Sequence alignment for CL0539

PF14622

RM15_SCHPO/67-197DKSLREQIVTHKSY....KH.....GL..K....R....Y....NEPFVSVGNAV...ID..V....C.....L.-----
Q7S1R6_NEUCR/117-265SEETKWLAVTHKSF....DY.....GR..R....G....Y....NTRLAFLGRQI...IA..LETTRSILTSPV.-----
Q2GMI6_CHAGB/267-400PDEIKWLAITHKSF....DQ.....GR..R....G....F....NTRLAYFANARDPPTQ..D....S.....F.-----
A8Q4V0_MALGO/115-263EETLVSHALTHESW....MH.....GM..Q....G....H....NRRLAFIGRRA...LKTYL....S.....L.-----
Q4P7G0_USTMA/113-257NPDLALRAVTHESY....LN.....AR..E....G....H....NRRFAFLGRRT...LK..L....LT..TLY.-----
A5E1N1_LODEL/106-245DDV.ALQIITHKSF....GN.....GM..K....P....Y....NIKLSVMGSKL...LK..L....Y.....T.-----
D5X4R4_THIK1/15-139DRKLFERALTHRSF....G..........A....D....H....NERLEFLGDSV...LN..L....S.....A.-----
C4Z0E7_EUBE2/19-151DISLLEVALTHSSYANEQKK.....GN..C....C....D....NERMEFLGDAV...LE..L....S.....S.-----
RNC_BORA1/16-141DQALLEQALTHRS......H.....GA.......R....H....NERLEFLGDSV...LN..F....V.....V.-----
RNC_MESFL/16-146DSKIFSTALTHNSY....AN.....ET..KT..KE....T....YQRLEFLGDAV...LQ..M....Y.....V.-----
RNC_LEIXX/20-149DPELLELALTHRSYA..YEN.....GG..I....P....N....NERLEFLGDSI...LG..Q....A.....VT-----
RNC_THELT/22-156EPELLYNALCHSSY....AHEQKQRGR..K....DV..ES....NERLEFLGDAV...ID..L....L.....L.-----
C8W586_DESAS/21-152DENLLWQALTHSSYV..YES.....GSAAH....T....N....NQRLEFLGDAV...LE..L....L.....V.-----
E4RLQ9_HALHG/23-154NKKLLQRALTHKSF....PN.....EN..K....N....LSIKDNERLEFLGDSV...LS..L....A.....V.-----
D4LHQ1_9FIRM/18-150AKSLLEQAMTHSSY....ANEK.HLGK..L....G....C....NERLEFLGDAV...LE..L....I.....S.-----
A4G6R8_HERAR/16-141DAVLMQQALTHRSH....S..........S....V....H....NERLEFLGDSI...LN..C....V.....V.-----
A1SLU8_NOCSJ/48-177DPELLERALTHRSFA..YEN.....GG..L....P....T....NERLEFLGDSV...LG..V....V.....V.-----
Q2LVR4_SYNAS/22-153DITLLDNALVHRSY....VN.....EN..PS..LS....FA..DNERLEFLGDAV...LE..L....C.....I.-----
E8NDE2_MICTS/20-149DPELLSLALTHRSFA..YEN.....GG..I....P....H....NERLEFLGDSV...LG..Q....A.....VT-----
E4TJ04_CALNY/16-145NKELLIEALTHSSY....SY.....EN..KL..CR....N....YERLEFLGDAV...LQ..L....I.....V.-----
D4J805_9FIRM/20-152DENLLFTALTHSSY....AN.....EH..KLHKIH....H....NERLEFLGDAV...LE..V....V.....S.-----
E8UCB0_TAYEM/16-140DIKLLNRALTHRSF....SS..............T....H....NERLEFLGDSI...LN..F....S.....V.-----
E3DQV9_HALPG/23-155NKFLLERALTHKSY....PN.....EN..R....H....LNLKDNERLEFLGDSV...LS..L....S.....I.-----
A5WCD8_PSYWF/39-165DTSLAKLALTHRSF....D......GK..I....N....Y.....ERLEFLGDAL...LG..M....I.....I.-----
D9R047_CLOSW/18-150DRHLMTQAMTHSSY....AN.....EH..RLNKLE....C....NERLEFLGDSV...LE..V....V.....S.-----
RNC_PELTS/21-152DEGLLTRALTHSSF....TY.....EN..R....QNGLEN....NQRLEFLGDAV...LE..L....A.....V.-----
A9KLR1_CLOPH/23-155EPGLLRQALTHSSF....AN.....EK..RLSKLA....N....NERLEFLGDAV...LE..L....T.....T.-----
D0MGH0_RHOM4/39-171NAALYEQALTHRSV....LR.....GQ..PDSHLH....S....NERLEFLGDAV...LG..F....V.....V.-----
D3PAP4_DEFDS/17-146NKSLLLEALTHSSYA..YEK.....KL..K....R....N....YERLEFLGDSV...LQ..L....I.....V.-----
F0S2Z0_DESTD/19-149DKKLLKKALTHKSFS..FEK.....DS..E....E....N....YEVLEFLGDAV...IG..L....I.....V.-----
A5I4N2_CLOBH/24-150NEKLLDVALTHSSY....AN.....GK..KN..IK....Y....YERLEFLGDSV...LQ..L....I.....I.-----
RNC_BACV8/34-159.ISIYEQALLHKSLSVKSEK.....GR..L....L....N....NERLEFLGDAI...LD..A....V.....V.-----
B6JY03_SCHJY/68-197.DELNLQLLTHKSF....NH.....GQ..T....P....Y....NEGFRAIGRHA...LE..L....S.....L.-----
C4R5N4_PICPG/63-200DNELLLQILTHKSF....AH.....GL..K....P....Y....NEKLSVIGFQL...LK..L....Q.....S.-----
E6UF22_RUMA7/20-145NEKLLYEALSHSSF....AN.....EN..KK.QRH....S....NERLEFLGDSV...LS..I....V.....V.-----
K7X354_MYCHR/18-142.LSLYEQAFTHKSY....HH.....VRPNK....P....H....YEMLEFLGDSL...LN..L....Q.....T.-----
Q13VM8_BURXL/16-137NAELLRQALTHRSH....S..........S....T....H....NERLEFLGDSV...LN..C....A.....V.-----
RNC_RALME/17-139.PELLQQALTHRSH....S..........A....Q....H....NERLEFLGDSV...LN..C....A.....V.-----
Q59PD0_CANAL/73-209.DEIALQVITHKSF....GN.....GI..K....P....Y....NEKLAAMGSKL...LS..L....Y.....F.-----
RNC_PSESM/18-137DQELMILALTHRSF....A..........G....R....N....NERLEFLGDAI...LN..F....V.....A.-----
R5BXA0_9FIRM/20-152DINLLKQAVTHSSY....SN.....EK..NMGKLG....C....NERLEFLGDAV...LE..V....I.....S.-----
R5HQM8_9FIRM/18-148.EKLLRQALTHSSF....AN.....EK..HLRKHS....D....NERLEFLGDAV...LE..I....V.....S.-----
R5TZE4_9FIRM/19-150.FSLLEQAMMHSSY....TN.....EK..HLEKYH....C....NERLEFLGDAV...LE..L....V.....S.-----
R5X6S0_9CLOT/24-150NKEYILEALTHSSY....SN.....EN..K....N....YP..FNERLEFLGDSV...LS..I....V.....I.-----
R6GD49_9FIRM/20-151NKRTLALAMTHSSY....AN.....EQ..RGRRKA....N....NERLEFLGDAV...LE..V....T.....I.-----
R6JSS6_9CLOT/18-150NKNLFTQALTHSSY....AN.....EH..RLDHSR....C....NERLEFLGDAV...LE..I....V.....T.-----
R6LRB3_9FIRM/18-150DSHLLRHAVTHSSY....VN.....EK..HMKKAD....C....NERLEFLGDAV...LE..L....I.....S.-----
R6PBG7_9FIRM/22-152..DLLVNALTHSSY....AN.....EH..HIAYKE....N....NERLEFLGDAV...LE..L....T.....S.-----
R6QQD7_9FIRM/19-150DKKLLTTALTHSSY....AN.....ER..KLSRGK....D....NERLEFLGDAV...LE..L....I.....M.-----
R7AJR0_9BACE/21-152.VSLLKHALTHSSY....AN.....EL..RINKTG....N....NERLEFLGDAV...LE..L....V.....S.-----
R7DB60_9FIRM/14-146NKKLLKQALTHSSY....AN.....EK..KLGKLG....C....NERLEFLGDAV...LE..L....I.....S.-----

PF00636

A3GHW8_PICST/84-184---------------------------------------------EKLSAMGSKI---LN--L----------YF.....
RM15_SCHPO/89-181---------------------------------------------EPFVSVGNAV---ID--V----------CL.....
RM03_SCHPO/83-189---------------------------------------------EKLWSIGKVF---GD--F----------YV.....
A2QRC1_ASPNC/121-242---------------------------------------------ESLATLGHDL---LT--H----------YT.....
Q0UQH0_PHANO/7-117---------------------------------------------AVDAYIGPKA---LA--I----------VA.....
Q1XG54_CRYJA/71-157---------------------------------------------GALNVLGYNI---IQ--A----------AI.....
Q9FYL8_ARATH/80-167---------------------------------------------KALSIFGTHI---IE--T----------AV.....
A0A023ZEP0_YEASX/153-272---------------------------------------------HGLNIMGKNL---LS--Y----------HV.....
Q4PA03_USTMA/211-325---------------------------------------------AALATVGNSL---LG--M----------LA.....
Q0CCZ5_ASPTN/48-132---------------------------------------------KSLALAGDAI---LR--Q----------VL.....
Q0UMM3_PHANO/145-228---------------------------------------------NRLALLGDRV---LS--L----------AL.....
A7I5W5_METB6/51-140---------------------------------------------DAYSTLGDAV---LK--T----------SL.....
A3CVM2_METMJ/43-132---------------------------------------------DALRTLGDAV---LK--T----------IL.....
A7I515_METB6/44-134---------------------------------------------DPLATVGDAV---LG--A----------VV.....
A3CRH2_METMJ/50-139---------------------------------------------DALATLGDAV---IN--V----------AV.....
A5DES0_PICGU/186-275---------------------------------------------EKLVLHGRSL---LN--V----------AL.....
A3LPK0_PICST/184-273---------------------------------------------EKLSILGRSL---LE--L----------LL.....
Q6BWD6_DEBHA/187-276---------------------------------------------AKLGLRGKRL---LE--F----------AL.....
A4RR17_OSTLU/28-138---------------------------------------------LAFTYLGDAV---WE--L----------YA.....
C1MLN8_MICPC/114-224---------------------------------------------LAYTYLGDAV---WE--L----------YA.....
C1FDU3_MICSR/76-186---------------------------------------------LAYTYLGDAV---WE--L----------YA.....
A9BJB7_PETMO/21-118---------------------------------------------ENFSYIGDAV---IG--L----------IY.....
D4CVS6_9FUSO/18-116---------------------------------------------LELAFIGDAI---WE--L----------EI.....
C3WFU5_FUSMR/12-110---------------------------------------------VVLAYLGDSI---WE--L----------NI.....
B9K831_THENN/17-112---------------------------------------------AVLAYVGDAV---LE--L----------VF.....
A5ILI0_THEP1/17-112---------------------------------------------AVLAYLGDAV---LE--L----------IF.....
A6LJ32_THEM4/19-114---------------------------------------------DSLAYIGDAV---FN--L----------YV.....
A8F7A2_THELT/9-104---------------------------------------------STMAYIGDAI---YS--L----------YC.....
A8J7A5_CHLRE/55-159---------------------------------------------LALAYLGDAV---WE--V----------SMAAQAV
B1C8Q3_9FIRM/18-117---------------------------------------------KELAYLGDSV---YE--V----------NI.....
C1DXY5_MICSR/99-208---------------------------------------------VSFAFLGDAV---WE--L----------YV.....
Q014M6_OSTTA/451-557---------------------------------------------IALAFLGDAV---FE--L----------YA.....
MRNC_KOSOT/20-117---------------------------------------------DSLSFVGDAV---YS--L----------YF.....
B7CDG4_9FIRM/9-110---------------------------------------------TSLAWIGDAV---MS--L----------AV.....
B7G3M0_PHATC/16-116---------------------------------------------TDLAYIGDVV---YE--L----------FV.....
A9RYU0_PHYPA/18-120---------------------------------------------ASLAYLGDSI---YE--V----------YV.....
Q94F12_ARATH/98-200---------------------------------------------ASLAFIGDSI---YE--L----------YA.....
C6T3M8_SOYBN/105-207---------------------------------------------ATLAYIGDCI---YE--L----------YA.....
C0PKE8_MAIZE/108-210---------------------------------------------VSLAYLGDCI---YE--L----------YA.....
Q2JI20_SYNJB/24-121---------------------------------------------AALAYLGDAI---YE--L----------HV.....
B4WGA4_9SYNE/42-139---------------------------------------------ISLAYIGDAV---FE--L----------YV.....
Q31LB9_SYNE7/26-123---------------------------------------------QALAYLGDAL---YE--F----------HV.....
MRNC_THEEB/23-120---------------------------------------------AALAYFGDAV---YE--L----------FI.....
F7UR33_SYNYG/28-125---------------------------------------------VALAYLGDAV---FE--L----------YV.....
B1XNV1_SYNP2/17-114---------------------------------------------ASLAYVGDAV---YE--L----------YS.....
B8HT79_CYAP4/37-134---------------------------------------------AALAYLGDAV---YE--L----------YI.....
B4VUK6_9CYAN/43-140---------------------------------------------AALAYLGDAV---YE--L----------YI.....
A8YKZ5_MICAE/29-126---------------------------------------------ASLAYLGDAV---YE--L----------YI.....
B7KCP4_CYAP7/45-142---------------------------------------------ASLAYIGDAV---YE--L----------YV.....
D3EMY0_ATETH/29-126---------------------------------------------AFLAYIGDAV---YE--L----------YV.....
B7K2P3_CYAP8/45-142---------------------------------------------AFLAYLGDAV---YE--L----------YI.....
A0ZGL0_NODSP/61-158---------------------------------------------LALAYIGDAI---YE--L----------YV.....
Q112N8_TRIEI/20-117---------------------------------------------SAWAYLGDAV---YE--L----------YI.....
A0YQT6_LYNSP/17-114---------------------------------------------ASWAYLGDAV---YE--L----------YI.....
A8G4M5_PROM2/20-117---------------------------------------------IQLAWLGDSV---WE--L----------HQ.....
A9B9W4_PROM4/20-117---------------------------------------------LQLAWLGDAV---WE--M----------HQ.....
Q7VCJ3_PROMA/20-117---------------------------------------------LQLAWLGDAI---WE--M----------HQ.....
A5GTM3_SYNR3/12-109---------------------------------------------AQLAWLGDAV---WE--L----------HQ.....
A2C1X8_PROM1/20-117---------------------------------------------LQLAWLGDAV---WE--M----------HQ.....
B1X410_PAUCH/23-120---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
B5IKV4_9CHRO/2-99---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
Q067M9_9SYNE/20-119---------------------------------------------LQLAWIGDAV---WE--L----------HQ.....
Q7U7F7_SYNPX/20-117---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
A3YYC2_9SYNE/20-117---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
Q0I9N3_SYNS3/20-117---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
A4CU57_SYNPV/21-118---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
A3Z7F5_9SYNE/21-118---------------------------------------------LQLAWLGDAV---WE--L----------HQ.....
A6GE80_9DELT/16-118---------------------------------------------KTLAWLGDAE---FE--R----------EV.....
A0A008AQZ0_STAAU/15-116---------------------------------------------LTLAYMGDAV---LD--Q----------YV.....
C8WTZ3_ALIAD/13-112---------------------------------------------LALAFLGDAV---WE--I----------YA.....
C1KYH3_LISMC/13-114---------------------------------------------LALAYMGDAV---YE--K----------FI.....
Q8ETZ8_OCEIH/12-114---------------------------------------------LALAYIGDSI---FE--L----------YI.....
J3ENE3_9LACO/31-132---------------------------------------------LTLAYLGDGV---YE--V----------YI.....
C9ASB2_ENTFC/15-116---------------------------------------------LALAYVGDAI---YE--I----------YV.....
D1BMT8_VEIPT/47-145---------------------------------------------VMLAYIGDAV---YS--M----------YV.....
D3LUV6_9FIRM/36-134---------------------------------------------ITLAFVGDAY---YA--L----------FL.....
D1VT13_9FIRM/26-124---------------------------------------------LALAYVGDAV---FE--L----------LV.....
A4XJ79_CALS8/5-105---------------------------------------------LVYAYIGDAV---YE--L----------YV.....
A6P055_9FIRM/19-118---------------------------------------------LGLAHLGDGV---FE--L----------MV.....
C9LMK9_9FIRM/35-133---------------------------------------------LTLAYIGDVC---WS--F----------FV.....
B0MM93_9FIRM/17-116---------------------------------------------LTLAFFGDSV---YE--V----------YV.....
D4LDD2_RUMC1/15-114---------------------------------------------LALAFLGDSV---YE--C----------MM.....
E6U8V4_ETHHY/21-120---------------------------------------------LALAFIGDAV---YE--L----------LA.....
B0TC36_HELMI/34-133---------------------------------------------LALAYLGDAV---YE--L----------WV.....
MRNC_SYMTH/12-111---------------------------------------------LTLAYLGDAL---YE--A----------FV.....
Q0AUF9_SYNWW/16-114---------------------------------------------VLLAYVGDAV---FE--L----------AV.....
A5D5M2_PELTS/19-118---------------------------------------------LVLAYVGDAV---YE--L----------AV.....
MRNC_MOOTA/10-109---------------------------------------------LALAYVGDAV---YE--L----------LV.....
D4KFD3_9FIRM/37-135---------------------------------------------LVLAYVGDAY---YH--L----------YI.....
C9LVQ2_SELS3/37-135---------------------------------------------LVLAYIGDAY---FH--L----------FV.....
C4V0H2_9FIRM/37-135---------------------------------------------LVLAYIGDAY---FH--L----------YV.....
A5KKA6_9FIRM/30-129---------------------------------------------IVLAYIGDCV---FD--L----------II.....
C5ENC6_9FIRM/5-104---------------------------------------------LVLAYIGDAV---YE--L----------MI.....
B1RJ47_CLOPF/20-120---------------------------------------------LQLALIGDGV---YE--V----------FI.....
A3DH39_CLOTH/26-125---------------------------------------------LVLAYIGDAV---YE--V----------FI.....
A6TWK4_ALKMQ/25-124---------------------------------------------LVLAYIGDAI---FE--V----------YV.....
A8MLB8_ALKOO/26-125---------------------------------------------LVLAYIGDAL---YE--V----------FI.....
C0WE29_9FIRM/32-129---------------------------------------------IELAYIGDAV---FS--L----------YV.....
C0GIM8_9FIRM/8-106---------------------------------------------LMLAYVGDAV---FE--L----------FV.....
A2QMS9_ASPNC/124-236---------------------------------------------DRLAFLGKRI---VQ--L----------QA.....
Q0TYG8_PHANO/64-174---------------------------------------------DRLAYLGRRI---VE--L----------QT.....
RM44_PONAB/123-207---------------------------------------------QELSEQGTSF---SQ--T----------CL.....
Q6BCK1_TETTH/1224-1338---------------------------------------------DVLSFLGSII---FS--Q----------IV.....
A3CW87_METMJ/121-210---------------------------------------------GALAWIGDAA---LK--I----------GL.....
I7MKB8_TETTS/752-862---------------------------------------------ELLEVIGDVV---IK--Y----------IS.....
A3LUF0_PICST/251-366---------------------------------------------SFLDGLGDLF---LA--H----------ES.....
Q5GAH0_9VIRU/44-137---------------------------------------------EALEIVGDGL---AG--C----------FF.....
Q4KS72_ISKNV/58-156---------------------------------------------EWYEKLGDAI---IA--S----------VM.....
A2F201_TRIVA/593-691---------------------------------------------ERIEFIGDLI---VK--Y----------SL.....
B0Y3J2_ASPFC/35-122---------------------------------------------PRLAFLGDKV---VG--L----------IL.....
E7NKX5_YEASO/105-208---------------------------------------------EKLNLLGAQF---LK--L----------QT.....
Q6FVA4_CANGA/96-187---------------------------------------------EKLNLLGSQY---LK--L----------QA.....
Q6T445_LEIMA/391-483---------------------------------------------ERLEYIGDNC---WG--N----------NI.....
Q9DSW1_9VIRU/45-139---------------------------------------------EFFEQLGDLT---IN--K----------FI.....
DCL22_ASPNC/1111-1258---------------------------------------------RRLSFLGASV---LE--W----------IV.....
Q2U0L3_ASPOR/1051-1198---------------------------------------------RRLSFLGAGI---IE--L----------VV.....
Q0E579_SFAVA/192-324---------------------------------------------EYFEYIGDSV---IN--R----------FI.....
A0DYG6_PARTE/384-498---------------------------------------------ELLETLGDSI---LK--Y----------LA.....
Q3SE73_PARTE/363-464---------------------------------------------QNLEMLGDVV---IK--Y----------LT.....
Q57XF2_TRYB2/735-814---------------------------------------------EILEFIGDAI---MD--F----------IV.....
A7SJH8_NEMVE/129-224---------------------------------------------SKLALLGHNL---TS--Q----------YI.....
Q2Q3V3_DROSI/1205-1377---------------------------------------------ERLEILGDSF---LK--L----------CA.....
Q6BCJ9_TETTH/1328-1487---------------------------------------------ERYEFLGDTV---LK--C----------LS.....
DCL_GIAIC/333-418---------------------------------------------QRLELLGDAV---LG--F----------IV.....
Q7Q073_ANOGA/1215-1375---------------------------------------------ERFEVLGDAF---LK--F----------AV.....
Q3SE71_PARTE/360-463---------------------------------------------ENLELLGDSV---LK--Y----------VV.....
DCL_GIAIC/646-734---------------------------------------------QKLELLGDAF---LK--C----------SL.....
DCL2_PHANO/1130-1270---------------------------------------------ERLEFLGDAV---LD--Y----------II.....
A7EYF3_SCLS1/1216-1363---------------------------------------------ERLEFLGDAI---LD--N----------II.....
DCL2_EMENI/1092-1250---------------------------------------------QRLEFLGDAV---LD--M----------LI.....
DCL2_NEOFI/1134-1281---------------------------------------------QRLEYLGDAV---LD--M----------VI.....
A1CZL8_NEOFI/163-252---------------------------------------------DRLEILGDAY---IE--L----------IA.....
Q0UFS5_PHANO/190-279---------------------------------------------ERLEYLGDAY---IE--L----------IA.....
Q110R1_TRIEI/53-143---------------------------------------------QGLANLGYVV---FS--R----------VI.....
Q55FS1_DICDI/1250-1335---------------------------------------------QRLEYVGDAV---LD--F----------FV.....
A2XBW0_ORYSI/1353-1498---------------------------------------------ERAELLGDAY---LK--W----------VV.....
Q80UU5_MOUSE/475-564---------------------------------------------QRMEFLGDSI---MQ--L----------VA.....
RNC_CAEEL/870-957---------------------------------------------QRLEWLGDSV---LQ--L----------IV.....
DCL2_NEUCR/998-1107---------------------------------------------ERLEFIGDTI---LK--F----------CA....C
DCL2_PHANO/947-1054---------------------------------------------QRLEFLGDCI---LK--F----------IA.....
DCL2_ASPCL/955-1060---------------------------------------------QRYEFLGDSI---LK--F----------SV.....
A6R2T0_AJECN/946-1054---------------------------------------------QRIEFLGDSI---LK--F----------QT.....
Q3SE73_PARTE/554-687---------------------------------------------ERLEFFGDAI---LE--L----------LV.....
I7MKB8_TETTS/1048-1163---------------------------------------------QILEFLGDAL---IE--I----------LV.....
Q3SE70_PARTE/522-610---------------------------------------------DRLEFLGDAA---IE--L----------LV.....
A5Z824_9FIRM/49-157---------------------------------------------EVLEFIGDKA---LD--L----------SV.....
Q5KKA7_CRYNJ/521-644---------------------------------------------ERLEILGDTL---LK--F----------MT.....
RTL3_ARATH/445-551---------------------------------------------QGLMFVGESA---LS--L----------AF.....
RTL3_ORYSJ/76-183---------------------------------------------ERLEYLGDAV---LT--C----------VV.....
RTL2_ARATH/93-203---------------------------------------------ERLEFIGDSA---IG--L----------AI.....
RTL1_ORYSJ/62-168---------------------------------------------QRLEFLGDAA---LG--L----------AF.....
Q2Q3U9_DROSI/1464-1620---------------------------------------------QELEFIGDAI---LD--F----------LI.....
A7SIA4_NEMVE/44-167---------------------------------------------EQLEFLGDAL---LD--Y----------LV.....
A7SKX2_NEMVE/37-156---------------------------------------------QRLEFLGDAL---LD--F----------LV.....
Q4SZJ7_TETNG/259-381---------------------------------------------QRLEFLGDAI---LD--Y----------LI.....
A7IYQ4_PHYPA/1379-1492---------------------------------------------QRLEFVGDAV---LD--H----------LI.....
DCL4_ARATH/1327-1436---------------------------------------------QRLEFLGDAV---LD--Y----------LM.....
DCL4_ORYSJ/1249-1358---------------------------------------------QRLEFLGDAV---LE--Y----------VI.....
DCR1_SCHPO/930-1038---------------------------------------------DRLEFYGDCF---LK--L----------GA.....
DCL1_ASPNC/1080-1192---------------------------------------------ERLEFLGDCF---LK--M----------AT.....
Q4PCH5_USTMA/903-1023---------------------------------------------ERLEQLGDSI---VN--M----------SS.....
A3Z4A6_9SYNE/40-129---------------------------------------------EQLEFLGDAV---LR--L----------AA.....
Q4C1B8_CROWT/48-137---------------------------------------------QQLEFVGDSV---VR--L----------VS.....
Q31MP4_SYNE7/55-144---------------------------------------------DRLEFLGDAV---LR--L----------AI.....
DCL2A_ORYSJ/1006-1124---------------------------------------------ESLETLGDSF---LK--Y----------VT.....
DICER_DANRE/1295-1551---------------------------------------------ERLEMLGDSF---LK--H----------AI.....
DCR1_CAEEL/1413-1589---------------------------------------------ERFETIGDSF---LK--F----------AT.....
Q27IU0_DROSI/1685-1862---------------------------------------------ERLETIGDSF---LK--Y----------AI.....
Q3SD86_PARTE/1582-1697---------------------------------------------ERLEFLGDSV---LD--S----------VV.....
A2F201_TRIVA/412-500---------------------------------------------ERLEYLGDTV---LD--L----------LF.....
Q3SD86_PARTE/1325-1459---------------------------------------------QVLEFLGDAN---LK--L----------LS.....
DCR1_SCHPO/1120-1233---------------------------------------------QQLEFLGDAV---LD--Y----------II.....
E3W000_MIMIV/351-441---------------------------------------------ERLQFLGDAV---IH--F----------II.....
DCL1_ASPFU/1291-1405---------------------------------------------QRLEFLGDSL---LD--M----------VC.....
Q0E5R5_MUCCI/1080-1190---------------------------------------------QRLEFLGDSV---LK--F----------IT.....
RNC_MYCMO/47-135---------------------------------------------DILEFIGDAI---LQ--M----------KS.....
Q6CC90_YARLI/191-332---------------------------------------------ERLEFVGDSI---VN--N----------IL.....
A2RV16_DANRE/886-976---------------------------------------------ERLEFLGDAV---VE--F----------LT.....
Q95ZG5_DICDI/926-1010---------------------------------------------QRLEFLGDSV---LK--I----------TS.....
Q6FQ28_CANGA/457-550---------------------------------------------ERLEFLGDSV---IN--S----------IM.....
Q64AH3_9ARCH/53-141---------------------------------------------QTLEFLGDRV---LS--L----------IL.....
RNC_MYCGH/469-556---------------------------------------------QRLEFLGDAI---IN--K----------IV.....
A0A024FAP5_UREPR/43-140---------------------------------------------QRLEFLGDAC---VE--W----------VI.....
Q8EW40_MYCPE/52-139---------------------------------------------QRLEFLGDAV---IS--K----------LI.....
Q1UZA6_PELUQ/38-127---------------------------------------------EKIEFLGDRV---LG--L----------II.....
RNC_AQUAE/37-121---------------------------------------------ETLEFLGDAL---VN--F----------FI.....
E3W000_MIMIV/65-149---------------------------------------------ERLEYLGDAI---FH--M----------II.....
A4VD87_TETTS/1750-1863---------------------------------------------QRLEFLGDAV---LD--L----------II.....
A3CSF0_METMJ/81-165---------------------------------------------ERLEFLGNYV---LD--F----------VI.....
Q4A7X2_MYCH7/44-131---------------------------------------------EMLEFLGDSV---IN--Y----------AV.....
A5IYM8_MYCAP/40-130---------------------------------------------QTLEFLGDAI---LQ--F----------YV.....
A4GK15_9BACT/37-125---------------------------------------------EVFEFLGDSV---LN--L----------II.....
A5CEW8_ORITB/60-150---------------------------------------------QRLEFLGDVI---LN--L----------VI.....
RNC_WOLTR/54-144---------------------------------------------ERLEFLGDSI---LN--M----------IV.....
RNC_MYCCT/40-130---------------------------------------------QRLEFLGDAI---LQ--M----------YV.....
RNC_MYCPB/56-141---------------------------------------------DRLEFLGDAL---ID--F----------IV.....
A4GHU1_9BACT/34-120---------------------------------------------ERLEFLGDAI---LN--L----------YV.....
RNC_BRADU/60-150---------------------------------------------QRLEFLGDHV---LG--L----------VV.....
A6DUU1_9RHOB/42-132---------------------------------------------QRLEFLGDRV---LG--L----------VM.....
A5FV46_ACICJ/38-128---------------------------------------------ERLEFIGDRV---LG--L----------LI.....
A5V2R4_SPHWW/51-141---------------------------------------------ERLEFLGDRV---LG--L----------VA.....
RNC_RHIEC/47-137---------------------------------------------ERLEFLGDRV---LG--L----------CI.....
RNC_SPHAL/39-129---------------------------------------------QRLEFLGDRV---LG--L----------VL.....
Q0F3I4_9PROT/44-134---------------------------------------------ERLEFLGDAV---LG--L----------VV.....
M1GI47_LAWIN/41-131---------------------------------------------ERLEFLGDAV---LE--I----------CI.....
A6GP51_9BURK/26-116---------------------------------------------ERLEFLGDSV---LN--C----------AA.....
RNC_MYXXD/55-145---------------------------------------------QRLEFLGDSV---VN--L----------AV.....
A1R7I4_ARTAT/40-130---------------------------------------------ERLEFLGDSI---LG--F----------SV.....
A7A3Q3_BIFAD/75-166---------------------------------------------ERLEFLGDAV---LE--L----------VS.....
Q1IJU6_KORVE/51-141---------------------------------------------EQLEFIGDSV---LA--F----------VT.....
D2BI67_DEHMV/54-144---------------------------------------------ERMEFLGDAV---LG--V----------IF.....
A9B5J8_HERA2/42-132---------------------------------------------ERLEFLGDAL---LN--F----------IC.....
A4MZ45_HAEIF/36-126---------------------------------------------ERLEFLGDSI---LN--F----------TI.....
RNC_MYCS5/49-139---------------------------------------------ERLEFLGDSL---VG--F----------LI.....
A5UJK3_METS3/37-127---------------------------------------------ERLEFLGDSV---LN--M----------IV.....
Q83VA6_9MOLU/41-129---------------------------------------------ERLEFLGDSV---IN--F----------FM.....
RNC_RHOBA/69-158---------------------------------------------ERLEFLGDSV---LG--L----------TV.....
A3LS79_PICST/241-330---------------------------------------------ERLEFLGDSV---LN--N----------LV.....
A4E6T0_9ACTN/44-134---------------------------------------------ERLEFLGDSI---LG--A----------VV.....
A7K823_9PHYC/78-168---------------------------------------------ERLEFLGDSV---LG--F----------LI.....
A0A015Q692_BACFG/59-145---------------------------------------------ERLEFLGDAI---LD--A----------IV.....
RNC_CHLPN/45-135---------------------------------------------ERLEFLGDAV---LG--L----------IV.....
A4BWV8_9FLAO/58-144---------------------------------------------ERLEFLGDSI---LG--A----------VI.....
A3EQH6_9BACT/58-148---------------------------------------------ERLEFLGDRV---IG--L----------IV.....
K6KAV8_LEPBO/59-149---------------------------------------------ERLEFLGDSV---LG--L----------VA.....
A6LNE7_THEM4/42-132---------------------------------------------ERLEFLGDSV---ID--I----------LV.....
A9BIG2_PETMO/59-148---------------------------------------------ERLEFLGDAV---LE--L----------VI.....
Q1CTK8_HELPH/52-142---------------------------------------------ERLEFLGDAV---LG--L----------VI.....
RNC_BDEBA/44-134---------------------------------------------EKLEFLGDAV---LD--L----------VV.....
A0YTK7_LYNSP/34-125---------------------------------------------ERLEFLGDAV---LG--F----------LV.....
F7UR75_SYNYG/35-125---------------------------------------------DRLEFLGDAV---LG--F----------VV.....
Q152U6_SCHPM/172-262---------------------------------------------ERLEFLGDSF---FN--L----------FT.....
Q14LC1_SPICI/52-142---------------------------------------------QRMEFLGDAI---LA--K----------EI.....
F8XZF3_STRAG/44-134---------------------------------------------ERLEFLGDAV---LQ--L----------LI.....
B3EKH3_CHLPB/78-168---------------------------------------------QRLEFLGDAV---LD--L----------II.....

PF11469

Q8U363_PYRFU/5-122---------------------------------------------KGLAKFGDSL---IN--F----------LY-----
H3ZKU7_THELN/10-127---------------------------------------------KNLSKFGDSL---VN--F----------IF-----
Q5JE89_THEKO/13-131---------------------------------------------KGLAKLGDSL---IN--L----------VF-----
A1RX42_THEPD/16-123---------------------------------------------KELARLGDSL---VN--F----------LV-----

PF14622

RM15_SCHPO/67-197--LN.H.Y.L-------------.ES............G.NF..S..T---------.I.P.........S--------Y
Q7S1R6_NEUCR/117-265--LN.E.P.I-------------.VDKYGRTPYNHAALA.NI..D..K---------.L.I.........Y--------T
Q2GMI6_CHAGB/267-400--GR.E.P.F-------------.QD............P.AL..ANVD---------.K.L.........N--------V
A8Q4V0_MALGO/115-263--FF.F.DIL-------------.EH............A.RRTNS..S---------.V.S.........D--------V
Q4P7G0_USTMA/113-257--LH.A.R.L-------------.QS............T.TK..G..D---------.A.AHNYISRLLES--------P
A5E1N1_LODEL/106-245--AK.Y.V.I-------------.HQ............Q.STTPD..K---------.IKI.........E--------G
D5X4R4_THIK1/15-139--AA.W.L.Y-------------.HQ............A.AR..Q..D---------.E.G.........Q--------L
C4Z0E7_EUBE2/19-151--SD.Y.I.Y-------------.KN...........HA.EM..A..E---------.G.K.........M--------T
RNC_BORA1/16-141--AA.M.L.F-------------.ER............Y.AK..L..D---------EG.D.........L--------S
RNC_MESFL/16-146--SK.FLY.L-------------.NF............T.NA..P..E---------.G.K.........L--------T
RNC_LEIXX/20-149--VK.L.F.R-------------.EN............P.GL..D..E---------.G.E.........L--------A
RNC_THELT/22-156--AE.YLY.L-------------.EF............P.EA..S..E---------.G.V.........M--------A
C8W586_DESAS/21-152--SG.Y.L.Y-------------.SS............Y.PE.CA..E---------.G.E.........L--------T
E4RLQ9_HALHG/23-154--ST.Y.I.F-------------.NK...........FS.DF..P..E---------.G.E.........L--------A
D4LHQ1_9FIRM/18-150--SD.F.L.Y-------------.KK...........FR.NN..Q..E---------.G.E.........L--------T
A4G6R8_HERAR/16-141--AS.L.L.F-------------.DR............Y.SK..I..D---------.E.G.........D--------L
A1SLU8_NOCSJ/48-177--TETL.Y.L-------------.KH............P.DL..S..E---------.G.R.........L--------A
Q2LVR4_SYNAS/22-153--SD.L.L.M-------------.KA...........FP.DY..S..E---------.G.Q.........L--------S
E8NDE2_MICTS/20-149--VR.L.F.T-------------.RH............P.DL..D..E---------.G.Q.........L--------A
E4TJ04_CALNY/16-145--SE.Y.L.I-------------FKY............K.DF..D..E---------.G.M.........L--------S
D4J805_9FIRM/20-152--SD.F.L.F-------------.KN...........FP.DM..A..E---------.G.Q.........M--------S
E8UCB0_TAYEM/16-140--AS.L.L.F-------------.KK...........LK.DQ..A..E---------.G.D.........L--------T
E3DQV9_HALPG/23-155--ST.Y.I.F-------------.NK...........FS.DF..P..E---------.G.D.........L--------A
A5WCD8_PSYWF/39-165--GEAL.Y.Y-------------.QY............P.KQ..D..E---------.G.R.........L--------T
D9R047_CLOSW/18-150--SDCL.Y.H-------------.KY............P.EK..P..E---------.G.D.........L--------T
RNC_PELTS/21-152--SD.Y.L.Y-------------.RS............K.PE..M..D---------.E.G.........D--------L
A9KLR1_CLOPH/23-155--SE.W.L.F-------------.EK............H.PK..M..P---------.E.G.........D--------L
D0MGH0_RHOM4/39-171--AA.Y.L.Y-------------.EH............FPDR..N..E---------.G.F.........L--------T
D3PAP4_DEFDS/17-146--TE.Y.LVI-------------.KY............K.EF..K..E---------.G.V.........L--------S
F0S2Z0_DESTD/19-149--SE.E.L.I-------------.KR............F.PT..K..T---------.E.G.........E--------L
A5I4N2_CLOBH/24-150--SE.H.L.Y-------------.QK............Y.ED.KK..E---------.G.E.........L--------T
RNC_BACV8/34-159--AD.I.V.Y-------------.KR............F.EG.KR..E---------.G.F.........L--------T
B6JY03_SCHJY/68-197--IN.F.S.L-------------.QQ............T.NQ..L..K---------.G.V.........S--------E
C4R5N4_PICPG/63-200--SV.H.V.I-------------.SKPSDSP..YALNGK.NF..D..C---------.L.G.........S--------L
E6UF22_RUMA7/20-145--SD.H.I.F-------------.EH............F.KH.LP..E---------.G.E.........L--------T
K7X354_MYCHR/18-142--SL.Y.I.F-------------.KN............I.DA.KN..E---------.G.N.........A--------T
Q13VM8_BURXL/16-137--AA.L.L.F-------------.QR............FGKL..D..E---------.G.D.........L--------S
RNC_RALME/17-139--AD.M.L.F-------------.GM............FGKL..D..E---------.G.D.........L--------S
Q59PD0_CANAL/73-209--AK.Y.V.T-------------.NQ...........PC.KH..D..N---------.G.V.........E--------G
RNC_PSESM/18-137--GE.A.L.F-------------.ER............F.PQ.AR..E---------.G.Q.........L--------S
R5BXA0_9FIRM/20-152--SE.F.L.Y-------------.QK............F.PI.LQ..E---------.G.E.........L--------T
R5HQM8_9FIRM/18-148--SD.F.L.Y-------------.KA...........YP.DK..S..E---------.G.D.........L--------T
R5TZE4_9FIRM/19-150--SE.F.LFL-------------.ES............P.KV..S..E---------.G.K.........L--------T
R5X6S0_9CLOT/24-150--SD.Y.L.F-------------.KK...........ET.KL..P..E---------.G.E.........L--------T
R6GD49_9FIRM/20-151--SD.Y.V.F-------------.RE...........YP.GY..N..E---------.G.R.........L--------T
R6JSS6_9CLOT/18-150--SE.F.L.Y-------------.RK............Y.ET.LP..E---------.G.D.........L--------T
R6LRB3_9FIRM/18-150--SE.Y.LFF-------------.EN............Q.TM..P..E---------.G.E.........L--------T
R6PBG7_9FIRM/22-152--SE.F.LFY-------------.QY............A.DL..P..E---------.G.K.........L--------T
R6QQD7_9FIRM/19-150--SD.Y.L.F-------------.HT............Y.KD.EP..E---------.G.K.........L--------T
R7AJR0_9BACE/21-152--SE.Y.L.F-------------.NE............H.KD.VN..E---------.G.S.........L--------S
R7DB60_9FIRM/14-146--SD.F.L.Y-------------.AK............F.TQ.VP..E---------.G.E.........L--------T

PF00636

A3GHW8_PICST/84-184..AK-F---V.............VE.........K...P-...SQ..N.........EL-A---------I........N
RM15_SCHPO/89-181..LN-H---Y.............LE..............-.................SG-N---------F........S
RM03_SCHPO/83-189..LE-Y---I............KCK.........Y...P-...RL..P.........EE-A---------V........H
A2QRC1_ASPNC/121-242..SE-Y---L.............ICT........Y...P-...RL..P.........LT-V---------I........F
Q0UQH0_PHANO/7-117..KE-W---G.............IE.........AAHEP-...GGEVD.........PG-Y---------LQFKRIQSGD
Q1XG54_CRYJA/71-157..SL-H---Y.............VL.........N...N-...SA..I.G.......SG-D---------L........H
Q9FYL8_ARATH/80-167..SL-Q---F.............LA.........K...D-...ID..I.S.......SK-A---------L........G
A0A023ZEP0_YEASX/153-272..TK-S---I.............IQK........Y...P-...RL..P.........TV-V---------L........N
Q4PA03_USTMA/211-325..TE-H---L.............HLR........Y...P-....N..L.P.......TR-V---------L........K
Q0CCZ5_ASPTN/48-132..VD-Y---G............................R-...ERQTT.........PG-R---------I........P
Q0UMM3_PHANO/145-228..CE-I---W.............FQ.......TDH...P-.................NG-G---------Y........A
A7I5W5_METB6/51-140..IL-F---L.............ME.........K...G-...LQ..E.........KG-A---------I........T
A3CVM2_METMJ/43-132..CD-L---L.............MR.........S...G-...YE..T.........KG-E---------I........T
A7I515_METB6/44-134..AT-R---L.............YE.........S...G-...IR..D.........KG-T---------L........T
A3CRH2_METMJ/50-139..VE-A---V.............VA.........G...G-...AH..D.........KG-A---------I........S
A5DES0_PICGU/186-275...L-H---L.............LD.......KKF...P-...KA..Q.........AE-D---------I........E
A3LPK0_PICST/184-273..YQ-I---L.....................DERF...P-...NM..Y.........GE-E---------M........F
Q6BWD6_DEBHA/187-276..IE-I---L.....................DEKL...P-...DI..H.........ED-D---------L........Y
A4RR17_OSTLU/28-138..RQ-H---M.............ILKRVTSSESAS...T-...SG..R.....A...IR-P---------Q........D
C1MLN8_MICPC/114-224..RQ-H---M.............ILRSAEKAGRTS...P-...CG..T.....V...IR-P---------Q........E
C1FDU3_MICSR/76-186..RR-H---M.............ILQRATVASLPY...S-...TN..V.....V...LR-P---------Q........E
A9BJB7_PETMO/21-118..KV-K---L.............LK.........D...G-...RI..K.........TR-D---------L........Y
D4CVS6_9FUSO/18-116..RK-Y---Y.............LQ.........F....-...GY..N.........IP-T---------L........N
C3WFU5_FUSMR/12-110..RK-Y---W.............IS.............K-...GL..N.........LR-N---------L........N
B9K831_THENN/17-112..RL-K---F........................A...G-...NY..K.........IS-T---------I........H
A5ILI0_THEP1/17-112..RS-R---F........................T...G-...DY..R.........MS-V---------I........H
A6LJ32_THEM4/19-114..KL-Y---Y.............FK..............-...KT..S.........VR-K---------L........H
A8F7A2_THELT/9-104..KV-K---S.............LK..............-...LM..K.........VK-A---------I........H
A8J7A5_CHLRE/55-159GERD-F---S.............ASM............P-...IT..V.....S...PA-G---------A........A
B1C8Q3_9FIRM/18-117..RK-T---L.............IR.........L...G-...IR..G.........VK-D---------L........N
C1DXY5_MICSR/99-208..RR-A---F.............FA.............P-...PC..K.........PV-D---------Y........D
Q014M6_OSTTA/451-557..RG-V---L.............F..........Y...P-...PA..K.........PL-D---------Y........D
MRNC_KOSOT/20-117..RI-K---T.............LR.........S...A-...KR..R.........TG-Y---------Q........H
B7CDG4_9FIRM/9-110..RE-H---L.............LS.........L...G-...FR..K.........AH-V---------L........Q
B7G3M0_PHATC/16-116..RS-R---S.............V..........W...P-...PK..R.........TS-D---------L........Q
A9RYU0_PHYPA/18-120..RR-H---F.............LT.............P-...PQ..K.........VD-V---------Y........N
Q94F12_ARATH/98-200..RR-H---F.............L..........F...P-...PL..S.........IE-D---------Y........N
C6T3M8_SOYBN/105-207..RR-H---F.............L..........F...P-...PL..S.........IE-E---------Y........N
C0PKE8_MAIZE/108-210..RR-H---F.............FF.............P-...PL..S.........IN-E---------Y........N
Q2JI20_SYNJB/24-121.RRQ-R---L........................F...P-...PD..R.........LE-R---------Y........H
B4WGA4_9SYNE/42-139..RS-R---L.............LI.............P-...AQ..R.........IR-D---------Y........H
Q31LB9_SYNE7/26-123..RL-R---L.............LL.............P-...AQ..R.........SH-Q---------F........H
MRNC_THEEB/23-120..RL-L---F.............LT.............P-...PQ..R.........IN-A---------Y........H
F7UR33_SYNYG/28-125.RCC-Y---L........................F...P-...PR..R.........IG-D---------F........H
B1XNV1_SYNP2/17-114..RC-Y---F.............LL.............P-...PC..R.........IA-D---------Y........H
B8HT79_CYAP4/37-134..RS-R---C.............LL.............P-...PQ..R.........LR-D---------Y........H
B4VUK6_9CYAN/43-140..RR-H---Y.............LL.............P-...PK..R.........LC-D---------Y........H
A8YKZ5_MICAE/29-126..RT-Y---Y.............LL.............P-...PQ..R.........LG-D---------Y........H
B7KCP4_CYAP7/45-142.RSV-Y---L........................L...P-...PR..R.........LS-D---------Y........H
D3EMY0_ATETH/29-126.RTA-Y---L........................L...P-...PR..K.........LA-D---------Y........H
B7K2P3_CYAP8/45-142..RT-Y---Y.............LL.............P-...PR..R.........LV-D---------Y........H
A0ZGL0_NODSP/61-158..RM-F---Y.............LL.............P-...IQ..Q.........TK-T---------Y........H
Q112N8_TRIEI/20-117..RN-Y---Y.............LI.............P-...PK..R.........SG-Y---------Y........H
A0YQT6_LYNSP/17-114..RH-F---Y.............LI.............P-...PK..R.........SQ-L---------Y........H
A8G4M5_PROM2/20-117..RL-R---H.............VH.........Y...P-....L..K.........SK-E---------L........H
A9B9W4_PROM4/20-117..RL-L---L.............CR.........K...P-....A..K.........SK-E---------L........H
Q7VCJ3_PROMA/20-117..RL-R---L.............CE.........K...P-....A..K.........SK-D---------L........H
A5GTM3_SYNR3/12-109..RR-G---L.............VA.........H....-...EG..T.........IQ-E---------L........H
A2C1X8_PROM1/20-117..RL-R---Y.............CS.........S...P-....M..R.........SK-D---------L........H
B1X410_PAUCH/23-120..RL-Q---L.............CQ.........T...P-...CC............SK-D---------L........H
B5IKV4_9CHRO/2-99..RL-N---R.............CR.........E...A-....A..R.........AL-D---------L........H
Q067M9_9SYNE/20-119..RL-R---L............................G-...ARPGR.........SD-A---------L........H
Q7U7F7_SYNPX/20-117..RL-R---F.............CR.........S...P-....G..R.........AD-V---------L........H
A3YYC2_9SYNE/20-117..RL-R---H.............CH.............Q-...AG..R.........PD-E---------L........H
Q0I9N3_SYNS3/20-117..RL-R---F.............CK.........T...P-...GR............SQ-D---------L........H
A4CU57_SYNPV/21-118..RL-R---H.............CR.........R...P-....G..R.........AS-D---------L........H
A3Z7F5_9SYNE/21-118..RL-R---H.............CR.........R...P-...GR............SD-D---------L........H
A6GE80_9DELT/16-118..RL-R---L.............AR.........R...G-...DY..S.........VD-R---------L........D
A0A008AQZ0_STAAU/15-116..RT-Y---I.............VL.........K...L-...KS..K.........PN-K---------L........H
C8WTZ3_ALIAD/13-112..RN-H---C.............LN.........L...G-...IL..R.........PR-D---------L........Q
C1KYH3_LISMC/13-114..RE-Y---L........................L...A-.AGKT..K.........PN-Q---------L........H
Q8ETZ8_OCEIH/12-114..RE-Y---L.............LE.........R...G-...TV..N.........PN-K---------L........H
J3ENE3_9LACO/31-132..RR-H---L.............VK.........G...G-...IV..K.........PQ-M---------L........Q
C9ASB2_ENTFC/15-116..RD-H---L.............ID.........Q...G-...ET..K.........PN-K---------L........H
D1BMT8_VEIPT/47-145..RE-R---V.............VQ.........M...N-...IT..K.........VQ-I---------L........H
D3LUV6_9FIRM/36-134..RR-R---L.............TA.......LGI...P-.......A.........VQ-V---------L........H
D1VT13_9FIRM/26-124..RT-M---V.............LK.............G-...NI..P.........AH-K---------L........H
A4XJ79_CALS8/5-105..RN-K---V.............ISE........N...P-...DL..T.........PY-H---------Y........Y
A6P055_9FIRM/19-118..RS-W---L.............CL.........H...G-...KA..T.........NK-G---------L........H
C9LMK9_9FIRM/35-133..RK-A---L.............ID.........T...G-...IY..N.........VQ-I---------L........N
B0MM93_9FIRM/17-116..RE-Q---I.............VK.........L...G-...TM..P.........VD-K---------L........H
D4LDD2_RUMC1/15-114..RS-R---I........................L...G-.SANM..P.........NA-K---------L........H
E6U8V4_ETHHY/21-120..RG-Q---V.............LA.........G...G-...SA..P.........VG-K---------L........H
B0TC36_HELMI/34-133..RR-T---L.............IE.........V...G-...VV..K.........VA-Q---------L........H
MRNC_SYMTH/12-111..RE-R---L.............LE.........R...G-...YV..R.........VN-D---------L........H
Q0AUF9_SYNWW/16-114..RT-R---L......................AIQ...G-...KR..R.........LK-D---------L........H
A5D5M2_PELTS/19-118..RS-S---L.............VN.........A...G-...LV..R.........VN-R---------L........H
MRNC_MOOTA/10-109..RA-H---L.............VG.........R...G-...PA..K.........PE-Q---------L........H
D4KFD3_9FIRM/37-135..RT-R---L.............LN.........F...E-...QS..R.........VH-L---------L........N
C9LVQ2_SELS3/37-135..RT-R---L.............LS.........F...E-...QS..Q.........VH-V---------L........S
C4V0H2_9FIRM/37-135..RM-R---L.............LS.........Y...E-...QT..Q.........VQ-G---------L........H
A5KKA6_9FIRM/30-129..KM-R---V.............VG.........R...G-...GR..Q.........VH-K---------L........H
C5ENC6_9FIRM/5-104..RS-R---V.............VN.........H...G-...SM..Q.........VN-K---------M........H
B1RJ47_CLOPF/20-120..RN-Y---I.............LS.........E...N-.AGLS............AH-K---------I........H
A3DH39_CLOTH/26-125..RT-M---L.............VS.........G...G-..NVP............VH-V---------L........H
A6TWK4_ALKMQ/25-124..RN-H---L.............IT.........Q...T-...KM..L.........VG-A---------Y........H
A8MLB8_ALKOO/26-125..RN-Y---L.............IN.........E...M-...TV..S.........VN-Q---------Y........H
C0WE29_9FIRM/32-129..RK-R---L........................L...P-..VSG..H.........VQ-V---------L........H
C0GIM8_9FIRM/8-106..RQ-K---L.............SR.........Q...K-...AL..P.........VR-Q---------L........H
A2QMS9_ASPNC/124-236..SL-A---L.............VQSPSNAANSAT...P-...DA..YGRVPFTHPALD-S---------L........D
Q0TYG8_PHANO/64-174..SQ-A---L.............IS.........S...P-QEAQA..E.........TD-E---------FGRIPFQHPA
RM44_PONAB/123-207..TQ-F---L.............ED.......E.Y...P-....D..L.....P...TE-G---------I........K
Q6BCK1_TETTH/1224-1338..LK-R---L.............YT.......R.Y...S-....Q..S.....N...PN-E---------L........D
A3CW87_METMJ/121-210..LP-A---I.............WD.............P-...DI.AK.........AG-V---------L........T
I7MKB8_TETTS/752-862..SL-Y---L.............YL.......H.L...P-....N..Q.....S...EN-A---------L........T
A3LUF0_PICST/251-366..SK-L---I.............YELC.....RDG...T-...MA..V.....S...NN-T---------Y........H
Q5GAH0_9VIRU/44-137..PI-Y---F.............INR........F...P-...QL..N.....SAEGVK-L---------V........A
Q4KS72_ISKNV/58-156..PQ-Y---Y.............MER........F...P-...KL..A..HDPSAAVAR-T---------V........S
A2F201_TRIVA/593-691.IVS-Q---M......................EAF...P-...NA..T.........ES-G---------M........S
B0Y3J2_ASPFC/35-122..LD-I---W.............YR.........T...E-...TS..C.........AQ-G---------Y........S
E7NKX5_YEASO/105-208..CI-H---S.............LK.......NGS...P-.AESC..E.........NG-Q---------LSLQFSNLGT
Q6FVA4_CANGA/96-187..AM-H---S.............VG.............P-...EN..S.........FG-N---------L........G
Q6T445_LEIMA/391-483..SN-R---I.............LL.......L.Y...P-....D..Q.....QWLYSE-R---------C........S
Q9DSW1_9VIRU/45-139..VS-Y---M.............SRR........F...P-...QL..R.....NRNGVN-V---------L........A
DCL22_ASPNC/1111-1258..VS-Y---L.............HR.........H....-...AQVMN.........PQ-R---------M........Q
Q2U0L3_ASPOR/1051-1198..VR-Y---L.............HR.............Q-...KSFTS.........SK-R---------L........Q
Q0E579_SFAVA/192-324..ID-Y---I..........RENYT.......DIH...N-...IQ..Q.....D...IG-V---------M........T
A0DYG6_PARTE/384-498..TV-S---V......................SLG...P-...QN..T.....N...EN-I---------L........S
Q3SE73_PARTE/363-464..SA-M---L.............FE.......D.S...K-....Y..K.....T...EN-T---------L........S
Q57XF2_TRYB2/735-814VSDS-F---L.............LG.........E...P-.......W.........HK-D---------V.........
A7SJH8_NEMVE/129-224..TE-Y---L............CFK.........Y...P-...NL..P.........SE-G---------V........R
Q2Q3V3_DROSI/1205-1377..TL-Y---L.............AS.......K.Y...S-....D..W.....N...EG-T---------L........T
Q6BCJ9_TETTH/1328-1487..ST-Q---I.............YF.......E.H...P-....K..S.....M...ED-H---------L........H
DCL_GIAIC/333-418..TA-R---L.............LCL........F...P-...DA..S.........VG-T---------L........V
Q7Q073_ANOGA/1215-1375..SV-Y---I............LFR.........H...T-...SW..H.........EG-Y---------L........T
Q3SE71_PARTE/360-463..TV-D---I.............FRQ........Y...E-...LL..D.........EG-E---------M........T
DCL_GIAIC/646-734..AL-H---L.............HAL........H...P-...TL..T.........EG-A---------L........T
DCL2_PHANO/1130-1270..SK-R---L........................HAHSP-...EL..S.........HQ-K---------M........H
A7EYF3_SCLS1/1216-1363..VT-A---M.............WS.........Y...E-..TEL..S.........HF-Q---------M........H
DCL2_EMENI/1092-1250..VD-L---I.............RA.........H...H-..VEC..Q.........QG-E---------M........T
DCL2_NEOFI/1134-1281..VS-A---I.............FN.........H...P-..IQR..P.........QG-D---------M........T
A1CZL8_NEOFI/163-252..TR-F---I.............WSR........F...E-...DI..S.........SG-Q---------I........S
Q0UFS5_PHANO/190-279..SR-A---L.............YNR........F...P-...HV..D.........VP-Q---------L........C
Q110R1_TRIEI/53-143..SK-Y---L.............SKN........F...S-...SL..G.........KA-T---------L........I
Q55FS1_DICDI/1250-1335..SD-F---L.............YAT........F...P-...LA..Q.........EG-Q---------L........T
A2XBW0_ORYSI/1353-1498..SR-F---L.............FL.......K.Y...P-....Q..K.....H...EG-Q---------L........T
Q80UU5_MOUSE/475-564..TE-Y---L.............FIH........F...P-...DH..H.........ER-H---------L........T
RNC_CAEEL/870-957..SD-F---L.............YRR........F...P-...YH..H.........EG-H---------M........S
DCL2_NEUCR/998-1107LTAS-A---L........................F...P-...NH..H.........ER-L---------L........S
DCL2_PHANO/947-1054..TV-H---L........................MAANP-...KW..P.........ES-H---------L........T
DCL2_ASPCL/955-1060.SCQ-L---F.............FK.........H...P-...NW..H.........EG-Y---------L........S
A6R2T0_AJECN/946-1054..TL-Q---L......................TAT...N-...LI..W.....H...EG-L---------L........S
Q3SE73_PARTE/554-687..IV-N---VHKECEKLYYNPRQQQLCREGKIT.Q...K-...LL..L.....C...PG-M---------L........H
I7MKB8_TETTS/1048-1163..VS-H---G.............YHISRNRQKKIN...S-.................PY-F---------F........C
Q3SE70_PARTE/522-610..IS-Y---A.............FRVAREKQQK.N...P-...NWSLN.........PG-L---------L........S
A5Z824_9FIRM/49-157..VK-T---LTDKYGHMISDEPDYEDEDD...EFY...C-....E..Y.....S...EG-K---------L........T
Q5KKA7_CRYNJ/521-644..TL-H---F.............YL.......L.G...G-...GA..D.....S...ED-D---------M........N
RTL3_ARATH/445-551..TK-H---L.............YL.......T.Y...P-...ML..E.........PK-D---------L........S
RTL3_ORYSJ/76-183..SR-E---V.............FL.......T.Y...G-...QL..Q.........PG-P---------L........T
RTL2_ARATH/93-203..SN-Y---L.............YL.......T.Y...P-...SL..E.........PH-D---------L........S
RTL1_ORYSJ/62-168..AT-I---F.............YR.......D.D...P-...GL..D.........QG-D---------L........T
Q2Q3U9_DROSI/1464-1620..SA-Y---I.............FE.............N-...NTKMN.........PG-A---------L........T
A7SIA4_NEMVE/44-167..TR-H---V.............LQ.......R.F...P-...RL..S.........PG-A---------I........T
A7SKX2_NEMVE/37-156..TE-L---I.............YS.........R...N-..TNL..D.........PG-E---------L........T
Q4SZJ7_TETNG/259-381..TK-H---L.............YE.........D...P-...RQ..HS........PG-V---------L........T
A7IYQ4_PHYPA/1379-1492..TR-Y---L.............FF........KY...T-...NL..P.........PG-R---------L........T
DCL4_ARATH/1327-1436..TS-Y---F.............FT.......V.F...P-...KL..K.........PG-Q---------L........T
DCL4_ORYSJ/1249-1358..TS-Y---L.............YS........TY...P-...DI..K.........PG-Q---------I........T
DCR1_SCHPO/930-1038..SI-T---V.............FL.......K.F...P-...DT..Q.........EY-Q---------L........H
DCL1_ASPNC/1080-1192..SI-A---L.............FT.......Q.N...P-...DD..D.........EF-D---------Y........H
Q4PCH5_USTMA/903-1023..RL-L---A.............YLS........Y...P-...DV..N.........EG-S---------L........T
A3Z4A6_9SYNE/40-129..TE-F---I.............AS.......T.Q...P-...QL..P.........MG-E---------R........S
Q4C1B8_CROWT/48-137..AE-I---L.............LE.......T.Y...P-...NE..L.........VG-E---------F........A
Q31MP4_SYNE7/55-144..AD-F---L.............DR.......H.Y...P-...DL..S.........VG-D---------C........S
DCL2A_ORYSJ/1006-1124..TR-H---L.............FSE........Y...R-...LQ..H.........EG-I---------L........T
DICER_DANRE/1295-1551..TT-Y---L.............FCT........Y...P-...DA..H.........EG-R---------L........S
DCR1_CAEEL/1413-1589..TD-Y---L.............YHT........L...L-...DQ..H.........EG-K---------L........S
Q27IU0_DROSI/1685-1862..TT-Y---L.............YIT........Y...E-...NV..H.........EG-K---------L........S
Q3SD86_PARTE/1582-1697..VE-W---L.............VKE........F...N-...KE..K.........VE-D---------L........A
A2F201_TRIVA/412-500..GI-S---V.............FN.......GCY...N-...YA..N.........EG-L---------M........S
Q3SD86_PARTE/1325-1459..SI-E---V.............FV.......Q.F...P-...FA..N.........EH-L---------L........H
DCR1_SCHPO/1120-1233..VQ-Y---L.............YK.......K.Y...P-...NA..T.........SG-E---------L........T
E3W000_MIMIV/351-441..GE-Y---L.............FN.......K.Y...A-...DS..G.........EG-Y---------L........T
DCL1_ASPFU/1291-1405..VE-D---L.............FRR........F...P-...DR..D.........PQ-W---------L........S
Q0E5R5_MUCCI/1080-1190..ST-Y---V.............FV.......T.L...P-...IS..N.........EF-E---------L........T
RNC_MYCMO/47-135..SI-F---I.............FQH........F...Q-...NI..T.........EG-E---------A........S
Q6CC90_YARLI/191-332..TK-I---I.............YD.......V.F...P-...GD..D.........QS-H---------L........S
A2RV16_DANRE/886-976..SV-H---L.............YH.......L.F...P-...SL..E.........EG-G---------L........A
Q95ZG5_DICDI/926-1010..SL-Y---L.............FKK........F...D-...NE..G.........EG-L---------L........S
Q6FQ28_CANGA/457-550..TT-I---I.............YKS........F...P-...NY..D.........AG-Q---------M........T
Q64AH3_9ARCH/53-141..AE-E---L.............FK.........L...S-KSASL..D.........EG-K---------M........T
RNC_MYCGH/469-556..AE-Y---L.............FN.........H...S-...DS..S.........EG-E---------M........T
A0A024FAP5_UREPR/43-140..SN-F---I.............FNYKIKDNEK.M...R-...SL..D.........EG-E---------M........T
Q8EW40_MYCPE/52-139..SE-F---L.............FK.........N...K-...SL..D.........EQ-K---------M........T
Q1UZA6_PELUQ/38-127..AK-K---L.............LE.......L.Y...P-...DE..K.........EG-V---------L........D
RNC_AQUAE/37-121..VD-L---L.............VQ.........YS..P-...NK..R.........EG-F---------L........S
E3W000_MIMIV/65-149..TE-Y---F.............YH.......R.Y...N-...EE..N.........EG-F---------L........T
A4VD87_TETTS/1750-1863..VE-Y---L.............FN.......K.F...P-...NS..D.........PG-E---------L........T
A3CSF0_METMJ/81-165..AD-H---L.............YGE........Y....-...DL..P.........PG-E---------M........N
Q4A7X2_MYCH7/44-131..SK-V---I.............YD.......NFY...K-.......N.........EG-N---------S........T
A5IYM8_MYCAP/40-130..SA-I---L.............FN.......S.F...K-...DK..N.........QG-Q---------L........T
A4GK15_9BACT/37-125..SQ-I---L.............VE.......K.F...S-...MD..D.........EG-T---------L........S
A5CEW8_ORITB/60-150..SE-T---L.............FK.......N.F...S-...HY..N.........EG-K---------L........A
RNC_WOLTR/54-144..SA-I---L.............FR.......L.F...P-...KE..K.........EG-A---------L........A
RNC_MYCCT/40-130..SK-F---L.............FF.......H.Y...S-...KL..G.........EG-E---------L........T
RNC_MYCPB/56-141..AK-K---L.............FEL........Y...P-...NY..N.........EG-M---------L........T
A4GHU1_9BACT/34-120..SE-R---L.............FNT........Y...G-...NL..K.........EG-K---------L........T
RNC_BRADU/60-150..SD-M---L.............YH.......A.F...P-...NA..D.........EG-E---------L........S
A6DUU1_9RHOB/42-132..AE-A---L.............LS.......Q.D...Q-...GA..T.........EG-Q---------L........A
A5FV46_ACICJ/38-128..AE-W---L.............IE.......R.F...P-...HE..R.........EG-G---------L........G
A5V2R4_SPHWW/51-141..GA-W---L.............FE.......L.F...P-...DE..P.........EG-K---------L........S
RNC_RHIEC/47-137..AE-L---L.............FR.......T.F...G-...TA..G.........EG-E---------L........S
RNC_SPHAL/39-129..AS-E---L.............YT.......R.F...P-...AA..S.........EG-E---------M........S
Q0F3I4_9PROT/44-134..AE-Y---L.............HQ.......S.F...P-...EE..P.........EG-Q---------L........S
M1GI47_LAWIN/41-131..SE-E---L.............FK.......R.H...P-...EA..R.........EG-E---------L........T
A6GP51_9BURK/26-116..SI-L---L.............FE.......T.H...P-...DM..D.........EG-K---------M........S
RNC_MYXXD/55-145..SH-R---L.............MA.......R.C...P-...GL..P.........EG-D---------L........T
A1R7I4_ARTAT/40-130..TD-S---L.............YR.......E.N...P-...SL..P.........EG-E---------L........A
A7A3Q3_BIFAD/75-166..TE-T---L.............YK.......V.H...P-...DM..N.........EG-Q---------L........A
Q1IJU6_KORVE/51-141..SQ-E---L.............VK.......K.F...P-...HF..Q.........EG-E---------L........S
D2BI67_DEHMV/54-144..AD-R---L.............YH.......D.F...P-...DI..Q.........EG-D---------L........T
A9B5J8_HERA2/42-132..GS-F---L.............FH.......E.F...P-...EL..G.........EG-D---------L........T
A4MZ45_HAEIF/36-126..AE-A---L.............YH.......Q.F...P-...RC..N.........EG-E---------L........S
RNC_MYCS5/49-139..SD-Y---C.............VR.......E.F...S-...SL..E.........PG-E---------L........S
A5UJK3_METS3/37-127..SE-Y---L.............YK.......Q.Y...P-...DY..E.........EG-K---------L........T
Q83VA6_9MOLU/41-129..AS-Y---L.............YK.........N...N-...KD..D.........EG-V---------M........T
RNC_RHOBA/69-158..CE-W---L.............FNE........Y...P-...EY..S.........EG-D---------L........T
A3LS79_PICST/241-330..TL-I---I.............YDK........F...P-...SA..S.........EG-K---------L........T
A4E6T0_9ACTN/44-134..AR-S---L.............FE.......S.Y...P-...EF..D.........EG-K---------L........T
A7K823_9PHYC/78-168..AR-Y---L.............YD.......V.F...P-...GK..N.........EG-V---------L........T
A0A015Q692_BACFG/59-145..GD-I---V.............YQH........F...E-...GK..R.........EG-F---------L........T
RNC_CHLPN/45-135..TE-H---L.............FL.......L.F...P-...SM..D.........EG-T---------L........S
A4BWV8_9FLAO/58-144..SA-Y---L.............YK.......E.A...P-...KG..S.........EG-Y---------L........T
A3EQH6_9BACT/58-148..SE-Y---L.............LN.......T.W...P-...SA..S.........EG-D---------I........G
K6KAV8_LEPBO/59-149..AR-S---L.............FQ.......K.Y...P-...KA..S.........EG-E---------L........S
A6LNE7_THEM4/42-132..CT-I---L.............YE.......Q.Y...Q-...TL..N.........EG-T---------M........A
A9BIG2_PETMO/59-148..SE-F---L.............YN.......N.Y....-...HL..S.........EG-E---------M........S
Q1CTK8_HELPH/52-142..GE-L---L.............YH.......KFY....-...QY..D.........EG-K---------L........S
RNC_BDEBA/44-134..GE-F---L.............YEK........F...P-...TD..T.........EG-G---------L........S
A0YTK7_LYNSP/34-125..GE-L---L.............YT.......Y.Y...P-..EEL..S.........EA-K---------M........T
F7UR75_SYNYG/35-125..GR-I---L.............FE.......R.Y...P-...HF..T.........EA-E---------L........T
Q152U6_SCHPM/172-262..TR-I---I.............FS.......K.F...P-...QM..D.........EE-S---------L........S
Q14LC1_SPICI/52-142..SL-Y---L.............FL.......S.F...P-...DK..N.........EG-E---------I........T
F8XZF3_STRAG/44-134..SQ-Y---L.............FT.......K.Y...P-...QK..A.........EG-D---------L........S
B3EKH3_CHLPB/78-168..SE-L---L.............YT.......V.F...P-...ES..D.........EG-K---------L........S

PF11469

Q8U363_PYRFU/5-122--SL-A---L-------------TEFLGKPTGDRV---PNASLAIALD---------LT-G---------L--------S
H3ZKU7_THELN/10-127--SL-A---L-------------SEYLGYPSAGRV---PNASLSIALE---------KA-K---------L--------L
Q5JE89_THEKO/13-131--SL-A---L-------------SEYLGKPTGERV---PNASLAIALE---------MA-G---------L--------R
A1RX42_THEPD/16-123--SA-A---L-------------T.LIGRPTGVKV---PGETLARAFL---------SS-R---------L--------S

PF14622

RM15_SCHPO/67-197KD---L.V.N...LRS.PA........RL.A-EVA-------------------------------K-KW--N.......
Q7S1R6_NEUCR/117-265QP---L...D...IMD.KT........KI.A-RMG-------------------------------I-DF--G.......
Q2GMI6_CHAGB/267-400KQ---P.M.D...VVS.KD........KL.A-KLA-------------------------------I-DV--G.......
A8Q4V0_MALGO/115-263EY---L.Q.N...LLSSQQ........HV.D-DIA-------------------------------S-TH--HLGIVSAA
Q4P7G0_USTMA/113-257TG---V.D.S...ILT.TH........RLGD-KIG-------------------------------R-EL--G.......
A5E1N1_LODEL/106-245KD---L.T.KLGSLYS.KELS...GRDAA.G-YFA-------------------------------K-VE--N.......
D5X4R4_THIK1/15-139SR---LRA.A...LVR.AE........AL.A-EVA-------------------------------R-AI--D.......
C4Z0E7_EUBE2/19-151RL---R.A.S...IVC.EP........TL.A-LCA-------------------------------R-AI--K.......
RNC_BORA1/16-141RV---R.A.N...LVK.QA........SL.A-DIA-------------------------------Q-RL--E.......
RNC_MESFL/16-146KT---R.S.D...IVR.QE........TL.S-EIA-------------------------------K-MI--D.......
RNC_LEIXX/20-149KR---R.A.S...LVS.SV........AL.A-EVA-------------------------------R-GI--G.......
RNC_THELT/22-156KV---K.A.A...IAS.EE........AL.A-QIA-------------------------------R-DI--N.......
C8W586_DESAS/21-152KL---R.A.A...IVC.EP........SL.A-KVA-------------------------------R-QL--N.......
E4RLQ9_HALHG/23-154KM---R.A.V...VVS.AP........IL.A-EAA-------------------------------K-KL--E.......
D4LHQ1_9FIRM/18-150KK---R.A.S...MVC.EK........SL.A-YCA-------------------------------R-EF--G.......
A4G6R8_HERAR/16-141SR---LRA.N...LVK.QQ........SL.Y-EIA-------------------------------Q-RL--E.......
A1SLU8_NOCSJ/48-177KL---R.A.A...VVN.AR........AL.A-EVG-------------------------------R-RI--G.......
Q2LVR4_SYNAS/22-153KL---R.A.S...VVN.EQ........PL.A-ELA-------------------------------K-KC--R.......
E8NDE2_MICTS/20-149KR---R.A.G...VVS.TI........AL.A-EVA-------------------------------R-GI--G.......
E4TJ04_CALNY/16-145RY---R.A.Y...FVS.EE........FI.S-ELA-------------------------------K-QI--D.......
D4J805_9FIRM/20-152KK---R.A.S...LVC.EP........TL.A-YCA-------------------------------R-QI--G.......
E8UCB0_TAYEM/16-140RI---R.A.S...YVN.QD........TL.A-KIA-------------------------------N-NL--K.......
E3DQV9_HALPG/23-155KM---R.A.V...IVS.AP........IL.A-EAA-------------------------------K-RI--N.......
A5WCD8_PSYWF/39-165RM---R.A.T...LVR.QE........SL.V-VVA-------------------------------Q-KL--N.......
D9R047_CLOSW/18-150KI---R.A.S...IVC.EP........TL.A-YCA-------------------------------E-SI--R.......
RNC_PELTS/21-152TK---LRA.S...VVC.EP........SL.A-RVA-------------------------------R-EL--E.......
A9KLR1_CLOPH/23-155TK---LRA.S...MVC.EQ........TL.A-LCA-------------------------------R-EL--H.......
D0MGH0_RHOM4/39-171RL---R.A.K...LVN.RE........AL.A-QAA-------------------------------R-RL--G.......
D3PAP4_DEFDS/17-146KY---R.S.F...FVS.ED........II.S-EIA-------------------------------L-KI--R.......
F0S2Z0_DESTD/19-149SQ---I.RAF...LVS.EP........SL.S-ELA-------------------------------K-TV--D.......
A5I4N2_CLOBH/24-150RK---R.A.I...IVC.EN........SL.Y-EIA-------------------------------K-RW--D.......
RNC_BACV8/34-159NT---R.S.K...IVQ.RE........TL.N-RLA-------------------------------I-EI--G.......
B6JY03_SCHJY/68-197MW---L.Q.N...ACR.PE........NI.N-KVA-------------------------------E-QW--G.......
C4R5N4_PICPG/63-200LT---K...S...IGN.HK........SL.A-RFA-------------------------------K-EK--Q.......
E6UF22_RUMA7/20-145KL---R.A.S...LVC.EK........AL.F-EFS-------------------------------H-KI--E.......
K7X354_MYCHR/18-142IL---R.S.Q...IVS.SV........SF.A-KIS-------------------------------D-KL--Q.......
Q13VM8_BURXL/16-137RV---R.A.N...LVK.QQ........SL.Y-EIA-------------------------------Q-AL--N.......
RNC_RALME/17-139RV---R.A.N...LVK.QQ........AL.Y-EIA-------------------------------Q-ML--Q.......
Q59PD0_CANAL/73-209KN---L.D.V...LGS.PMSRELPSLKTA.A-IFA-------------------------------K-SN--N.......
RNC_PSESM/18-137RL---R.A.R...LVK.GE........TL.A-LLA-------------------------------R-GF--D.......
R5BXA0_9FIRM/20-152KK---R.A.S...MVC.EP........TL.A-LCA-------------------------------R-EI--R.......
R5HQM8_9FIRM/18-148KL---R.A.S...LVC.EP........TL.A-ICT-------------------------------R-EM--E.......
R5TZE4_9FIRM/19-150KT---R.A.S...MVC.EP........SL.A-FCA-------------------------------R-EI--E.......
R5X6S0_9CLOT/24-150KI---R.A.N...IVC.EE........SL.S-EVS-------------------------------K-NI--H.......
R6GD49_9FIRM/20-151KL---R.S.S...LVC.EY........TL.A-ICA-------------------------------R-DV--E.......
R6JSS6_9CLOT/18-150KI---R.A.S...IVC.EP........TL.A-YCA-------------------------------G-DI--K.......
R6LRB3_9FIRM/18-150KL---R.A.S...MVC.EK........AL.A-FCA-------------------------------R-DL--E.......
R6PBG7_9FIRM/22-152KK---R.A.S...IVC.EP........TL.A-LCA-------------------------------K-EI--S.......
R6QQD7_9FIRM/19-150KM---R.A.S...LVC.EP........TL.A-FCA-------------------------------K-DL--S.......
R7AJR0_9BACE/21-152KL---R.A.S...MVC.EP........SL.A-FCA-------------------------------R-DI--S.......
R7DB60_9FIRM/14-146KK---R.A.S...LVC.EP........SL.A-YCA-------------------------------R-QF--G.......

PF00636

A3GHW8_PICST/84-184GK...N-L-D---VLG-TP--------IA-K.ELA...............................G.RL..S-------
RM15_SCHPO/89-181TI.PSY-K-D---LVN-LR--------SP-A.RLA...............................EVAK..K-------
RM03_SCHPO/83-189GM...Q-N-G---WMG-SK--------AL-S.QLA...............................T.IW..G-------
A2QRC1_ASPNC/121-242AA...M-Y-A---YVG-PK--------TL-A.AMA...............................R.EW..G-------
Q0UQH0_PHANO/7-117AL...P-D-A---FTR-QA--------PW-AWNVT.....................................T-------
Q1XG54_CRYJA/71-157SK...I-S-E---LSN-C.--------TV-L.SKD...............................AFDL..Q-------
Q9FYL8_ARATH/80-167RL...I-S-E---VSN-VE--------SS-C.ALD...............................GDRL..G-------
A0A023ZEP0_YEASX/153-272AA...V-N-A---YIS-EA--------VL-A.HIA........................KYWGIEVETTS..V-------
Q4PA03_USTMA/211-325AA...V-S-A---YVG-PS--------TL-S.DVG...............................S.EL..G-------
Q0CCZ5_ASPTN/48-132FR...N-P-Q---IIC-KL--------TA-P.FMA...............................D.....E-------
Q0UMM3_PHANO/145-228LM...S-S-Q---TVS-RA--------AL-A.VTG...............................H.KL..G-------
A7I5W5_METB6/51-140RA...K-E-Q---LED-NA--------SL-A.QIG...............................R.RL..K-------
A3CVM2_METMJ/43-132IK...K-S-T---IER-RP--------FL-A.ELG...............................R.RF..D-------
A7I515_METB6/44-134SE...K-I-R---GVN-RD--------KT-R.AFA...............................E.KF..Q-------
A3CRH2_METMJ/50-139NR...K-M-N---LVN-MT--------RL-R.GLA...............................E.DL..D-------
A5DES0_PICGU/186-275SM...K-V-R---LSS-SV--------VL-T.KMA...............................M.GY..N-------
A3LPK0_PICST/184-273VF...R-H-K---LLS-PG--------IL-T.KLA...............................F.GY..N-------
Q6BWD6_DEBHA/187-276YL...Q-F-K---LVS-TS--------IL-T.KLA...............................F.GY..N-------
A4RR17_OSTLU/28-138GV...S-K-G---WCS-AK--------AM-H.AHL...............................N.RL..L-------
C1MLN8_MICPC/114-224AT...K-L-N---WCS-SV--------AM-S.DHL...............................A.RL..L-------
C1FDU3_MICSR/76-186AT...K-Q-G---WSS-SI--------AM-C.GHL...............................R.RL..L-------
A9BJB7_PETMO/21-118EK...T-K-D---FLS-AK--------AH-S.KFV...............................D.....I-------
D4CVS6_9FUSO/18-116KH...V-K-S---KVN-AR--------YQ-S.LIY...............................K.....Q-------
C3WFU5_FUSMR/12-110RK...V-K-D---CVN-AK--------RQ-S.ELY...............................R.....E-------
B9K831_THENN/17-112ER...V-K-E---WTS-KH--------GQ-A.RML...............................E.....S-------
A5ILI0_THEP1/17-112ER...V-K-E---HTS-KH--------GQ-A.WML...............................E.....N-------
A6LJ32_THEM4/19-114KN...T-H-S---IVN-RD--------HQ-A.LLL...............................D.....K-------
A8F7A2_THELT/9-104KE...V-N-K---IIS-RE--------GQ-A.RSF...............................D.....R-------
A8J7A5_CHLRE/55-159AI...A-A-A---AAT-DA--------SG-A.AAS...............................Q.LL...-------
B1C8Q3_9FIRM/18-117KM...S-M-N---YVS-AL--------YQ-A.DIF...............................S.....F-------
C1DXY5_MICSR/99-208LK...T-K-R---AAR-AE--------AQ-D.MVL...............................R.ALMDE-------
Q014M6_OSTTA/451-557LK...T-K-R---LAR-AE--------AQ-D.YLL...............................R.LL..V-------
MRNC_KOSOT/20-117NL...T-L-L---YVE-AK--------GQ-R.KAL...............................E.....V-------
B7CDG4_9FIRM/9-110KK...N-A-V---ICS-AK--------GQ-A.IML...............................N.KM..M-------
B7G3M0_PHATC/16-116TD...V-V-G---FVR-AE--------FQ-S.RLL...............................A.QL..K-------
A9RYU0_PHYPA/18-120KR...V-M-D---LVC-CE--------AQ-D.AML...............................Q.QL..L-------
Q94F12_ARATH/98-200DR...V-R-A---VVR-CE--------AQ-Y.ALL...............................N.KL..V-------
C6T3M8_SOYBN/105-207DR...V-M-A---VVR-CE--------AQ-D.ALL...............................Q.KL..L-------
C0PKE8_MAIZE/108-210KR...V-M-D---VVK-CE--------SQ-D.LLL...............................N.KL..L-------
Q2JI20_SYNJB/24-121QQ...V-V-R---RVR-GS--------AQ-A.KLL...............................L.....A-------
B4WGA4_9SYNE/42-139HQ...V-V-T---QVK-AE--------QQ-S.HFV...............................D.....L-------
Q31LB9_SYNE7/26-123QS...V-V-A---AVR-AE--------RQ-A.ELL...............................V.....S-------
MRNC_THEEB/23-120RQ...V-V-A---HVR-AE--------SQ-A.RYM...............................D.....F-------
F7UR33_SYNYG/28-125RR...V-V-A---QVR-AE--------QQ-A.QIL...............................T.....T-------
B1XNV1_SYNP2/17-114GK...V-V-A---EVR-AE--------TQ-A.QYL...............................T.....L-------
B8HT79_CYAP4/37-134QR...V-V-A---HVR-AE--------AQ-A.EYL...............................R.....S-------
B4VUK6_9CYAN/43-140DQ...V-V-A---QVR-AE--------SQ-A.NTL...............................R.....S-------
A8YKZ5_MICAE/29-126AQ...V-V-G---KVR-AE--------QQ-ALDLA.....................................Q-------
B7KCP4_CYAP7/45-142SQ...V-V-A---QVR-AE--------QQ-A.AHL...............................Q.....T-------
D3EMY0_ATETH/29-126NQ...V-V-A---QVR-AE--------TQ-A.AAL...............................Q.....Q-------
B7K2P3_CYAP8/45-142NQ...V-V-S---FVR-AE--------TQ-A.ALL...............................E.....Y-------
A0ZGL0_NODSP/61-158CL...V-V-A---QVR-AE--------TQ-A.LHL...............................R.....S-------
Q112N8_TRIEI/20-117QL...V-V-S---QVR-AE--------SQ-AHQLH.....................................N-------
A0YQT6_LYNSP/17-114QL...V-V-S---QVR-AE--------TQ-A.RHL...............................R.....S-------
A8G4M5_PROM2/20-117LS...V-V-N---EVK-AK--------SQ-SKSLS.....................................Q-------
A9B9W4_PROM4/20-117KT...V-V-S---RVK-AE--------AQ-A.DAL...............................Q.....M-------
Q7VCJ3_PROMA/20-117FS...V-V-S---LVR-AE--------AQ-A.AAL...............................E.....N-------
A5GTM3_SYNR3/12-109KR...A-V-A---LVR-AE--------AQ-SEALA.....................................K-------
A2C1X8_PROM1/20-117NA...V-V-K---EVN-AS--------SQ-A.KAI...............................T.....K-------
B1X410_PAUCH/23-120SA...V-V-K---RVK-AT--------AQ-S.SAL...............................Q.....K-------
B5IKV4_9CHRO/2-99RQ...V-V-A---SVR-AD--------AQ-A.RQL...............................E.RL...-------
Q067M9_9SYNE/20-119KA...V-V-A---EVR-AD--------AQ-S.NLL...............................A.....W-------
Q7U7F7_SYNPX/20-117RA...V-V-A---KVC-AE--------AQ-A.EAL...............................G.RL...-------
A3YYC2_9SYNE/20-117QA...V-V-A---RVR-AQ--------AQ-A.QAL...............................Q.....C-------
Q0I9N3_SYNS3/20-117QA...V-V-S---LVR-AD--------AQ-A.AAL...............................E.....K-------
A4CU57_SYNPV/21-118RS...V-V-A---EVR-AD--------AQ-A.LAL...............................E.RL...-------
A3Z7F5_9SYNE/21-118RA...V-V-A---EVK-AA--------AQ-A.DLL...............................E.....R-------
A6GE80_9DELT/16-118KA...R-A-R---IVN-AG--------AQ-A.ELL...............................A.EL..L-------
A0A008AQZ0_STAAU/15-116QM...S-K-K---YVS-AK--------SQ-A.QTL...............................E.YL..M-------
C8WTZ3_ALIAD/13-112RQ...A-T-R---YVS-AV--------AQ-A.EAL...............................R.....L-------
C1KYH3_LISMC/13-114KT...A-T-K---FVS-AK--------GQ-A.VAL...............................K.AM..I-------
Q8ETZ8_OCEIH/12-114QS...A-T-S---YVA-GK--------TQ-A.MVI...............................LYWL..D-------
J3ENE3_9LACO/31-132RY...A-T-H---YVS-AK--------AQ-A.GLI...............................T.KM..Q-------
C9ASB2_ENTFC/15-116RA...A-T-N---YVS-AN--------AQ-A.FLI...............................Q.QM..L-------
D1BMT8_VEIPT/47-145TI...V-T-E---FIC-AK--------SQ-A.KVL...............................L.....E-------
D3LUV6_9FIRM/36-134AL...A-A-E---FVS-AK--------CQ-S.FVY...............................T.....C-------
D1VT13_9FIRM/26-124TK...S-I-K---YVQ-AK--------GQ-K.ELI...............................E.....K-------
A4XJ79_CALS8/5-105LK...T-T-K---YVK-AS--------SQ-A.IAI...............................K.....K-------
A6P055_9FIRM/19-118KA...T-V-K---YVA-AP--------AQ-A.AAA...............................E.....K-------
C9LMK9_9FIRM/35-133SL...A-S-E---MVS-AR--------QQ-S.RIL...............................F.....E-------
B0MM93_9FIRM/17-116KK...A-V-Q---YVN-AG--------FQ-S.YAY...............................D.....V-------
D4LDD2_RUMC1/15-114NL...T-I-R---RVC-AE--------YQ-S.AAV...............................D.....V-------
E6U8V4_ETHHY/21-120HR...T-V-G---FVR-AD--------AQ-A.QAA...............................H.....V-------
B0TC36_HELMI/34-133KQ...A-V-E---IVR-AA--------SQ-V.ALL...............................R.....R-------
MRNC_SYMTH/12-111RH...A-L-R---YVQ-AT--------AQ-A.AIL...............................H.....H-------
Q0AUF9_SYNWW/16-114LD...A-V-A---TVR-AE--------SQ-A.QVL...............................R.....Q-------
A5D5M2_PELTS/19-118DE...A-V-K---YVN-AG--------AQ-A.RLL...............................R.....L-------
MRNC_MOOTA/10-109RE...A-L-K---YVR-AT--------AQ-A.RVV...............................P.....A-------
D4KFD3_9FIRM/37-135DF...S-M-K---LVS-AT--------LQ-A.QAY...............................K.....A-------
C9LVQ2_SELS3/37-135DF...A-A-Q---IVS-AV--------WQ-A.KAY...............................H.....A-------
C4V0H2_9FIRM/37-135AF...S-A-Q---IVS-AV--------WQ-A.RAY...............................R.....G-------
A5KKA6_9FIRM/30-129EE...T-S-R---YVQ-AS--------AQ-S.FMM...............................R.....A-------
C5ENC6_9FIRM/5-104KR...S-A-G---LVK-AG--------TQ-A.ALI...............................R.....A-------
B1RJ47_CLOPF/20-120VK...A-I-Q---YVK-AK--------AQ-S.DII...............................N.....A-------
A3DH39_CLOTH/26-125KR...S-I-A---YVK-AK--------AQ-S.DIV...............................H.....R-------
A6TWK4_ALKMQ/25-124RD...A-I-G---YVK-AQ--------SQ-A.TIV...............................R.....T-------
A8MLB8_ALKOO/26-125KR...A-T-H---YVR-AK--------AQ-S.HVV...............................H.....A-------
C0WE29_9FIRM/32-129DL...A-A-R---MVS-AV--------MQ-A.KAM...............................D.....G-------
C0GIM8_9FIRM/8-106RR...A-T-R---LVR-AE--------GQ-DAALG.....................................Q-------
A2QMS9_ASPNC/124-236NLDYNT-K-S---FLT-SK--------TK-LSELA...............................H.KY..D-------
Q0TYG8_PHANO/64-174LI...G-L-Q---GLS-DE--------AQ-S.KIL...............................D.KA..R-------
RM44_PONAB/123-207NL...V-E-F---LTG-ED--------VV-C.HVA...............................R.NL..A-------
Q6BCK1_TETTH/1224-1338IF...M-E-I---ICC-EQ--------TK-S.FLS...............................A.KF..K-------
A3CW87_METMJ/121-210GN...R-K-A---YDR-NS--------NL-A.RLC...............................D.RW..G-------
I7MKB8_TETTS/752-862MI...R-T-I---FIN-NK--------YL-G.ISA...............................F.RN..G-------
A3LUF0_PICST/251-366ML...R-T-I---LAT-NT--------LL-S.KLT...............................V.AY..N-------
Q5GAH0_9VIRU/44-137RL...K-I-N---YAS-RK--------SF-A.AIA...............................G.SL..G-------
Q4KS72_ISKNV/58-156QL...A-I-T---YQS-GT--------TM-S.TIA...............................Q.KM..G-------
A2F201_TRIVA/593-691IA...S-S-F---LKS-ND--------FL-GKRAY.................................KI..G-------
B0Y3J2_ASPFC/35-122RL....-Q-D---YAT-NK--------AM-A.HQA...............................I.RL..H-------
E7NKX5_YEASO/105-208KF...A-K-E---LTS-KN--------TA-C.TFV...............................K.LH..N-------
Q6FVA4_CANGA/96-187TP..VS-K-G---LVS-YQ--------TA-A.EYV...............................I.AK..N-------
Q6T445_LEIMA/391-483TFTLVR-D-A---CEM-NV--------NL-D.FVF...............................D.TL..E-------
Q9DSW1_9VIRU/45-139TL...R-I-S---YGS-KN--------VL-S.GLS...............................S.KY..G-------
DCL22_ASPNC/1111-1258SL...K-S-A---FTN-NT--------FL-T.FIA......ITFHQVREQNHIDVDDEHNVHKNVTTCSI..R-------
Q2U0L3_ASPOR/1051-1198SL...K-S-A---VTN-NM--------FL-A.FLC......LTFHWEKQHDIIEVDSMGVPSVIQTRGRV..A-------
Q0E579_SFAVA/192-324KL...R-S-I---YVG-KW--------NL-S.KCC...............................V.SI..G-------
A0DYG6_PARTE/384-498DQ...R-S-Q---IVN-NN--------FI-G.KHLFKY............................Q.YF..G-------
Q3SE73_PARTE/363-464SA...R-V-R---LIT-NK--------HL-S.SIY...............................G.NL..K-------
Q57XF2_TRYB2/735-814.....N-T-K---LCC-NE--------VL-ATLIP...............................P.....G-------
A7SJH8_NEMVE/129-224QL...H-N-F---LTN-RE--------TL-V.KVA.................................DL..T-------
Q2Q3V3_DROSI/1205-1377QV...K-S-K---LVS-NR--------NL-L.YCL...............................A.DT..D-------
Q6BCJ9_TETTH/1328-1487VH...R-T-I---IIQ-NR--------NL-A.QIA...............................V.KK..K-------
DCL_GIAIC/333-418EL...K-M-E---LVR-NE--------AL-N.YLV...............................Q.TL..G-------
Q7Q073_ANOGA/1215-1375TC...K-G-R---MVS-NR--------NL-L.YCA...............................M.GY..G-------
Q3SE71_PARTE/360-463SL...R-S-R---LIM-NT--------FL-A.QLF...............................E.QL..G-------
DCL_GIAIC/646-734RM...R-Q-S---AET-NS--------VL-G.RLT...............................K.....R-------
DCL2_PHANO/1130-1270AI...R-T-A---TVN-AS--------FL-AFRLF..............ETTIDEETINKTSMRPESQKR..A-------
A7EYF3_SCLS1/1216-1363LL...R-S-A---LVN-AD--------FL-A.FLCME.....MSIEQYVTDLTEGKDHQIHETHTRR.RF..S-------
DCL2_EMENI/1092-1250KI...K-H-A---IVN-GH--------LL-A.FLCMQFKWAMPSPLTPSIDTG.TETETEIISPPPK.TL..S-------
DCL2_NEOFI/1134-1281KI...K-H-A---VVN-AN--------LL-A.FLC......MESATSEEKLDVAQTSKDSFAVTTSQESV..E-------
A1CZL8_NEOFI/163-252QI...R-E-L---LVK-NE--------TL-S.EFA...............................T.LY..G-------
Q0UFS5_PHANO/190-279SW...R-E-R---LVE-NV--------AL-A.KFS...............................E.AY..G-------
Q110R1_TRIEI/53-143II...E-S-D---LVS-IK--------ML-S.EFA...............................K.DL..K-------
Q55FS1_DICDI/1250-1335DY...R-S-R---LVR-NS--------NL-S.SIS...............................R.KL..C-------
A2XBW0_ORYSI/1353-1498RM...R-Q-Q---MVS-NM--------VL-Y.QYA...............................L.NK..T-------
Q80UU5_MOUSE/475-564LL...R-S-S---LVN-NR--------TQ-A.KVA...............................E.EL..G-------
RNC_CAEEL/870-957LL...R-T-S---LVS-NQ--------TQ-A.VVC...............................D.DL..G-------
DCL2_NEUCR/998-1107QW...K-D-K---LVN-NV--------RL-C.RAS...............................R.DF..G-------
DCL2_PHANO/947-1054AK...K-G-R---IVS-NG--------FL-A...................................RATIAAG-------
DCL2_ASPCL/955-1060EG...R-D-E---IVQ-NP--------RL-T.KAA...............................L.DT..G-------
A6R2T0_AJECN/946-1054RA...K-D-T---VVS-NK--------RL-S.YAA...............................I.EA..G-------
Q3SE73_PARTE/554-687TA...K-I-S---LLD-SG--------FM-G.TMA...............................I.YH..N-------
I7MKB8_TETTS/1048-1163EM...K-S-L---LLS-ND--------FM-S.RMA.........................ILNKFHYYAL..N-------
Q3SE70_PARTE/522-610TW...K-Q-Y---LLG-NK--------FM-GEQTI.................................KM..G-------
A5Z824_9FIRM/49-157HL...K-S-L---LVR-KE--------YL-S.ARI...............................D.EL..K-------
Q5KKA7_CRYNJ/521-644KVWQDR-H-M---LIS-NR--------TL-T.ANA...............................V.KQ..G-------
RTL3_ARATH/445-551VL...R-D-A---NTC-HD--------KY-A.CVA...............................V.KK..G-------
RTL3_ORYSJ/76-183RL...R-A-A---NVD-KE--------KL-A.RVA...............................V.VH..G-------
RTL2_ARATH/93-203LL...R-A-A---NVS-TE--------KL-A.RVS...............................L.NH..G-------
RTL1_ORYSJ/62-168VL...R-S-A---NVS-TQ--------KL-A.RVA...............................V.RR..R-------
Q2Q3U9_DROSI/1464-1620DL...R-S-A---LVN-NT--------TL-A.CIC...................VRHRLHFFILAENEKLSET-------
A7SIA4_NEMVE/44-167DL...R-S-A---VVN-NY--------SL-A.CLT...............................I.QR..D-------
A7SKX2_NEMVE/37-156DL...R-Q-A---LVN-NN--------IF-A.EIA...............................V.KH..G-------
Q4SZJ7_TETNG/259-381DL...R-S-A---LVN-NT--------IF-A.SLA...............................V.KY..D-------
A7IYQ4_PHYPA/1379-1492DL...R-A-A---AVN-NE--------NF-A.RVA...................VKHSYHLHLRHGSTALETQ-------
DCL4_ARATH/1327-1436DL...R-S-L---SVN-NE--------AL-A.NVA...............................V.SF..S-------
DCL4_ORYSJ/1249-1358DL...R-S-L---AVG-ND--------SL-A.YAA...............................V.EK..S-------
DCR1_SCHPO/930-1038FN...R-K-K---IIS-NC--------NL-Y.KVA...............................I.DC..E-------
DCL1_ASPNC/1080-1192VN...R-M-C---LIC-NK--------NL-F.NAA...............................V.DK..E-------
Q4PCH5_USTMA/903-1023RL...S-N-Y---PTQ-NN--------FL-A.LLF...............................R.EC..G-------
A3Z4A6_9SYNE/40-129AL...R-A-Q---LVS-DQ--------WL-A.QLG...............................E.QI..G-------
Q4C1B8_CROWT/48-137AI...R-S-I---LVS-DR--------TL-A.EFA...............................D.NY..G-------
Q31MP4_SYNE7/55-144AL...R-S-E---LGS-DR--------TL-A.AIA...............................A.SY..N-------
DCL2A_ORYSJ/1006-1124KM...K-K-N---LIS-NA--------AL-C.QLA...............................C.SS..N-------
DICER_DANRE/1295-1551YM...R-S-K---KVS-NC--------NL-Y.RLG...............................K.KK..G-------
DCR1_CAEEL/1413-1589FA...R-S-K---EVS-NC--------NL-Y.RLG...............................K.KL..G-------
Q27IU0_DROSI/1685-1862HL...R-S-K---QVA-NL--------NL-Y.RLG...............................R.RK..R-------
Q3SD86_PARTE/1582-1697LK...K-Q-C---VVC-NK--------AL-A.LVT...............................L.HY..K-------
A2F201_TRIVA/412-500EL...K-I-A---FVK-NR--------TF-S.KIS...............................E.IL..D-------
Q3SD86_PARTE/1325-1459LE...R-A-R---IVS-NE--------NL-R.KFSIIHRFFNCIKCT...................NFDY..S-------
DCR1_SCHPO/1120-1233DY...K-S-F---YVC-NK--------SL-S.YIG...............................F.VL..N-------
E3W000_MIMIV/351-441RL...R-C-K---LEN-SE--------SL-F.FLA...............................K.QS..D-------
DCL1_ASPFU/1291-1405EH...K-M-A---MVS-NK--------FL-G.ALS...............................V.KL..G-------
Q0E5R5_MUCCI/1080-1190ES...R-M-R---MIS-NT--------AL-F.KSA...............................I.QL..R-------
RNC_MYCMO/47-135LI...R-A-K---NVC-SS--------GL-S.ELS...............................K.KL..G-------
Q6CC90_YARLI/191-332FL...R-G-Q---VIA-NI--------VL-C.RWAAIYGFPSKLRVASSVLSPEQLHILTVSILSPR.TL..G-------
A2RV16_DANRE/886-976TY...R-T-A---IVQ-NQ--------HL-A.MLA...............................K.KL..E-------
Q95ZG5_DICDI/926-1010KK...R-E-F---YTK-NE--------YL-T.ELS...............................R.RI..G-------
Q6FQ28_CANGA/457-550RL...R-V-L---LVS-NR--------RL-E.KWA...............................Y.LY..G-------
Q64AH3_9ARCH/53-141FL...K-A-E---LEN-NL--------RL-A.EYG...............................E.NI..G-------
RNC_MYCGH/469-556KD...R-I-K---IIQ-SN--------TL-I.KAA...............................T.QL..E-------
A0A024FAP5_UREPR/43-140RA...R-S-N---MVR-SE--------IL-S.YAA...............................K.DL..G-------
Q8EW40_MYCPE/52-139EI...R-K-N---LVN-SE--------IF-K.KAS...............................E.EL..G-------
Q1UZA6_PELUQ/38-127KK...F-A-S---LVN-KK--------KC-L.EIA...............................K.KI..E-------
RNC_AQUAE/37-121PL...K-A-Y---LIS-EE--------FF-N.LLA...............................Q.KL..E-------
E3W000_MIMIV/65-149RL...R-I-R---IER-GD--------SM-V.ELS...............................K.NL..G-------
A4VD87_TETTS/1750-1863QM...K-T-S---LVQ-NK--------TL-C.LIN...............................L.MK..G-------
A3CSF0_METMJ/81-165R....R-L-Q---VTR-NT--------KL-A.EIV...............................R.RQ..G-------
Q4A7X2_MYCH7/44-131QI...R-S-L---LTS-TS--------SL-A.NAT...............................K.KV..G-------
A5IYM8_MYCAP/40-130LI...R-S-K---LVC-TD--------SL-N.QIA...............................D.LL..K-------
A4GK15_9BACT/37-125LM...R-S-K---LVS-RT--------TL-N.KIA...............................K.KL..E-------
A5CEW8_ORITB/60-150KS...R-A-F---LVC-NE--------SI-C.LIA...............................Q.KI..N-------
RNC_WOLTR/54-144RR...K-T-D---LVC-GN--------TI-A.NVA...............................K.EI..K-------
RNC_MYCCT/40-130RL...R-S-S---TVR-EE--------SL-S.RIA...............................K.DI..N-------
RNC_MYCPB/56-141RT...K-I-E---IVK-GE--------NL-N.RIG...............................K.EL..N-------
A4GHU1_9BACT/34-120RF...K-A-S---IVS-RE--------NL-H.RVA...............................I.NL..E-------
RNC_BRADU/60-150KR...L-A-E---LVR-KE--------SC-A.DVA...............................K.SL..G-------
A6DUU1_9RHOB/42-132PR...F-N-A---LVR-KE--------AC-A.DVA...............................R.EI..D-------
A5FV46_ACICJ/38-128PR...L-A-H---LVS-RQ--------SL-A.EIA...............................E.HG..G-------
A5V2R4_SPHWW/51-141RR...L-N-A---IVS-RE--------TC-A.DVG...............................R.AI..G-------
RNC_RHIEC/47-137VR...L-N-Q---LVS-AE--------TC-A.AVA...............................D.EL..N-------
RNC_SPHAL/39-129SR...L-H-V---LAS-GA--------TC-A.AIA...............................Q.RL..D-------
Q0F3I4_9PROT/44-134RM...R-A-N---LVC-RD--------SL-L.VVA...............................S.DW..R-------
M1GI47_LAWIN/41-131RM...R-S-N---LVN-TK--------ML-V.LLA...............................R.EL..K-------
A6GP51_9BURK/26-116RV...R-S-H---LVK-QD--------CL-A.MVG...............................R.NL..L-------
RNC_MYXXD/55-145KM...R-A-R---VVN-ED--------GL-A.RVA...............................R.TI..P-------
A1R7I4_ARTAT/40-130KR...R-S-A---VVS-TR--------AL-A.GIG...............................R.EI..G-------
A7A3Q3_BIFAD/75-166KM...R-A-K---AVS-EE--------SL-S.KIA...............................REKL..H-------
Q1IJU6_KORVE/51-141KL...R-A-Y---LVS-AR--------HL-I.QTA...............................R.NL..D-------
D2BI67_DEHMV/54-144RF...R-S-L---LVR-RE--------SL-V.RVA...............................L.GI..N-------
A9B5J8_HERA2/42-132KT...R-A-M---LVQ-TR--------TL-A.GLA...............................R.RF..N-------
A4MZ45_HAEIF/36-126RM...R-A-T---LVR-EP--------TL-A.ILA...............................R.QF..E-------
RNC_MYCS5/49-139RL...R-S-K---LVD-KL--------AL-F.KIA...............................Q.KL..K-------
A5UJK3_METS3/37-127KL...R-A-N---YVC-QT--------AL-I.YYS...............................H.EL..G-------
Q83VA6_9MOLU/41-129KK...R-A-Q---AVC-VD--------SL-L.IYA...............................E.EI..Q-------
RNC_RHOBA/69-158KI...K-S-A---VVS-RR--------SC-G.KVA...............................C.KL..G-------
A3LS79_PICST/241-330KM...R-S-Q---LID-NH--------TL-T.QFS...............................F.EY..G-------
A4E6T0_9ACTN/44-134RL...K-V-S---LVS-GA--------TL-S.EVS...............................H.EL..G-------
A7K823_9PHYC/78-168RL...R-V-K---FVS-GK--------LL-S.KLA...............................H.QL..G-------
A0A015Q692_BACFG/59-145NT...R-S-K---IVQ-RE--------TL-N.KLA...............................V.EI..G-------
RNC_CHLPN/45-135TA...R-A-S---LVN-AK--------AC-C.RYT...............................T.ML..G-------
A4BWV8_9FLAO/58-144QM...R-S-K---IVS-RE--------HL-N.ELG...............................K.DL..N-------
A3EQH6_9BACT/58-148QI...F-S-G---IVS-TQ--------TL-A.SIA...............................R.RM..D-------
K6KAV8_LEPBO/59-149RI...K-S-K---IVS-TP--------IL-N.SIA...............................E.KL..N-------
A6LNE7_THEM4/42-132QI...K-S-A---VTS-ED--------IL-F.EIA...............................K.KF..N-------
A9BIG2_PETMO/59-148KA...R-A-I---IGS-EI--------IL-A.EVA...............................L.KL..R-------
Q1CTK8_HELPH/52-142KL...R-A-S---IVS-AH--------GF-T.KLA...............................K.AI..A-------
RNC_BDEBA/44-134KK...R-A-S---IVN-EE--------VL-S.ELA...............................L.EM..G-------
A0YTK7_LYNSP/34-125RL...R-A-A---LVD-EQ--------QL-G.KFA...............................A.QL..G-------
F7UR75_SYNYG/35-125RL...R-S-Q---LVN-QN--------QL-A.YLA...............................R.FL..H-------
Q152U6_SCHPM/172-262KL...R-A-K---FVG-NE--------SA-D.KFA...............................R.LY..G-------
Q14LC1_SPICI/52-142NL...R-S-K---IVR-EG--------TL-A.ELV...............................R.RM..N-------
F8XZF3_STRAG/44-134KL...R-S-M---IVR-EE--------SL-A.GFS...............................R.LC..G-------
B3EKH3_CHLPB/78-168SN...R-A-K---IVN-RK--------SL-A.GFA...............................G.KI..S-------

PF11469

Q8U363_PYRFU/5-122KNLR.R-VDK---HAK-GD--------YAEA-LIA-------------------------------K-AW----------
H3ZKU7_THELN/10-127SYVPPR-TDK---HGR-GD--------IAEA-ILA-------------------------------Y-AW----------
Q5JE89_THEKO/13-131HIIPPR-TDK---HGK-GD--------IAEA-LFA-------------------------------Y-AW----------
A1RX42_THEPD/16-123KLGKPR-..G---IAP-GE--------AMEA-FLA-------------------------------Y-AW----------

PF14622

RM15_SCHPO/67-197...PET--ATQCI.LPL---------------------------------------------------KGPNS.PS----
Q7S1R6_NEUCR/117-265...LLT--VMRWK..PR---------------------------------------------------M.PED.LE----
Q2GMI6_CHAGB/267-400...LPE--VTRWK..PR---------------------------------------------------M.PEH.LE----
A8Q4V0_MALGO/115-263NLCLEK--VMRWHSTVR---------------------------------------------------MDPVSGPQ----
Q4P7G0_USTMA/113-257...LEN--VMRWTPAVS---------------------------------------------------DGQVG.PR----
A5E1N1_LODEL/106-245...LNK--TMFWV..SR---------------------------------------------------DPTAS.FE----
D5X4R4_THIK1/15-139...LGR--FLRL....G---------------------------------------------------EGELQ.SG----
C4Z0E7_EUBE2/19-151...LDT--FIRL....G---------------------------------------------------KGEEL.TG----
RNC_BORA1/16-141...LSP--YLRL.....---------------------------------------------------.GEGE.MK----
RNC_MESFL/16-146...LGK--IIRL.....---------------------------------------------------.GQGE.IK----
RNC_LEIXX/20-149...LGE--YLLL....G---------------------------------------------------RGENQ.SG----
RNC_THELT/22-156...LGR--YMFL....G---------------------------------------------------R..GE.EV----
C8W586_DESAS/21-152...LGY--CLRM.....---------------------------------------------------.GKGE.ER----
E4RLQ9_HALHG/23-154...LGR--YLFL....G---------------------------------------------------KGEEM.TG----
D4LHQ1_9FIRM/18-150...LPE--FILL....G---------------------------------------------------RGEEM.MG----
A4G6R8_HERAR/16-141...LSQ--FLRL.....---------------------------------------------------.GEGE.LK----
A1SLU8_NOCSJ/48-177...VGE--HVKL....G---------------------------------------------------RGEES.TG----
Q2LVR4_SYNAS/22-153...IGS--FILL....G---------------------------------------------------KGEES.SG----
E8NDE2_MICTS/20-149...LGQ--HVRL....G---------------------------------------------------RGEIL.TG----
E4TJ04_CALNY/16-145...LGN--FIRL....G---------------------------------------------------KGELN.SG----
D4J805_9FIRM/20-152...LGK--YLML....G---------------------------------------------------KGEDM.GG----
E8UCB0_TAYEM/16-140...LQD--LIKL.....---------------------------------------------------.GEGE.LK----
E3DQV9_HALPG/23-155...LGQ--YLFL....G---------------------------------------------------KGEEM.TG----
A5WCD8_PSYWF/39-165...LSS--YLILGVGER---------------------------------------------------KGGGR.ER----
D9R047_CLOSW/18-150...LGE--YLLL....G---------------------------------------------------KGEEA.TG----
RNC_PELTS/21-152...LGT--CLYM....G---------------------------------------------------KGEER.SG----
A9KLR1_CLOPH/23-155...LGN--YVFL....G---------------------------------------------------KGEDT.TG----
D0MGH0_RHOM4/39-171...LGA--HVRLS.ENM---------------------------------------------------E...R.AG----
D3PAP4_DEFDS/17-146...LND--FLML.....---------------------------------------------------.GKGE.IV----
F0S2Z0_DESTD/19-149...LGS--YIYLG.KGE---------------------------------------------------H......L----
A5I4N2_CLOBH/24-150...LGF--YLQM....S---------------------------------------------------KGEEL.TG----
RNC_BACV8/34-159...LDK--LIKY.....---------------------------------------------------...TA.RQ----
B6JY03_SCHJY/68-197...LQQ--VIRWKTPKL---------------------------------------------------RASVD.TK----
C4R5N4_PICPG/63-200...FDQ--LVFWK.KRD---------------------------------------------------PTLED.PA----
E6UF22_RUMA7/20-145...LGK--YIFL....G---------------------------------------------------KGEEL.TG----
K7X354_MYCHR/18-142...LSK--YLKV....A---------------------------------------------------KGSEE...----
Q13VM8_BURXL/16-137...ISE--GLRL....G---------------------------------------------------EGELR.SG----
RNC_RALME/17-139...LSD--ALRL....G---------------------------------------------------EGELK.SG----
Q59PD0_CANAL/73-209...INE--IMFWH..TR---------------------------------------------------NSTLG.FE----
RNC_PSESM/18-137...LGE--YLRL....G---------------------------------------------------SGELK.SG----
R5BXA0_9FIRM/20-152...LDN--YLLL....G---------------------------------------------------HGEEN.TG----
R5HQM8_9FIRM/18-148...LGK--YLFL....G---------------------------------------------------KGENL.TG----
R5TZE4_9FIRM/19-150...LGS--YLLL....G---------------------------------------------------KGEEA.TG----
R5X6S0_9CLOT/24-150...LGK--YMLL....G---------------------------------------------------KGEEA.TG----
R6GD49_9FIRM/20-151...LGK--YLLL....S---------------------------------------------------RGEDA.TG----
R6JSS6_9CLOT/18-150...LGQ--YLYL....G---------------------------------------------------KGEDA.TG----
R6LRB3_9FIRM/18-150...LGS--YLLL....G---------------------------------------------------KGEDA.TG----
R6PBG7_9FIRM/22-152...LGD--YLLL....G---------------------------------------------------KGEEA.TG----
R6QQD7_9FIRM/19-150...LGD--YLLL....S---------------------------------------------------KGEDL.TG----
R7AJR0_9BACE/21-152...LQK--YIML....G---------------------------------------------------KGEDA.TG----
R7DB60_9FIRM/14-146...LPQ--YLLL....G---------------------------------------------------KGENM.TG----

PF00636

A3GHW8_PICST/84-184---LGI..FARTNNLNSTMFWKSY............................................NYGVG-FE....
RM15_SCHPO/89-181---WNP..ETATQCILPL..................................................KGPNS-PS....
RM03_SCHPO/83-189---LEV..QRREEGLQESFGKVLAKR..........................................ADPEM-LR....
A2QRC1_ASPNC/121-242---VEP..HEDQTHWRKSITSSVVYDNEFGD.....................................PVKGP-KDPSEQ
Q0UQH0_PHANO/7-117---THK..ITKTDEFGSENAPPSPHA..........................................LANSP-VP....
Q1XG54_CRYJA/71-157---LHD..LIK...........................................................VAP-KI....
Q9FYL8_ARATH/80-167---LGK..IIR...........................................................VST-KT....
A0A023ZEP0_YEASX/153-272---LSR..YLKMEPFEFTLGRLKFFNNS........................................LNSKD-GIELIT
Q4PA03_USTMA/211-325---LAAQNILRWNKQARAPGSGFTQNRGG.......................................RGAAP-RS....
Q0CCZ5_ASPTN/48-132---IQN..TIT.........................................................QNPGQ-WG....
Q0UMM3_PHANO/145-228---LHL..SIL.........................................................TGDGK-GV....
A7I5W5_METB6/51-140---IRR..FVR.........................................................LGRGE-KD....
A3CVM2_METMJ/43-132---LQD..KIL.........................................................VGEGA-RM....
A7I515_METB6/44-134---LHK..FIR.........................................................WGKGE-EK....
A3CRH2_METMJ/50-139---LAD..YVR.........................................................WGKGE-AA....
A5DES0_PICGU/186-275---LSQ..HLKH........................................................NISKE-LS....
A3LPK0_PICST/184-273---LVD..PYKY........................................................NLSSE-ID....
Q6BWD6_DEBHA/187-276---LAD..NYKF........................................................HFSKE-MN....
A4RR17_OSTLU/28-138---EQD..LLTDQELAVLKWGRD.............................................FGHES-RS....
C1MLN8_MICPC/114-224---ADG..TITDDEISILEWGRN.............................................FGHES-RS....
C1FDU3_MICSR/76-186---NGT..MITDDELTILEWGRD.............................................YGHEC-RS....
A9BJB7_PETMO/21-118---VLD..HLTPIEMQYYKRAEN.............................................SNGAK-KR....
D4CVS6_9FUSO/18-116---IIE..ELDEEFKVIGKRAKNSN...........................................IKTFP-KT....
C3WFU5_FUSMR/12-110---IFP..KLEEKFQMLGNRSKNGN...........................................IKTFP-KS....
B9K831_THENN/17-112---LWN..LLTEEEREVVKRAMN.............................................SKAAK-RY....
A5ILI0_THEP1/17-112---IWN..LLGEKEREIVKRAMN.............................................SKAAK-RH....
A6LJ32_THEM4/19-114---ILP..LLTEEEFSYVKRGIN.............................................SKGAG-KY....
A8F7A2_THELT/9-104---LVE..LLSAEEFSLVKRALN.............................................SRAAK-KY....
A8J7A5_CHLRE/55-159---.....VLTPAEADVLRWGRN..AA.........................................VGSIP-KS....
B1C8Q3_9FIRM/18-117---LKD..YFTEEEMKVALRGRNTK...........................................IKHSS-KS....
C1DXY5_MICSR/99-208---ADP..FFTEEELAVVRWGRNGGS..........................................AGNTP-SRLRGK
Q014M6_OSTTA/451-557---DGG..ELSEDEISIVKWGRNAA...........................................YGNIP-TRLKGK
MRNC_KOSOT/20-117---IEK..FLSEEERIIVRRGYN.............................................SRGAR-KR....
B7CDG4_9FIRM/9-110---EED..FFTEDEKTILARGRNAT...........................................IHSKA-KN....
B7G3M0_PHATC/16-116---EDV..ELSEKERQVLSRGRNAV...........................................SGSAR-NR....
A9RYU0_PHYPA/18-120---KGD..FLTDEERDVVRWGKNIETG.........................................QRRAS-RR....
Q94F12_ARATH/98-200---DDD..FLTKEERDILRWGKNLGSA.........................................RTRTR-RR....
C6T3M8_SOYBN/105-207---ESN..FLSDQERDVLRWGKNIVSN.........................................KTKTK-KR....
C0PKE8_MAIZE/108-210---GED..FLTEEERDILRWGRNIVSS.........................................KTRTR-KR....
Q2JI20_SYNJB/24-121---LLP..HLNPEEQEIVRWGRNG............................................CGRPP-RH....
B4WGA4_9SYNE/42-139---LSP..VLTDAEKDIVRRGRNA............................................TTGKS-RR....
Q31LB9_SYNE7/26-123---LLP..LLTAEELEIVRRGRNA............................................AGRVP-RR....
MRNC_THEEB/23-120---LWE..YCTETERSIFRQGRNA............................................AADGP-KR....
F7UR33_SYNYG/28-125---LLP..QLTDPEKEWVRRGRNA............................................ATSTS-RR....
B1XNV1_SYNP2/17-114---LEP..HLSELERDIVRRGRNA............................................ATGKP-RR....
B8HT79_CYAP4/37-134---LRP..HLSNQELNLLRQGRNA............................................ASAGP-KR....
B4VUK6_9CYAN/43-140---LEP..YLTEPELALLRRGRNA............................................ATGTS-RR....
A8YKZ5_MICAE/29-126---LQP..YLTDQEKEILRRGRNA............................................VTGKR-RR....
B7KCP4_CYAP7/45-142---LEP..YLTETEQEIVRQGRNA............................................ATGRP-RR....
D3EMY0_ATETH/29-126---LQP..YLTETEKDIVRRGRNA............................................TNSHP-RR....
B7K2P3_CYAP8/45-142---LKP..YLTDAEREIVRRGRNA............................................ATGKP-RR....
A0ZGL0_NODSP/61-158---LTP..HLSPAELEIVRRGRNA............................................ASGRP-KR....
Q112N8_TRIEI/20-117---LKP..HLTDVELDILKRGRNA............................................AFRKP-KR....
A0YQT6_LYNSP/17-114---LEP..YLSTAELEVVRRGRNA............................................AVKGP-KR....
A8G4M5_PROM2/20-117---IEH..LLNSNEIDLIRRARNK............................................TKRYP-KS....
A9B9W4_PROM4/20-117---INV..FLTDLEKDFVRRGRNR............................................VGRGS-RK....
Q7VCJ3_PROMA/20-117---LDY..YLTDLERKFVRKGRNR............................................VGRGS-RK....
A5GTM3_SYNR3/12-109---LEP..LLNAEELDWVRRGRNA............................................CGRGP-RR....
A2C1X8_PROM1/20-117---LEP..FLTDTEKDFLRKGRNK............................................AGRGP-KN....
B1X410_PAUCH/23-120---LKP..LLEKDELDLIRRGRNR............................................AKRGP-RN....
B5IKV4_9CHRO/2-99---.DP..WLQSSERELVRRARN.R...........................................AGRGP-RG....
Q067M9_9SYNE/20-119---LEQHDLLHDDELDLVRRGRNS............................................AGRGP-RR....
Q7U7F7_SYNPX/20-117---.DP..VLSEQERDLVRRGRN.R...........................................AGRGP-KR....
A3YYC2_9SYNE/20-117---LEP..LLDERERELVRRGRNR............................................AGRGP-RG....
Q0I9N3_SYNS3/20-117---LEP..FLNDQERDYVRRGRNR............................................AGRGP-KR....
A4CU57_SYNPV/21-118---.RP..MLTEFESDLVRRGRN.R...........................................AGRGP-RG....
A3Z7F5_9SYNE/21-118---LDP..LLTDQERDWVRRGRNR............................................AGRGP-RR....
A6GE80_9DELT/16-118---AAG..VLDEAEEAVVRRGRNTAL..........................................RGAGH-RR....
A0A008AQZ0_STAAU/15-116---EQE..WFTDEEMDILKRGRNAK...........................................SHTKA-KN....
C8WTZ3_ALIAD/13-112---LEP..MLTDAERDVIRRGRNQK...........................................SSHTR-RN....
C1KYH3_LISMC/13-114---AEG..FLTEEEDRIAKRGRNAK...........................................SYTVP-KN....
Q8ETZ8_OCEIH/12-114---VDG..FLTEEEQKVVARGRNAK...........................................SGSVP-KN....
J3ENE3_9LACO/31-132---DLK..MLDEAELAAFKRGRNAK...........................................SHTHA-KN....
C9ASB2_ENTFC/15-116---EEH..LLTEEEELYYRRGRNAK...........................................SHTSA-KN....
D1BMT8_VEIPT/47-145---IEN..TFTEDEQAIARRARNS............................................NVNVP-KS....
D3LUV6_9FIRM/36-134---LQS..FLTEAEKSLCRRSRNA............................................YSQVP-KS....
D1VT13_9FIRM/26-124---VLQ..SLSEEELGVYNRGKNSK...........................................PHTVA-KN....
A4XJ79_CALS8/5-105---LYE..RLDENEKIIVKRGRNVK...........................................SKTVP-KN....
A6P055_9FIRM/19-118---IIP..LLTEEEGDVFRRGRNTS...........................................PHSVP-KA....
C9LMK9_9FIRM/35-133---IKE..LLSDRELKVCKRARNT............................................HSTVP-KS....
B0MM93_9FIRM/17-116---IAD..ELTEEETEIFKRGRNAT...........................................GNNVP-RS....
D4LDD2_RUMC1/15-114---ILP..MLTEQEQTVLRRGRNAT...........................................GNTVP-KH....
E6U8V4_ETHHY/21-120---LLP..LLDEAEIAVLRRGRNAN...........................................TAHVA-KH....
B0TC36_HELMI/34-133---IEP..FLDDEEKEWVRRGRNAD...........................................SGRSP-RS....
MRNC_SYMTH/12-111---LMP..ALTEQEQDVVRRGRNAK...........................................GHGAP-KS....
Q0AUF9_SYNWW/16-114---ILD..HLSEEEQDIVRRGRNS............................................RSTPP-RH....
A5D5M2_PELTS/19-118---LEG..ILTEEEAEVVRRGRNAR...........................................SPHAP-RG....
MRNC_MOOTA/10-109---LEE..YLTPAEKDILRRGRNAR...........................................PGHLP-RT....
D4KFD3_9FIRM/37-135---IKD..DLTEDEAYVFKRGKNA............................................KSHAP-RV....
C9LVQ2_SELS3/37-135---IEE..RLTERERGIFRRGRNA............................................KSHAP-RR....
C4V0H2_9FIRM/37-135---IAD..MLTEEEQTIYRRARNT............................................KSHAP-RS....
A5KKA6_9FIRM/30-129---IQE..HLTEEEHAVYRRGRNTR...........................................SVSAA-KN....
C5ENC6_9FIRM/5-104---IED..LLTEEEHAVYKRGRNAK...........................................SVTTA-KN....
B1RJ47_CLOPF/20-120---LEG..ELKEDELYIYKRGRNAK...........................................SATVP-KN....
A3DH39_CLOTH/26-125---IMP..LLTEEELNIVRRGRNAK...........................................SATVP-KN....
A6TWK4_ALKMQ/25-124---LEA..ELSEEEWRVIKKGRNQK...........................................PATVP-KN....
A8MLB8_ALKOO/26-125---LES..ELSEPEWTIVKRGRNQK...........................................SATVP-KN....
C0WE29_9FIRM/32-129---IEP..QLTEAEAVVVRRGRNT............................................KSTVP-KS....
C0GIM8_9FIRM/8-106---IEP..LLSEEEAEIVRRGRNT............................................KSRVP-KN....
A2QMS9_ASPNC/124-236---MQR..VVRW........................................................CPRKP-NN....
Q0TYG8_PHANO/64-174---LAQ..IAERYGLDKVTRWTP.............................................KRADN-LQ....
RM44_PONAB/123-207---VEQ..LTL.............................................................S-EE....
Q6BCK1_TETTH/1224-1338---LDQ..YFIYGIQYQQIFQKINHAAN........................................LKRQQ-NI....
A3CW87_METMJ/121-210---LYE..HRIHFDPD....................................................TPRST-RK....
I7MKB8_TETTS/752-862---LQF..YVQTKRPSSYDWRFNLFNLNSFT.....................................EAPQD-QK....
A3LUF0_PICST/251-366---LHK..GLDDAIIAYRLESDYLLN..........................................LHTGN-LH....
Q5GAH0_9VIRU/44-137---FWQ..HVKKPTD.....................................................TVITP-TS....
Q4KS72_ISKNV/58-156---FLK..WVVAHR......................................................DGAAP-AS....
A2F201_TRIVA/593-691---LID..LLSIVRKENSSED...............................................AAKGD-ID....
B0Y3J2_ASPFC/35-122---LDA..FAA.........................................................PGPSQ-SQ....
E7NKX5_YEASO/105-208---LDP..FIFWKMRDPIKDGH...................................................-......
Q6FVA4_CANGA/96-187---LEP..LVFWKVSDP...................................................LNDGP-IK....
Q6T445_LEIMA/391-483---LWH..LLS.........................................................TTAHS-RL....
Q9DSW1_9VIRU/45-139---LDK..LVR.........................................................MTREE-SL....
DCL22_ASPNC/1111-1258---LWD..FLRLHSDALSTELSDF............................................VQKSS-EK....
Q2U0L3_ASPOR/1051-1198---LYH..FLRSQSDSLSDKVSSLVEDLTSQLH...................................VIKRD-LW....
Q0E579_SFAVA/192-324---LNK..FIRCQYAGVDGRKLQVYGHRFKRNNASGVQCQPKVCADS.....................VYTDT-TS....
A0DYG6_PARTE/384-498---LFH..YVRSLGHQTKWFSPVLQNIHSNH.....................................IQPEP-IK....
Q3SE73_PARTE/363-464---LNA..MNFKINSKKLLNHMMM............................................IINEH-ED....
Q57XF2_TRYB2/735-814---LSE..ELS.........................................................RVYDE-VH....
A7SJH8_NEMVE/129-224---ALP..ELIRTKHDLDS.................................................LKKEK-HV....
Q2Q3V3_DROSI/1205-1377---IPK..KLNTILFTPRYTWVPPSISLPHNVLALWREKPGFANMIGPHNLRDLA.............LDDEE-SL....
Q6BCJ9_TETTH/1328-1487---IFK..YILSSKIETLSPIGIKYEIAVDDDEQNQFQKEKEPDEYDKADQRNK..............NKKGN-EE....
DCL_GIAIC/333-418---LPQ..............................................................LAEFS-NN....
Q7Q073_ANOGA/1215-1375---LPG..KIKAHPFDPKNDWVPPLSTVPGAVRRAMVD..............................ANESP-ALLYNL
Q3SE71_PARTE/360-463---LQH..YIINQDLHFKQIRNP.............................................LVNDM-IS....
DCL_GIAIC/646-734---FPS..VVSEV.......................................................IIESH-PK....
DCL2_PHANO/1130-1270---IWQ..FLRSGSPSLNANRDNALRQHEQVRDEIIIG..............................LNEAA-RFPWHL
A7EYF3_SCLS1/1216-1363---LVN..FLRH...SSATFSIYQKQ....A.....................................LARHQ-EL....
DCL2_EMENI/1092-1250---LYS..YLRYSPSRPLPLHVEPESGSSNA.....................................LTRHN-LL....
DCL2_NEOFI/1134-1281---LWR..FMRYRGQNLNAARDASLARHRALRDEIASS..............................LLHAP-HYPWHA
A1CZL8_NEOFI/163-252---LDG..RASVPQD.....................................................LLNQP-RR....
Q0UFS5_PHANO/190-279---FPD..QLKR........................................................KVEFD-KN....
Q110R1_TRIEI/53-143---LRQ..FSQ.........................................................LGKSY-KW....
Q55FS1_DICDI/1250-1335---LPP..............................................................TVSKG-IR....
A2XBW0_ORYSI/1353-1498---LQS..YIQADRFAPSRWAAPGVLPVFDEESREYEPSIFDEESTGCELQKESYDDYADNMQEDGEIEGDSS-CY....
Q80UU5_MOUSE/475-564---MQE..YAIT........................................................NDKTK-RP....
RNC_CAEEL/870-957---FTE..FVIKA.......................................................PYKTP-EL....
DCL2_NEUCR/998-1107---LDE..YIINSAASKKWRPKFVEDYMD.......................................EMKSP-IS....
DCL2_PHANO/947-1054---LDR..FMITKSFTGAKWAPRYAGDLL.......................................AETGP-AV....
DCL2_ASPCL/955-1060---LDA..FVITKMFTPRKWSAPLISER........................................LERVA-GK....
A6R2T0_AJECN/946-1054---LDK..FILLDVFTGAKWRPPYNKDHLES.....................................EEQGV-AQ....
Q3SE73_PARTE/554-687---FHQ..YARNLPKEIQNSIKKALA..........................................LLRQD-QF....
I7MKB8_TETTS/1048-1163---ISK..YQQDEIIQFIEDCNLNTK..........................................FKESV-SH....
Q3SE70_PARTE/522-610---LKP..Q...........................................................VNEIP-KL....
A5Z824_9FIRM/49-157---LAP..FLI.........................................................MSKGD-LK....
Q5KKA7_CRYNJ/521-644---LVK..YVRNKKFKVKEWTPRDWELDLLPGQFAP................................KKTMP-TS....
RTL3_ARATH/445-551---IYQ..SFIGSVPKPEKMTTDFIELMG.......................................KEDDP-YR....
RTL3_ORYSJ/76-183---LHH..FLRHKAPNLDGQITDFIEE.........................................LSMYP-IH....
RTL2_ARATH/93-203---LYS..FLRRNAPSLDEKVKEFSEA.........................................VGKED-DLSVSY
RTL1_ORYSJ/62-168---LYP..LLRRYNCAPQDHEVSRFTK.........................................SVEGP-YS....
Q2Q3U9_DROSI/1464-1620---ISK..FVNFQESQGHRVTNYVHILLEEADVQPTPLDLDDELELPHANKCISQEAE..........QGVPP-KGEFNM
A7SIA4_NEMVE/44-167---FHK..HMRSMSMALFKVVRRFVRRLSEIEE...................................KETRP-DQLLLT
A7SKX2_NEMVE/37-156---FNK..SLFQMSPEWFNKIGVFVDHVKEREARGIQDPFLT..........................LSNDD-EE....
Q4SZJ7_TETNG/259-381---YHK..YFKAISPELFHVIDDFVQFQLEKNEMQG................................MDSEL-RRSEED
A7IYQ4_PHYPA/1379-1492---IRN..FVNDIHSELDKPGVNS............................................FGLGD-FK....
DCL4_ARATH/1327-1436---LKR..FLFCESIYLHEVIEDYTNFLASSP....................................LASGQ-SE....
DCL4_ORYSJ/1249-1358---IHK..HLIKDSNHLTSAISKFEMYVK.......................................LSNSE-KD....
DCR1_SCHPO/930-1038---LPK..YALSTPLEIRHWCPYGFQ............................................KST-SD....
DCL1_ASPNC/1080-1192---IYK..YIRSRGFSRHTWYPEGLKLL........................................QGKDH-SR....
Q4PCH5_USTMA/903-1023---LAA....RRDELCRELRGQHGHDDDASTTQKQA................................CRKCT-RTRQTD
A3Z4A6_9SYNE/40-129---IAR..WWQ.........................................................IGAMA-SG....
Q4C1B8_CROWT/48-137---LDR..YLL.........................................................MIDSV-AQ....
Q31MP4_SYNE7/55-144---LER..VLR.........................................................VGKTA-AN....
DCL2A_ORYSJ/1006-1124---LVG..YIHAEEFNPRD.WIIPCL............................................DYD-ER....
DICER_DANRE/1295-1551---LPS..RMVVSIFDPPVNWLPPGYVVNQDKSSTDKWDSDENKDLANGK..................ASDDE-DE....
DCR1_CAEEL/1413-1589---IPQ..LIVANKFDAHDSWLPPCY..............IPTCDFKAPN..................TDDAE-EK....
Q27IU0_DROSI/1685-1862---LGE..YMIATKFEPHDNWLPPCYYVPKELEKALIEAKIPTHHWKLADLLDIKNLSSVQICE....MVREK-ADALGL
Q3SD86_PARTE/1582-1697---LDQ..FLLHPTLHKVAHENHQT...........................................LNKIK-QM....
A2F201_TRIVA/412-500---LKS..LL..........................................................CTSTP-TN....
Q3SD86_PARTE/1325-1459---PPE..FLLDKNTQELSEIQPEKQKENKE.....................................NTKYQ-YT....
DCR1_SCHPO/1120-1233---LHK..YIQ.....HESAAMCDAIFEYQE.....................................LIEAF-RE....
E3W000_MIMIV/351-441---ISS..YLL.........................................................ISQNI-EV....
DCL1_ASPFU/1291-1405---FHR..RIMAFSNPLQAQITHYVEE.........................................IETAQ-AE....
Q0E5R5_MUCCI/1080-1190---LYE..YICSQNLPRRFYRPPNYLCKDDS.....................................AEMIK-SL....
RNC_MYCMO/47-135---LSK..LLL.........................................................ISKGS-EH....
Q6CC90_YARLI/191-332---ADA..NMWLVKYTFPGGYAAEYEKWYKS.....................................LEVKP-KI....
A2RV16_DANRE/886-976---LDR..FML.........................................................YAHGP-DL....
Q95ZG5_DICDI/926-1010---FDY..ILR.........................................................ITTIG-DH....
Q6FQ28_CANGA/457-550---LQK..HLLIRKSILNEM................................................LNSGS-KV....
Q64AH3_9ARCH/53-141---LRN..YIR...........................................................ANE-KR....
RNC_MYCGH/469-556---LIN..YIR.........................................................VGEGL-KI....
A0A024FAP5_UREPR/43-140---LTD..FLM.........................................................IGVGL-EQ....
Q8EW40_MYCPE/52-139---LLD..YAF.........................................................IGKGI-NL....
Q1UZA6_PELUQ/38-127---LEK..YI..........................................................LVLNP-KN....
RNC_AQUAE/37-121---LHK..FIR.........................................................IKRGK-IN....
E3W000_MIMIV/65-149---LNN..FVQ..............................................................-.I....
A4VD87_TETTS/1750-1863---FYK..FIIGSIQHNKEEIELLLNNVEMF.....................................MGDTS-LM....
A3CSF0_METMJ/81-165---LGI..............................................................DGAVR-RR....
Q4A7X2_MYCH7/44-131---LMN..YVL.........................................................LGRGA-SE....
A5IYM8_MYCAP/40-130---LKD..FLV.........................................................LSSNV-VA....
A4GK15_9BACT/37-125---LDS..FIV...........................................................KGD-SL....
A5CEW8_ORITB/60-150---LHK..YII.........................................................MTANE-EK....
RNC_WOLTR/54-144---LGN..FII.........................................................MNNSE-RC....
RNC_MYCCT/40-130---LGQ..LIR.........................................................LGHGE-LM....
RNC_MYCPB/56-141---FGN..FIK.........................................................LGKGM-PY....
A4GHU1_9BACT/34-120---LSN..HIK.........................................................LGKGE-SL....
RNC_BRADU/60-150---LLD..DIK.........................................................LGSVG-PS....
A6DUU1_9RHOB/42-132---LGG..VLK.........................................................LGRSE-ML....
A5FV46_ACICJ/38-128---IAG..LLS.........................................................VSPGE-SR....
A5V2R4_SPHWW/51-141---VAT..HMK.........................................................LGKQA-RD....
RNC_RHIEC/47-137---LHL..YIR.........................................................TGADV-KK....
RNC_SPHAL/39-129---LPA..LIR.........................................................FGAQA-RS....
Q0F3I4_9PROT/44-134---LSA..CLI.........................................................VGDGE-RG....
M1GI47_LAWIN/41-131---LNQ..YLL.........................................................LARGE-EN....
A6GP51_9BURK/26-116---LDQ..YLF.........................................................LGAGE-LR....
RNC_MYXXD/55-145---LGD..LLL.........................................................LGRGE-LM....
A1R7I4_ARTAT/40-130---VGE..FIY.........................................................LGQGE-KL....
A7A3Q3_BIFAD/75-166---VGP..YIL.........................................................LGHGE-AE....
Q1IJU6_KORVE/51-141---LGK..FLR.........................................................LGRGE-ER....
D2BI67_DEHMV/54-144---LGN..YLY.........................................................LGRGE-DV....
A9B5J8_HERA2/42-132---LGS..YVQ.........................................................ISRGE-ER....
A4MZ45_HAEIF/36-126---LGD..YMS.........................................................LGSGE-LK....
RNC_MYCS5/49-139---VEQ..IIK.........................................................TGPKK-AR....
A5UJK3_METS3/37-127---LDK..HIK.........................................................IYGDD-SK....
Q83VA6_9MOLU/41-129---LKK..YIY.........................................................LGKGE-KK....
RNC_RHOBA/69-158---LDQ..CLI.........................................................VGRGV-TR....
A3LS79_PICST/241-330---FDK..RLKT........................................................KTDEE-IL....
A4E6T0_9ACTN/44-134---IDD..III.........................................................FGASE-TG....
A7K823_9PHYC/78-168---LHE..FII.........................................................MSQKG-LY....
A0A015Q692_BACFG/59-145---LDK..LIKY........................................................STRSS-SH....
RNC_CHLPN/45-135---IGD..YLL.........................................................IGKGE-KI....
A4BWV8_9FLAO/58-144---LIR..FVK.........................................................SNIDQ-AN....
A3EQH6_9BACT/58-148---LGS..YMI.........................................................LGKGS-HS....
K6KAV8_LEPBO/59-149---LGE..YLL.........................................................LGKGE-KN....
A6LNE7_THEM4/42-132---LGK..YIL.........................................................LGKGE-RR....
A9BIG2_PETMO/59-148---LDD..FIF.........................................................LSKGE-DK....
Q1CTK8_HELPH/52-142---LQD..YLR.........................................................VSSSE-EI....
RNC_BDEBA/44-134---LNK..LMQ.........................................................LGKGE-AL....
A0YTK7_LYNSP/34-125---IGE..IMR.........................................................LGKGA-IK....
F7UR75_SYNYG/35-125---IAP..EIR.........................................................LSQSL-AR....
Q152U6_SCHPM/172-262---FDK..TLV.........................................................LSYSA-EK....
Q14LC1_SPICI/52-142---WAP..FLL.........................................................LGKGE-IK....
F8XZF3_STRAG/44-134---FDH..YIK.........................................................LGKGE-EK....
B3EKH3_CHLPB/78-168---LGE..HLL.........................................................IGETA-DK....

PF11469

Q8U363_PYRFU/5-122---LMG--LISEREAVEIIKKN----------------------------------------------LTPEV-LD----
H3ZKU7_THELN/10-127---LER--KITIEEAVSILKRN----------------------------------------------FTPDV-LH----
Q5JE89_THEKO/13-131---LEK--KITIEEAVEILSQN----------------------------------------------LDDDV-TH----
A1RX42_THEPD/16-123---LKG--SLSCEESVEMLYTG----------------------------------------------L....-..----

PF14622

RM15_SCHPO/67-197--SSS---------------------------------------------------------------------------
Q7S1R6_NEUCR/117-265--SSG---------------------------------------------------------------------------
Q2GMI6_CHAGB/267-400--GSG---------------------------------------------------------------------------
A8Q4V0_MALGO/115-263--ESG---------------------------------------------------------------------------
Q4P7G0_USTMA/113-257--ETG---------------------------------------------------------------------------
A5E1N1_LODEL/106-245--ASG---------------------------------------------------------------------------
D5X4R4_THIK1/15-139--GAQ---------------------------------------------------------------------------
C4Z0E7_EUBE2/19-151--GRS---------------------------------------------------------------------------
RNC_BORA1/16-141--SGG---------------------------------------------------------------------------
RNC_MESFL/16-146--SKG---------------------------------------------------------------------------
RNC_LEIXX/20-149--GRE---------------------------------------------------------------------------
RNC_THELT/22-156--SSG---------------------------------------------------------------------------
C8W586_DESAS/21-152--SGG---------------------------------------------------------------------------
E4RLQ9_HALHG/23-154--GRE---------------------------------------------------------------------------
D4LHQ1_9FIRM/18-150--GRK---------------------------------------------------------------------------
A4G6R8_HERAR/16-141--SGG---------------------------------------------------------------------------
A1SLU8_NOCSJ/48-177--GRH---------------------------------------------------------------------------
Q2LVR4_SYNAS/22-153--GRS---------------------------------------------------------------------------
E8NDE2_MICTS/20-149--GHD---------------------------------------------------------------------------
E4TJ04_CALNY/16-145--GKD---------------------------------------------------------------------------
D4J805_9FIRM/20-152--GRN---------------------------------------------------------------------------
E8UCB0_TAYEM/16-140--SGG---------------------------------------------------------------------------
E3DQV9_HALPG/23-155--GRE---------------------------------------------------------------------------
A5WCD8_PSYWF/39-165--AS.---------------------------------------------------------------------------
D9R047_CLOSW/18-150--GRG---------------------------------------------------------------------------
RNC_PELTS/21-152--GRD---------------------------------------------------------------------------
A9KLR1_CLOPH/23-155--GRD---------------------------------------------------------------------------
D0MGH0_RHOM4/39-171--GRD---------------------------------------------------------------------------
D3PAP4_DEFDS/17-146--SGG---------------------------------------------------------------------------
F0S2Z0_DESTD/19-149--SGG---------------------------------------------------------------------------
A5I4N2_CLOBH/24-150--GRE---------------------------------------------------------------------------
RNC_BACV8/34-159--SSH---------------------------------------------------------------------------
B6JY03_SCHJY/68-197--QSG---------------------------------------------------------------------------
C4R5N4_PICPG/63-200--TSG---------------------------------------------------------------------------
E6UF22_RUMA7/20-145--GRE---------------------------------------------------------------------------
K7X354_MYCHR/18-142--ILN---------------------------------------------------------------------------
Q13VM8_BURXL/16-137--GFR---------------------------------------------------------------------------
RNC_RALME/17-139--GFR---------------------------------------------------------------------------
Q59PD0_CANAL/73-209--SSG---------------------------------------------------------------------------
RNC_PSESM/18-137--GFR---------------------------------------------------------------------------
R5BXA0_9FIRM/20-152--GRK---------------------------------------------------------------------------
R5HQM8_9FIRM/18-148--GRN---------------------------------------------------------------------------
R5TZE4_9FIRM/19-150--GRQ---------------------------------------------------------------------------
R5X6S0_9CLOT/24-150--GRE---------------------------------------------------------------------------
R6GD49_9FIRM/20-151--GRE---------------------------------------------------------------------------
R6JSS6_9CLOT/18-150--GRN---------------------------------------------------------------------------
R6LRB3_9FIRM/18-150--GRF---------------------------------------------------------------------------
R6PBG7_9FIRM/22-152--GRN---------------------------------------------------------------------------
R6QQD7_9FIRM/19-150--GRE---------------------------------------------------------------------------
R7AJR0_9BACE/21-152--GRQ---------------------------------------------------------------------------
R7DB60_9FIRM/14-146--GRN---------------------------------------------------------------------------

PF00636

A3GHW8_PICST/84-184..TSG...........................................................................
RM15_SCHPO/89-181..SSS...........................................................................
RM03_SCHPO/83-189..KPG...........................................................................
A2QRC1_ASPNC/121-242SKQDV...........................................................................
Q0UQH0_PHANO/7-117................................................................................
Q1XG54_CRYJA/71-157..NPK...........................................................................
Q9FYL8_ARATH/80-167..DAS...........................................................................
A0A023ZEP0_YEASX/153-272GKNFS...........................................................................
Q4PA03_USTMA/211-325..TNS...........................................................................
Q0CCZ5_ASPTN/48-132..VVA...........................................................................
Q0UMM3_PHANO/145-228................................................................................
A7I5W5_METB6/51-140..LWK...........................................................................
A3CVM2_METMJ/43-132QKHNE...........................................................................
A7I515_METB6/44-134..NKV...........................................................................
A3CRH2_METMJ/50-139..QRV...........................................................................
A5DES0_PICGU/186-275..NEG...........................................................................
A3LPK0_PICST/184-273..SNR...........................................................................
Q6BWD6_DEBHA/187-276..LDD...........................................................................
A4RR17_OSTLU/28-138.GHKG...........................................................................
C1MLN8_MICPC/114-224.GHKT...........................................................................
C1FDU3_MICSR/76-186.RHNK...........................................................................
A9BJB7_PETMO/21-118..GND...........................................................................
D4CVS6_9FUSO/18-116..CTV...........................................................................
C3WFU5_FUSMR/12-110..CSV...........................................................................
B9K831_THENN/17-112..GND...........................................................................
A5ILI0_THEP1/17-112..GND...........................................................................
A6LJ32_THEM4/19-114..GND...........................................................................
A8F7A2_THELT/9-104..GND...........................................................................
A8J7A5_CHLRE/55-159..VSA...........................................................................
B1C8Q3_9FIRM/18-117..VNI...........................................................................
C1DXY5_MICSR/99-208NKGGF...........................................................................
Q014M6_OSTTA/451-557GKGGH...........................................................................
MRNC_KOSOT/20-117..GDD...........................................................................
B7CDG4_9FIRM/9-110..ATH...........................................................................
B7G3M0_PHATC/16-116..RDP...........................................................................
A9RYU0_PHYPA/18-120..AGS...........................................................................
Q94F12_ARATH/98-200..AGN...........................................................................
C6T3M8_SOYBN/105-207..AGA...........................................................................
C0PKE8_MAIZE/108-210..AGI...........................................................................
Q2JI20_SYNJB/24-121..LPL...........................................................................
B4WGA4_9SYNE/42-139..ARG...........................................................................
Q31LB9_SYNE7/26-123..LTA...........................................................................
MRNC_THEEB/23-120..VAA...........................................................................
F7UR33_SYNYG/28-125..ANP...........................................................................
B1XNV1_SYNP2/17-114..LSL...........................................................................
B8HT79_CYAP4/37-134..VDP...........................................................................
B4VUK6_9CYAN/43-140..LNR...........................................................................
A8YKZ5_MICAE/29-126..LTA...........................................................................
B7KCP4_CYAP7/45-142..LSP...........................................................................
D3EMY0_ATETH/29-126..LKP...........................................................................
B7K2P3_CYAP8/45-142..LSP...........................................................................
A0ZGL0_NODSP/61-158..VDP...........................................................................
Q112N8_TRIEI/20-117..LDP...........................................................................
A0YQT6_LYNSP/17-114..IDQ...........................................................................
A8G4M5_PROM2/20-117..SNP...........................................................................
A9B9W4_PROM4/20-117..VEI...........................................................................
Q7VCJ3_PROMA/20-117..VNI...........................................................................
A5GTM3_SYNR3/12-109..GDP...........................................................................
A2C1X8_PROM1/20-117..VDA...........................................................................
B1X410_PAUCH/23-120..IDP...........................................................................
B5IKV4_9CHRO/2-99..GDP...........................................................................
Q067M9_9SYNE/20-119..ADA...........................................................................
Q7U7F7_SYNPX/20-117..SDA...........................................................................
A3YYC2_9SYNE/20-117..GDP...........................................................................
Q0I9N3_SYNS3/20-117..ADA...........................................................................
A4CU57_SYNPV/21-118..GDP...........................................................................
A3Z7F5_9SYNE/21-118..GEA...........................................................................
A6GE80_9DELT/16-118..GTV...........................................................................
A0A008AQZ0_STAAU/15-116..TDV...........................................................................
C8WTZ3_ALIAD/13-112..VDV...........................................................................
C1KYH3_LISMC/13-114..TDP...........................................................................
Q8ETZ8_OCEIH/12-114..ISV...........................................................................
J3ENE3_9LACO/31-132..TSI...........................................................................
C9ASB2_ENTFC/15-116..ADV...........................................................................
D1BMT8_VEIPT/47-145..STV...........................................................................
D3LUV6_9FIRM/36-134..ASA...........................................................................
D1VT13_9FIRM/26-124..QTL...........................................................................
A4XJ79_CALS8/5-105..AKL...........................................................................
A6P055_9FIRM/19-118..ASR...........................................................................
C9LMK9_9FIRM/35-133..ATV...........................................................................
B0MM93_9FIRM/17-116..SNP...........................................................................
D4LDD2_RUMC1/15-114..ADV...........................................................................
E6U8V4_ETHHY/21-120..ADP...........................................................................
B0TC36_HELMI/34-133..TDV...........................................................................
MRNC_SYMTH/12-111..ADP...........................................................................
Q0AUF9_SYNWW/16-114..AEV...........................................................................
A5D5M2_PELTS/19-118..AGV...........................................................................
MRNC_MOOTA/10-109..AAP...........................................................................
D4KFD3_9FIRM/37-135..ASV...........................................................................
C9LVQ2_SELS3/37-135..ASV...........................................................................
C4V0H2_9FIRM/37-135..ASV...........................................................................
A5KKA6_9FIRM/30-129..QSI...........................................................................
C5ENC6_9FIRM/5-104..ASV...........................................................................
B1RJ47_CLOPF/20-120..ANV...........................................................................
A3DH39_CLOTH/26-125..ADI...........................................................................
A6TWK4_ALKMQ/25-124..ADL...........................................................................
A8MLB8_ALKOO/26-125..ADL...........................................................................
C0WE29_9FIRM/32-129..ATV...........................................................................
C0GIM8_9FIRM/8-106..ADM...........................................................................
A2QMS9_ASPNC/124-236LESSG...........................................................................
Q0TYG8_PHANO/64-174..GSG...........................................................................
RM44_PONAB/123-207..FPV...........................................................................
Q6BCK1_TETTH/1224-1338..QSF.....................................................................RNIATN
A3CW87_METMJ/121-210................................................................................
I7MKB8_TETTS/752-862..QSF...........................................................................
A3LUF0_PICST/251-366..PDM.....................................................................DANETR
Q5GAH0_9VIRU/44-137................................................................................
Q4KS72_ISKNV/58-156..YKE...........................................................................
A2F201_TRIVA/593-691..ESR...........................................................................
B0Y3J2_ASPFC/35-122..RAT.....................................................................L.....
E7NKX5_YEASO/105-208..ING...........................................................................
Q6FVA4_CANGA/96-187....G...........................................................................
Q6T445_LEIMA/391-483..GSG...........................................................................
Q9DSW1_9VIRU/45-139..DKT...........................................................................
DCL22_ASPNC/1111-1258..ADA...........................................................................
Q2U0L3_ASPOR/1051-1198..ENG...........................................................................
Q0E579_SFAVA/192-324..THI...........................................................................
A0DYG6_PARTE/384-498..QVS...........................................................................
Q3SE73_PARTE/363-464..SKL...........................................................................
Q57XF2_TRYB2/735-814..YKV...........................................................................
A7SJH8_NEMVE/129-224..EVT...........................................................................
Q2Q3V3_DROSI/1205-1377..VKG.....................................................................NCSDIK
Q6BCJ9_TETTH/1328-1487..DGD.....................................................................AENEEI
DCL_GIAIC/333-418..LVA...........................................................................
Q7Q073_ANOGA/1215-1375KLTEE...........................................................................
Q3SE71_PARTE/360-463..SDN...........................................................................
DCL_GIAIC/646-734..IQP...........................................................................
DCL2_PHANO/1130-1270FALTD...........................................................................
A7EYF3_SCLS1/1216-1363..REE...........................................................................
DCL2_EMENI/1092-1250..CPS...........................................................................
DCL2_NEOFI/1134-1281LSRLN...........................................................................
A1CZL8_NEOFI/163-252................................................................................
Q0UFS5_PHANO/190-279..SKA...........................................................................
Q110R1_TRIEI/53-143KHKSE...........................................................................
Q55FS1_DICDI/1250-1335..DTL...........................................................................
A2XBW0_ORYSI/1353-1498..RVL...........................................................................
Q80UU5_MOUSE/475-564..VAL...........................................................................
RNC_CAEEL/870-957................................................................................
DCL2_NEUCR/998-1107..AET...........................................................................
DCL2_PHANO/947-1054..KEE...........................................................................
DCL2_ASPCL/955-1060..RQV...........................................................................
A6R2T0_AJECN/946-1054..REM...........................................................................
Q3SE73_PARTE/554-687..TDF...........................................................................
I7MKB8_TETTS/1048-1163..QAN...........................................................................
Q3SE70_PARTE/522-610................................................................................
A5Z824_9FIRM/49-157..NNI...........................................................................
Q5KKA7_CRYNJ/521-644..FDG...........................................................................
RTL3_ARATH/445-551..VVK...........................................................................
RTL3_ORYSJ/76-183..SNG.....................................................................LLD...
RTL2_ARATH/93-203GGLVK...........................................................................
RTL1_ORYSJ/62-168..GDP...........................................................................
Q2Q3U9_DROSI/1464-1620STNVD...........................................................................
A7SIA4_NEMVE/44-167TVEDG...........................................................................
A7SKX2_NEMVE/37-156..GIE...........................................................................
Q4SZJ7_TETNG/259-381EEKEE...........................................................................
A7IYQ4_PHYPA/1379-1492................................................................................
DCL4_ARATH/1327-1436..GPR...........................................................................
DCL4_ORYSJ/1249-1358..LLE...........................................................................
DCR1_SCHPO/930-1038..KCR...........................................................................
DCL1_ASPNC/1080-1192..KAT...........................................................................
Q4PCH5_USTMA/903-1023EEMAQ...........................................................................
A3Z4A6_9SYNE/40-129..DVA...........................................................................
Q4C1B8_CROWT/48-137..DKI...........................................................................
Q31MP4_SYNE7/55-144..DRA...........................................................................
DCL2A_ORYSJ/1006-1124..DNK...........................................KISFLAPNGMYSQRK.................
DICER_DANRE/1295-1551..DDDDEPEEAEVEPSKEDVNVEDDLEYYYEHIRFIDSMLIGSGAFGKKISLQPTDPGYEWKAPKKAHNSHFSPDGGADE
DCR1_CAEEL/1413-1589..DNE..............................IERILDG......QVIEEKPENKTGWDI...........GGDVSK
Q27IU0_DROSI/1685-1862EQNGG...........................................................................
Q3SD86_PARTE/1582-1697..YNE.....................................................................YYDDIS
A2F201_TRIVA/412-500..YDL...........................................................................
Q3SD86_PARTE/1325-1459..QNG.....................................................................EVITEL
DCR1_SCHPO/1120-1233..TAS.....................................................................ENPWFW
E3W000_MIMIV/351-441..LHG...........................................................................
DCL1_ASPFU/1291-1405..SQG.....................................................................AVDYWV
Q0E5R5_MUCCI/1080-1190..TYH...........................................................................
RNC_MYCMO/47-135..LRE...........................................................................
Q6CC90_YARLI/191-332..DEA...........................................................................
A2RV16_DANRE/886-976..CRE...........................................................................
Q95ZG5_DICDI/926-1010..SKP...........................................................................
Q6FQ28_CANGA/457-550..YKI...........................................................................
Q64AH3_9ARCH/53-141..EDI...........................................................................
RNC_MYCGH/469-556..APL...........................................................................
A0A024FAP5_UREPR/43-140..DQS...........................................................................
Q8EW40_MYCPE/52-139..END...........................................................................
Q1UZA6_PELUQ/38-127..KKI...........................................................................
RNC_AQUAE/37-121..ETI...........................................................................
E3W000_MIMIV/65-149..YGI...........................................................................
A4VD87_TETTS/1750-1863..YDT...........................................................................
A3CSF0_METMJ/81-165..GQP...........................................................................
Q4A7X2_MYCH7/44-131..IRE...........................................................................
A5IYM8_MYCAP/40-130..TEV...........................................................................
A4GK15_9BACT/37-125..AGQ...........................................................................
A5CEW8_ORITB/60-150..CGG...........................................................................
RNC_WOLTR/54-144..NGG...........................................................................
RNC_MYCCT/40-130..TKG...........................................................................
RNC_MYCPB/56-141................................................................................
A4GHU1_9BACT/34-120..QGN...........................................................................
RNC_BRADU/60-150..ADA...........................................................................
A6DUU1_9RHOB/42-132..SGG...........................................................................
A5FV46_ACICJ/38-128..RGV...........................................................................
A5V2R4_SPHWW/51-141..DGA...........................................................................
RNC_RHIEC/47-137..LTG...........................................................................
RNC_SPHAL/39-129..DGG...........................................................................
Q0F3I4_9PROT/44-134..EYG...........................................................................
M1GI47_LAWIN/41-131..QGG...........................................................................
A6GP51_9BURK/26-116..SAK...........................................................................
RNC_MYXXD/55-145..SGG...........................................................................
A1R7I4_ARTAT/40-130..TDG...........................................................................
A7A3Q3_BIFAD/75-166..QGG...........................................................................
Q1IJU6_KORVE/51-141..SGG...........................................................................
D2BI67_DEHMV/54-144..SKG...........................................................................
A9B5J8_HERA2/42-132..AKA...........................................................................
A4MZ45_HAEIF/36-126..NGG...........................................................................
RNC_MYCS5/49-139..NEV...........................................................................
A5UJK3_METS3/37-127..ITE...........................................................................
Q83VA6_9MOLU/41-129..RSV...........................................................................
RNC_RHOBA/69-158..NRS...........................................................................
A3LS79_PICST/241-330..KTG...........................................................................
A4E6T0_9ACTN/44-134..TGA...........................................................................
A7K823_9PHYC/78-168..RCW...........................................................................
A0A015Q692_BACFG/59-145................................................................................
RNC_CHLPN/45-135..QSE...........................................................................
A4BWV8_9FLAO/58-144..VGD...........................................................................
A3EQH6_9BACT/58-148..SGD...........................................................................
K6KAV8_LEPBO/59-149..SQG...........................................................................
A6LNE7_THEM4/42-132..SRG...........................................................................
A9BIG2_PETMO/59-148..QGG...........................................................................
Q1CTK8_HELPH/52-142..SNG...........................................................................
RNC_BDEBA/44-134..TGG...........................................................................
A0YTK7_LYNSP/34-125..DGG...........................................................................
F7UR75_SYNYG/35-125..DDG...........................................................................
Q152U6_SCHPM/172-262..DQL...........................................................................
Q14LC1_SPICI/52-142..TKG...........................................................................
F8XZF3_STRAG/44-134..SGG...........................................................................
B3EKH3_CHLPB/78-168..INI...........................................................................

PF11469

Q8U363_PYRFU/5-122--FSK---------------------------------------------------------------------------
H3ZKU7_THELN/10-127--PSR---------------------------------------------------------------------------
Q5JE89_THEKO/13-131--FTR---------------------------------------------------------------------------
A1RX42_THEPD/16-123--..R---------------------------------------------------------------------------

PF14622

RM15_SCHPO/67-197------------------------------------------------------FEK..I---YSSIVSGLVAVVYFQKG
Q7S1R6_NEUCR/117-265------------------------------------------------------VVV..V---LNSTLFAIIGAISLEKG
Q2GMI6_CHAGB/267-400------------------------------------------------------LTA..V---LNTSLFAIIGAISLQHG
A8Q4V0_MALGO/115-263------------------------------------------------------LFK..V---RGSCVEGLIGAIYHYKG
Q4P7G0_USTMA/113-257------------------------------------------------------LFK..V---RGVAVEALVGAIYHQKG
A5E1N1_LODEL/106-245------------------------------------------------------ELK..V---SGQLVHSLIGAINFYHG
D5X4R4_THIK1/15-139------------------------------------------------------RES..I---LADTVEALLGAIYLEAG
C4Z0E7_EUBE2/19-151------------------------------------------------------RDS..I---VSDACEAVIGAIYLDGG
RNC_BORA1/16-141------------------------------------------------------FRRPSI---LADAVEALFGAVFLDAG
RNC_MESFL/16-146------------------------------------------------------YEKPSI---LSDVYEAVTAAIYLDQT
RNC_LEIXX/20-149------------------------------------------------------KAS..I---LADTVEAVIGAVYLDAG
RNC_THELT/22-156------------------------------------------------------RERDSL---LADMLEAVVAAVYID.G
C8W586_DESAS/21-152------------------------------------------------------RERPSI---LADSFEALLGAVYLDQG
E4RLQ9_HALHG/23-154------------------------------------------------------RDS..I---LADSMEAIFGALYLDQG
D4LHQ1_9FIRM/18-150------------------------------------------------------RDS..I---VSDGLESLIGAMYLDGG
A4G6R8_HERAR/16-141------------------------------------------------------FRRPSI---LADTLEALFGAIFLDAG
A1SLU8_NOCSJ/48-177------------------------------------------------------KAS..I---LSDTVEAVIGAVHLS.G
Q2LVR4_SYNAS/22-153------------------------------------------------------KPS..I---LANTMEAITAAVFLDGG
E8NDE2_MICTS/20-149------------------------------------------------------KDS..I---LADTMEAIIGATYLSAG
E4TJ04_CALNY/16-145------------------------------------------------------RPS..I---LCDIFESIVAAMYLDGG
D4J805_9FIRM/20-152------------------------------------------------------RDS..I---LSDALEAVIGSIYLDGG
E8UCB0_TAYEM/16-140------------------------------------------------------FKRPSI---LADAVEAIFGAIYIDSN
E3DQV9_HALPG/23-155------------------------------------------------------RDS..I---LADTMEAIFGALYLDQS
A5WCD8_PSYWF/39-165------------------------------------------------------.....I---LADTVESLIGAIYLDSQ
D9R047_CLOSW/18-150------------------------------------------------------RAS..I---VSDAMEALIGAIYLDGG
RNC_PELTS/21-152------------------------------------------------------RPS..I---LADAFEALLGAVYLDQG
A9KLR1_CLOPH/23-155------------------------------------------------------RDS..I---LSDALESIIGAIYLDGG
D0MGH0_RHOM4/39-171------------------------------------------------------NDS..I---LSDAFEALVGAIYLDLG
D3PAP4_DEFDS/17-146------------------------------------------------------YTKPSI---LADIFESLLGAVYLDGG
F0S2Z0_DESTD/19-149------------------------------------------------------REKSSI---LCDVFESLFGAIYLDGG
A5I4N2_CLOBH/24-150------------------------------------------------------RVS..I---LADCVESIIAAIYLDKG
RNC_BACV8/34-159------------------------------------------------------NSY..M---CGNAFEALVGAIYLDRG
B6JY03_SCHJY/68-197------------------------------------------------------LER..V---TFDTMLAIIGAVYMRKG
C4R5N4_PICPG/63-200------------------------------------------------------EDT..V---LGKTVLALIGAINLTHG
E6UF22_RUMA7/20-145------------------------------------------------------RAS..I---VSDAMEAVIAAIYLDGG
K7X354_MYCHR/18-142------------------------------------------------------NTK..I---KADILESLTAAIYLDQD
Q13VM8_BURXL/16-137------------------------------------------------------RPS..I---LADTLEAVLGAVFLDGG
RNC_RALME/17-139------------------------------------------------------RPS..I---LADALEAIVGAVFLDAG
Q59PD0_CANAL/73-209------------------------------------------------------ELK..V---SGELLFSLVGAVNFYHG
RNC_PSESM/18-137------------------------------------------------------RES..I---LADALEALIGAIYLDAG
R5BXA0_9FIRM/20-152------------------------------------------------------RDS..I---VSDALEAVIGAIYLDGG
R5HQM8_9FIRM/18-148------------------------------------------------------RNS..I---LSDALEAVIGAIYLDGG
R5TZE4_9FIRM/19-150------------------------------------------------------RPS..V---TSDAMEALIGAIYLDGG
R5X6S0_9CLOT/24-150------------------------------------------------------RIS..I---LADALEAVIAAIYLDGG
R6GD49_9FIRM/20-151------------------------------------------------------RDS..I---LSDAFEALIGAIYLDGG
R6JSS6_9CLOT/18-150------------------------------------------------------RNS..V---VSDAMEALIGAIYLDGG
R6LRB3_9FIRM/18-150------------------------------------------------------RES..I---TSDALEALIGAIYLDGG
R6PBG7_9FIRM/22-152------------------------------------------------------RNS..I---ISDAMEALIGAIYLDGG
R6QQD7_9FIRM/19-150------------------------------------------------------RDS..I---LSDAFEAVIGAVYLDQG
R7AJR0_9BACE/21-152------------------------------------------------------RDS..I---TSDALEAVIGAIYLDGG
R7DB60_9FIRM/14-146------------------------------------------------------RDS..I---VSDATEALLGAIYLDGG

PF00636

A3GHW8_PICST/84-184......................................................EMK--V...SAQMMYALVGAVTFVHG
RM15_SCHPO/89-181......................................................FEK--I...YSSIVSGLVAVVYFQKG
RM03_SCHPO/83-189......................................................EIY--KDEAARRAILAILGGVYLHQG
A2QRC1_ASPNC/121-242...............................................QNTQGVTAEQ--A...NATFVRAVMGAIYLHAG
Q0UQH0_PHANO/7-117......................................................SDE--A...GQSFVRALIGALHIHLG
Q1XG54_CRYJA/71-157......................................................KQS--I...LCGCYRALFGAIGADAN
Q9FYL8_ARATH/80-167......................................................NSA--I...LCTGFRAIFGAIAIDAG
A0A023ZEP0_YEASX/153-272......................................................ETS--A...LAMSVRSIIAAIWAVTE
Q4PA03_USTMA/211-325................................................ATRTLLSRD--V...AADAMRAIVAVIFQEQG
Q0CCZ5_ASPTN/48-132......................................................GKN--V...MATTMEAIIGAVYYDSN
Q0UMM3_PHANO/145-228......................................................TRD--N...IAETFEAIMGAVYVDSG
A7I5W5_METB6/51-140......................................................SGE--D.TILADTVEAIIGAVYLDSD
A3CVM2_METMJ/43-132......................................................EPN--V...IAETLEAIIGAMYLDGG
A7I515_METB6/44-134......................................................WEQ--GSQAFDAAFEALIGAVFLDTR
A3CRH2_METMJ/50-139......................................................WTS--G.RVLAECLEALVGAVYLDGG
A5DES0_PICGU/186-275......................................................KVL--V...LSTVFLAYLGALFSEGY
A3LPK0_PICST/184-273......................................................KME--I...FGKIFLSYVAGLSMDGY
Q6BWD6_DEBHA/187-276......................................................KLA--K...LSNIFLAYIGGLALDGY
A4RR17_OSTLU/28-138......................................................DVH--R...DASALEALVAYLYLFES
C1MLN8_MICPC/114-224......................................................LQH--R...EASSLEALIAYWYLFDQ
C1FDU3_MICSR/76-186......................................................VQH--K...EASALEALIAYWYLFDQ
A9BJB7_PETMO/21-118......................................................NDY--R...KSTGFEAVIGYLFLTKS
D4CVS6_9FUSO/18-116......................................................MEY--K...EATALEAVVGAMYLLNK
C3WFU5_FUSMR/12-110......................................................QEY--R...EATAFEALIAGFYIEGR
B9K831_THENN/17-112......................................................PLY--R...KSTGFEALVGYLFLKRD
A5ILI0_THEP1/17-112......................................................PTY--R...KSTGFEALIGYLFLKRE
A6LJ32_THEM4/19-114......................................................PAY--R...KSTGFEVLIGFLYLKNE
A8F7A2_THELT/9-104......................................................IFY--R...KSTALEALIGYLYLKGN
A8J7A5_CHLRE/55-159......................................................GTY--K...KATAVEVLVAHLYLTA.
B1C8Q3_9FIRM/18-117......................................................STY--R...LATALECVFGYLYLLDD
C1DXY5_MICSR/99-208......................................................AIY--R...NASALECVVGYLYISDG
Q014M6_OSTTA/451-557......................................................GTY--R...NASALECLVGYLYVADR
MRNC_KOSOT/20-117......................................................ENY--K...CATALEALVGYLFLKGR
B7CDG4_9FIRM/9-110......................................................KTY--L...EATALESMLGYLYLYGH
B7G3M0_PHATC/16-116......................................................AAY--Q...DATALEALLGYLYIADS
A9RYU0_PHYPA/18-120......................................................KAY--S...SASALETLIGYLYLTDH
Q94F12_ARATH/98-200......................................................AVY--N...KASSLETLIGYLYLTNG
C6T3M8_SOYBN/105-207......................................................AVY--N...RASSLETLVGYLYLTNV
C0PKE8_MAIZE/108-210......................................................AVY--N...RASSLETLIGYLYLTNF
Q2JI20_SYNJB/24-121......................................................ADY--Q...NASGLETVLGYLYLANP
B4WGA4_9SYNE/42-139......................................................QDY--Q...KATGLESLIGFLYLTDQ
Q31LB9_SYNE7/26-123......................................................ECY--Q...QATGLETLLGYLYLCDP
MRNC_THEEB/23-120......................................................KIY--R...QATGFEALLGYLYLTNP
F7UR33_SYNYG/28-125......................................................ELY--Q...AASGLETLLGYLYLRDA
B1XNV1_SYNP2/17-114......................................................AIY--R...QATGFEALVGYLYLTNP
B8HT79_CYAP4/37-134......................................................ETY--Q...QATSLETLLGYLYLTNP
B4VUK6_9CYAN/43-140......................................................KIY--Q...QATSLETLLGYLYLTDP
A8YKZ5_MICAE/29-126......................................................QVY--Q...QASSLETLFGYLYLQDP
B7KCP4_CYAP7/45-142......................................................KLY--Q...QATSLETLIGYLYLQDP
D3EMY0_ATETH/29-126......................................................EVY--Q...QATSLETLIGYLYLQDS
B7K2P3_CYAP8/45-142......................................................EIY--Q...QATSLETLIGYLYLHNQ
A0ZGL0_NODSP/61-158......................................................KIY--Q...QATSLETLIGYLYLTDF
Q112N8_TRIEI/20-117......................................................EVY--Q...QATSLETLIGYLYLTDP
A0YQT6_LYNSP/17-114......................................................QTY--Q...LATSLETLVGYLYLTDP
A8G4M5_PROM2/20-117......................................................SIY--S...RATGFETLIGWLFLKDP
A9B9W4_PROM4/20-117......................................................ATY--A...KATGFETLIGWLFLKDP
Q7VCJ3_PROMA/20-117......................................................AIY--G...KATGFETLIGWLFLKDP
A5GTM3_SYNR3/12-109......................................................SVY--G...RASGFETMVGWLYLNQP
A2C1X8_PROM1/20-117......................................................ATY--A...IATGFETIVGWLFLKNP
B1X410_PAUCH/23-120......................................................AIY--A...RATGFETMMGWLFLQNP
B5IKV4_9CHRO/2-99......................................................AAY--A...RATGFEALLGWLFLHDP
Q067M9_9SYNE/20-119......................................................AVY--G...RATGFETMVGWLFLNNP
Q7U7F7_SYNPX/20-117......................................................AVY--G...LATGFETMVGWLYLNDP
A3YYC2_9SYNE/20-117......................................................ASY--G...RATGFETMVGWLFLRNP
Q0I9N3_SYNS3/20-117......................................................GIY--G...RATGFETMIGWLFLQNP
A4CU57_SYNPV/21-118......................................................AAY--G...KATGFETMVGWLYLHNP
A3Z7F5_9SYNE/21-118......................................................SIY--G...RATGFETMVGWLFLQNP
A6GE80_9DELT/16-118......................................................REY--R...AATALEALMAWWLLGGQ
A0A008AQZ0_STAAU/15-116......................................................QTY--R...KSSAIEAVIGFLYLEKR
C8WTZ3_ALIAD/13-112......................................................VVY--R...LATGFEALVGYLYATGE
C1KYH3_LISMC/13-114......................................................GTY--S...MSTSFEAVLGYLYLAGE
Q8ETZ8_OCEIH/12-114......................................................QTY--R...YSTAFEALIGYHYMMKN
J3ENE3_9LACO/31-132......................................................NTY--K...LSTGFEAMFGYLDLLGK
C9ASB2_ENTFC/15-116......................................................TTY--R...VATGFEALMGYLHLTKQ
D1BMT8_VEIPT/47-145......................................................QEY--R...SSTAFEAVLGFLYETRQ
D3LUV6_9FIRM/36-134......................................................AEY--H...NSTALEALIGYLVLDGQ
D1VT13_9FIRM/26-124......................................................GDY--M...EATGLEALFGYLYLLDR
A4XJ79_CALS8/5-105......................................................SDY--K...YATALETLIGYLYLENN
A6P055_9FIRM/19-118......................................................ADY--Q...TATALEALFGWLYLQGR
C9LMK9_9FIRM/35-133......................................................EEY--R...ESTAFEGLLGYLYLSRQ
B0MM93_9FIRM/17-116......................................................KDY--R...RATGMEALFGYLYLTGQ
D4LDD2_RUMC1/15-114......................................................QTY--R...RATALECLFGYLHLLGR
E6U8V4_ETHHY/21-120......................................................IDY--R...YATGLEALFGYLYLTGR
B0TC36_HELMI/34-133......................................................ATY--R...LSTGFECLVGYWSLARP
MRNC_SYMTH/12-111......................................................AEY--A...ASTGFEALVGYLYLAGQ
Q0AUF9_SYNWW/16-114......................................................HDY--R...MSTGFEALLGYTYLKGD
A5D5M2_PELTS/19-118......................................................VEY--R...HSTALECLIGYLYLKGD
MRNC_MOOTA/10-109......................................................AEY--H...SSTALESLLGYLYLQGD
D4KFD3_9FIRM/37-135......................................................HDY--H...ISTGFEAVLGYLYLNKD
C9LVQ2_SELS3/37-135......................................................AEY--H...ASTGFEALLGTLFLEKD
C4V0H2_9FIRM/37-135......................................................ADY--H...ASTGFEALLGSLYIRHE
A5KKA6_9FIRM/30-129......................................................TDY--R...RATGFEALVGYLYLKKE
C5ENC6_9FIRM/5-104......................................................IDY--R...TATGLEALAGWLFLKER
B1RJ47_CLOPF/20-120......................................................RDY--R...NATGFEALVGYLYLTGK
A3DH39_CLOTH/26-125......................................................TDY--R...YATGFESLLGFLYLKKD
A6TWK4_ALKMQ/25-124......................................................MDY--K...YATGFEALIGYLFYMGK
A8MLB8_ALKOO/26-125......................................................TEY--K...YATGFEALLGYLFYIGQ
C0WE29_9FIRM/32-129......................................................REY--R...QGTAFEALMGWLYLTGE
C0GIM8_9FIRM/8-106......................................................AAY--R...RATGFEALLGWLYLNGE
A2QMS9_ASPNC/124-236......................................................MDL--V...LAHTMYAVIGAISLEKG
Q0TYG8_PHANO/64-174......................................................IES--V...LMTSLYAIVGAIALERG
RM44_PONAB/123-207......................................................PPT--V...LQQTFFAVIGALLQSSG
Q6BCK1_TETTH/1224-1338Y............................................NK.......DIS--I...LSQLFDSLVGAIYIDLQ
A3CW87_METMJ/121-210......................................................VDH--V...KGTLVESVFGILFLREG
I7MKB8_TETTS/752-862.............................................QL.......SYS--N...LSDTLESVVGCFYASNQ
A3LUF0_PICST/251-366IY....................................................EEE--F...LGDYFESYMGALVIEQP
Q5GAH0_9VIRU/44-137......................................................KEI--L...LEDVFEAFLGAISTAVD
Q4KS72_ISKNV/58-156......................................................QQR--L...LEDTFEAMVGAISITMD
A2F201_TRIVA/593-691......................................................TPK--Y...YGDVFEAITAAIAGTFG
B0Y3J2_ASPFC/35-122......................................................GTH--G...LGTEIEALVAATWIDSR
E7NKX5_YEASO/105-208......................................................ETT--I...FASVLNAFIGAILSTNG
Q6FVA4_CANGA/96-187......................................................KSK--V...MSTVLNSFIGAILLQQG
Q6T445_LEIMA/391-483........................................................K--V...KADLVEGIFGELHLHLY
Q9DSW1_9VIRU/45-139......................................................KSR--L.SVFEDVFEALFGAIEFVFD
DCL22_ASPNC/1111-1258..................................IKHELWEQRFYPWVRLRALGDMR--V...LSDIIQSIFGAVFIDSQ
Q2U0L3_ASPOR/1051-1198...........................................IYPWARLSVFRGLK--V...FSDIVQSVFGAIYIDSL
Q0E579_SFAVA/192-324......................................................HRD--VISLLEDVMESFVGALWCSLM
A0DYG6_PARTE/384-498......................................................ATM--LVTFLADIFESLIATVFLDKD
Q3SE73_PARTE/363-464......................................................SQK--Q...QADIYEALCGACYIKNY
Q57XF2_TRYB2/735-814.........................................................--....KADMVESILGAVYQSGM
A7SJH8_NEMVE/129-224......................................................KED--V...ISDAFLALIGAIYLDQG
Q2Q3V3_DROSI/1205-1377YNRF....VEGCRANGQSFYAGSDFSSEVNFCVGLV.........AI.......ANK--V...IADTLEALLGVIVKNYG
Q6BCJ9_TETTH/1328-1487EEQQ....QQNDIPNLLRLEPTYR.....................HI.......KGK--T...LADTLESIIGVFFQQKK
DCL_GIAIC/333-418......................................................KSK--T...WADMYEEIVGSIFTGPN
Q7Q073_ANOGA/1215-1375...............EIQSGVVAQATVDKFLPLIEQAPAPSQSTLHTVLQQVQIRDK--V...VADVTEALLGVCVKTVG
Q3SE71_PARTE/360-463......................................................KQL--QISQKADIYEAIVGGVFEVTQ
DCL_GIAIC/646-734......................................................DSK--V...YGDTFEAILAAILLACG
DCL2_PHANO/1130-1270......................................................PPK--F...LSDMVESVIGAVYIDSL
A7EYF3_SCLS1/1216-1363..................................ILAVIKTGDKFPWTLLSRLDARK--F...FSDMIESLLGAIWIDSG
DCL2_EMENI/1092-1250..................................ILHALNNTTAYPWSLFSAIHADK--F...FSDVVESIIGAIFVDSG
DCL2_NEOFI/1134-1281......................................................ADK--F...FSDIVESVLGAIFVDSG
A1CZL8_NEOFI/163-252......................................................WTK--T...KGDIFESYVAAIILSRP
Q0UFS5_PHANO/190-279......................................................WRK--V...VADIFEAYVAGVVLSDP
Q110R1_TRIEI/53-143......................................................KNK--M...LAQMFEALIGVIYLEFD
Q55FS1_DICDI/1250-1335......................................................PIK--K...LGDYLESFIGCCFVDTT
A2XBW0_ORYSI/1353-1498......................................................SSK--T...LADVVEALIGVYYVAGG
Q80UU5_MOUSE/475-564......................................................RTK--T...LADLLESFIAALYIDKD
RNC_CAEEL/870-957......................................................KLK--D...KADLVEAFIGALYVDRG
DCL2_NEUCR/998-1107......................................................RQM--SSKMVADVVESLIGAAYMCGG
DCL2_PHANO/947-1054.....................................................RSSK--L...IADIIESLIGACYTVGG
DCL2_ASPCL/955-1060......................................................SSK--V...LADVVEALIGAAYMDGG
A6R2T0_AJECN/946-1054......................................................STK--T...LADVVEALLAAATLDGG
Q3SE73_PARTE/554-687.............................................RRINQYSQQIPK--I...MSDLWESVAACILVEYG
I7MKB8_TETTS/1048-1163......................................................SPK--V...LGDLWESVAGAIIMDSD
Q3SE70_PARTE/522-610.........................................................--....YGDIFQSVAAAILLDSG
A5Z824_9FIRM/49-157.............................................DK.......NTS--V...KEDLFEAIIGAVTLDTL
Q5KKA7_CRYNJ/521-644.............................................PE...SRVLGDK--V...IADIIEAIIGASYMPNK
RTL3_ARATH/445-551......................................................APK--I...LVNLLAGVAGAVYIDVK
RTL3_ORYSJ/76-183......................................................PPK--V...LCDVVESLIGAIYCDSN
RTL2_ARATH/93-203......................................................APK--V...LADLFESLAGAVYVDVN
RTL1_ORYSJ/62-168......IE..............................................GPR--V...LADIVEAIVGAVYLDSK
Q2Q3U9_DROSI/1464-1620......................................................VPK--T...LGDVLEALIAAIYLDCR
A7SIA4_NEMVE/44-167..........................................RGGEAIE.....VPK--V...LGDLFEALLGALYVDCG
A7SKX2_NEMVE/37-156......................................................APK--V...LGDIFESVAGAIFLDSG
Q4SZJ7_TETNG/259-381......................................................DIE--VPKAMGDIFESLAGAIYMDSG
A7IYQ4_PHYPA/1379-1492......................................................APK--V...LGDIFESIAGALFLDAR
DCL4_ARATH/1327-1436......................................................CPK--V...LGDLVESCLGALFLDCG
DCL4_ORYSJ/1249-1358......................................................EPA--CPKALGDIVESCIGAVLLDSG
DCR1_SCHPO/930-1038..YA.............................................VLQKLSVK--R...IADMVEASIGACLLDSG
DCL1_ASPNC/1080-1192..TE.............................................SKHALAEK--T...IADVCEALIGAALLSGG
Q4PCH5_USTMA/903-1023......................................................LPL--LIKRDADMFEAYAAAVFLSHG
A3Z4A6_9SYNE/40-129...G..................................................HAT--L...RAELSEALIGAIYAIGG
Q4C1B8_CROWT/48-137...G..................................................RVS--W...LADTFEAVLGALYLSTQ
Q31MP4_SYNE7/55-144...G..................................................QQS--R...LAEAFEALLGALYLSQR
DCL2A_ORYSJ/1006-1124...................................................MSIKSK--R...IADSVEALIGAYLSTAG
DICER_DANRE/1295-1551FDYSSWDAMCYLDPSKAGEEDDFVVGFWNPSEENCGTDIGKQSISYDLHTEQCIADK--S...IADCVEALLGCYLTSCG
DCR1_CAEEL/1413-1589STTDGIETITFPKQARVGNDD...................ISPLPYNLLTQQHISDK--S...IADAVEALIGVHLLTLG
Q27IU0_DROSI/1685-1862........................AQNGQLDDSNDSCNDFSCFIPYNLVSQHSIPDK--S...IADCVEALIGAYLIECG
Q3SD86_PARTE/1582-1697KMYT..................................................SEP--IIKILGDVFESIVGAIFVDSS
A2F201_TRIVA/412-500......................................................GKK--G...SADLFEALFGAILLDSN
Q3SD86_PARTE/1325-1459PKNY..................................................QPI--PEKVHSDVVEALNGAFLIQYD
DCR1_SCHPO/1120-1233FEID..................................................SPK--F...ISDTLEAMICAIFLDSG
E3W000_MIMIV/351-441..RE..................................................NVN--I...IGGGLEAFVGALYLNIG
DCL1_ASPFU/1291-1405VAKD..................................................PPK--C...LPDMVEAYLGAIFVDSK
Q0E5R5_MUCCI/1080-1190..KL..................................................SDK--T...LADVVESTLGASYLSCL
RNC_MYCMO/47-135......................................................NVK--I...NADLFESFVAAIYLDLG
Q6CC90_YARLI/191-332..LC..................................................GRK--I...VADLFEAYVAGVYLSYG
A2RV16_DANRE/886-976..SD..................................................LRH--A...MANCFEALIGAVYLEGG
Q95ZG5_DICDI/926-1010.........................................................--....HADLIEAFIGAIYIECG
Q6FQ28_CANGA/457-550.........................................................--....YADLFEAYVGGLVEDDP
Q64AH3_9ARCH/53-141......................................................RPK--V...IADVFEAICGAIYLDTE
RNC_MYCGH/469-556......................................................SPK--I...LEDIFEAFIGAMYLDQG
A0A024FAP5_UREPR/43-140..AR..................................................MEK--I...YEDIFEAFIGAVAQDQG
Q8EW40_MYCPE/52-139......................................................TKK--I...KADLFEAFAGAIFIDKG
Q1UZA6_PELUQ/38-127..EI..................................................EDK--I...VADCLEALIGAIYLDKG
RNC_AQUAE/37-121.........................................................--....IGDVFEALWAAVYIDSG
E3W000_MIMIV/65-149..SL..................................................NDH--I...LEDIFESFIGAFYLNFG
A4VD87_TETTS/1750-1863..TY..................................................NQS--LIKTLGDVIESLVGAIFIDNN
A3CSF0_METMJ/81-165.....................................................PTDS--I...VADAFEALIGAIYLDRG
Q4A7X2_MYCH7/44-131......................................................NNK--L...KADIFESFCAAILLDQG
A5IYM8_MYCAP/40-130..LS..................................................SKK--V...GADIFESLVAAIFLDQG
A4GK15_9BACT/37-125..ET..................................................PEN--I...LGNSLEAIFGAVYKESG
A5CEW8_ORITB/60-150..RS..................................................NKN--N...IENTMEAVIGAVYLDGG
RNC_WOLTR/54-144..KR..................................................NLK--N...LENALEALIGAIYIDGG
RNC_MYCCT/40-130..YE..................................................KQS--I...LADIFEALTAAVYIDQN
RNC_MYCPB/56-141......................................................TET--L...FGDVLEALVAAIYEDLG
A4GHU1_9BACT/34-120........................................................S--I...LGNVLEALIGAIFLDSD
RNC_BRADU/60-150..RL..................................................RKS--V...LGDICEAVIGAIFLDGG
A6DUU1_9RHOB/42-132..RR..................................................KEA--L...LGDAMEAVIAAVYLDAG
A5FV46_ACICJ/38-128..RN..................................................RAT--V...LADALEALIGALYLDGG
A5V2R4_SPHWW/51-141..VQ..................................................SDN--V...LGDVVEALIGALYLEGG
RNC_RHIEC/47-137..KR..................................................MMN--V...RADVVESLIAAIYLDGG
RNC_SPHAL/39-129..RH..................................................SDN--I...AADAIEALIGALFLERG
Q0F3I4_9PROT/44-134..IK..................................................SPS--I...VANAVEAVIGAVFEESG
M1GI47_LAWIN/41-131..RQ..................................................RNT--L...LADTMEAVFGAVFVDGD
A6GP51_9BURK/26-116..TI..................................................KDS--I...VADALEALFGAILLDSG
RNC_MYXXD/55-145..RE..................................................KNS--V...LADALEAVFGAVFLTSG
A1R7I4_ARTAT/40-130..KN..................................................KAS--I...LADTMEALIGATYLSND
A7A3Q3_BIFAD/75-166..AD..................................................KSS--I...LCDIVESLIGATFIQHG
Q1IJU6_KORVE/51-141..RS..................................................KSA--I...LVDALEAVIAAIYLDGG
D2BI67_DEHMV/54-144..RF..................................................KPA--N...LAGAFEAVLAAIYIDKG
A9B5J8_HERA2/42-132..RE..................................................RDN--L...LADAFEALLAAIALDGG
A4MZ45_HAEIF/36-126..FR..................................................RES--I...LADCVEAIIGAMSLDQG
RNC_MYCS5/49-139..LS..................................................SSN--V...LSDVVEALIAAIYLDQG
A5UJK3_METS3/37-127..NE..................................................VLS--I...TADVFESFLGAIFLDQG
Q83VA6_9MOLU/41-129......................................................HNY--S..IVTDAFEALFGAIYLDLG
RNC_RHOBA/69-158.....................................................YPKS--L...VSDVFEAVIAALYIDGG
A3LS79_PICST/241-330......................................................DQK--V...YADIFEAYIGALSVERG
A4E6T0_9ACTN/44-134..RG..................................................LHS--A...LENVYESLVGALYLDAG
A7K823_9PHYC/78-168..HT..................................................NPK--T...LEDAFEALIGAIYLDLG
A0A015Q692_BACFG/59-145......................................................NSY--M...YGNAFEAFIGAIYLDRG
RNC_CHLPN/45-135..RG..................................................RLS--A...YANLFESILGAVYLDGG
A4BWV8_9FLAO/58-144........................................................N--I...HGNIFEALIGAIYLDKG
A3EQH6_9BACT/58-148..RE..................................................NSS--L...LADTFESLAAAIYLEYG
K6KAV8_LEPBO/59-149..KG..................................................RRK--I...AANLFESLVGAIYLDRG
A6LNE7_THEM4/42-132..SE..................................................KKS--I...LADVVESLIAAIYLDSN
A9BIG2_PETMO/59-148..RT..................................................KKS--I...LSDTMEALFACIYLSCG
Q1CTK8_HELPH/52-142..RE..................................................KPS--I...LSSAFEALMAGVYLEAG
RNC_BDEBA/44-134....................................................AQKPR--L...IASSFEAIVGALYLDGG
A0YTK7_LYNSP/34-125..YQ..................................................NPA--L...LSDTFEAYIGAYYLDAG
F7UR75_SYNYG/35-125..QS..................................................SPS--I...LADVFESLLGAALLDRG
Q152U6_SCHPM/172-262..RK..................................................SQK--V...IADTFEAYLGALILDGQ
Q14LC1_SPICI/52-142..YE..................................................KNR--I...LADIYESMIAALYLDLG
F8XZF3_STRAG/44-134..RN..................................................RDT--I...LGDLFEAFLGALLLDKG
B3EKH3_CHLPB/78-168..QT..................................................STS--S...LADAFEALIGALYLDKG

PF11469

Q8U363_PYRFU/5-122------------------------------------------------------KKE--A---IGRALAPLLVIISERLT
H3ZKU7_THELN/10-127------------------------------------------------------KKE--V---IGNAFGELLKIIKEKLE
Q5JE89_THEKO/13-131------------------------------------------------------KKE--T---IGKAFAVLYEEIGKRLG
A1RX42_THEPD/16-123------------------------------------------------------EGY--D---VAQALAKLADYLLEKIE

PF14622

RM15_SCHPO/67-197GVEAMNFCKKSIISDL
Q7S1R6_NEUCR/117-265AAVAQRIVREKILKRL
Q2GMI6_CHAGB/267-400AEVAQQVVREKILRRL
A8Q4V0_MALGO/115-263AQVAQQFFLSRILLPL
Q4P7G0_USTMA/113-257ASEASKFFQRWILPSL
A5E1N1_LODEL/106-245KDVAEEFIGEKIMKGL
D5X4R4_THIK1/15-139FDTAQEVMRR.LFAPL
C4Z0E7_EUBE2/19-151FANAKEFVNKFILNDL
RNC_BORA1/16-141FDAARKVIEQQYVPVL
RNC_MESFL/16-146EEVLISWIKSTIFKYI
RNC_LEIXX/20-149GDEATALVLR.LIGPL
RNC_THELT/22-156GLTAVKKVFLSYFAKY
C8W586_DESAS/21-152LEKTRMFALKF.LAPV
E4RLQ9_HALHG/23-154FTAASDFVLK.ILKED
D4LHQ1_9FIRM/18-150FEPAQAFVMKFILNDL
A4G6R8_HERAR/16-141FNAARDVIRALYIPIL
A1SLU8_NOCSJ/48-177GFTTSAVVVHRLFDPL
Q2LVR4_SYNAS/22-153FDRAYEFVR.RLFTPL
E8NDE2_MICTS/20-149PDAATAMVL.RLVEPL
E4TJ04_CALNY/16-145YNEARRFII.TIASDK
D4J805_9FIRM/20-152IEQAGSFIMTHVLNDI
E8UCB0_TAYEM/16-140IEQAQKVV.ESIYEPL
E3DQV9_HALPG/23-155FKVVSDFILELLKVDI
A5WCD8_PSYWF/39-165SVDTVKACVLDWFAEL
D9R047_CLOSW/18-150FANAKEFILRFIMNDL
RNC_PELTS/21-152LEKAAGLAIKYL.APL
A9KLR1_CLOPH/23-155FANAKEFISNYILSDI
D0MGH0_RHOM4/39-171LEAARAFVERALLAPL
D3PAP4_DEFDS/17-146YNEARRIVL.MLMSEL
F0S2Z0_DESTD/19-149FENAKEVFKRNFLMKL
A5I4N2_CLOBH/24-150LDHAREFVMKNF....
RNC_BACV8/34-159YRACKYFMEHRIIG..
B6JY03_SCHJY/68-197ARTAVDFCQKNLVPA.
C4R5N4_PICPG/63-200KKVATEFIETELMP..
E6UF22_RUMA7/20-145LEAARKHIMN......
K7X354_MYCHR/18-142RKTFEDFVKK.ILH..
Q13VM8_BURXL/16-137FEAAQTVIKRLY....
RNC_RALME/17-139FDAARALIRKLYIP..
Q59PD0_CANAL/73-209KNKAEQFITEKLVDQ.
RNC_PSESM/18-137MEAARERVLA......
R5BXA0_9FIRM/20-152LASAKEFILKHVLNDM
R5HQM8_9FIRM/18-148FEHAKTFIHKFILTD.
R5TZE4_9FIRM/19-150FTNAKEFIHRFILTDL
R5X6S0_9CLOT/24-150IKCAREFILTNM....
R6GD49_9FIRM/20-151MDRARTFIHTHLLKD.
R6JSS6_9CLOT/18-150FANAKEFIHRFILNDI
R6LRB3_9FIRM/18-150FANAKEFILKYILNDL
R6PBG7_9FIRM/22-152FANAKEFVHKYILNDI
R6QQD7_9FIRM/19-150FEEARKFVETYLLQD.
R7AJR0_9BACE/21-152FEPAKKFIMAHVLNDL
R7DB60_9FIRM/14-146FEPAKDFVLKFILNDI

PF00636

A3GHW8_PICST/84-184----------------
RM15_SCHPO/89-181----------------
RM03_SCHPO/83-189----------------
A2QRC1_ASPNC/121-242----------------
Q0UQH0_PHANO/7-117----------------
Q1XG54_CRYJA/71-157----------------
Q9FYL8_ARATH/80-167----------------
A0A023ZEP0_YEASX/153-272----------------
Q4PA03_USTMA/211-325----------------
Q0CCZ5_ASPTN/48-132----------------
Q0UMM3_PHANO/145-228----------------
A7I5W5_METB6/51-140----------------
A3CVM2_METMJ/43-132----------------
A7I515_METB6/44-134----------------
A3CRH2_METMJ/50-139----------------
A5DES0_PICGU/186-275----------------
A3LPK0_PICST/184-273----------------
Q6BWD6_DEBHA/187-276----------------
A4RR17_OSTLU/28-138----------------
C1MLN8_MICPC/114-224----------------
C1FDU3_MICSR/76-186----------------
A9BJB7_PETMO/21-118----------------
D4CVS6_9FUSO/18-116----------------
C3WFU5_FUSMR/12-110----------------
B9K831_THENN/17-112----------------
A5ILI0_THEP1/17-112----------------
A6LJ32_THEM4/19-114----------------
A8F7A2_THELT/9-104----------------
A8J7A5_CHLRE/55-159----------------
B1C8Q3_9FIRM/18-117----------------
C1DXY5_MICSR/99-208----------------
Q014M6_OSTTA/451-557----------------
MRNC_KOSOT/20-117----------------
B7CDG4_9FIRM/9-110----------------
B7G3M0_PHATC/16-116----------------
A9RYU0_PHYPA/18-120----------------
Q94F12_ARATH/98-200----------------
C6T3M8_SOYBN/105-207----------------
C0PKE8_MAIZE/108-210----------------
Q2JI20_SYNJB/24-121----------------
B4WGA4_9SYNE/42-139----------------
Q31LB9_SYNE7/26-123----------------
MRNC_THEEB/23-120----------------
F7UR33_SYNYG/28-125----------------
B1XNV1_SYNP2/17-114----------------
B8HT79_CYAP4/37-134----------------
B4VUK6_9CYAN/43-140----------------
A8YKZ5_MICAE/29-126----------------
B7KCP4_CYAP7/45-142----------------
D3EMY0_ATETH/29-126----------------
B7K2P3_CYAP8/45-142----------------
A0ZGL0_NODSP/61-158----------------
Q112N8_TRIEI/20-117----------------
A0YQT6_LYNSP/17-114----------------
A8G4M5_PROM2/20-117----------------
A9B9W4_PROM4/20-117----------------
Q7VCJ3_PROMA/20-117----------------
A5GTM3_SYNR3/12-109----------------
A2C1X8_PROM1/20-117----------------
B1X410_PAUCH/23-120----------------
B5IKV4_9CHRO/2-99----------------
Q067M9_9SYNE/20-119----------------
Q7U7F7_SYNPX/20-117----------------
A3YYC2_9SYNE/20-117----------------
Q0I9N3_SYNS3/20-117----------------
A4CU57_SYNPV/21-118----------------
A3Z7F5_9SYNE/21-118----------------
A6GE80_9DELT/16-118----------------
A0A008AQZ0_STAAU/15-116----------------
C8WTZ3_ALIAD/13-112----------------
C1KYH3_LISMC/13-114----------------
Q8ETZ8_OCEIH/12-114----------------
J3ENE3_9LACO/31-132----------------
C9ASB2_ENTFC/15-116----------------
D1BMT8_VEIPT/47-145----------------
D3LUV6_9FIRM/36-134----------------
D1VT13_9FIRM/26-124----------------
A4XJ79_CALS8/5-105----------------
A6P055_9FIRM/19-118----------------
C9LMK9_9FIRM/35-133----------------
B0MM93_9FIRM/17-116----------------
D4LDD2_RUMC1/15-114----------------
E6U8V4_ETHHY/21-120----------------
B0TC36_HELMI/34-133----------------
MRNC_SYMTH/12-111----------------
Q0AUF9_SYNWW/16-114----------------
A5D5M2_PELTS/19-118----------------
MRNC_MOOTA/10-109----------------
D4KFD3_9FIRM/37-135----------------
C9LVQ2_SELS3/37-135----------------
C4V0H2_9FIRM/37-135----------------
A5KKA6_9FIRM/30-129----------------
C5ENC6_9FIRM/5-104----------------
B1RJ47_CLOPF/20-120----------------
A3DH39_CLOTH/26-125----------------
A6TWK4_ALKMQ/25-124----------------
A8MLB8_ALKOO/26-125----------------
C0WE29_9FIRM/32-129----------------
C0GIM8_9FIRM/8-106----------------
A2QMS9_ASPNC/124-236----------------
Q0TYG8_PHANO/64-174----------------
RM44_PONAB/123-207----------------
Q6BCK1_TETTH/1224-1338----------------
A3CW87_METMJ/121-210----------------
I7MKB8_TETTS/752-862----------------
A3LUF0_PICST/251-366----------------
Q5GAH0_9VIRU/44-137----------------
Q4KS72_ISKNV/58-156----------------
A2F201_TRIVA/593-691----------------
B0Y3J2_ASPFC/35-122----------------
E7NKX5_YEASO/105-208----------------
Q6FVA4_CANGA/96-187----------------
Q6T445_LEIMA/391-483----------------
Q9DSW1_9VIRU/45-139----------------
DCL22_ASPNC/1111-1258----------------
Q2U0L3_ASPOR/1051-1198----------------
Q0E579_SFAVA/192-324----------------
A0DYG6_PARTE/384-498----------------
Q3SE73_PARTE/363-464----------------
Q57XF2_TRYB2/735-814----------------
A7SJH8_NEMVE/129-224----------------
Q2Q3V3_DROSI/1205-1377----------------
Q6BCJ9_TETTH/1328-1487----------------
DCL_GIAIC/333-418----------------
Q7Q073_ANOGA/1215-1375----------------
Q3SE71_PARTE/360-463----------------
DCL_GIAIC/646-734----------------
DCL2_PHANO/1130-1270----------------
A7EYF3_SCLS1/1216-1363----------------
DCL2_EMENI/1092-1250----------------
DCL2_NEOFI/1134-1281----------------
A1CZL8_NEOFI/163-252----------------
Q0UFS5_PHANO/190-279----------------
Q110R1_TRIEI/53-143----------------
Q55FS1_DICDI/1250-1335----------------
A2XBW0_ORYSI/1353-1498----------------
Q80UU5_MOUSE/475-564----------------
RNC_CAEEL/870-957----------------
DCL2_NEUCR/998-1107----------------
DCL2_PHANO/947-1054----------------
DCL2_ASPCL/955-1060----------------
A6R2T0_AJECN/946-1054----------------
Q3SE73_PARTE/554-687----------------
I7MKB8_TETTS/1048-1163----------------
Q3SE70_PARTE/522-610----------------
A5Z824_9FIRM/49-157----------------
Q5KKA7_CRYNJ/521-644----------------
RTL3_ARATH/445-551----------------
RTL3_ORYSJ/76-183----------------
RTL2_ARATH/93-203----------------
RTL1_ORYSJ/62-168----------------
Q2Q3U9_DROSI/1464-1620----------------
A7SIA4_NEMVE/44-167----------------
A7SKX2_NEMVE/37-156----------------
Q4SZJ7_TETNG/259-381----------------
A7IYQ4_PHYPA/1379-1492----------------
DCL4_ARATH/1327-1436----------------
DCL4_ORYSJ/1249-1358----------------
DCR1_SCHPO/930-1038----------------
DCL1_ASPNC/1080-1192----------------
Q4PCH5_USTMA/903-1023----------------
A3Z4A6_9SYNE/40-129----------------
Q4C1B8_CROWT/48-137----------------
Q31MP4_SYNE7/55-144----------------
DCL2A_ORYSJ/1006-1124----------------
DICER_DANRE/1295-1551----------------
DCR1_CAEEL/1413-1589----------------
Q27IU0_DROSI/1685-1862----------------
Q3SD86_PARTE/1582-1697----------------
A2F201_TRIVA/412-500----------------
Q3SD86_PARTE/1325-1459----------------
DCR1_SCHPO/1120-1233----------------
E3W000_MIMIV/351-441----------------
DCL1_ASPFU/1291-1405----------------
Q0E5R5_MUCCI/1080-1190----------------
RNC_MYCMO/47-135----------------
Q6CC90_YARLI/191-332----------------
A2RV16_DANRE/886-976----------------
Q95ZG5_DICDI/926-1010----------------
Q6FQ28_CANGA/457-550----------------
Q64AH3_9ARCH/53-141----------------
RNC_MYCGH/469-556----------------
A0A024FAP5_UREPR/43-140----------------
Q8EW40_MYCPE/52-139----------------
Q1UZA6_PELUQ/38-127----------------
RNC_AQUAE/37-121----------------
E3W000_MIMIV/65-149----------------
A4VD87_TETTS/1750-1863----------------
A3CSF0_METMJ/81-165----------------
Q4A7X2_MYCH7/44-131----------------
A5IYM8_MYCAP/40-130----------------
A4GK15_9BACT/37-125----------------
A5CEW8_ORITB/60-150----------------
RNC_WOLTR/54-144----------------
RNC_MYCCT/40-130----------------
RNC_MYCPB/56-141----------------
A4GHU1_9BACT/34-120----------------
RNC_BRADU/60-150----------------
A6DUU1_9RHOB/42-132----------------
A5FV46_ACICJ/38-128----------------
A5V2R4_SPHWW/51-141----------------
RNC_RHIEC/47-137----------------
RNC_SPHAL/39-129----------------
Q0F3I4_9PROT/44-134----------------
M1GI47_LAWIN/41-131----------------
A6GP51_9BURK/26-116----------------
RNC_MYXXD/55-145----------------
A1R7I4_ARTAT/40-130----------------
A7A3Q3_BIFAD/75-166----------------
Q1IJU6_KORVE/51-141----------------
D2BI67_DEHMV/54-144----------------
A9B5J8_HERA2/42-132----------------
A4MZ45_HAEIF/36-126----------------
RNC_MYCS5/49-139----------------
A5UJK3_METS3/37-127----------------
Q83VA6_9MOLU/41-129----------------
RNC_RHOBA/69-158----------------
A3LS79_PICST/241-330----------------
A4E6T0_9ACTN/44-134----------------
A7K823_9PHYC/78-168----------------
A0A015Q692_BACFG/59-145----------------
RNC_CHLPN/45-135----------------
A4BWV8_9FLAO/58-144----------------
A3EQH6_9BACT/58-148----------------
K6KAV8_LEPBO/59-149----------------
A6LNE7_THEM4/42-132----------------
A9BIG2_PETMO/59-148----------------
Q1CTK8_HELPH/52-142----------------
RNC_BDEBA/44-134----------------
A0YTK7_LYNSP/34-125----------------
F7UR75_SYNYG/35-125----------------
Q152U6_SCHPM/172-262----------------
Q14LC1_SPICI/52-142----------------
F8XZF3_STRAG/44-134----------------
B3EKH3_CHLPB/78-168----------------

PF11469

Q8U363_PYRFU/5-122S---------------
H3ZKU7_THELN/10-127.---------------
Q5JE89_THEKO/13-131L---------------
A1RX42_THEPD/16-123A---------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window