDQG-----
Q4SZJ7_TETNG/259-381..................EED..............IEV.................PKAMGDIFESLAGAIYMDSG-----
A7SKX2_NEMVE/37-156...................EG..............IEA.................PKVLGDIFESVAGAIFLDSG-----
A7IYQ4_9BRYO/1379-1492..................LGD..............FKA.................PKVLGDIFESIAGALFLDAR-----
DCL4_ARATH/1327-1436..................SEG..............PRC.................PKVLGDLVESCLGALFLDCG-----
DCL4_ORYSJ/1249-1358...................EE..............PAC.................PKALGDIVESCIGAVLLDSG-----
A7SIA4_NEMVE/44-167..................GEA..............IEV.................PKVLGDLFEALLGALYVDCG-----
Q2Q3U9_DROSI/1464-1620..SQEAEQGVPPKGEFNMSTN..............VDV.................PKTLGDVLEALIAAIYLDCR-----
RTL3_ARATH/445-551...................IE..............LMGKEDDP......YRVVKAPKILVNLLAGVAGAVYIDVK-----
RTL3_ORYSJ/76-183...................EE..............LSMYPIHS......NGLLDPPKVLCDVVESLIGAIYCDSN-----
DCR1_SCHPO/1120-1233................WFWFE..............IDS.................PKFISDTLEAMICAIFLDSG-----
A4VD87_TETTS/1607-1720..................TYN..............QSL.................IKTLGDVIESLVGAIFIDNN-----
Q3SD86_PARTE/1582-1697..........YYDDISKMYTS..............EPI.................IKILGDVFESIVGAIFVDSS-----
Q55FS1_DICDI/1250-1335...................RD..............TLP.................IKKLGDYLESFIGCCFVDTT-----
DCL_GIAIC/333-418.......................................................SKTWADMYEEIVGSIFTGPN-----
DCL2_EMENI/1092-1250................SLFSA..............IHA.................DKFFSDVVESIIGAIFVDSG-----
DCL2_NEOFI/1134-1281................HALSR..............LNA.................DKFFSDIVESVLGAIFVDSG-----
A7EYF3_SCLS1/1216-1363................TLLSR..............LDA.................RKFFSDMIESLLGAIWIDSG-----
DCL2_PHANO/1130-1270................HLFAL..............TDP.................PKFLSDMVESVIGAVYIDSL-----
A5IYM8_MYCAP/40-130...................LS..............SK...................KVGADIFESLVAAIFLDQG-----
RNC_MYCMO/47-135...................RE..............NV...................KINADLFESFVAAIYLDLG-----
Q57XF2_TRYB2/735-814......................................................HYKVKADMVESILGAVYQSGM-----
Q3SE73_PARTE/554-687...................FR..............RINQYSQQ...........IPKIMSDLWESVAACILVEYG-----
Q6BCJ7_TETTH/1048-1163..................FKE..............SVSHQANS............PKVLGDLWESVAGAIIMDSD-----
Q3SE70_PARTE/522-610......................................................IPKLYGDIFQSVAAAILLDSG-----
A2F201_TRIVA/593-691...................NS..............SEDAAKGD......IDESRTPKYYGDVFEAITAAIAGTFG-----
A0DYG6_PARTE/384-498................PIKQV..............SAT....M...........LVTFLADIFESLIATVFLDKD-----
Q6CC90_YARLI/191-332...............YEKWYK..............SLEVKPKI......DEALCGRKIVADLFEAYVAGVYLSYG-----
Q0UFS5_PHANO/190-279.......................................................RKVVADIFEAYVAGVVLSDP-----
Q6FQ28_CANGA/457-550..................NSG..............SKV.................YKIYADLFEAYVGGLVEDDP-----
A6RQB2_BOTFB/172-263...................KE..............PEK.................IKAMGDIFEAYVAAIVLADP-----
A1CZL8_NEOFI/163-252...................RR..............WT...................KTKGDIFESYVAAIILSRP-----
Q152U6_SCHPM/172-262...................RK..............SQ...................KVIADTFEAYLGALILDGQ-----
A3LS79_PICST/241-330...................TG..............DQ...................KVYADIFEAYIGALSVERG-----
Q4PCH5_USTMA/903-1023...............RTRQTD..............EEMAQLPL...........LIKRDADMFEAYAAAVFLSHG-----
Q3SE71_PARTE/360-463....................I...................................SQKADIYEAIVGGVFEVTQ-----
Q0E579_SFAVA/192-324...............KVCADS..............VYTDTTST......HIHRDVISLLEDVMESFVGALWCSLM-----
Q9DSW1_9VIRU/45-139......................................................RLSVFEDVFEALFGAIEFVFD-----
Q5GAH0_9VIRU/44-137......................................................KEILLEDVFEAFLGAISTAVD-----
Q4KS72_ISKNV/58-156......................................................QQRLLEDTFEAMVGAISITMD-----
A3CW87_METMJ/121-210......................................................VDHVKGTLVESVFGILFLREG-----
Q6T445_LEIMA/391-483......................................................SGKVKADLVEGIFGELHLHLY-----
Q27IU0_DROSI/1685-1862QNGGAQNGQLDDSNDSCNDFS..............CFIPYNLV......SQHSIPDKSIADCVEALIGAYLIECG-----
DCR1_CAEEL/1348-1524TTDGIETITFPKQARVGNDDI..............SPLPYNLL......TQQHISDKSIADAVEALIGVHLLTLG-----
DICER_DANRE/1295-1551DAMCYLDPSKAGEEDDFVVGFWNPSEENCGTDIGKQSISYDLH......TEQCIADKSIADCVEALLGCYLTSCG-----
DCL2A_ORYSJ/1006-1124...................FL..............APNGMYSQ......RKMSIKSKRIADSVEALIGAYLSTAG-----
Q2Q3V3_DROSI/1205-1377YNRFVEGCRANGQSFYAGSDF..............SSEVNFCV......GLVAIANKVIADTLEALLGVIVKNYG-----
Q7Q073_ANOGA/1215-1375.....TVDKFLPLIEQAPAPS..............QSTLHTVL......QQVQIRDKVVADVTEALLGVCVKTVG-----
DCL_GIAIC/646-734......................................................DSKVYGDTFEAILAAILLACG-----
A2XBW0_ORYSI/1353-1498.............YADNMQED..............GEIEGDSS......CYRVLSSKTLADVVEALIGVYYVAGG-----
A6R2T0_AJECN/946-1054..................................................QREMSTKTLADVVEALLAAATLDGG-----
DCL2_PHANO/947-1054...................GD..............LLAETGPA......VKEERSSKLIADIIESLIGACYTVGG-----
DCL2_ASPCL/955-1060..................................................KRQVSSKVLADVVEALIGAAYMDGG-----
DCL2_NEUCR/998-1113...................MD..............EMKSPISA......ETRQMSSKMVADVVESLIGAAYMCGG-----
Q6BCJ9_TETTH/1328-1487.AENEEIEEQQQQNDIPNLLR..............LEPTYRHI...........KGKTLADTLESIIGVFFQQKK-----
A3LUF0_PICST/251-366...................GN..............LHPDMDAN......ETRIYEEEFLGDYFESYMGALVIEQP-----
Q6BCJ7_TETTH/752-862...................SF..............TEAPQDQK......QSFQLSYSNLSDTLESVVGCFYASNQ-----
Q5KKA7_CRYNJ/521-644...................KT..............MPTSFDGP......ESRVLGDKVIADIIEAIIGASYMPNK-----
Q3SE73_PARTE/363-464...................NH..............MMMIINEH......EDSKLSQKQQADIYEALCGACYIKNY-----
Q95ZG5_DICDI/926-1010........................................................KPHADLIEAFIGAIYIECG-----
DCL1_ASPNC/1080-1192...................KD..............HSRKATTE......SKHALAEKTIADVCEALIGAALLSGG-----
DCR1_SCHPO/930-1038...................KS..............TSDKCRYA......VLQKLSVKRIADMVEASIGACLLDSG-----
Q3SD86_PARTE/1325-1459..............NGEVITE..............LPKNYQPI...........PEKVHSDVVEALNGAFLIQYD-----
Q0E5R5_MUCCI/1080-1190...................DD..............SAEMIKSL......TYHKLSDKTLADVVESTLGASYLSCL-----

PF11469

Q8U363_PYRFU/5-123-----------------------------------------------EVLDFSKKKEAIGRALAPLLVIISERLTSS---
Q5JE89_PYRKO/13-132-----------------------------------------------DVTHFTRKKETIGKAFAVLYEEIGKRLGLK---
A1RX42_THEPD/16-124-----------------------------------------------......REGYDVAQALAKLADYLLEKIEAD---

PF14622

RM15_SCHPO/67-197NFC...KKS...IISDL
B6JY03_SCHJY/37-168DFC...QKN...LVPAL
Q7S1R6_NEUCR/117-265RIV...REK...ILKRL
Q2GMI6_CHAGB/267-400QVV...REK...ILRRL
F2QVA9_PICP7/51-190EFI...ETE...LMPLL
A8Q4V0_MALGO/115-263QFF...LSR...ILLPL
B9W9P9_CANDC/72-210EFI...TEK...LVDQF
Q4P7G0_USTMA/113-257KFF...QRW...ILPSL
B1QQ64_CLOBO/21-154EFV...MKNFKEIIEKA
A5E1N1_LODEL/106-245EFI...GEK...IMKGL
D5X4R4_THIK1/15-139EVM...RR....LFAPL
D0BJZ8_9LACT/21-153QFL...TQV...IISKI
E0E418_9FIRM/25-155DFI...LSN...LRDTI
B0AAQ8_9FIRM/24-157EFILTNMEK...IINDS
C4Z0E7_EUBE2/19-151EFV...NKF...ILNDL
RNC_BORA1/16-141KVI...EQQ...YVPVL
F2MX01_PSEU6/18-139DVA...RER...VIAWL
A5ZPT6_9FIRM/14-146DFV...LKF...ILNDI
RNC_MESFL/16-146SWI...KST...IFKYI
RNC_LEIXX/20-149ALV...LR....LIGPL
E7P1S1_PSESG/18-139EAA...RER...VLAWL
RNC_CUPPJ/16-141TLI...RKL...YIPIL
RNC_THELT/22-156KKV...FLS...YFAKY
A7B5M4_RUMGN/41-173EFI...HRF...ILTDL
C8W586_DESAS/21-152MFA...LKF....LAPV
E4RLQ9_HALSL/23-154DFV...LK....ILKED
C0CHF6_9FIRM/25-157EFI...LKH...VLNDM
D4LHQ1_9FIRM/18-150AFV...MKF...ILNDL
D8DXQ2_PREBR/33-161NFM...QNR...ILAKM
A4G6R8_HERAR/16-141DVI...RAL...YIPIL
C4V2U1_9FIRM/26-157SYV...QRQ...FTEEV
E9RSL3_9FIRM/47-179EFI...QKF...ILSDL
C5EV89_9FIRM/18-150EFI...HRF...ILNDI
B7ANP9_9FIRM/26-158KFI...MAH...VLNDL
C0B4M7_9FIRM/39-171EFI...LKY...ILNDL
C8NEF3_9LACT/21-153RFL...NLV...VIPKI
E0TKT7_MYCHH/17-144DFV...KK....ILHSL
C9L8J0_RUMHA/47-179EFV...HKY...ILNDI
B6BPF5_9PROT/18-138......TEK...IILDL
A1SLU8_NOCSJ/48-177AVV...VHR...LFDPL
Q2LVR4_SYNAS/22-153EFV...R.R...LFTPL
E1T562_BURSG/16-140TVI...KRL...YV.PI
C2KW20_9FIRM/24-156CFV...RGK...VLSDI
E8NDE2_MICTS/20-149AMV...L.R...LVEPL
B0M9W6_9FIRM/19-151KFV...ETY...LLQDV
E4TJ04_CALNY/16-145RFI...I.T...IASDK
D4J805_9FIRM/20-152SFI...MTH...VLNDI
E8UCB0_TAYEM/16-140KVV....ES...IYEPL
C3X4M2_OXAFO/22-146RVI....TR...LFADM
E7GKA5_CLOSY/18-150EFI...HKF...ILNDM
E3DQV9_HALPG/23-155DFI...LEL...LKVDI
A5WCD8_PSYWF/39-165KAC...VLD...WFAEL
D9R047_CLOSW/18-150EFI...LRF...IMNDL
C0ERZ0_9FIRM/20-152TFI...HTH...LLKDV
C0FMS9_9FIRM/17-149TFI...HKF...ILTDI
D4CL61_9FIRM/17-149CFI...KRL...VLSDI
RNC_PELTS/21-152GLA...IKY...L.APL
D9PK52_9ZZZZ/26-157KFL...EIN...LFPYL
C6Z037_9BACE/33-161YFM...EHR...IIGPY
A6BED1_9FIRM/22-154EFI...HRF...ILKDL
A9KLR1_CLOPH/23-155EFI...SNY...ILSDI
E8ULD9_STREJ/18-150EFI...HKV...MIPRL
D0MGH0_RHOM4/39-171AFV...ERA...LLAPL
E9S866_RUMAL/20-147..A...RKH...IMGFL
B4VPC8_9CYAN/19-151NWL...VKQ...LIAPL
A8UFH9_9FLAO/33-161KFI...YKR...VINPY
F2NYA2_TRES6/34-167RLV...LEL...IIPEI
D3PAP4_DEFDS/17-146RIV...L.M...LMSEL
A1HN82_9FIRM/26-157NFV...LNH...LHEDL
F0S2Z0_DESTD/19-149EVF...KRN...FLMKL

PF00636

A4XJ79_CALS8/5-105-----------------
C1KYH3_LISMC/13-114-----------------
Q4WU14_ASPFU/35-122-----------------
RTL2_ARATH/93-203-----------------
DCL1_ASPFU/1291-1405-----------------
Y3330_ARATH/256-318-----------------
A6SJD6_BOTFB/200-296-----------------
Q0F3I4_9PROT/44-134-----------------
RNC_WOLTR/54-144-----------------
A5CEW8_ORITB/60-150-----------------
A6DUU1_9RHOB/42-132-----------------
RNC_BRAJA/60-150-----------------
A5V2R4_SPHWW/51-141-----------------
RNC_SPHAL/39-129-----------------
RNC_RHIEC/47-137-----------------
A5FV46_ACICJ/38-128-----------------
A3Z4A6_9SYNE/40-129-----------------
Q4C1B8_CROWT/48-137-----------------
Q5MZ89_SYNP6/55-144-----------------
Q80UU5_MOUSE/475-564-----------------
RNC_CAEEL/870-957-----------------
Q6BCK1_TETTH/1224-1338-----------------
Q110R1_TRIEI/53-143-----------------
A2QMS9_ASPNC/124-236-----------------
Q0TYG8_PHANO/64-174-----------------
Q1XG54_CRYJA/71-157-----------------
Q9FYL8_ARATH/80-167-----------------
DCL22_ASPNC/1111-1258-----------------
Q2U0L3_ASPOR/1051-1198-----------------
RM03_SCHPO/83-189-----------------
A7SJH8_NEMVE/129-224-----------------
Q4PA03_USTMA/211-325-----------------
A2QRC1_ASPNC/121-242-----------------
RM44_PONAB/123-207-----------------
A6ZM86_YEAS7/153-272-----------------
RM15_YEAST/105-208-----------------
Q6FVA4_CANGA/96-187-----------------
A3LPK0_PICST/184-273-----------------
Q6BWD6_DEBHA/187-276-----------------
A5DES0_PICGU/186-275-----------------
A3GHW8_PICST/84-184-----------------
Q0UQH0_PHANO/7-117-----------------
Q0CCZ5_ASPTN/48-132-----------------
A2C1X8_PROM1/20-117-----------------
A9B9W4_PROM4/20-117-----------------
Q7VCJ3_PROMA/20-117-----------------
B1X410_PAUCH/23-120-----------------
Q067M9_9SYNE/20-119-----------------
A3YYC2_9SYNE/20-117-----------------
A3Z7F5_9SYNE/21-118-----------------
A4CU57_SYNPV/21-118-----------------
Q0I9N3_SYNS3/20-117-----------------
Q7U7F7_SYNPX/20-117-----------------
B5IKV4_9CHRO/2-99-----------------
A8G4M5_PROM2/20-117-----------------
A5GTM3_SYNR3/12-109-----------------
B7KCP4_CYAP7/45-142-----------------
B7K2P3_CYAP8/45-142-----------------
D3EMY0_UCYNA/29-126-----------------
A8YKZ5_MICAE/29-126-----------------
B4VUK6_9CYAN/43-140-----------------
Q112N8_TRIEI/20-117-----------------
A0YQT6_LYNSP/17-114-----------------
B8HT79_CYAP4/37-134-----------------
A0ZGL0_NODSP/61-158-----------------
Q31LB9_SYNE7/26-123-----------------
MRNC_SYNY3/28-125-----------------
B4WGA4_9SYNE/42-139-----------------
B1XNV1_SYNP2/17-114-----------------
MRNC_THEEB/23-120-----------------
Q2JI20_SYNJB/24-121-----------------
B7G3M0_PHATC/16-116-----------------
C6T3M8_SOYBN/105-207-----------------
Q94F12_ARATH/98-200-----------------
C0PKE8_MAIZE/108-210-----------------
A9RYU0_PHYPA/18-120-----------------
C1DXY5_MICSR/99-208-----------------
Q014M6_OSTTA/451-557-----------------
A8J7A5_CHLRE/55-159-----------------
A6GE80_9DELT/16-118-----------------
A6TWK4_ALKMQ/25-124-----------------
A8MLB8_ALKOO/26-125-----------------
Q8XHQ6_CLOPE/20-120-----------------
C1I8F8_9CLOT/21-121-----------------
A3DH39_CLOTH/26-125-----------------
MRNC_SYMTH/12-111-----------------
A5D5M2_PELTS/19-118-----------------
MRNC_MOOTA/10-109-----------------
B0TC36_HELMI/34-133-----------------
Q0AUF9_SYNWW/16-114-----------------
C0GIM8_9FIRM/8-106-----------------
Q045X7_LACGA/31-132-----------------
Q3Y164_ENTFC/15-116-----------------
C8WTZ3_ALIAD/13-112-----------------
MRNC_STAA8/15-116-----------------
Q8ETZ8_OCEIH/12-114-----------------
B0MM93_9FIRM/17-116-----------------
E6U8V4_ETHHY/21-120-----------------
D4LDD2_RUMC1/15-114-----------------
A6P055_9FIRM/19-118-----------------
A5KKA6_9FIRM/30-129-----------------
C5ENC6_9FIRM/5-104-----------------
D1VT13_9FIRM/26-124-----------------
B7CDG4_9FIRM/9-110-----------------
B1C8Q3_9FIRM/18-117-----------------
C9LVQ2_9FIRM/37-135-----------------
C4V0H2_9FIRM/37-135-----------------
D4KFD3_9FIRM/37-135-----------------
C0WE29_9FIRM/32-129-----------------
D1BMT8_VEIPT/47-145-----------------
C9LMK9_9FIRM/35-133-----------------
D3LUV6_9FIRM/36-134-----------------
B9K831_THENN/17-112-----------------
D2C868_THENR/17-112-----------------
A6LJ32_THEM4/19-114-----------------
A8F7A2_THELT/9-104-----------------
A9BJB7_PETMO/21-118-----------------
MRNC_KOSOT/20-117-----------------
C1MLN8_MICPC/114-224-----------------
C1FDU3_MICSR/76-186-----------------
A4RR17_OSTLU/28-138-----------------
D4CVS6_9FUSO/18-116-----------------
C3WFU5_FUSMR/12-110-----------------
A7I5W5_METB6/51-140-----------------
A3CVM2_METMJ/43-132-----------------
A7I515_METB6/44-134-----------------
A3CRH2_METMJ/50-139-----------------
Q0UMM3_PHANO/145-228-----------------
A4GHU1_9BACT/34-120-----------------
RNC_MYCPN/56-141-----------------
A5Z824_9FIRM/49-157-----------------
A4E6T0_9ACTN/44-134-----------------
RNC_RHOBA/69-158-----------------
A2F201_TRIVA/412-500-----------------
A6GP51_9BURK/26-116-----------------
RM15_SCHPO/89-181-----------------
A6LNE7_THEM4/42-132-----------------
Q4A7X2_MYCH7/44-131-----------------
A3EQH6_9BACT/58-148-----------------
RNC_CHLPN/45-135-----------------
RNC_LEPBJ/59-149-----------------
RNC_HAEI8/36-126-----------------
A1R7I4_ARTAT/40-130-----------------
A7A3Q3_BIFAD/75-166-----------------
Q3DNE4_STRAG/44-134-----------------
Q14LC1_SPICI/52-142-----------------
RNC_MYCCT/40-130-----------------
D2BI67_DEHSV/54-144-----------------
A9B5J8_HERA2/42-132-----------------
Q1MQV2_LAWIP/41-131-----------------
RTL1_ORYSJ/62-168-----------------
RNC_MYXXD/55-145-----------------
Q1CTK8_HELPH/52-142-----------------
A9BIG2_PETMO/59-148-----------------
Q1IJU6_KORVE/51-141-----------------
RNC_BDEBA/44-134-----------------
A0YTK7_LYNSP/34-125-----------------
A3CSF0_METMJ/81-165-----------------
RNC1_SYNY3/35-125-----------------
A2RV16_DANRE/886-976-----------------
B3EKH3_CHLPB/78-168-----------------
A4BWV8_9FLAO/58-144-----------------
RNC_BACFN/59-145-----------------
A7K823_9PHYC/78-168-----------------
RNC_MYCS5/49-139-----------------
RNC_AQUAE/37-121-----------------
A4GK15_9BACT/37-125-----------------
Q83VA6_9MOLU/41-129-----------------
A5UJK3_METS3/37-127-----------------
RNC_PELUB/38-127-----------------
Q64AH3_9ARCH/53-141-----------------
RNC_MIMIV/351-441-----------------
RNC_MIMIV/65-149-----------------
Q8EW40_MYCPE/52-139-----------------
RNC_UREPA/43-140-----------------
RNC_MYCGA/469-556-----------------
Q4SZJ7_TETNG/259-381-----------------
A7SKX2_NEMVE/37-156-----------------
A7IYQ4_9BRYO/1379-1492-----------------
DCL4_ARATH/1327-1436-----------------
DCL4_ORYSJ/1249-1358-----------------
A7SIA4_NEMVE/44-167-----------------
Q2Q3U9_DROSI/1464-1620-----------------
RTL3_ARATH/445-551-----------------
RTL3_ORYSJ/76-183-----------------
DCR1_SCHPO/1120-1233-----------------
A4VD87_TETTS/1607-1720-----------------
Q3SD86_PARTE/1582-1697-----------------
Q55FS1_DICDI/1250-1335-----------------
DCL_GIAIC/333-418-----------------
DCL2_EMENI/1092-1250-----------------
DCL2_NEOFI/1134-1281-----------------
A7EYF3_SCLS1/1216-1363-----------------
DCL2_PHANO/1130-1270-----------------
A5IYM8_MYCAP/40-130-----------------
RNC_MYCMO/47-135-----------------
Q57XF2_TRYB2/735-814-----------------
Q3SE73_PARTE/554-687-----------------
Q6BCJ7_TETTH/1048-1163-----------------
Q3SE70_PARTE/522-610-----------------
A2F201_TRIVA/593-691-----------------
A0DYG6_PARTE/384-498-----------------
Q6CC90_YARLI/191-332-----------------
Q0UFS5_PHANO/190-279-----------------
Q6FQ28_CANGA/457-550-----------------
A6RQB2_BOTFB/172-263-----------------
A1CZL8_NEOFI/163-252-----------------
Q152U6_SCHPM/172-262-----------------
A3LS79_PICST/241-330-----------------
Q4PCH5_USTMA/903-1023-----------------
Q3SE71_PARTE/360-463-----------------
Q0E579_SFAVA/192-324-----------------
Q9DSW1_9VIRU/45-139-----------------
Q5GAH0_9VIRU/44-137-----------------
Q4KS72_ISKNV/58-156-----------------
A3CW87_METMJ/121-210-----------------
Q6T445_LEIMA/391-483-----------------
Q27IU0_DROSI/1685-1862-----------------
DCR1_CAEEL/1348-1524-----------------
DICER_DANRE/1295-1551-----------------
DCL2A_ORYSJ/1006-1124-----------------
Q2Q3V3_DROSI/1205-1377-----------------
Q7Q073_ANOGA/1215-1375-----------------
DCL_GIAIC/646-734-----------------
A2XBW0_ORYSI/1353-1498-----------------
A6R2T0_AJECN/946-1054-----------------
DCL2_PHANO/947-1054-----------------
DCL2_ASPCL/955-1060-----------------
DCL2_NEUCR/998-1113-----------------
Q6BCJ9_TETTH/1328-1487-----------------
A3LUF0_PICST/251-366-----------------
Q6BCJ7_TETTH/752-862-----------------
Q5KKA7_CRYNJ/521-644-----------------
Q3SE73_PARTE/363-464-----------------
Q95ZG5_DICDI/926-1010-----------------
DCL1_ASPNC/1080-1192-----------------
DCR1_SCHPO/930-1038-----------------
Q3SD86_PARTE/1325-1459-----------------
Q0E5R5_MUCCI/1080-1190-----------------

PF11469

Q8U363_PYRFU/5-123-----------------
Q5JE89_PYRKO/13-132-----------------
A1RX42_THEPD/16-124-----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window