Sequence alignment for CL0540

PF14609

MOD21_SCHPO/60-677M...........GIQG-REDLE-MPLRNACEV.LNR..QTVSVKQ-----------------------------------
E4WX70_OIKDI/53-731VKDQIESVVDKFRMHN-FTAQA-NDFDDHMDDFVDRALVENGTGN-----------------------------------
B6K1F8_SCHJY/48-653VISSVEGIAEKQSILG-REDVA-NCLHARLAE.LDQ..VSSNWRV-----------------------------------

PF04130

Q2UAG9_ASPOR/234-750--------ETIFMLQG.LPTSL.FWR.............HHESV.............................EVDRKYS
Q4WEE6_ASPFU/229-741--------ETLFMLQG.LPTSL.FWR.............LDDNI.............................EVDRRYT
A1C564_ASPCL/237-752--------ETIFMLQG.LPTSL.FWR.............LDDNI.............................EVDRRYT
Q5AUB0_EMENI/232-744--------EAIFMLQG.LPTSL.LRR.............IDGNV.............................EIDRRYT
Q0UBK8_PHANO/224-738--------ETLFMLAG.LRTSL.YKL.............DPQQSS...........................IRINPKYV
Q2HBB4_CHAGB/228-739--------EALFMLAG.LETSL.FDFECNPIT.............................................RYQ
Q1K6Z8_NEUCR/239-749--------.VVFMLRG.LPTSL.FDLACKPVP.............................................DYV
F4HUK8_ARATH/48-872--------.LLQALQG.FSSPF.IFWDRKEQTF..RAKS......................................EIR
Q6H548_ORYSJ/50-922--------SVFEVLQG.FDTVL.LYWDKTAPGY..CEKA......................................GIY
Q014J8_OSTTA/270-889--------GALHALRAGGEDLE.......................................................RVS
GCP5_MOUSE/273-942--------ETLWLLSG.VKKMF.IFQ.............LIDGK............................VTVRNNII
F1QBQ4_DANRE/270-933--------ETLWLFSG.VKKLF.IFQ.............HNDGK............................VTVRNDVV
C3ZYG0_BRAFL/302-1685--------ESLWVLGG.CQQSF.LYRSREQKLL..LMN.......................................NIK
Q7PX58_ANOGA/302-918--------EILWMFTNPVDCKL.FRI.............DDDQI.............................WINTNVS
Q4P9B0_USTMA/319-997--------ESLSSLMG.SSSML.YSRHSSGQFT..IDNSRK..................................DPL..
Q9VTS3_DROME/266-1244--------HLKKAACG.IESLT.F..PISSADK..LELRVRPNT............................TLPTML..
Q2M0Y2_DROPS/276-1186--------HLKKAAAG.LQSET.FECPAGGGDQ..LQ..IKRNT............................TVRTVL..
Q17IM7_AEDAE/330-1376--------DVKFLITG.FSSRC.FEYDDDNRFR..MVG.......................................NFT
Q0UQH9_PHANO/170-704--------QSLWNLGLGRSSIL.FDFNTKLKSF..EPTVP.....................................QGR
Q5BEM5_EMENI/175-843--------QSLFRVGLGWSSML.FRFNKQRQKF..EKVVK.....................................DIR
Q2UCE2_ASPOR/176-851--------RSLFRLGLGWSSLF.FRYNRERQMF..ERVFD.....................................DIR
Q0D0R6_ASPTN/174-839--------RSLFRLGLGWSSMF.FRYNQQQAQF..ERVFK.....................................DVR
A1CPI0_ASPCL/179-855--------HAMFRLGLGWSSIF.FRYNRQQRKF..ERVSG.....................................GIR
Q4WSG8_ASPFU/170-850--------HALFRLGLGWNSVL.FRYNKQRKAF..ERVSD.....................................NIR
Q2H076_CHAGB/195-897--------ACLSNLALGRSSVL.FSWESEKNSF..VKTSP.....................................CLG
Q4P4I8_USTMA/198-1067--------SLVNTATTGTSSDH.FQWDSDSASFVWAATLQHCKNVRQLRRRYKEQATLRASLAAAGDDVDPPPLLPTAMM
A8BFK8_GIAIC/197-740--------DLIYAMQG.LPGQY.FELIKDPTSG..ISHFVLQRQ............................YQSLSV..
A2E6U4_TRIVA/44-540--------DLFSCLLG.GDGTY.IRRTKQNKYL..VQAIL........................................
GACP2_ARATH/70-583--------DLLSALVG.IEGRY.ISIKRFHGKE..DSIAFQV................................DPSM..
Q0JBZ2_ORYSJ/73-597--------DLLSALVG.IEGRY.ISIKRVRGKE..GYVVFQI................................DSSM..
Q011F8_OSTTA/257-775--------DLLYAMMG.IDGRY.ISAWRRKPLARVKFEVEI...................................GL..
GCP2_DROME/204-721--------ELLHCLTG.IRESLLVPQKPIISAV..GLAKYDTDF............................DIHTHL..
Q29G36_DROPS/282-800--------ELIHCLCG.TRGNFIVPLPPDANST..GIAKYETYF............................TIHAHL..
Q16HU4_AEDAE/210-728--------ELLDCLVG.VKGSL.IGPKKTVRAT..VGLFPVEFE.............................VSDQI..
Q7Q703_ANOGA/248-764--------EVLNCLIG.IKGTL.ITPRKGATTLDPDGALAVEFQ.............................LSNQL..
GCP2_MOUSE/220-738--------DLLYVLVG.VDGRY.ITAQPLAGRQ..NRTFLVD.................................PNL..
SPC97_DICDI/430-1044--------DLLSTMIG.IEGEC.IHIGVVQENE..DDSLQSNLVS..........................FVVEGEV..
A0BDB2_PARTE/150-660--------DLLYAMMS.IEGQY.IKK....KNG..SFEYQIEGH............................LEQSTC..
Q23AE3_TETTS/242-771--------DLLFVMTG.IEGNY.IKKKADQYRK..PYIYCIEPY............................LETSTC..
SPC97_YEAST/62-688--------DLLNVLIG.LEGTY.IRYFNDYEPS......DPETPI..........................EFKIAKKM.
Q6FQY5_CANGA/70-712--------DLLDTMMG.LEGKY.IRYNNSYDPH..VDMMPAFR...............................ISKNM.
Q756H1_ASHGO/63-723--------DLLHVLVG.LEGIY.IRYNNSYEPE......QRRSGALPYD..................IVGPDFKIAKNM.
Q6CXD9_KLULA/57-697--------DLLLVLQG.YEGVY.IRYNSSYRRD......SMTGPE..........................YKVVKMM..
Q6BGV8_DEBHA/61-751--------DLLFSLIG.YEGCY.IRYSEKYDPS..EINSKIRGPD..........................FKIAKHL..
Q59PZ2_CANAL/94-759--------ELLFTLLG.HEGHY.IQYSKRYDPT..SQISRIEGPD..........................YKIAKNL..
Q6C787_YARLI/102-681--------DLLNVLMG.HEGVY.INYSDSYNPR..LELDRLKGPD..........................YRTARGL..
ALP4_SCHPO/74-693--------ELLNAFMG.MEGVF.VHLQDMKASS..EFETIIMPPS..........................FYILPGF..
Q4X128_ASPFU/183-784--------DLLFVFMG.FEGRY.IHYHHTFDPT..AEKDRLAGPA..........................FQLPSGL..
Q7S902_NEUCR/140-744--------DLLFVFMG.FEGQY.IRFAKGYNPY..EERDRLSGPQ..........................WRILSGL..
Q0V2V1_PHANO/184-787--------DLLFVFMG.FEGQY.IRFSETYNPH..EEKERLVGPQ..........................FRILPGL..
Q5KPG7_CRYNJ/181-812--------DLLFVLQG.VEGVL.IRYDEGYDPF..DEEQRVKGAK..........................WRVNPLL..
Q4Q0X5_LEIMA/136-766--------EVLAAAVG.LGGLF.LQYTPAAPGT..SSGISPKEGF...........................QVSPLV..
Q7XUI5_ORYSJ/65-1092--------LALHALHG.VKSSL.................DEIEELSVLFFS...............CPADRTSHRVANVW
Q9VS91_DROME/97-627--------DLIYAFSG.VPSAY.VKPDIQIDQI..SEMSAVDIAKI........................RFRLKKTF..
Q2M118_DROPS/72-608--------NLIYAFSG.VPSSH.IKPEATIKQI..ATMQQSGLPNV........................RFKIDEGF..
Q5CFR0_CRYHO/45-593--------NI.......LPANI.IKK......................................................
Q29HV5_DROPS/23-546--------NVLFSFTG.IQGKF.LRKNVVTGRF..KLDTANT.................................NLL..
GCP3_DROME/235-758--------SAIYSFTG.VQGKY.LKKDVVTGRF..KLDQQNI.................................KFL..
Q16YQ3_AEDAE/217-729--------DVIYACTG.IQGKY.LRKHVVTGEF..KLDHIKG.................................RTL..
GCP3_MOUSE/251-761--------DILYVFQG.IDGKN.IKMSSTENCY..KVEAKA...................................NL..
Q1K720_NEUCR/225-737--------DLPFTLQG.LSSAT.LPFLNDTTLK..LPPTL........................................
ALP6_SCHPO/196-713--------SISYVLQG.ISTEY.VQFKNELALL..SKRI.........................................
Q4PG13_USTMA/283-861--------DVIFLMQG.INGRH.VRFQEEFQYN..TAAAAAAAAASEAGESGPA.........KVVRIVFSEGEAGYI..
Q5KL44_CRYNJ/148-724--------DTLYLLQG.IDGRY.VHFAVSPPKE..QNPYLTERGREGEGTGFPLG......KEGPIIEEGYDDEVVVI..
Q01AM7_OSTTA/101-630--------DVLYACQG.IDGEF.VKFSPAEQAF..VIAPNV...................................NV..
GACP3_ARATH/192-713--------DVLYASQG.IDGKY.VKFNSEIDGY..AVQESV...................................KV..
SPC98_DICDI/112-705--------DIIYVFQG.IDGTY.IKYNKQSDSF..KIDENTSNTLV.........................NGEPAYI..
Q383E4_TRYB2/204-700--------DMLFMWMGVDKTKY.FAYDNACCRY..EMNSG....................................YG..
Q6FLE0_CANGA/180-724--------SIPFVLLG.TTSEL.FDI.............EYDKI.............................IIPSNI.
SPC98_YEAST/187-740--------YVSYTLLA.TTSAL.FPF.............DHEQI.............................QIPSKI.
Q74Z68_ASHGO/190-740--------YISYTLLA.TTSSL.FPI.............SNQVI.............................EIPPNV.
Q6CIT0_KLULA/175-721--------SIPYLVLG.TPSTL.FEL.............KDKKF.............................TIPSNI.
Q6BX70_DEBHA/183-753--------YLSYSLLG.LDSKL.LSF.............SRDGNS...........................IELPPNI.
Q4U9K6_THEAN/45-615--------DLLNVFSG.LGSSF.FIWSKNSE..............................................NSS
Q4N294_THEPA/45-610--------DLLNVFSG.LGSFF.FIWTKNSE..............................................NSS
A8BD62_GIAIC/283-863--------DCIAVLQGCMQTTY.LQVSEQNKEY..VVTIRKEV...............................ATEL..
Q0UGY4_PHANO/31-649--------EILLSLSG.HPSAL.FDTGATSGHV..NSTTSH...................................LL..
Q2H2M0_CHAGB/4-638--------EILLSLSG.HPSPL.LRSASASSST..PPNSDNPNNN..........................NTPTSPL..
Q2UDA7_ASPOR/4-644--------EILLSLSG.QPSPL.FEAHAEEDTV..SEDAFP...................................LL..
Q0CV34_ASPTN/4-641--------EILLSLSG.QPSPL.FNLRTDEDAI..SEDAFP...................................LL..
Q4WZU3_ASPFU/32-668--------EILLSLSG.QPSPL.FAFNTEEDIV..PEDAF....................................PL..
A1C7R2_ASPCL/32-668--------EILLSLSG.QPSPL.FNVHSEEDII..SENAF....................................PL..
C8VMB1_EMENI/4-637--------EILLSLSG.QQSSL.FSFQTEEDAV..SEESFP...................................LL..
Q5KH00_CRYNJ/4-686--------EILLILSG.HPSSFFIPYPSPPAVP..FTCKASPS..............................LTEYL..
Q584R6_TRYB2/3-521--------ELQCALLGFHSASLPFEILKDSPCD..AGVTGTF.................................SQL..
Q0IG23_AEDAE/4-557--------DILFTLFS..............................................................SN
Q7PWU6_ANOGA/4-573--------DILFTLFS..............................................................SN
GCP4_DROME/4-548--------DLLLACRS..............................................................HN
GACP4_ARATH/4-645--------ELLLALLG.FTGDL.I.VDEREQRK..TLGLAFNSDSPLS....................DECTFKLAPDIS
Q60F24_ORYSJ/4-649--------ELLLALLG.FTGDF.V.LDAASSPS......ATRRRRPVPPEAAA...........GGDVGPASFRLAPDLT
Q05AR5_XENTR/4-571--------ELLLALSG.YPGSI.FTWNKRTGLQ..VVQ.......................................DVP
Q01B37_OSTTA/4-547--------DLLLALLG.VPGDV.FIATDAPERA..PSLAVAEE..............................LNFFI..
A0C933_PARTE/4-693--------DLLFSLLG.KPGSF.VKQFDNSPFY..IDESLN...................................LF..
Q24CL5_TETTS/4-831--------EILFGLLG.KSGNI.IIE.............QNDSF.............................VLDPKIT

PF14609

MOD21_SCHPO/60-677-------------------------SILHAQILKLFLELSKPPSDIHVPQIPVY--------------------------
E4WX70_OIKDI/53-731-------------------------SDLHWEILHFLLEMSNSPTRAAEIKNPA.--------------------------
B6K1F8_SCHJY/48-653-------------------------KLGIANVLHLLLTLSAHPRDVVWPKEEQE--------------------------

PF04130

Q2UAG9_ASPOR/234-750LA....................HLSSETLSSLLRSFCSIGSKIDILRRYNQVPR..........................
Q4WEE6_ASPFU/229-741LA....................HTSSEALSSLLRSFSMIGARLDVVRRFVKITQ..........................
A1C564_ASPCL/237-752LA....................HASNESLTSLLQSLGVIGARIDVLRQFTKTKQ..........................
Q5AUB0_EMENI/232-744LP....................HLSHEALSSVLRSICACGTKIDILRRFTRTPQ..........................
Q0UBK8_PHANO/224-738LA....................SAMSNTVQHLLSELVNIGRNVYRLRQWTKRSQ..........................
Q2HBB4_CHAGB/228-739LR....................GVSWDSYKALVTSFSECGRKLAPLRVYVENRE..........................
Q1K6Z8_NEUCR/239-749LE....................GVTWQTYDALVNTFSECGRKLAPLRIYASKKE..........................
F4HUK8_ARATH/48-872VS....................HLSQSSLHVLLAGFLYAATCLKLVESIVSGIN..........................
Q6H548_ORYSJ/50-922VS....................HLSQTSLRAVLKPFLFAATCLKQVELFVGRVR..........................
Q014J8_OSTTA/270-889LP....................HVSCVTLDGALASIRRVVAVLVRVREINQASL..........................
GCP5_MOUSE/273-942VT....................HLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESLP..............PGNG
F1QBQ4_DANRE/270-933VT....................HLTNNCLHSVLEHIAAYGQAVSRLQKFIDEVTGHSAEPCPPG...........LNSSS
C3ZYG0_BRAFL/302-1685VS....................HITPDALQSILQKLAWYGDITHKLHHMIDSVITRSF......................
Q7PX58_ANOGA/302-918LS....................STTEHGIQTFLLNFTEYMTIAYRLRNFCRSILEH........................
Q4P9B0_USTMA/319-997.........................TNSLTEQMEAVAYLASTLSILRSFVKATVFQS.......................
Q9VTS3_DROME/266-1244.........................PEVLADFANHFIRAGCAFLRLSSRTKWNNI.........................
Q2M0Y2_DROPS/276-1186.........................PEVLSDFVQPFLESGTAFRRLSARIKSRG..........................
Q17IM7_AEDAE/330-1376VD....................GVSPVTIKAVVDQFLELGTCFRRLHKMTKKNPY.........................
Q0UQH9_PHANO/170-704TS....................GLSPVAAQSLVTRFIHTGNTFLYLRSFAAKTF..........................
Q5BEM5_EMENI/175-843IS....................GVSTLALSGIIDEMLQCGNNMQRVRTFIGRVP..........................
Q2UCE2_ASPOR/176-851LS....................GVSVAALNSLTDEMIQCGTDMQRVRNFVGKAP..........................
Q0D0R6_ASPTN/174-839VS....................GISLTALSGLVDEMIRCGTDMQRVRNFVIKTP..........................
A1CPI0_ASPCL/179-855IS....................GVSLTAINSVVEQLLQCGTDMQRIREFARRTR..........................
Q4WSG8_ASPFU/170-850VS....................GVSLAVVNGLTEEVLRCGTAMYNLRDFARRTR..........................
Q2H076_CHAGB/195-897IS....................GLSLETVKAVDKLCLDCGNSARHLQAFAEGAY..........................
Q4P4I8_USTMA/198-1067QPWIGS............ERILGWSQAASDSVIRPLLDIGALLRRIDDRTLAIH..........................
A8BFK8_GIAIC/197-740.........................SQTAATFCERIASCGFFYTRCTELLNAVT..........................
A2E6U4_TRIVA/44-540.........................RDSTQSFIDQLIPICDKFYYCQKFSETHY..........................
GACP2_ARATH/70-583.........................DLALQELAKRIFPLCEYYLLIDQFVESSS..........................
Q0JBZ2_ORYSJ/73-597.........................DLALQELTRRIFPLCEDFVLVYHFVESRS..........................
Q011F8_OSTTA/257-775.........................EAPLAALVNNMLPLCTDAATVRAFIESRQ..........................
GCP2_DROME/204-721.........................DRSLTHQVREILPLASYFMGVQKIIAATD..........................
Q29G36_DROPS/282-800.........................DKSLTELLQDILPLASYFIGIQKMMAATD..........................
Q16HU4_AEDAE/210-728.........................EESLRDIVREILPLASHYSQVQDFIAASS..........................
Q7Q703_ANOGA/248-764.........................TESCRDMVVEVLPLAANYSAVQSFIEGAS..........................
GCP2_MOUSE/220-738.........................DLSIRELVNRILPVAASYSTVTRFIEEKS..........................
SPC97_DICDI/430-1044.........................DPSNNDLVQRILPLCSYYSFVNDFIQIRY..........................
A0BDB2_PARTE/150-660.........................DLSLQQMVSKILPMCSQHDFIENYIQQKI..........................
Q23AE3_TETTS/242-771.........................ESSLKQLVNKILEICLQYDKIQNYIAQHQ..........................
SPC97_YEAST/62-688.........................DPSFKTFSRRIVRYGKQYMILTRAYEKWS..........................
Q6FQY5_CANGA/70-712.........................DKSLKQCCIKILKLSKSYIFINNCIQEWS..........................
Q756H1_ASHGO/63-723.........................DPSLKSVAKRISKVGRLYVILSEFINRFE..........................
Q6CXD9_KLULA/57-697.........................NVTFKSFSKKLIKIGSIFVKLDKFQQWCC..........................
Q6BGV8_DEBHA/61-751.........................DISLKCITKKLVKFGKYYSGLNGFLELYD..........................
Q59PZ2_CANAL/94-759.........................DISLKVITKKLVKFGKFYSGLKSFIQVFD..........................
Q6C787_YARLI/102-681.........................DPSFKDFTRACIKIASTYVSLSAFVDKMT..........................
ALP4_SCHPO/74-693.........................DLGIKDIASEMLEMGSHYLSITAFIESRS..........................
Q4X128_ASPFU/183-784.........................DPTLRDLTSSMLKMATHYSALESFVEVQS..........................
Q7S902_NEUCR/140-744.........................DPSLLDLTQSMLRMASHYTALETFVDVQS..........................
Q0V2V1_PHANO/184-787.........................DPSLRDLTKSMLKTATHYIAVETCIEVLS..........................
Q5KPG7_CRYNJ/181-812.........................DASLLSLVKRLLPLASFFTAVEASMELRT..........................
Q4Q0X5_LEIMA/136-766.........................PASMRSLCETVLPVADAFMALRCIEKAEY..........................
Q7XUI5_ORYSJ/65-1092SR....................SSSTTSVGNILKSIRTTGLSVLFLCKFLHFYLFQSRELNGRGRE......GHEHEVSD
Q9VS91_DROME/97-627.........................TGAFRALANETLPLIGYYISVQSYIEETN..........................
Q2M118_DROPS/72-608.........................NSTIRTLGNYLLPLVGHFISVQNFIETTN..........................
Q5CFR0_CRYHO/45-593.........................NPSLYPLSYKTLELSSLHRRIRKFLKVHE..........................
Q29HV5_DROPS/23-546.........................TTGDAGLMLRLSELGYYHDRVAEFADPSK..........................
GCP3_DROME/235-758.........................TTGQAGMLLRLSELGYYHDRVVKFSDVST..........................
Q16YQ3_AEDAE/217-729.........................SIGDAGMILQLAEVGHFHDRVVKFTDPKS..........................
GCP3_MOUSE/251-761.........................NKSLRDTAVRLAELGWLHNKIRKYADQRS..........................
Q1K720_NEUCR/225-737.........................PIPIISLLNTLAEPSLLYRGLNEFTKTPA..........................
ALP6_SCHPO/196-713.........................PVQYLLQMRALSETGLLYQELKVFSNYDPSVSQSID.................GD
Q4PG13_USTMA/283-861.........................NAPTKRIVHRLAELGQLYKRVSEFSQQRS..........................
Q5KL44_CRYNJ/148-724.........................SQPTRTLLMQLSEMGMLYRRVTNFVNSRQ..........................
Q01AM7_OSTTA/101-630.........................SAGRRNLIKSLTEVGWLFKKVTSSLGDARTT........................
GACP3_ARATH/192-713.........................PRATRIMVRMLSELGWLFRKVKTFITESMD.........................
SPC98_DICDI/112-705.........................SKPKRDLVYRLCEFGWLFKKVRLFITNND..........................
Q383E4_TRYB2/204-700.........................TVRQRQAFSAFQECGCLAHQIDDALRGGT..........................
Q6FLE0_CANGA/180-724.........................PNSESGILHLIFEAGLLYKELGNLCDKYR..........................
SPC98_YEAST/187-740.........................PNFESGLLHLIFEAGLLYQSLGYKVEKFR..........................
Q74Z68_ASHGO/190-740.........................PNGESGVFHSIFEAALLYQYLSNQVEKFK..........................
Q6CIT0_KLULA/175-721.........................PNGESQQLHDIVEAGLLYLHLQIRVEYLK..........................
Q6BX70_DEBHA/183-753.........................NSSYSGLLHSILEPGLVYKKLKLFVDSNK..........................
Q4U9K6_THEAN/45-615FDIENNPLINGNTIYNLFIIYLIYVGNEMIEVCHEILRIHFDQLTLLEFVASSY..........................
Q4N294_THEPA/45-610YYIEN.............NPLIQDVGDDMIEMCHEILRIHFDQLTLLEFVASSY..........................
A8BD62_GIAIC/283-863.........................PATLVAMTQRVLVHAHARFQIVNTIYTHQ..........................
Q0UGY4_PHANO/31-649.........................SPPEAELLSSIGHLSRLHRKVRDHAARIA..........................
Q2H2M0_CHAGB/4-638.........................TPPERALLASLAHLSELHIQLLTSTAHIA..........................
Q2UDA7_ASPOR/4-644.........................SPPEKALLASLARLSRLHAKLRAHTALIS..........................
Q0CV34_ASPTN/4-641.........................SPPEKALLTSLARLSRLHAKLRAHTASIS..........................
Q4WZU3_ASPFU/32-668.........................SPPEKALLTSLARLSRLHAKLREQTSLIS..........................
A1C7R2_ASPCL/32-668.........................APPEKALLASLSRLSKLHAGLRKHTALIS..........................
C8VMB1_EMENI/4-637.........................SPPEKALLASLARLSRLHARLQAHTALIC..........................
Q5KH00_CRYNJ/4-686.........................HPGEVASLNSLADLAFQYRKVKTWANDTIDCGRKAILAESLPP..SRKGKEREVF
Q584R6_TRYB2/3-521.........................HPSERSLVGEVLPLGEMCQTLRALATDFA..........................
Q0IG23_AEDAE/4-557SDLPIENFT......IPEVAANFLHPG.EIKILEDLIRIANQYKELKKFVHQYGTQSAGLVK...............PKQ
Q7PWU6_ANOGA/4-573AELPIENFT......IPEVASTFLHPG.EIHILEELIRIANQYKEIKKFVQQYGTLNAGLLK...............PKQ
GCP4_DROME/4-548PEQLGIKAF.....NETTVIDQFIHPC.EREIFMDIIKIIKVYQEVEQFTHSSGRKSD......................
GACP4_ARATH/4-645F.....................IEPS..ERDLIERLIKLGFYYRELDRFAKKSRNLSWIRSVTSVH.......PLERADE
Q60F24_ORYSJ/4-649F.....................LQPS..ERSAIERLISLGFYYRELNRFATESRDLSWINSPIDV.........SPTHGE
Q05AR5_XENTR/4-571F.....................LHPG..ETNVLNRLCKLGTDYIRFTEFIEQYTGHVQQQD.................HH
Q01B37_OSTTA/4-547.........................KPHERERLNNLIRIGASYGALERVTRSERESVI......................
A0C933_PARTE/4-693.........................SKPEIVQLNQIVNLGYHYQQIDNFLQNQE..........................
Q24CL5_TETTS/4-831F.....................LTPA..EKEIINSLCCLGYYYKNLEQFLDENYNNFAKITYFMNKNNNFNENCDDQNDG

PF14609

MOD21_SCHPO/60-677-KDCNKN.EQEAIIQ.....LLTSCEGDHWL..MPDWSSMPDDET-----------------------------------
E4WX70_OIKDI/53-731-KRLNASIEEEAEKSEDSENMEEFDNGDRWDDKLSEWSE......-----------------------------------
B6K1F8_SCHJY/48-653-EDISDELASEKLINQDDTYLSAPFEGEHWD..IPNWESSDSDTS-----------------------------------

PF04130

Q2UAG9_ASPOR/234-750.........VIPYLQTFHRGIEDRLR.EFDR.FLSNVQAQY....LSQS...............................
Q4WEE6_ASPFU/229-741.........VVPYMQTFHRCVEDCLS.QFDA.FLSEVQTQC....ISQG...............................
A1C564_ASPCL/237-752.........AVPFMQTFHRCIEGHLH.KFDA.FLSKIQSGF....LPQR...............................
Q5AUB0_EMENI/232-744.........SAAYMQTLHRSTEDCLH.KFDK.FLSEMQNKF....LSRD...............................
Q0UBK8_PHANO/224-738.........TLPLIQTFESTVRMRLV.AFDR.ALADVQQRY....LTPN...............................
Q2HBB4_CHAGB/228-739.........QSPLLQVFRACLQKALH.HLDL.ELSLIQTSLVAIKED.................................
Q1K6Z8_NEUCR/239-749........KEEPLLQVFQDSLQKALQ.SFDQ.ELTAIQGRFVAIHKD.................................
F4HUK8_ARATH/48-872.....ASLKSPPTLMAFSNSASGWLE...AN.IALNEEVKINDSNVA.................................
Q6H548_ORYSJ/50-922.....SCGHGTPTLSAFASSVDSWLM.RLRK.AALKEEEQLFLS.VE.................................
Q014J8_OSTTA/270-889........KFGPTIQAFAHALDARGR.ALVS.ELAPLENRLSSDSTT.................................
GCP5_MOUSE/273-942PIPKKQPDAPFRTYQAFMWALYKYFI.NFKE.ELTDIEKCVISSDT..................................
F1QBQ4_DANRE/270-933SSSKKSSEPPFRTYQAFVWALYKYFT.SFKE.ELNAIEKDIIAKDE..................................
C3ZYG0_BRAFL/302-1685GCHDNGEPSVSRTQQAFTSALLRCLQ.DFNK.KLAALEKRLVLQEE..................................
Q7PX58_ANOGA/302-918...TARSLPAPHSFECYAAGVKSFL..DHMESVMIRHEKELIKQEPG.................................
Q4P9B0_USTMA/319-997.IHTVDALTRTPAVEAFAEQLQALLE.NLCS.QFSELDADIAAGSTLAHPAV............................
Q9VTS3_DROME/266-1244....AEMRLERPLNRAMRETIMDYLS.TTRQ.FLLSLQA.........................................
Q2M0Y2_DROPS/276-1186......PRLEGPLNRAMRDTIIDFLA.TNRQ.FFLSLPA.........................................
Q17IM7_AEDAE/330-1376...NYAMILEGFVFKAFCDCVERILS.CFRV.VVTCYDG.........................................
Q0UQH9_PHANO/170-704.....ASATSIPARVALATTVSSVLY.TLEE.QLGKYSSKI.......................................
Q5BEM5_EMENI/175-843.....TAAAEPSALSAFSTAASVIVY.TLEK.QLLHSFKQI.......................................
Q2UCE2_ASPOR/176-851.....SKSTKLSALSTLSSAVAVVIY.IVEK.RLLRDADNI.......................................
Q0D0R6_ASPTN/174-839.....SGSGIPSALSTLSSAAAVIVY.TLEA.QLVRNYKQA.......................................
A1CPI0_ASPCL/179-855.....VKSREFSARSAFSSTIAAIVY.TLEK.RLSGYSRGI.......................................
Q4WSG8_ASPFU/170-850.....IKPEGFSARSAFASAVAMIIY.TLEK.QIINYFKEV.......................................
Q2H076_CHAGB/195-897......SIASTPTRVALAGVVDRLVT.AVRS.ELKNNSHGV.......................................
Q4P4I8_USTMA/198-1067....RSSATLCSEATALAAALDTVVT.WFKA.ELATQSSTLVSNSSAS................................
A8BFK8_GIAIC/197-740......KTNMGKTRASLCEALHTGLS.EYRQ.RISLLDSQLTEEQ...................................
A2E6U4_TRIVA/44-540......YLKYGKIVHTVCNAIRKYLL.QFME.QVSEIEALPV......................................
GACP2_ARATH/70-583......QFKNGLVNHAFAAALRALLL.DYQA.MVAQLEHQFRLGR...................................
Q0JBZ2_ORYSJ/73-597......HFKSGLVNHALAAALRAFLL.DYQA.MVAQLEHQFRLGR...................................
Q011F8_OSTTA/257-775......DFKHGFVSHALAADLRELLN.DWST.LIVQLEHQRNIGS...................................
GCP2_DROME/204-721........GLGQVMNSLNEALQELTH.DFYL.IIVQAEQELRHNR...................................
Q29G36_DROPS/282-800........GHGQVVNSLNAALQDLTN.DFYV.LVVQSEQELQQQQ...................................
Q16HU4_AEDAE/210-728......SLESGQVLQALRAALQAIIK.DYYL.SITQLEDLFLKQQ...................................
Q7Q703_ANOGA/248-764......VTEGGVVLQALRSVLKTIMT.DYYL.SIAQLDDLRCRRG...................................
GCP2_MOUSE/220-738......SFEYGQVNHALAAAMRTLVK.EYLI.LVTQLEQLHRQGL...................................
SPC97_DICDI/430-1044......AYEWGIINHSLCFSIDQLLK.EYLV.LVSQLEGQLKSER...................................
A0BDB2_PARTE/150-660......KFENGYISQAFCSAIKELMQ.KYLL.MVNQLDYEFNQGE...................................
Q23AE3_TETTS/242-771......QFSFGTVSQALCAALGLLLR.EYVV.MINQLDQEFQKAE...................................
SPC97_YEAST/62-688......DTSFGMVLQRFAYEIRRFLEDVYLKTLVERLERDFNKVPN..................................
Q6FQY5_CANGA/70-712......RPSYGCILHRLTYEIRKFLKDGYLRFIVERLEKEYSSNVS..................................
Q756H1_ASHGO/63-723......QTRYGTVLHRMCFVVRRFLTDDYLPFVVGKLERWFQEDAR..................................
Q6CXD9_KLULA/57-697......DERYGRVMHRLGHEVRIFLYENYLS.CIKELEIRFQQDVK..................................
Q6BGV8_DEBHA/61-751......RPEFGKVVQRLCFAISEFLI.VYQQ.VIKHIEDEFKFNST..................................
Q59PZ2_CANAL/94-759......NNKFGKIVQKFCSEVRKFLS.SYQQ.VLINVEHEFKFNKN..................................
Q6C787_YARLI/102-681......RDRRGLVNGALAASIRKLLK.EYVK.LAQGLEYSLRFESG..................................
ALP4_SCHPO/74-693......HFEYGFVNHALCAALRKFVM.DYVV.LIMQCENQSRIDPN..................................
Q4X128_ASPFU/183-784......RAEYGAVNHALCATIRRILK.DYLI.LVAQLETQLLNHSN..................................
Q7S902_NEUCR/140-744......REEFGAVNHALCASIRRYLH.EYLV.MVVQLETQFLNDEN..................................
Q0V2V1_PHANO/184-787......REEYGAVNHALCAAIRRLMK.DYLT.LIAQLEHQLLTNDS..................................
Q5KPG7_CRYNJ/181-812......APEYGMVSHALCSGIRAMLK.EFRV.LTAQLESLFLTSPT..................................
Q4Q0X5_LEIMA/136-766.......SSCSLVLMALGEVVSEINT.SYAH.QVSKLQLWSEGRP...................................
Q7XUI5_ORYSJ/65-1092SEETEQPAPYSLVNQAFAAAVEKVLE.GYFC.SLNTLPASIKLRRLEGQPDIPSMT.......................P
Q9VS91_DROME/97-627.....MSPNCGRTRLTLATALSDQLQ.DYYD.LQSKLETDLQDKK...................................
Q2M118_DROPS/72-608.....MTPRSGRTSLALAAALNDKMQ.QYYD.LQATMETEMQQRK...................................
Q5CFR0_CRYHO/45-593....SGNSQFGIISNTLCDSFRELLR.HFMI.KITKFESNLRKGQ...................................
Q29HV5_DROPS/23-546.....GYSALGCMGQALTCFLRKELG.AYHG.EVALLHDQVNDFKKAQLKRGFADR.......................E
GCP3_DROME/235-758.....GFNAIGSMGQALISKLKEELA.NFHG.QVAMLHDEMQRFRQASVNGIANKG.......................K
Q16YQ3_AEDAE/217-729.....DCYMKGNFGQGYIAALQRELT.QYYG.MLAILQEDLNRQRKERTGL.............................
GCP3_MOUSE/251-761.....LDRSFGLVGQSFCAALHQELK.EYYR.LLSVLHSQLQLEDDQGVNL.............................
Q1K720_NEUCR/225-737.........NGLLGQSLRAAISKELR.SYLT.LVATLETQIRRALSELDESAP...........................
ALP6_SCHPO/196-713NVSKAFINDQSLALQSLKSVISKELT.NFLA.LIASLDSQIRADASLE................................
Q4PG13_USTMA/283-861.....AMPASGLIMQSLCHFISKELT.GFYR.LVASLEAQMSNGSKNSPGLAQDANV.....................AA
Q5KL44_CRYNJ/148-724....AGDSKGGMIEQSLCHFLHHELS.EYHR.LLAVLESQMNTASSSGEQ..............................
Q01AM7_OSTTA/101-630..GVDVETGEGSTRQAFQAAIQRELA.EYYK.LVAVLESQAQVPIIGFMPDGKDA.........................
GACP3_ARATH/192-713...RFPAEDVGTVGQAFCAALQDELS.DYYK.LLAVLEAQAMNPIPLVSES.............................
SPC98_DICDI/112-705......FKKTGLTNQSFCSAINDELI.ELYR.IIAILETQVYKKFDMVNYGGGGGGSGGSGSGSGLESPSSVSSGGTTTS
Q383E4_TRYB2/204-700.......SERSFLQQSLRGAVRRHLS.QYHT.LVASFRGRQTPP....................................
Q6FLE0_CANGA/180-724......RMPISPMKKAFIIAVGSELN.TYNG.LINQLASNDKI.....................................
SPC98_YEAST/187-740......MLNISPMKKALIIEISEELQ.NYTA.FVNNLVSSGTV.....................................
Q74Z68_ASHGO/190-740.....VASSLSPLKVNFLTVVSERLR.EYSR.VVNQLSSSIAS.....................................
Q6CIT0_KLULA/175-721.....KHVTTSTLKVAFLTLIQSKLR.DYSN.FVNNFSSHLHPL....................................
Q6BX70_DEBHA/183-753......GKIVSPIKTAFLRSLESELN.YYVNHINEYFNTEP.......................................
Q4U9K6_THEAN/45-615.........TGVICESITAEFVEILE.DLQE.CVTRFHDIHITSF...................................
Q4N294_THEPA/45-610.........TGVICETITAEFVDVLE.DLQE.CVSRFHDIHITTF...................................
A8BD62_GIAIC/283-863......VPEYGRIANAFSQALRCIIK.EYDF.YLADLSKKHYGKMQSSA...............................
Q0UGY4_PHANO/31-649......TTHPSTVCRAVAAAVTSHHLESFQR.KILDVESRILKQDASTVG..............................
Q2H2M0_CHAGB/4-638......AAHPSVICRAVASAVDALHLAAFRR.KVRAVEETLLRRDAALVG..............................
Q2UDA7_ASPOR/4-644......SSHSSVICRAASTAISTQHLGDFQR.KVLEVEKSILVEDSGYVG..............................
Q0CV34_ASPTN/4-641......ASHPSVVCRAVSTAISKHHLGNFQK.KILEVEEAILTEDSGYVG..............................
Q4WZU3_ASPFU/32-668......SSHPSIICRAVSSAINAHHLGGFQR.KILEVEKAILAEDSAYVG..............................
A1C7R2_ASPCL/32-668......SSHPSVICRAVATNISAQHLGNFQK.KILDVEKAVLAEDSAYVG..............................
C8VMB1_EMENI/4-637......STHASVICRAVSTAIRSHHLGAFQK.KILEVEKAILVEDSGYVG..............................
Q5KH00_CRYNJ/4-686MNDKGDSIKLNQYLVTLAASIIEVLN.GYEL.LIVETEAKVLSFDPAVVQ..............................
Q584R6_TRYB2/3-521.....VGRTDGLYISAIASAVVQILR.SYEE.SVRAA...........................................
Q0IG23_AEDAE/4-557QKPSEEPLPQGLYLQAFADGLDLAVK.PYRD.LIVHLEAYY....LKR................................
Q7PWU6_ANOGA/4-573QKPTEEPLPQGLYLQAFVDGLELVVK.PYRD.LVVELEAKY....LKR................................
GCP4_DROME/4-548THGELPDSLHGYYLLNLAKGIEMALE.EYYA.EIGRLEKYC....LGN................................
GACP4_ARATH/4-645LSKQSREKKPSVYRRAIANGIGEILS.VYRS.AVLHIEQKL....LAE................................
Q60F24_ORYSJ/4-649KTVKAKVRKGSAYRRAIANGIAEILS.VYRS.AVLQVEQNL....LSD................................
Q05AR5_XENTR/4-571PSQQGQVGLHGIYLRAFCRGLDSILQ.PYRQ.ALLDLEQEF....LAD................................
Q01B37_OSTTA/4-547DHDGLDVKSGSLYRRALASGVDEILD.AYEA.KILKLEQDA....LRRR...............................
A0C933_PARTE/4-693........EKSSYIKALVFGIDNSLN.DYRQ.TILTLEQEYLNEKM..................................
Q24CL5_TETTS/4-831PIAEVNVIGNSAYLKGFCLGLEQIIN.SYRE.KIIEIERDF....LEN................................

PF14609

MOD21_SCHPO/60-677----------ITEDSEEETFNG--NANEITIPANI.HIPIIEESDNASNNKLC---------------------------
E4WX70_OIKDI/53-731----------VTKSEESEEETD--ENERKNEASGFPEIPT..KFKNFEKIDRI---------------------------
B6K1F8_SCHJY/48-653----------VTFYEETPPVIP--DNENIQDPQYYPHAKVSEHTEDYAYQQYE---------------------------

PF04130

Q2UAG9_ASPOR/234-750......RTIAVSLLQLYESVLR..ESKLLLLLAEIV............SNLRHDAS........................
Q4WEE6_ASPFU/229-741......APFSVSLLQLAEDVRT..ASAMLVLLADLI............SNLEYDSP........................
A1C564_ASPCL/237-752......TSVSISLLQLAEDVRN..ESRMLVILSDLI............SNLQCNAS........................
Q5AUB0_EMENI/232-744......SSVAVSLLQLLDDVQR..ESKLLTLLADLV............SNLDRTAV........................
Q0UBK8_PHANO/224-738......SPAAVSLLQLHTEVRS..MSAPLLRLAHLT............SDVEVA..........................
Q2HBB4_CHAGB/228-739........VVVSLIGVLGELGP..KLAPLYGLADIV............RQVQQERN........................
Q1K6Z8_NEUCR/239-749........VIVSLVAMLAELGP..SLAPLYVLSGIV............QQVHRERN........................
F4HUK8_ARATH/48-872........VTPTLLGLTSSLSS..LCSDAEYLFQVVRGAIPHAYFESSSAIST...........................
Q6H548_ORYSJ/50-922........RTITLLGLTDSMSS..LCSGAEHLYQVVQGAVPDAFWNSGAQMAS...........................
Q014J8_OSTTA/270-889........APPTLLELRASVRK..LETKVDALEHVALNAFPMEGTPAAEAASH...........................
GCP5_MOUSE/273-942.........TITLAIVVNKLAP..RLAQLKVLDKVF................STGVAEV.....................
F1QBQ4_DANRE/270-933.........TVTLSSVLERLSP..HLAQITMLHRVF................CTGVAEV.....................
C3ZYG0_BRAFL/302-1685.........LITLSTMMGTLQE..QFGDLEMLYTVYQLGVVSPSTDKTNDVLKASRLLSVLYQNILQYNTLGDAANTKYN
Q7PX58_ANOGA/302-918........KTHTIIKLFHELEP..ELFVLKKLYDIH................KFSVLD......................
Q4P9B0_USTMA/319-997....IRTNRYTTLTQLINFSYS..KAASVLLLARLLKDMGFISGHGGDTDVSLIPRGS......................
Q9VTS3_DROME/266-1244..........DSLFQLLNNTST..AIQLLCQLDRMF................ENEPR.......................
Q2M0Y2_DROPS/276-1186..........ESFSQLLMSAQP..AMRLLQHLERMF................ETEPS.......................
Q17IM7_AEDAE/330-1376..........KSLLQLQRNTDP..MRKQILALAKFC................GIHPN.......................
Q0UQH9_PHANO/170-704..........RSLIQLQHQFSK..PREVLLHVARMV............DATQH...........................
Q5BEM5_EMENI/175-843..........SSVLQIRALFQR..CAELIGVLVNMM............DAVET...........................
Q2UCE2_ASPOR/176-851..........LSLIQVRALFQR..CGELAGVLADLV............EAVEG...........................
Q0D0R6_ASPTN/174-839..........VSVLRIKSLFEP..CREIVAALANII............ESIEG...........................
A1CPI0_ASPCL/179-855..........SSLLQITSLFER..CGELVHALATIV............EAVEK...........................
Q4WSG8_ASPFU/170-850..........SSLIQIMTLFQR..CGDLVGALSNIV............EAVQK...........................
Q2H076_CHAGB/195-897..........RSILQLQSVVQP..ARSILLYFKGLV............KKLAQ...........................
Q4P4I8_USTMA/198-1067.......VKCSAVLNAHAELET..CFAVLKNLGNLL................SCGQPRT.....................
A8BFK8_GIAIC/197-740..........MTLVELTAVANL..IREEISTLAVIADNCLYDKSLTSPQ...............................
A2E6U4_TRIVA/44-540..........KSLPVICINISK..SAEFLDVLSEIV............TKIEN...........................
GACP2_ARATH/70-583..........LSIQGLWFYCQP..MMGSMRALAAVIQQA......STKQ...............................
Q0JBZ2_ORYSJ/73-597..........LSVQGLWFFCQR..MMSSLNALAVLVEKA......ISNN...............................
Q011F8_OSTTA/257-775..........LSLQAAWFYCQP..AAPALRLMANIASR........AFY...............................
GCP2_DROME/204-721..........LTLQKLLYYLQP..TMWVMHEVWSSLVII......QLSD...............................
Q29G36_DROPS/282-800..........LTVQKLLYYLQP..TIWVMEELWTTLVNV......QLNE...............................
Q16HU4_AEDAE/210-728..........LTFHKLLYFLRP..VFHTMEVLAETVTAI......RQTN...............................
Q7Q703_ANOGA/248-764..........LSLQRLIQFLKP..VYPTMEELAATVSEI......RRSN...............................
GCP2_MOUSE/220-738..........LSLQKLWFYIQP..AMRTIDILASLATSV......DKGE...............................
SPC97_DICDI/430-1044..........LSLQRMWFYLQP..TIKTFEILYRVTSEI......MRCN...............................
A0BDB2_PARTE/150-660..........ITLQKFWYYTQP..SIRIINSIYVLIQS........LSK...............................
Q23AE3_TETTS/242-771..........LTLQKLWFYIQP..SLKVMEALYKLVSE........TEN...............................
SPC97_YEAST/62-688..........FSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESS............
Q6FQY5_CANGA/70-712..........FSIRDMEHMINDYELSKKMEILYNLCLRLNEEMNRRLNMNLDQEDFNNFKRELEDV..............
Q756H1_ASHGO/63-723..........FGIRIMEQLLNE.EIIYKARLLYELVMCVVNEMERRDKVDLAEADFENFIQDLKMGSDAGA.........
Q6CXD9_KLULA/57-697..........FSIRDLEMVLED.GFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDTN............
Q6BGV8_DEBHA/61-751..........FNLSIFETILNQ.ELSLKLSHFYDIVIAVHTETIERSKYKHQTSESYFNNFIKSIQNDL...........
Q59PZ2_CANAL/94-759..........FNLNMLDSLLHQ.EISNEMTHLYQIGIEISRITEERQKMSQ.AEIMGNFEPTTLANTS............
Q6C787_YARLI/102-681..........LTLHKFHLKLMT..IGGILHETHELAKDILREDEVRFHNATLEPSNDLDALLAKFRENS...........
ALP4_SCHPO/74-693..........FSLQTLRLYTLP..TSRSLRQVYLILRDLLLSMEKNASSSDDLGLSNIDDLLEQLNEG............
Q4X128_ASPFU/183-784..........FTLHMLHLHTMP..TSQCLSQLYSLGQELLRRNGLLDQDIDESIDDFDDVDNILEQL.............
Q7S902_NEUCR/140-744..........FTLQQLNVHILP..SSHLMAHMYGLALELLKRNALLDDDSDESSDSSDDDFDHIIEQL............
Q0V2V1_PHANO/184-787..........FTLHVLNLHTKQ..TSHMLFQLYTTGIELLKANDILEDDKDEDSADDDSNDFENI...............
Q5KPG7_CRYNJ/181-812..........FTLQTLYLHLHP..TLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLGGMAEELGLGGAG.........
Q4Q0X5_LEIMA/136-766..........MPLMGVVSEILR..VGHHVVRLRQVLPMDLICSALAEAAAAAADPTSST.....................
Q7XUI5_ORYSJ/65-1092DGASYNSNSEITLLEVYLHTEE..LRRHIKSLGNICFPKFAGLSLCQEGLTTDSNLGFE.....................
Q9VS91_DROME/97-627..........LDLKDLVRQVRP..WLPILKTFSNMA...........SS...............................
Q2M118_DROPS/72-608..........LFLKDLVRQLRP..WVGILKVFSSMV...........TS...............................
Q5CFR0_CRYHO/45-593..........LTVQNICAYSQQ..ALITLKALDLISVQ........VLH...............................
Q29HV5_DROPS/23-546QEWLDSQREQVTLFKLLVWYTK..PLHRMQWLTKIA............HSCMM...........................
GCP3_DROME/235-758KDSGPDAGDEMTLFKLLAWYIK..PLHRMQWLTKIA............DACQV...........................
Q16YQ3_AEDAE/217-729....TGGGDRLTLKKLRLWLTS..PMERLQWLAQIS............ESCKE...........................
GCP3_MOUSE/251-761.....GLESSLTLRRLLVWTYD..PKIRLKTLAALV............DHCQG...........................
Q1K720_NEUCR/225-737..RGGIGKTGVTLKRCVVWTRE..ATMGLRLMSLIA............EESKN...........................
ALP6_SCHPO/196-713.......KPMVTIRRCIAWTQV..AKLKLRILSSVV............NDNMN...........................
Q4PG13_USTMA/283-861GVGSDASTAYVTLKRLSLWTDE..MTLRFRLMSTIV............ESCQD...........................
Q5KL44_CRYNJ/148-724......PDSGLTLLRLRLWTED..MKLKLKQMSTIV............DEAKN...........................
Q01AM7_OSTTA/101-630.PAAKGADAYLTLRRLFLWLAD..PLKTLRTLAILV............DATYG...........................
GACP3_ARATH/192-713....ASSNNYLSLRRLSVWFAE..PMVKMRLMAVLV............DKCKV...........................
SPC98_DICDI/112-705TEIPFIDGDSLTLIRLFVWIQS..PLKRLKVLGTCV............DSITV...........................
Q383E4_TRYB2/204-700..........MAFGDLVVAFKR..VQPKLRVLHTML............KETEN...........................
Q6FLE0_CANGA/180-724..........STNNGVYVSIYD..SINKLRVFYSIM............LKFEG...........................
SPC98_YEAST/187-740..........VSLKSLYREIYE..NIIRLRIYCRFT............EHLEE...........................
Q74Z68_ASHGO/190-740..........ESVKSIYIQIYT..QILVFRFYHGYL............ERFEQ...........................
Q6CIT0_KLULA/175-721..........DPLCFTYQHLYP..EVLKLRTYMEYI............ENFEK...........................
Q6BX70_DEBHA/183-753..........TSLIAVYNALFP..FILKLRLLYSLT............NELNL...........................
Q4U9K6_THEAN/45-615..........LGLQKLLNYLRP..SMQTLSTLASLVTEFDSKRLIDNNSNIGV...........................
Q4N294_THEPA/45-610..........LGLQKLLNYLRP..STQTLSTLASLVTDFDTKRLTDDNSNIGV...........................
A8BD62_GIAIC/283-863......ERGSLSLQTLEVKTKQ..IHIILENVADLC............SRLGV...........................
Q0UGY4_PHANO/31-649......AYNIVPLAGIVGEFSE..WIRLLEWLWELSTFMLSPHVQPNAEKGLV...........................
Q2H2M0_CHAGB/4-638......AYDIVPLTAVVAEFAG..WARRLEWLAGVVAVMVGGGGSGSGSGSGSGSGSGGG....................
Q2UDA7_ASPOR/4-644......GYGIVPLSTIVGEFSP..WTRRLEWLWEVARFILPNHKKANNQS..............................
Q0CV34_ASPTN/4-641......GYGIVPLSTIVGEFSP..WTRRLEWLWEVARVIKPEQPQSKSHG..............................
Q4WZU3_ASPFU/32-668......GYGIVPLSTIVGEFSP..WTRRLEWLWDVTRFVLPENRTSSAHG..............................
A1C7R2_ASPCL/32-668......GYGIVPLSTIVGEFSP..WTRRLEWLWEVVHFIIPEQGTGSAQG..............................
C8VMB1_EMENI/4-637......GYGIVPLATVVGEFAP..WTRRLEWLWEVVRFILPTEKKKHTQS..............................
Q5KH00_CRYNJ/4-686.....DQQGYVPLASIVATFDR..WRAPLTALSQIVDQLSSFDEREDSWSPGR...........................
Q584R6_TRYB2/3-521..........VTPSSVVSLRPT..YFLAFSLIMEMV................Q...........................
Q0IG23_AEDAE/4-557........PNLSLIFIYHQVNQ..YQSLFGFLLRLV............SGVVT...........................
Q7PWU6_ANOGA/4-573........PNLSLMFIFHQVSQ..YRSLFGFLLQLI............SGVVT...........................
GCP4_DROME/4-548........ERNSLSYVYNALYA..KFPLLVFMRNLI............TEIHV...........................
GACP4_ARATH/4-645........TTPILATVTEGLNK..FFVLFPPLYEVI............LEIER...........................
Q60F24_ORYSJ/4-649........PLPILATVTHGLNK..FEVLLPPLHELV............MEIEQ...........................
Q05AR5_XENTR/4-571........PHLSISHINYSLDQ..FHLLFPSVMVVV............EQIKS...........................
Q01B37_OSTTA/4-547.......GDAGTLSSIESELSE..ERAVIPALMELF............GEVLD...........................
A0C933_PARTE/4-693..........FIVSQLNVRLQA..YYQILLNLHTSI............NIIQQ...........................
Q24CL5_TETTS/4-831........RVFTIASLKIKLTS..HFDILPDLHKIV............IKIVE...........................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685TLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLG
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685DAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLS
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685VLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKYNTLGDAANTKVCILKASRLLSVLYQNILQ
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688...............................................................................L
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723............................................................................TGDS
Q6CXD9_KLULA/57-697...............................................................................D
Q6BGV8_DEBHA/61-751..............................................................................KE
Q59PZ2_CANAL/94-759..............................................................................MN
Q6C787_YARLI/102-681..............................................................................VE
ALP4_SCHPO/74-693...............................................................................N
Q4X128_ASPFU/183-784...............................................................................K
Q7S902_NEUCR/140-744...............................................................................R
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812...........................................................................LKGLM
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677------------TLFKKSKQPNLDFLQIKPFMFWDSSLNETVRISERSIIRD.SIYMLIGYPSFFFLKNGSKIETRLSLL
E4WX70_OIKDI/53-731------------YIFEEEAQKIADKYPEKK..........VYRIGEQPWKGEKTIGKLYG..............EILDHV
B6K1F8_SCHJY/48-653------------DPVSHASETLLQRILEKE....SSGTPQLLQLSQQSMLYE.IIYMLMGYQGHIF....TCVEGVFRPA

PF04130

Q2UAG9_ASPOR/234-750..........DSPVR......CLDLLYDSVCMT..QATGD.ENE.FK..FLAQLFFSCFE--------------------
Q4WEE6_ASPFU/229-741..........DDGVR......CLDLLYDVVCMK..QATGD.DVE.FT..FLAKLFFSCLE--------------------
A1C564_ASPCL/237-752..........GNCVR......CLDLLYDSVCLN..QATGD.DSE.FK..VLAGLFLSCLE--------------------
Q5AUB0_EMENI/232-744...........DSVQ......CLDQLFDLVCIT..QAAGD.DEN.FA..RLAEIFFASLE--------------------
Q0UBK8_PHANO/224-738.............LLVNPFS.HLEALFDQINLA..QMTLE.IRS.FQ..YLSSVFFDCLQ--------------------
Q2HBB4_CHAGB/228-739..........PHAFR......YLELLYDAAGIA..QLQGS.TAT.YR..LLGTIFFDCFQ--------------------
Q1K6Z8_NEUCR/239-749..........TKAFH......YLELLYDAVGMA..QMEGS.LDT.YR..LLGTIFLDCFQ--------------------
F4HUK8_ARATH/48-872...............AEIAVHVLDYLYKRLDEVCLVQGGELVAV.EGFHMLLQIFAGSLL--------------------
Q6H548_ORYSJ/50-922...............SEVAVHAVNHLFKKLNEVCLVEDGE...G.EPYHMLLVIFAGTLL--------------------
Q014J8_OSTTA/270-889.....................CLSAVYEAVSYHQATANID.GFA.....VTLRVFVDTLQ--------------------
GCP5_MOUSE/273-942........PPDTRNVVRASH.LLNTLYKAILEY..DNVGE.ASE.QTVSLLFSLWVETVR--------------------
F1QBQ4_DANRE/270-933........PPGTPNVLRASH.LLNTLYKAIIEY..DSVGE.ASE.QSVALLFSLWVETVR--------------------
C3ZYG0_BRAFL/302-1685YNTLGDAANTKVCTILKASR.LLSVLYQNILQY..NTLGDAANTKLP..LLLPLWIQTLR--------------------
Q7PX58_ANOGA/302-918.........WTKFPAHIAVAHLLSGLFRSVKLSANLEKGN.........LAFALLLAALK--------------------
Q4P9B0_USTMA/319-997........SDRALID......GLQALLAFVHQQDELAHGDMILT.....DLSTCLLAACR--------------------
Q9VTS3_DROME/266-1244.........LNLNTGITGSF.LLSSIWLAIDTCGNKDFLH.........LLIYFLRCISR--------------------
Q2M0Y2_DROPS/276-1186.........LNLHSGVSGTF.ILASIGSAIDTCSNTDFLQ.........LLMYLLKCMCQ--------------------
Q17IM7_AEDAE/330-1376.........YESDKEFPTGSVFLDHLYKEIIHITSSDVST.........FLLHILKHCCN--------------------
Q0UQH9_PHANO/170-704...............AKTNEQLASILHHRLLEL.....EDGDTDIRQ..LSSRIMCEVAK--------------------
Q5BEM5_EMENI/175-843...............AGSEARIISSVFKLAAHYAQIYGQM.....ES..LFREIVFKVAQ--------------------
Q2UCE2_ASPOR/176-851...............VVSDAQIFSIVLEKAAHYSQTFGHM.....ED..LFREIVIRTVY--------------------
Q0D0R6_ASPTN/174-839...............PTTESQIISIVLARAAHFSQTFAHM.....EN..LFREIATRVAR--------------------
A1CPI0_ASPCL/179-855...............AVSDAQVISVIIKKAAHFAQTLSSM.....EN..LFREIVARAIT--------------------
Q4WSG8_ASPFU/170-850...............AASDAQVISAVIEKAAHYSEAFGSM.....EN..LFRELVARVIA--------------------
Q2H076_CHAGB/195-897...............ETSDEGMLSCLFQEAQAS.....EYRDGLIED..VTREVLRVLSQ--------------------
Q4P4I8_USTMA/198-1067.......PPFRPLTWLESTHATLSHLHAHLAASLASGASSLPSA.....VLAYLLDRTSV--------------------
A8BFK8_GIAIC/197-740.....................ILNIIFGYSLH......GD.RKM.HH..IGQSLLIKASE--------------------
A2E6U4_TRIVA/44-540...............LKGPK.ICTIIHQAISTN....RGL.PYI.RE..PLTALFNQSVQ--------------------
GACP2_ARATH/70-583...............FVGSG.VLNLLQSQAKA....MAGD.NSV.RS..LLEKMTECASN--------------------
Q0JBZ2_ORYSJ/73-597...............TSGSA.TLNLLQSQAKA....MAGD.SAV.RS..LLEKMTECASA--------------------
Q011F8_OSTTA/257-775...............LKGAS.VLNLLHREGCE....HAGD.SAV.LA..LVQRLSKAAAK--------------------
GCP2_DROME/204-721...............SRDAE.VLTYLHERIKR....LEGN.KDA.QQ..LIIGLVRKAAK--------------------
Q29G36_DROPS/282-800...............FQGAA.VLTHLHGRIKR....LEGD.RAA.QQ..IMIKLTHQAAE--------------------
Q16HU4_AEDAE/210-728...............CRGGT.VLTLLYDKIIA....TTGD.EKS.RK..VLIHLIEMAAV--------------------
Q7Q703_ANOGA/248-764...............ARGGQ.VLSLLHDRITA....KSGT.NHA.QK..VLVHLVESAAA--------------------
GCP2_MOUSE/220-738...............CVGGS.TLSLLHDRSFN....YTGD.SQA.QE..LCLYLTKAASA--------------------
SPC97_DICDI/430-1044...............SHGVQ.VINLLLKLQSK....YSSD.KKT.DD..LFHYLIKATTL--------------------
A0BDB2_PARTE/150-660...............QIGGT.LLSTITHFINT.....STD.PQI.VE..VYSFLLQKSFL--------------------
Q23AE3_TETTS/242-771...............YKGGE.LLSKLYDLLKNTSDKQIVD.........IYYYVLQKSFA--------------------
SPC97_YEAST/62-688HLRLMVAFDTTVYPVPKGGA.ILKIFQQKILEN....LGD.RSS.VM..FLKKLLNNISQ--------------------
Q6FQY5_CANGA/70-712GQAILLPTDSSLSLTPKGGN.IIKVVQEMIAET....LGD.RNG.VQ..FLKDILNKIGE--------------------
Q756H1_ASHGO/63-723STNGILITDTRVSPVAKGGV.VLQMVLEKMKQN....WGD.QRN.LQ..FLHQVWQDISA--------------------
Q6CXD9_KLULA/57-697ELDLRVLYDTRVSLFVKGGS.LIIIVQQIMEQE....QGD.IRH.VE..FLSLICDSLNR--------------------
Q6BGV8_DEBHA/61-751TGSIDLATDNVNFEFCKGGI.LLKIIQDRINAY....QGD.VIS.LE..FLTKIFDVVSI--------------------
Q59PZ2_CANAL/94-759GINSEPNLYYGKFDCCKGGL.LLQVIQERMVYY....KGD.PTS.LD..FLTQLFDIVSS--------------------
Q6C787_YARLI/102-681IDTRGYGISLNGSSMCRGGI.TLKVIAERLNA....HSGD.PTA.NQ..LLTRLLNDASK--------------------
ALP4_SCHPO/74-693DISHVVNATRSKKKVCKGGQ.VISFLTESLTK....YAGD.PVA.RK..ILTYLLREASR--------------------
Q4X128_ASPFU/183-784EGGDLIPGAMSSKKICKGGN.VLRLLTERLAT....FSGD.PTT.KT..LLEKLLRDASR--------------------
Q7S902_NEUCR/140-744DGGDLVPGNMTGKKICKGGV.VLGLITKRLES....LSGD.PSA.RV..LLTTLLRDASR--------------------
Q0V2V1_PHANO/184-787.LESLREGGNATKKLCKGGS.VLGLITKRLSS....MSGD.PAA.RT..LLTTLLREASR--------------------
Q5KPG7_CRYNJ/181-812KNLKAREGLIGDGGDVLGGE.VLGIICEREAT....MSGD.PTA.ST..LHSSLLLHASQ--------------------
Q4Q0X5_LEIMA/136-766........FASPSTGLVGPR.ILNHLCDQVNKY........SGSCEDHELLTLLLRRSLV--------------------
Q7XUI5_ORYSJ/65-1092........NFPWSTD......LLSYLYVHLRDADSVHYG..........LLKYLFVRSCE--------------------
Q9VS91_DROME/97-627...............ARGNLTSAQVLTLLDQFYRDLKDTD.IDL.KE..RVNKILTSTSR--------------------
Q2M118_DROPS/72-608...............ARGKKTSAQILSDINEIYEKLKPSD.LEL.KE..LLEKILNSVSS--------------------
Q5CFR0_CRYHO/45-593...............KKGCE.IIDQVYKIANNEFKGEESS.....QK..IANFVFNQVFL--------------------
Q29HV5_DROPS/23-546...............KKGGE.LTSVVWDFLDN......GH.PAV.DK..LVIDLLTAMCR--------------------
GCP3_DROME/235-758...............KKGGD.LASTVYDFLDN......GN.DMV.NK..LVEDLLTAICG--------------------
Q16YQ3_AEDAE/217-729...............LKGGA.LATIVYDYTAN......GD.PEN.RR..LAMELLRSACI--------------------
GCP3_MOUSE/251-761...............RKGGE.LASAVHAYTKT......GD.PYM.KS..LVQHILSLVSH--------------------
Q1K720_NEUCR/225-737...............KHGGQ.LVTLIHNFSSS.....HGD.PVV.AA..FAERLLVDVTR--------------------
ALP6_SCHPO/196-713...............QENKKRLIQVVSKYNVH......GD.PLI.QE..LSDKILTEITG--------------------
Q4PG13_USTMA/283-861...............AHGGL.LVSLIHSYTFN......GD.PFI.RK..FTSGLLDEVSK--------------------
Q5KL44_CRYNJ/148-724...............THGGA.LVSKLHSHTSN......GD.PLI.RN..FTTQILEEVSK--------------------
Q01AM7_OSTTA/101-630...............HRGGA.ILAAIHKYSRH......GD.PST.TT..LVRRILSASAT--------------------
GACP3_ARATH/192-713...............LRGGA.MAGAIHLHAQH......GD.PLV.HD..FMMSLLRCVCS--------------------
SPC98_DICDI/112-705..............DMKGGE.ILSKIDTLSKH......GD.QDI.RI..LIHNIMFKICQ--------------------
Q383E4_TRYB2/204-700...............VKGGE.LASKLQRLVQQ......GS.RRL.CA..LLSDVYMEAVS--------------------
Q6FLE0_CANGA/180-724...............LTGDQ.LLSLLEQL......RHHGD.LTI.EN..IADKLFSTLLT--------------------
SPC98_YEAST/187-740...............LSGDT.FLIELNIF......KSHGD.LTI.RK..IATNLFNSMIS--------------------
Q74Z68_ASHGO/190-740...............LRGDQ.LISEFDSL......RQHGD.PLV.KN..LAEEIFSTLID--------------------
Q6CIT0_KLULA/175-721................SSAEGLLSVCQLQ......KSNGD.PVL.EK..FASDALERLLQ--------------------
Q6BX70_DEBHA/183-753................SGYE.FLSKVYHL......SKFGD.IRI.KD..LTHNIFSQISA--------------------
Q4U9K6_THEAN/45-615........................LILDSLDFRCRSEVGS.KKL.....LLQHILNSVLD--------------------
Q4N294_THEPA/45-610........................LILDSLDFRCRSEIGP.KKL.....LLQHILNSVLD--------------------
A8BD62_GIAIC/283-863...............VRGCA.LLQQLETAVLQSSGLSVKE.........VFQYLLSESLK--------------------
Q0UGY4_PHANO/31-649.............GASSGAQ.VIDKLRMEAQT......GH.PTI.EE..AANQLGDVAET--------------------
Q2H2M0_CHAGB/4-638.......GSGGGEAGCTGAR.VMDFLRGELQT......GY.RDV.EE..AAGSLVGVAEA--------------------
Q2UDA7_ASPOR/4-644...............CTGAA.LIDYLRAESQT......GY.IDI.GE..MALHLISAAET--------------------
Q0CV34_ASPTN/4-641...............CTGAA.LIDFLRAESQT......GY.QDL.EE..MALHMIGVAEV--------------------
Q4WZU3_ASPFU/32-668...............CTGSA.LIDYLRTESQT......GY.LDL.EE..IALHLITVAES--------------------
A1C7R2_ASPCL/32-668...............CTGAA.LINYLRTESQT......GY.VDL.EE..MALHMIATAET--------------------
C8VMB1_EMENI/4-637...............CTGAG.LIDHLRRESHT......GY.IDI.EE..IVLDLIGAAET--------------------
Q5KH00_CRYNJ/4-686.....................LIDLILLKSQT......GN.PFL.QN..IFSNLAKSLQD--------------------
Q584R6_TRYB2/3-521..............QQKNADLLLVTIQSFLSN.........REIPQK..FRLWMGEAVWM--------------------
Q0IG23_AEDAE/4-557.............QRIHGCA.LLQYLQQNCLH......GN.EKH.YQ..AVKLIQNAVYA--------------------
Q7PWU6_ANOGA/4-573.............QRIHGCA.LLPYLQQHCLH......GN.DAN.YQ..AVKTIQKSVYV--------------------
GCP4_DROME/4-548.............LNLRGCV.LLHNLHQQCEH......GD.IQL.EK..AIKIIMKPVKN--------------------
GACP4_ARATH/4-645.............DDIRGGQ.LLNVLNKRCHC......GV.PEL.RT..CLQRLLWNGHQ--------------------
Q60F24_ORYSJ/4-649.............KDIKGGQ.LLNLLHKRCHC......GV.PEL.QS..CIQRLLWHGHQ--------------------
Q05AR5_XENTR/4-571.............QKIHGCQ.ILETVYKHSCG......GL.PPV.RS..ALEKILAVCHG--------------------
Q01B37_OSTTA/4-547..............GARGVS.GAEVLRRARDAW..LRAGH.PAT.RA..ACERLYWRATQ--------------------
A0C933_PARTE/4-693.............HNMRGGQ.ILDYLYERTLT......GN.DKL.QL..IYQNILSACYE--------------------
Q24CL5_TETTS/4-831.............ENLKGGQ.LLDLMHSKSQT......GN.TAL.RE..VYQILTDQCYS--------------------

PF14609

MOD21_SCHPO/60-677P....KLHH-MSEEILR--------S--IMTE---------LADYGSN--------------------------------
E4WX70_OIKDI/53-731P....VNDT-LEYWIEQ--------T--NLLH---------KKGFGKG--------------------------------
B6K1F8_SCHJY/48-653PFDYFQIQG-LSTSMQE--------H--ILSN---------FCNWGRE--------------------------------

PF04130

Q2UAG9_ASPOR/234-750T----YARP.IRLWMEK........G..ELEETV.......QGSFFIR................................
Q4WEE6_ASPFU/229-741T----YIRP.IRRWMEE........G..RLDP.R.......EGVSFII................................
A1C564_ASPCL/237-752T----YMRP.IHRWMEE........G..QLDS.R.......QGTFFII................................
Q5AUB0_EMENI/232-744T----YARP.LYRWMET........G..QLED.S........SLFFVS................................
Q0UBK8_PHANO/224-738T----YLKP.IRKWMEA........G..ELGA.N.......DETFFVF................................
Q2HBB4_CHAGB/228-739V----YLKP.IRLWMEE........G..KLLP.G.......DRTFFIS................................
Q1K6Z8_NEUCR/239-749V----YLKP.IRFWMEE........G..ELLA.G.......DRTFFIG................................
F4HUK8_ARATH/48-872P----YVES.LDSWLFE........G..TLDD.P.......FEELFFT................................
Q6H548_ORYSJ/50-922P----YLQC.LDSWLYD........G..ILDD.P.......NEEMFFY................................
Q014J8_OSTTA/270-889P----YMET.LHRWLAF........G..VLDD.P.......SEELFIA................................
GCP5_MOUSE/273-942P----YLQT.VDEWIVH........G..HLWD.G.......AREFIIQ................................
F1QBQ4_DANRE/270-933P----YLEI.VDEWIVH........G..HLFD.P.......AKEFIIQ................................
C3ZYG0_BRAFL/302-1685P----YLEI.IDGWVNK........G..NLID.P.......AMEFIIQ................................
Q7PX58_ANOGA/302-918C----YMNM.IDTWWTE........G..RLDD.W.......REEFLVEKT..............................
Q4P9B0_USTMA/319-997P----AWRS.VCHLLQRGLSFAIHRDHDLLFDDR.......LVQHMIR................................
Q9VTS3_DROME/266-1244N----YFIQ.LQRWIYH........G..ELDE.S.......VNEIFISRC..............................
Q2M0Y2_DROPS/276-1186T----YFAQ.LQRWVYK........G..ELDE.A.......VNEIFIRR...............................
Q17IM7_AEDAE/330-1376A----YFLL.FQQWLFG........G..QLGD.P.......SGELFIY................................
Q0UQH9_PHANO/170-704P----SLEL.LAEWI..........G..TMKEQETI..PVTSRDSFVT................................
Q5BEM5_EMENI/175-843P----WLTY.VETWI..........G..FRPETSASIELLTNGRSFVS................................
Q2UCE2_ASPOR/176-851P----FLKH.AETWI..........G..LRLEASTLKELAANGRSFVV................................
Q0D0R6_ASPTN/174-839P----FLDH.IESWV..........G..FRSETPTSKEFARSGRSFVS................................
A1CPI0_ASPCL/179-855P----WLHY.VEAWV..........G..LRAETPGLFEATGNSAGFVV................................
Q4WSG8_ASPFU/170-850P----WLQY.VEAWV..........G..LRTETPALVDLAAKSEGFVA................................
Q2H076_CHAGB/195-897P----WIEF.VEEWV..........G..LRAENGIAMTKTGPSKGFVN................................
Q4P4I8_USTMA/198-1067T----WRQQ.VARWVGFPGFESDRTG..ELDDRP.............SV...............................
A8BFK8_GIAIC/197-740P----FFDY.LKHWIIE........G..SLL..........STEYFIQPTTSNST.........................
A2E6U4_TRIVA/44-540P----ILEY.IEKWIYE........G..KIDD.P.......YNEFFIQ................................
GACP2_ARATH/70-583A----YLSI.LERWVYE........G..IIDD.P.......YGEFFIAEN..............................
Q0JBZ2_ORYSJ/73-597A----YLRM.LERWVYE........G..VIDD.P.......YGEFFIAEN..............................
Q011F8_OSTTA/257-775P----YIQA.IELWVYD........G..QVDD.P.......YDEFLILEQ..............................
GCP2_DROME/204-721P----YMRM.LQMWIQK........G..VIVD.R.......HREFLVVDN..............................
Q29G36_DROPS/282-800P----YMRM.LQLWIQK........G..VIVD.R.......NREFLVEDN..............................
Q16HU4_AEDAE/210-728P----YMEM.LQLWIFN........G..VIHD.T.......RKEFLVE................................
Q7Q703_ANOGA/248-764P----FMEM.LELWIYR........G..VIND.P.......QQEFFID................................
GCP2_MOUSE/220-738P----YFEI.LEKWIYR........G..IIHD.P.......YSEFMVEE...............................
SPC97_DICDI/430-1044P----FLEM.LDLWIHQ........G..IIRD.T.......YFEFMIEEN..............................
A0BDB2_PARTE/150-660P----YMKQ.LSNWIYY........G..RIDD.P.......FEEFLVAE...............................
Q23AE3_TETTS/242-771P----YVQM.LSQWIYY........G..QIDD.L.......FQEFFIQEN..............................
SPC97_YEAST/62-688D----YCTM.LYEWLTQ........G..ILND.P.......YQEFMTYD...............................
Q6FQY5_CANGA/70-712G----YLKM.FDDWLIN........G..DIND.P.......HEEFMIRDMM.............................
Q756H1_ASHGO/63-723P----YCEM.LNEWLIK........G..DLKD.P.......YEEFLISDT..............................
Q6CXD9_KLULA/57-697V----YGQM.FVEWMQE........G..KLND.Y.......HEEFLISDTV.............................
Q6BGV8_DEBHA/61-751D----YVSM.LNKWLIN........G..EIDD.S.......AEEFIIKMN..............................
Q59PZ2_CANAL/94-759D----YIGM.LNQWLLE........G..VIND.P.......FDEFMIREK..............................
Q6C787_YARLI/102-681P----YLQM.LSRWIYQ........G..VILD.P.......YGEFCIQE...............................
ALP4_SCHPO/74-693P----YTKM.LNEWIHL........G..LVND.P.......YDEFMIKIH..............................
Q4X128_ASPFU/183-784P----YMAM.LNEWLHH........G..DIKD.P.......HAEFLIKEQ..............................
Q7S902_NEUCR/140-744P----YMAM.LNEWLHH........G..SIND.P.......HSEFLIKEQ..............................
Q0V2V1_PHANO/184-787P----YMAM.LNEWLHH........G..GIKD.P.......HSEFLIKEQ..............................
Q5KPG7_CRYNJ/181-812P----YCKM.LIQWIAT........G..HLSD.P.......FDEFMVKES..............................
Q4Q0X5_LEIMA/136-766P----YLRM.LQRWMHS........G..VLDD.P.......YGEFFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPS
Q7XUI5_ORYSJ/65-1092P----YCNF.IKSWIYR........A..SVDD.P.......YEEFLIT................................
Q9VS91_DROME/97-627A----YMKI.VQLWMQK........G..VLFD.T.......QHEFFVEDTEP............................
Q2M118_DROPS/72-608V----YMKI.VQLWTQK........G..IIYD.L.......QHEFFVEDSER............................
Q5CFR0_CRYHO/45-593S----WFKHFLTPWLKF........G..TAFD.........HFSEFIN................................
Q29HV5_DROPS/23-546P----LTRM.ISQWMLD........G..DITD.L.......HNEFFVE................................
GCP3_DROME/235-758P----LVRM.ISKWILE........G..GISD.M.......HREFFVK................................
Q16YQ3_AEDAE/217-729P----LQQA.LIRWLID........G..EIID.P.......NGEFFIE................................
GCP3_MOUSE/251-761P----VLSF.LYRWIYD........G..ELED.T.......YHEFFVA................................
Q1K720_NEUCR/225-737P----FYDI.LRRWIYD........G..ELLD.P.......HMEFFVREQN.............................
ALP6_SCHPO/196-713P----LYEM.IENWIYK........G..ELVD.P.......YQEFFVKE...............................
Q4PG13_USTMA/283-861P----FFNS.LSLWIYQ........G..ELQD.P.......FREFFVELNDDPRKVNQ....................SR
Q5KL44_CRYNJ/148-724P----FFLT.LQRWIFS........G..ELHD.P.......FKEFFVQLNPENVSFREG..................QIS
Q01AM7_OSTTA/101-630P----FLGM.TQRWTVS........G..ELDD.P.......SREYFVR................................
GACP3_ARATH/192-713P----LFEM.VRSWVLE........G..ELED.T.......FGEFFVV................................
SPC98_DICDI/112-705P----LFSM.IRLWMFK........G..EIND.P.......YQEFFIR................................
Q383E4_TRYB2/204-700P----LLHM.TVSSIIK........G..DVSD.P.......FNEFFVK................................
Q6FLE0_CANGA/180-724L----YYDY.LSQWLTL........G..SIDN.T.......NNELFIE................................
SPC98_YEAST/187-740L----YYEY.LMNWLTK........G..LLRA.T.......YGEFFIA................................
Q74Z68_ASHGO/190-740L----YMEY.LLYWLVR........G..QLKS.T.......HDEFFVS................................
Q6CIT0_KLULA/175-721P----YMKN.ICDWLID........G..KLDSNV.......SSDFFVQ................................
Q6BX70_DEBHA/183-753P----YYEV.LEHWVIK........G..ELID.N.......SDEFFIA................................
Q4U9K6_THEAN/45-615S----YSLL.INHYINFFNFSQVDFT..DF...........VTDFFIKTC..............................
Q4N294_THEPA/45-610S----YSLL.INHYINFFNFSQVDFT..EF...........VSDFFIKIN..............................
A8BD62_GIAIC/283-863P----LGRI.MDRYINE........A..VIPDSD.......AADFFIRKS..............................
Q0UGY4_PHANO/31-649S----WLRQ.LSTWLLY........G..RLPSFG.......AIDFFVH................................
Q2H2M0_CHAGB/4-638A----WVKQ.VSAWVLY........G..RLPGFG.......EGDFFVR................................
Q2UDA7_ASPOR/4-644A----WMRQ.LSTWLLY........G..NLPVLG.......KDDFFIQ................................
Q0CV34_ASPTN/4-641A----WMRQ.LSTWLLY........G..NLPVLG.......REDFFIQ................................
Q4WZU3_ASPFU/32-668A----WIRQ.LSTWLLY........G..NLPIFG.......KDDFFIQ................................
A1C7R2_ASPCL/32-668A----WMRQ.LSTWLLY........G..TLPVFG.......KEDFFIQ................................
C8VMB1_EMENI/4-637A----WMRQ.LSTWLLY........G..NLPILG.......KGDFFIQ................................
Q5KH00_CRYNJ/4-686L----FLTH.LVSFILH........G..IAPSEPLMTSPSIGRTVGVD................................
Q584R6_TRYB2/3-521S----LLYT.IGHYVAH........G.VVLHG.........RRDFFIS................................
Q0IG23_AEDAE/4-557I----FIKQ.LFGWLLH........G..KFVD.Q.......FGEFFIQHVDNTKTAGIGS................LQGT
Q7PWU6_ANOGA/4-573I----FLKQ.LYGWLMH........G..KFVD.H.......YGEFFIQQVESSAKASIAAG...............GAAI
GCP4_DROME/4-548A----FFSS.LAHWLLF........G..VIDD.V.......HSEFFIKFTPTDAVD........................
GACP4_ARATH/4-645V----MYNQ.LAAWMVY........G..ILQD.P.......HGEFFIKRQDDGDLDH.......................
Q60F24_ORYSJ/4-649V----MFNQ.LTSWMVY........G..ILQD.Q.......YNEFFIRRQEDRDKEN.......................
Q05AR5_XENTR/4-571V----MYKQ.LSAWMLH........G..LLLD.Q.......YEEFFVRQGPSSNLA........................
Q01B37_OSTTA/4-547V----MMQQ.LLGWCAH........G..TIVD.P.......CDEFFVRTI..............................
A0C933_PARTE/4-693V----LFQQ.LSSWLQY........G..QILD.T.......SDEFFIQ................................
Q24CL5_TETTS/4-831V----LYQQ.LSGWILY........G..NLQD.Y.......YDEFFIYRIEQTK..........................

PF14609

MOD21_SCHPO/60-677-------LEFFR.QKLTSPSDSFFKSDD............----------------------------------------
E4WX70_OIKDI/53-731-------FDVMNYQVANERQCQIWLCDSCMGITENPLINW----------------------------------------
B6K1F8_SCHJY/48-653-------LHILN.RVASTKHCRFLPSSPS...........----------------------------------------

PF04130

Q2UAG9_ASPOR/234-750...........DNRNNDLDLRTLWHG...............WYTL...................................
Q4WEE6_ASPFU/229-741...........DQR.DDKDLRSLWRD...............WYAV...................................
A1C564_ASPCL/237-752...........DNH.NDNDLRSLWRE...............WYTL...................................
Q5AUB0_EMENI/232-744...........ANH.EKNDLRTLWHD...............WYLL...................................
Q0UBK8_PHANO/224-738............ESDSGSDAASLWHD...............RYVL...................................
Q2HBB4_CHAGB/228-739............ESPAKLPLSQIWKG...............QFNL...................................
Q1K6Z8_NEUCR/239-749............KSSARPQLHQIWEQ...............QFHQ...................................
F4HUK8_ARATH/48-872...........ANQSVSVSDAEFWEK...............SYLLTRVLGPKSNVTSLNQK.....KGMSGNDSNSVSDK
Q6H548_ORYSJ/50-922...........ANKAVTIDQPAFWEM...............SYMLRVRGPRTDSSSTLADNESIRKKELINQETTAAAAL
Q014J8_OSTTA/270-889.........KGRAVDDFVGSKEHWLH...............GYVL...................................
GCP5_MOUSE/273-942...........RNKNVPVNHRDFWYA...............TYTLYSVSEKTENEDKVS.........DSASASSGSDQG
F1QBQ4_DANRE/270-933...........RNKDVPVNHRDFWYA...............TYTLYSVSEMVESEERLS.........DAASGSSGGEQT
C3ZYG0_BRAFL/302-1685...........RNGKVDVFHEDFWES...............AFLVSCSPMHQDDTTESSMK......EDGQEENLDDGKT
Q7PX58_ANOGA/302-918......YGEHSPTGLQTGYQARMFSKCK...........IRSFYV...................................
Q4P9B0_USTMA/319-997...........HDASISTSDSAFWTS...............GYVVNQPS..............................I
Q9VTS3_DROME/266-1244......LNTSP..SFTNQCSKEFFDK...............SYQV...................................
Q2M0Y2_DROPS/276-1186........RAPLDRQIDECSKEFFDK...............GYQV...................................
Q17IM7_AEDAE/330-1376...........FVDHYRPKTKHFFDK...............AFLI...................................
Q0UQH9_PHANO/170-704.........................LEPNPL.....NEDQPEYVY...................................
Q5BEM5_EMENI/175-843......................LEKSESNGKI...SSQERHEYAY...................................
Q2UCE2_ASPOR/176-851......................LEPSEENPKT..TSQSTRLEYRY...................................
Q0D0R6_ASPTN/174-839......................LRHPEESDKQ..ISKAEMDHYIY...................................
A1CPI0_ASPCL/179-855......................TERRDGRSTSK.RSRTTTVDYRY...................................
Q4WSG8_ASPFU/170-850......................VERYEGRAGSR.SMKASSLQYRY...................................
Q2H076_CHAGB/195-897..................IVDKMWIDDQGF......ELEEADYFL...................................
Q4P4I8_USTMA/198-1067........LKSGSSSNTAHISTPWSGAVVDWSLDERGEEDVGYTL...................................
A8BFK8_GIAIC/197-740..DILILQTNNLLVSRSIFINSNWYN...............KFHI...................................
A2E6U4_TRIVA/44-540........TNDISPDIPDPHRTYWND...............HFTC...................................
GACP2_ARATH/70-583.......RSLKKESLSQDSTAKYWSQ...............RYSL...................................
Q0JBZ2_ORYSJ/73-597.......KSLQKESLTQDYDAKYWQQ...............RYSL...................................
Q011F8_OSTTA/257-775.......QEMKKQSLNDDYNSAYWTK...............RYSL...................................
GCP2_DROME/204-721.......EVIHRDELPEHYSDDYWER...............RYTL...................................
Q29G36_DROPS/282-800.......EVVHQGELPEHYSDDYWEK...............RYTV...................................
Q16HU4_AEDAE/210-728.........HHAMDLNENDMMDYWEK...............QYII...................................
Q7Q703_ANOGA/248-764.........HSSMELTENELVDYWEK...............QYTI...................................
GCP2_MOUSE/220-738.......HELRKEKIQEDYNDKYWDQ...............RYTV...................................
SPC97_DICDI/430-1044.......TDLKRDNINRDFNDLYWEQ...............RYQI...................................
A0BDB2_PARTE/150-660.......KKIQKSSLETDYKNDFWDQ...............RFAL...................................
Q23AE3_TETTS/242-771.......VFVKRDNISKDFKENYWDQ...............RFIL...................................
SPC97_YEAST/62-688.......DLEGKTDNIFDTRDRAWDT...............QYFI...................................
Q6FQY5_CANGA/70-712......KDVNVTDTNAMMTTDRLWET...............RYLI...................................
Q756H1_ASHGO/63-723.......SQDNNIVLNSLNSERLWDT...............QYVI...................................
Q6CXD9_KLULA/57-697......ADVDEEKLANTIDNERLWDT...............RFVI...................................
Q6BGV8_DEBHA/61-751......RFPDNPDSPIRRNVEKYWDE...............LYVT...................................
Q59PZ2_CANAL/94-759......RVPDSFMEIFQSKSEYYWNE...............LFLI...................................
Q6C787_YARLI/102-681........NGDLATGNEGAYDEYWEQ...............RYSV...................................
ALP4_SCHPO/74-693.......KGITSMQLDEDYTDEYWEK...............RYVI...................................
Q4X128_ASPFU/183-784.......KWIKREKLEEDYTDEYWEK...............RYTI...................................
Q7S902_NEUCR/140-744.......KSIRRERLEQDYTDEYWER...............RYTI...................................
Q0V2V1_PHANO/184-787.......RSIKRERLDQDYTDEYWEK...............RYTM...................................
Q5KPG7_CRYNJ/181-812.......GHITKGVLESDYTDEYWER...............RYTLRDGAIPGSSKVSARN........NTPSISAGVPPP
Q4Q0X5_LEIMA/136-766ATSAGRDGELGASGASTASQGRFGLKRRAAAQQ.DVVAFDRRFSL...................................
Q7XUI5_ORYSJ/65-1092........................QAKNKRTQG.GSSDPVDNFTL...................................
Q9VS91_DROME/97-627.....SSTMSSTLLAPEKCCHAYWAE...............RYRL...................................
Q2M118_DROPS/72-608.....SNSMSSTLLAPEQCCHAYWEN...............RYTL...................................
Q5CFR0_CRYHO/45-593........YNLSTKKKKFNKENIHSK...............NFYR...................................
Q29HV5_DROPS/23-546.............SLTDIGPDRLWHD...............KFRV...................................
GCP3_DROME/235-758.............SIKDVGVDRLWHD...............KFRL...................................
Q16YQ3_AEDAE/217-729.............EICEVGFDQLWHQ...............KYRI...................................
GCP3_MOUSE/251-761.............SDPTVKTDRLWHD...............KYTL...................................
Q1K720_NEUCR/225-737......PLDEERKDAKAKGQMSVWNS...............KYEL...................................
ALP6_SCHPO/196-713.......KNGSESHDHQGQGDVVWKG...............KYFL...................................
Q4PG13_USTMA/283-861THSNLADGDMPSFGDLDGDAASLWQN...............KFVF...................................
Q5KL44_CRYNJ/148-724PTGDVGFEMGMDADGGEEEAYKLWEK...............KYVF...................................
Q01AM7_OSTTA/101-630.............VDHAVPDKDLWRR...............KYEF...................................
GACP3_ARATH/192-713..............GQPVKVDLLWRE...............GYKL...................................
SPC98_DICDI/112-705.............QYESVQLEKTWKE...............KFAI...................................
Q383E4_TRYB2/204-700...........SDPRVEDTSDTFWSS...............KFSL...................................
Q6FLE0_CANGA/180-724............VEQENTDGEVIFKL......................................................
SPC98_YEAST/187-740..........ENTDTNGTDDDFIYHI...............PIEF...................................
Q74Z68_ASHGO/190-740...............VNKSADPKLGM...............NFAI...................................
Q6CIT0_KLULA/175-721................NDEKEPL..................GLVF...................................
Q6BX70_DEBHA/183-753............FNTEAQHINDIIEY......................................................
Q4U9K6_THEAN/45-615.......ENYEFSPSNERDDGTGWNLCSFCR.....EVGWPRVWV...................................
Q4N294_THEPA/45-610......QDDEYSPSDAYGDEGTEWNLSSLCR.....EIGLPRVSI...................................
A8BD62_GIAIC/283-863.......HSTELAEEQGKTTINTWMQ...............MFKV...................................
Q0UGY4_PHANO/31-649.........................RDEED.......SGELLFVI...................................
Q2H2M0_CHAGB/4-638.........................RVVGE.......EGREEYGC...................................
Q2UDA7_ASPOR/4-644.........................EDSIAES..NRTPAVAQFVL...................................
Q0CV34_ASPTN/4-641.........................EEPMDGN...TPSVAPSFAL...................................
Q4WZU3_ASPFU/32-668.........................KDNSSQM..DDSSSITNFVM...................................
A1C7R2_ASPCL/32-668.........................EDKSSDP..DSSSAVTQFVM...................................
C8VMB1_EMENI/4-637.........................EADTKEN..EGPVSTVQFTI...................................
Q5KH00_CRYNJ/4-686.........................PLSP.........QHRVYAL...................................
Q584R6_TRYB2/3-521.........................VKSK........GGKEDHTL...................................
Q0IG23_AEDAE/4-557TGGTGTHLSVNSFSDNTSINTELW.................RYEI...................................
Q7PWU6_ANOGA/4-573ANPPAGHTSVNT.SDSASINTELW.................RYEI...................................
GCP4_DROME/4-548GSSFSKSATCSLLSAEKNPEDYIW.................QYEV...................................
GACP4_ARATH/4-645RSSQEEVSEKLARTSVHETSLTDWHS...............GFHI...................................
Q60F24_ORYSJ/4-649DSSQVDVADKFTQKSAKETSLTSWHT...............GFHV...................................
Q05AR5_XENTR/4-571ASSEEDDDDLGIGGLTGKQLRELQDLRLIEEEN.MLAPSLKQFSL...................................
Q01B37_OSTTA/4-547.......DRCEGLRTKEDDGGGIWHE...............SHRV...................................
A0C933_PARTE/4-693.........RIDEKKKTDQHEYNWDT...............SFTL...................................
Q24CL5_TETTS/4-831..SQQSNAYDKNVVEQPNELEIDWDS...............IFSL...................................

PF14609

MOD21_SCHPO/60-677---QST-----KNE-PFLSVVFIYPQIKPHLLSCLKNTHQELIKL-----------------------------------
E4WX70_OIKDI/53-731---DEE-----KQE-AFVNEFTLVQHATPNWHGYIK....RLLPL-----------------------------------
B6K1F8_SCHJY/48-653---DIE-----RLP-PF.....IFQIMTVWMNETVQN...ELLRM-----------------------------------

PF04130

Q2UAG9_ASPOR/234-750....DESAWISSAP.KFVQPV......ARKIFVAGKSM--VFLRHL..................................
Q4WEE6_ASPFU/229-741....DDS..CGL.P.QFMRPV......AQKIFTTGKSM--VFLQHL..................................
A1C564_ASPCL/237-752....DETSGLEHIP.QFMKPF......ARQIFTAGKSM--VFLQHL..................................
Q5AUB0_EMENI/232-744....ETKPELAKIP.KFIRPF......AHKIFITGKSR--VFLNRL..................................
Q0UBK8_PHANO/224-738...RRDAQNSLQCP.SFLQPA......VKKIFNTGKSI--IFLKELG.................................
Q2HBB4_CHAGB/228-739...LRSPEGKLHAP.RFLDPS......IHQIFEAGKSI--VVLKHM..................................
Q1K6Z8_NEUCR/239-749...LVSSEGVLNAP.RFLSPA......VDRIVRAGKSI--VVLKHL..................................
F4HUK8_ARATH/48-872DKEQNNR...VLCP.LFIKDI......CKSIVSAGKSL--QLMQHIPSTSSENCEKIQYHGRNGFGNSGCGILLAGKNSF
Q6H548_ORYSJ/50-922LKSSNQGCADILCP.VFLKDI......ARAILSAGKSF--QLVQHVQETHRIQTREVIHEFNIDQHGNYISQQKFRPDTS
Q014J8_OSTTA/270-889...RHD....IETP.CFLREF......AVQTLDIGRSI--VLLHHTESRTGKVPKLEVHLCESFCEQVRVALGATRD...
GCP5_MOUSE/273-942PSSRQH.....TMV.SFLKPV......LKQIIMAGKSM--QLLKNLNCAEGPACQAAARDAERKSLYTLFLESIQLRLQH
F1QBQ4_DANRE/270-933SSSRQH.....TMV.SFLKPV......LKQIIMAGKSM--QLLKNLDCKETEQSDGSSRDAERKSLYTLFLESVQTRLRR
C3ZYG0_BRAFL/302-1685DKDTRENQEEEFIP.VFLKSV......FKEIILAGKSM--ELLKALGKMGGRVEFPVPLYEEFVQSLQTFLEVTDDLDQT
Q7PX58_ANOGA/302-918....SS.....AIS.EVIENDPIIKLLLHHSLEAGYTL--NILNGLDRISDMRKEQGTDENLIYTSFLKTIVDELERFR.
Q4P9B0_USTMA/319-997DEVDNMVNPGYSSP.AFLQSI......MQDVLTTAKGV--GLLRSLGVDALGGVQPDPNLGHVLGLRTTIAQTSLNPLQS
Q9VTS3_DROME/266-1244...DNE.....AIP.EFLVGC......EEEILQCGKYN--LVLRAYNAQHPVFDVQYPDIVVCLTEQQLKNMRRNLADKY
Q2M0Y2_DROPS/276-1186...HEE.....EVP.DFLSGC......ETVILHCGKYN--RLLKAFNAQHPAFDVSYPDIVVCLSEQQLTAMRRNLNDKY
Q17IM7_AEDAE/330-1376...RRQ.....AVP.GFLKGF......EEDILLCGKYT--MLLKAFKKSHPIFSLKIPKLEVCLSYRAVDRLKARWLQYV
Q0UQH9_PHANO/170-704...RSE.....MMP.RFILPE.....DGNMAFETGQSL--RFLKTQHPGHPLVRLHDAEISPPKFQW.............
Q5BEM5_EMENI/175-843...LPE.....QMP.SFVPPD.....QAYLIYESGRSL--RLLKRYHPHHPLAGEQVRIDSPKLACAGTWAELERIQMKA
Q2UCE2_ASPOR/176-851...NPA.....EMP.SFIPTD.....QAELIFESGRSL--RLLKRFHPQHPIASDEICNGDVPRLSCASTWTDIERIQEK
Q0D0R6_ASPTN/174-839...CPE.....QMP.SFVPSD.....QAKLIFESGRSL--RLLKRFHPRHPIANGKFRNSTLDCARSWAEIERIQSKAQT
A1CPI0_ASPCL/179-855...HPD.....QMP.SFIPED.....QAQLIFESGRGL--RLLRRYHPQHPVASGTPLRKDRRPALSCAGTWSDIERIQK
Q4WSG8_ASPFU/170-850...HPE.....QMP.TFIPAE.....QADLIFETGRSL--RLLRRYHPQHPIANDAILTKDSPNLRCAGSWSDIERIQKK
Q2H076_CHAGB/195-897...DED.....RVP.TFIPED.....MARSIFETGQNL--RFLREHHPEHPLARPDLVSLAMPPKLEWEFNWDAVSQLEA
Q4P4I8_USTMA/198-1067...KPS.....AVP.SFLPFR.....HARAFLEAGRAL--RLLKKAAPQDHPLVHQWSLNAQERASAKRVSLPTWRWSLL
A8BFK8_GIAIC/197-740...SSS.......P.DLKTHPLLSPYVTKLCFEIGRAS--AFLRE...................................
A2E6U4_TRIVA/44-540...NEE.....NAP.MFIPSA.....IINLIIATGKVQ--SIIAD...................................
GACP2_ARATH/70-583....KD.....TIP.GFLANI......AATILTTGKYL--NVMRE...................................
Q0JBZ2_ORYSJ/73-597....KD.....GIP.SFLTNV......AATILTTGKYL--NVMRE...................................
Q011F8_OSTTA/257-775...REE......FP.QFIGEQ.....LAQKILTTGRYL--NAVRE...................................
GCP2_DROME/204-721...RDE.....QIP.SFLAKY......SDKILRTGKYL--NVIRQ...................................
Q29G36_DROPS/282-800...RRD.....RIP.SFLEKY......SDKILRTGKYL--NVIRQ...................................
Q16HU4_AEDAE/210-728...RTD.....KVP.CFLNEY......ADIILRTGKYL--NVIRE...................................
Q7Q703_ANOGA/248-764...RNE.....KVP.CFLAKH......ADIILRTGKYL--NVVRV...................................
GCP2_MOUSE/220-738...LPQ.....QIP.SFLQKV......AGKILSTGKYL--NVVRE...................................
SPC97_DICDI/430-1044...RQD.....QIP.KYLQSH......ALKILTTGKYL--NVVRECNQSISQQQQHNK......................
A0BDB2_PARTE/150-660...RNS.....QIP.KFLEKY......QDIILRTGKYI--NVIGQ...................................
Q23AE3_TETTS/242-771...REK.....QVP.AFLYLW......KEMVFKTGKYL--SVLSE...................................
SPC97_YEAST/62-688...RKD....VLLR.DCDSEEDK..NLLFKMLRTGILL--KVVRA...................................
Q6FQY5_CANGA/70-712...RKD....GLLE.SFHEEL......LSKILVTGKLL--NIVKV...................................
Q756H1_ASHGO/63-723...RKD....GLTE.QFQDRQ.....LQYKVLMTGKLL--NLFKR...................................
Q6CXD9_KLULA/57-697...RKD....GLLP.QFRDKE.....LQQKILMTGKIW--NLIAI...................................
Q6BGV8_DEBHA/61-751...RTD....GVID.QFSSKD.....IQLKILATGKYL--NIFKT...................................
Q59PZ2_CANAL/94-759...KID....GLLN.QFQNST.....IQSKILNTGKYL--NIFKR...................................
Q6C787_YARLI/102-681...RKD.....ELP.LLLSQSN....LLEKVLLAGKYL--NIVRE...................................
ALP4_SCHPO/74-693...RED.....QVP.PQLLDL......QNKVLFAGKYL--NVVLE...................................
Q4X128_ASPFU/183-784...RDN.....EVP.PQLEGV......KDKVLLAGKYL--NVVRE...................................
Q7S902_NEUCR/140-744...RDH.....DVP.PQLEAV......KDKVLLAGKYL--NVVRE...................................
Q0V2V1_PHANO/184-787...RDA.....LVP.PQLEAV......KDKVLLAGKYL--NVVRE...................................
Q5KPG7_CRYNJ/181-812RQGTNRLPGGACIP.QFLQPW......KHKILLAGKYL--NVIRE...................................
Q4Q0X5_LEIMA/136-766...NKS.....LVP.VFLNTPS...RIAKMAFFAGKYC--CILRE...................................
Q7XUI5_ORYSJ/65-1092..LSLKGANHVSAP.CFLKDV......CGPLLRTGQQL--QVLMKLLESCNLSDTGGDAHASRHIIHLEEILPWFDTSIE
Q9VS91_DROME/97-627...LPD.....RLP.GFLLSQ......ADDIFLAGKYL--NILRQ...................................
Q2M118_DROPS/72-608...LPE.....RLP.DFLNPL......AAEIFHAGKYL--NILRQ...................................
Q5CFR0_CRYHO/45-593...EKERKIYFILP.SFMHEL......VEKVNYIGLVS--HFVSH...................................
Q29HV5_DROPS/23-546...RTA.....MQP.KFIGQE.....LADKILRTGKSI--NFLREVCEMNELVKGQGE......................
GCP3_DROME/235-758...RLP.....MLP.KFVPMD.....MANKILMTGKSI--NFLREICEEQGMMKERDE......................
Q16YQ3_AEDAE/217-729...RKS.....MLP.SFVSDG.....IARRILVIGKSI--NYLREVCQDKTPVKARND......................
GCP3_MOUSE/251-761...RKS.....MIP.SFITMD.....QSRKVLLIGKSI--NFLHQVCHDQTPTTKMIAV.....................
Q1K720_NEUCR/225-737...VED.....MVP.SIITRN.....FADKVFLIGKSL--NFIRHSCGDHKWVED.........................
ALP6_SCHPO/196-713...DKE.....LIP.SFLSEE.....LVDKIFLIGKSL--NFARYGCGDFDWAQE.........................
Q4PG13_USTMA/283-861...RKE.....MLP.SFLQES.....FGRKIFSTGKSL--NFIRQSCGDGDWVGMR........................
Q5KL44_CRYNJ/148-724...VKK.....MVP.GFVGED.....FAKKIFSTGRSL--NFIRYSCHDSDWIETQAKIANAGR................
Q01AM7_OSTTA/101-630...DEN.....MLP.SFITQE.....QGRTIMRLGKSI--NFLRRCCDDSSWAPERA.......................
GACP3_ARATH/192-713...HPA.....MLP.SFISPS.....LAQRILRTGKSI--NFLRVCCDDHGWADAASEA.....................
SPC98_DICDI/112-705...VAR.....LLP.SFISLP.....LSKRILIIGKSI--NYMKQFCNNFKEDKNDRYYYYNQEDDDDDDEDHDDNDD..
Q383E4_TRYB2/204-700...LPD.....MLP.TTVSYS.....LAERIRLVAKNV--SFIRNCCRCKQWHM..........................
Q6FLE0_CANGA/180-724...NTD.....KIP.SFLTYM.....QARQIFVIGKSY--IFVQKYCKELEYSNEFS.......................
SPC98_YEAST/187-740...NQE.....RVP.AFIPKE.....LAYKIFMIGKSY--IFLEKYCKEVQWTNEFS.......................
Q74Z68_ASHGO/190-740...LKE.....SIP.GFIPPA.....VAQQIYTVGKSY--IYLETYLKEIEWASNFS.......................
Q6CIT0_KLULA/175-721...LPQ.....KIP.KFIPSL.....VAKKIYIIGKSL--RYLEHCCSEVEWIGKF........................
Q6BX70_DEBHA/183-753...LPQ.....RIP.DFFVSMNE..TMAYKIYQIGKML--IFLLKYCKELKWISDYSM......................
Q4U9K6_THEAN/45-615...DER.....YVP.KFLKNV......AVSVLEIGVLL--KLLDN...................................
Q4N294_THEPA/45-610...DER.....YVP.KFLKNV......AVCVLEIGVLL--KFLDN...................................
A8BD62_GIAIC/283-863...DDA.....QVP.LFLNNI......KTHLCDIGRST--VLLKWKKKQYIDKG..........................
Q0UGY4_PHANO/31-649...NHQ.....LLP.KFVTRQ.....TASSILFVGKSL--NQIRS...................................
Q2H2M0_CHAGB/4-638...EMA.....LLP.RFVTAA.....TAASMLFIGRSL--NQIRA...................................
Q2UDA7_ASPOR/4-644...RTD.....LQP.KFVSPD.....AASSILFIGKTL--NLIRA...................................
Q0CV34_ASPTN/4-641...HVD.....LQP.KFVSSH.....TASSILFIGKTL--NLIRA...................................
Q4WZU3_ASPFU/32-668...QTS.....LLP.KFVSLH.....TASSILFIGKTL--NHITA...................................
A1C7R2_ASPCL/32-668...QTN.....LLP.QFVSLQ.....TASSILFIGKTL--NHIKA...................................
C8VMB1_EMENI/4-637...HTQ.....LIP.QFVSSH.....TAASILFIGKTL--NLMRA...................................
Q5KH00_CRYNJ/4-686...NVD.....MLP.TSIGEN.....TRESTLYVGRVV--ATLKR...................................
Q584R6_TRYB2/3-521...HSD.....LLP.HGIPMEL...GLL..ILSVGKER--RVLLSDA.................................
Q0IG23_AEDAE/4-557...RHE.....MLP.YYLPTS.....WAEKVLFVGQTV--LMLNCDPRDHTD............................
Q7PWU6_ANOGA/4-573...RRE.....MLP.YYFPAS.....WAEKVLFVGQTV--LMCHFDPRQQIAD...........................
GCP4_DROME/4-548...NMS.....QLP.GFFSIV.....LAEKVLFVGQTV--LVFKMGRNVKVK............................
GACP4_ARATH/4-645...SLD.....MLP.DYIPMR.....LGESILFAGKAI--RVLRNPSPAFQFQKDKSFQQTM..................
Q60F24_ORYSJ/4-649...SLD.....MLP.EYIHMR.....VAESILFAGKAI--RVLRNPSPGATLQESMNQSQNVKGSY..............
Q05AR5_XENTR/4-571...RAE.....MLP.SYIPVR.....VAEKILFVGESV--QMFEN...................................
Q01B37_OSTTA/4-547...ALE.....RLP.PGIELS.....TAEAVSFIGRGV--RILTR...................................
A0C933_PARTE/4-693...NIQ.....MLPLHFITLQ.....MADKILFIGKAV--KVLKG...................................
Q24CL5_TETTS/4-831...RYA.....MLPQSIVSHK.....QAEKILFIGKGI--RILRN...................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872RSIADLSLSEIFCLSLAGLIGHGDHVSRYLWKDETDEWEISPTLASYISGKLVNGTGDLLTYSERMWYKLLVGAVQEKKS
Q6H548_ORYSJ/50-922SIRIQDKREDIIEESTGQFGNNACKMDFLTLSESFLICLSGLLENGDHVDDYLRKLCADNAPVNKTIVHSKSNVQETEEV
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942GEDSAPHIVNEDQTTKEN..............................................................
F1QBQ4_DANRE/270-933GEESPTNTVTEQQATKKS..............................................................
C3ZYG0_BRAFL/302-1685GSSLCPPDHVGPVMVSSTMLHRVLDTAVKDSLLDKNFLKAIVVDSSEEEQDETRIKPVTIRCRRIVAPAFESGHKLNQSP
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997LVERGADDPIN.....................................................................
Q9VTS3_DROME/266-1244AIIYKRFGWCSMQSIFEDRMATKRVFANLMVKRTQAHLDAWAQKQRELQIKANAQKKLQNDQLNAEQERIQQNHLEKRRQ
Q2M0Y2_DROPS/276-1186NRIRQTFEKCSMKSIFEERMASKLRFKNRMVERTESFIAAWEEEQRELLLESNAKKRLLYDKINAEQELQQRNRVQQRRL
Q17IM7_AEDAE/330-1376AKARDVCGPSLAVRELYERKEREREEFLRQVEANFRRSMEQWRQDQDAEALELRKKKERQMEELLGHLNEIRESKLAAKK
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843RDYEARLRAEVLKYNRNGPSEHVMNI......................................................
Q2UCE2_ASPOR/176-851AKIYENRLRSEILRYNRGRPSATKNLII....................................................
Q0D0R6_ASPTN/174-839YERELRAEILKYNRHGSFEKERC.........................................................
A1CPI0_ASPCL/179-855KAQFYEAELRSEILKYTRGQTTDNALAAS...................................................
Q4WSG8_ASPFU/170-850AQQYETQLRSEILKYSQGQRVGQVEMDKVLA.................................................
Q2H076_CHAGB/195-897RVNQYQNAVVRAIKGTLSGTPQAAPYGA....................................................
Q4P4I8_USTMA/198-1067ESKLQVDAIEDHILQFKREIVRWRRQRRKTIDGSV.............................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092SSMNSFTFSKSRVEAVICQRDAMYKSMIEKLHHFFSNVEVIPFDAALNVLHISTSPLDTAVSDVELFYHGTNALPACNVV
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872IEAKSEL.........................................................................
Q6H548_ORYSJ/50-922CGENSSEKTWLKLLRDATSGRDYDGMEK....................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685PQIRNLTTCLRLQVTRISSTMFNNGSHPWMLPEETYAPEFTSLLGCYRWHLQNNTASIAQADEACSMHEDLVRLGTGTDI
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244DIVNELAFQRECERMEDKLLEREKQELQKKVVQLAAVLSSSPDRSTVSDLSFASCIEEPDCLAESSSDKDDANTENSEDE
Q2M0Y2_DROPS/276-1186EVVQELQHQRDRERYEDQLLEREKLALINKIQVLRQRDLAAEDASGWEMAESPDNKLNRNRRKMLSSALVQECQSEESS.
Q17IM7_AEDAE/330-1376QELELEQKYQHEGLEFENRRLMAENLEREKAVEGYRELNRMMDEKVEKAEREVERLKVQLAGVGGSGGDSSDFESCVGSV
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092AELKDNDASSTSQESSDKVDALESSESSSSYSSIDDIEDEIDTACDNMPSSMFSSYRASSGEAKCSSVTTKLLSYETCSV
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685VFSLIGLIEIIANAVVILGIIGTKELRKPIYFFLANLAMADVFAGIGLLYRTVGHVGHNQMYDFSVTYLNFLIFSQMTSA
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244ATKQLDKTLNVPLEQPEAEYQADVDVDQPRGKE...............................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376TEDDAGSVYEDAQKSPLSDKSEDRTVKEITESDVVNSNDVISESEQNRKRILGSNLGEYLAEDHANAN............
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092SDGINPASPINENKKK................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685SALSLLSINSYVGVRHPIYFHIHANSAKLRAVVAMIVSWIIFSLIAFSPSMGWNCLHMETLTTGTCTYYFPQAYIIMCLS
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376...................................................IEAIKETAAAGLRQMTEAQRNKMKIMTEE
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685IMFLMCMVMLFTNISVYVAIRDREKRRLEQAGVPPGVEGENGPVQNIVGGNQPNNAAQEEALRKYEARVYRSRTVMIYVV
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244.....CSLPNVFQYQRSHSDVINSNEHPTTQAEFNRNRQHGLSSDQFQQCHATVHLQESDLLKTAASTSSGLHAEIPQDI
Q2M0Y2_DROPS/276-1186.......................................STGTELRAFLPPDINMNLNRLEETTEQSDLQRNRQRMLQHD
Q17IM7_AEDAE/330-1376FGLREGVVTAVDINSNQTEERHRNRQRILISDYTSREEEDPVKASGEMTELQKNRIKIMSQEYNVVVDDHDRGSKKDRKP
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092.......................DDLSYGHVPMHSQSIEHDVVCDALELDNQYSEFWPFDSFLKNSFDISSGKMSLAEEF
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872...............................QSPCCVTCVKEEKNVLAAEKVLQGLFCHENLVVSASKMDLERNKNAWHV
Q6H548_ORYSJ/50-922...........TLAKNAVMRDPTFVPGDHQDVSSTEVESYFNLSCYENPGITACQEMLERNKNSWSDLNISKSFHLPPLN
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685VAFVFWLVPLLLMAVCSRYPSTCARWIGPEILFSFYSLNSIINPMATLIRTEELRNAIWQKMTGIHQTLVTAIRGNRVDP
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244NANLNCPDTKELTELQRNRKRNEHHDGFFSFNSTEDEHTHRLRSLLNSNTERGRNRLRVMETEFGLGYKNTDIETKATPC
Q2M0Y2_DROPS/276-1186GFNAFNSMEDVHTERVKCQLRSDSPLARNRRRVMASEFDIPSICRKITIPLFSIAESGLHLPLELNKLHVEVPLDAATPM
Q17IM7_AEDAE/330-1376EMYLNLETDRAKNRRRILECEYDIVTGAQNFVDTPMSVDSDTISEDIQVPVIVIDDVPQDVNANPIAGDDGQLKLDTTAA
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092LYTGDKGAEQVSHANVVCRHSESGSPRLPNRDNDEKSINIKQPWNTNIPYNFSINPIVKNAVSCHTEHDLHGNRKNQALI
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750.........................................................................DVSGDDE
Q4WEE6_ASPFU/229-741.........................................................................NALETMG
A1C564_ASPCL/237-752.........................................................................NALDEVE
Q5AUB0_EMENI/232-744.........................................................................NLADSLE
Q0UBK8_PHANO/224-738........................................................................IRGAGAQP
Q2HBB4_CHAGB/228-739.........................................................................KQHESTK
Q1K6Z8_NEUCR/239-749.........................................................................KRYSPVA
F4HUK8_ARATH/48-872LNLSENYCLPSLNDKSLLSAVFEGSGVAPKFVGTNYKYGFQFGRSEYLSSQDDTKILETLFPFPTLLPSFQSKLHMSEFL
Q6H548_ORYSJ/50-922DENIRKSIFGDRDSSGTIPGDTLSTTYFPRLDGTDYKFGFQFDDSEYIRQEDDRRTLEALYTFPTLLPCVNENVPLSEIL
Q014J8_OSTTA/270-889..........................................VVDDVMSIEDSSKRASDLISTAKVESTGLIGVFQNYTS
GCP5_MOUSE/273-942.....................LIKMQSIAERHLELDDIHDPLLAINFARLYLEQSDFHEKFAGGDICVDRSSESV.....
F1QBQ4_DANRE/270-933.....................LIKMQSIVARHLELDDIHDPLLAINFARLYLEQNDFHEKFSGGSVILDRSSESV.....
C3ZYG0_BRAFL/302-1685QGDQAGTGDPPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAGTGDPPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAG
Q7PX58_ANOGA/302-918.......................................TENPKESGCDSDPQASLAVEVSRKVLCKAYRLTEASEPSQS
Q4P9B0_USTMA/319-997...........................TEAEAGHEEIVAALCFTPEVATENLRRLLFARGTQLAEQTETKTYVEDVLPQT
Q9VTS3_DROME/266-1244LPLEIDKLHVEIPLAVLTPMSTTSDVDFGDPSPRELPEIADTANNNNVSGSIESLSPELPKPVLAIAKPTSLLPKLDFGM
Q2M0Y2_DROPS/276-1186STTSDVDIDGLSDHNPFKEEESETDATDYNGHALISNAGHEQDPAPLLPTNPLAVEPAQASVERRVTSMTSRLPAVNWPT
Q17IM7_AEDAE/330-1376QEKFNESRFGVPDTAVLAKLTPESGLISAGLQAKRGFEFPIVQEGSELEIRSEASYEDDEIYREFVEAMEKRNLNLCELP
Q0UQH9_PHANO/170-704....................................................AFGWQDIEAISNKAKQYEHRLRT.....
Q5BEM5_EMENI/175-843.............EKPNTIESKELPDAFSLFDINDAQHMTGLLASDASLEKAKLGQLLNEADHDIEKQSGKLETNF....
Q2UCE2_ASPOR/176-851..........NSQPPAHTEASDTLKDTFDLFDIDDAQNMTGLLANPSSIEKDELSRLIEQGNHKDLEVPEDHRCNF....
Q0D0R6_ASPTN/174-839...............DFTPEHLVLDGDNVVSGAFDLFDMDSAKVTGLLNNQASVESDPLGQLVDAGSIVTGNENAF....
A1CPI0_ASPCL/179-855..........HAQKSDSAVEDRNGPENYEMFDIDDSRNTTGLLTQHSTLNCDELVPLLNTAQPQKSESLESRRSKF....
Q4WSG8_ASPFU/170-850........EEQMQKFVSAGDDPAISPAFELFDIDDSKHTTGLLASDSSLENDELGPLFDASTLEVSRPIHPHRKNF....
Q2H076_CHAGB/195-897..........NKRKYDVAELEYFGKDETQVRENILASIRQLDQSLGNPEPRDELTRLLRHRLYQTPETSHSPRGLTPHWT
Q4P4I8_USTMA/198-1067...GTFSTTSSPLDSSPALPQPAGETDKHMGRVQTNEAPLDPVDDQLARMSQLFASLPGVTNSTLSAAIFTDTEQEPLLS
A8BFK8_GIAIC/197-740...............................................................................D
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044............................................................SDNNNNNNNNVKLNSQQQLL
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766..........................................................................YGAALP
Q7XUI5_ORYSJ/65-1092GFNFESVTNPCEAYCGRSTSSLDEFEVRSAMAVQSNAQASKQFDCSSKLLQSKTTSHAYLTSPGDISAQTNLLENPSGGA
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593.........................................................................INHLHSQ
Q29HV5_DROPS/23-546............................................................LKNIMESNAGDIFSY.....
GCP3_DROME/235-758............................................................LMKVMESSASQIFSY.....
Q16YQ3_AEDAE/217-729............................................................LKQCLENDMDSIFST.....
GCP3_MOUSE/251-761............................................................TKSAESPRDAADLFT.....
Q1K720_NEUCR/225-737................................................................YSKNASRELKY.....
ALP6_SCHPO/196-713................................................................HYQKLVKKLSY.....
Q4PG13_USTMA/283-861...............................................................HTIAGASAELRY.....
Q5KL44_CRYNJ/148-724.......................................................GEFMGCKRGSMSDRVVALKY.....
Q01AM7_OSTTA/101-630.............................................................EILNEVEKAGGLDF.....
GACP3_ARATH/192-713............................................................AAASGTTTRRGGLGY.....
SPC98_DICDI/112-705........................................DDENENQGEDDEIIERKLLIKESKIIKEKTKELNY.....
Q383E4_TRYB2/204-700.................................................................DPSIVAAAQS.....
Q6FLE0_CANGA/180-724..............................................................NRYKQIYDGLRKN.....
SPC98_YEAST/187-740..............................................................KKYHVLYQSNSYR.....
Q74Z68_ASHGO/190-740..............................................................NKYMNKFADLPKS.....
Q6CIT0_KLULA/175-721..............................................................ANKYSLQYRLLGP.....
Q6BX70_DEBHA/183-753............................................................KYSTYIFQNNQGIQS.....
Q4U9K6_THEAN/45-615.........................................................................KVQHHFL
Q4N294_THEPA/45-610.........................................................................PIQYHFL
A8BD62_GIAIC/283-863................................................................PNASGQELLLLSAEAS
Q0UGY4_PHANO/31-649...........................................................................VPPSI
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644..........................................................................KRSGSR
Q0CV34_ASPTN/4-641..........................................................................KRNNSI
Q4WZU3_ASPFU/32-668..........................................................................KRKGAT
A1C7R2_ASPCL/32-668..........................................................................KRTSSI
C8VMB1_EMENI/4-637..........................................................................KRSPTG
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521........................................................................ESHGKEYL
Q0IG23_AEDAE/4-557..................................................................KRTTGDRKFAAI..
Q7PWU6_ANOGA/4-573.................................................................RAASKGSRKGAALAA
GCP4_DROME/4-548..................................................................NKTDPLAAKLAELD
GACP4_ARATH/4-645........................................................RGSQRIRGFMHSDFPETETELDAD
Q60F24_ORYSJ/4-649....................................................RMQSLIGGSGALKELPNFPNISAE....
Q05AR5_XENTR/4-571............................................................................QNAN
Q01B37_OSTTA/4-547...........................................................................SINQR
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677-----------ETEV....YNATKNCTLFQFFQHV-KKFVDPL--------LCFRFAYEKSATNMWD-------------
E4WX70_OIKDI/53-731-----------ITNVRKVRDFIWQ...LTGSTRHE-NKF....--------..FRPAFLDFGEQVMD-------------
B6K1F8_SCHJY/48-653-----------ELLVRKHAYNILK...LEHDVTDL-IVFVEL.--------..LTKRLISGCTSVDE-------------

PF04130

Q2UAG9_ASPOR/234-750HARKSSLTLGDVFPEDSASVYM....PFSA..LLD.SAFGRIV........D...ENHSFTSSLLRR.............
Q4WEE6_ASPFU/229-741DSKAITLTLEHTYGDESSSLLCL...PFAA..ICE.SAIGKLV........E...ANHSFASDLLRK.............
A1C564_ASPCL/237-752QHQKTALTFEGMSNDEHASLVYL...PFAA..TFG.SALDKVV........K...ANQSFTSNLLHQ.............
Q5AUB0_EMENI/232-744APRKTALSFEDIYPSNLSS.TCL...PFYA..LLE.SALNDVI........N...ENHAFTSSLLRK.............
Q0UBK8_PHANO/224-738FGSEPRLDHESVCGLSDDV.PVP...PFAE..LFQ.AAFDRWM........Q...SKYSQASSVLRE.............
Q2HBB4_CHAGB/228-739KYRATAEPSMDFATVCPDGFEFA...PFSE..LFG.AAFQAWI........Q...SKHHSAAATLRE.............
Q1K6Z8_NEUCR/239-749DRMKAEEPPMEFAAVCSDGTSFA...PFSE..LFG.NAFNKWI........Q...SKYHSASITLLD.............
F4HUK8_ARATH/48-872PYQKNSTLPSRVLSWILRTEPRN...TLLPVVIMQ.ECFTINI........R...RQVDNISKVIFS.............
Q6H548_ORYSJ/50-922PLQKDSTLASRALKFIQSMSLRD...PLQPVGIIQ.ECLSKCI........K...RQVDHIGKQILS.............
Q014J8_OSTTA/270-889LVGVRSISTEQVRDTIVSQPTRI...VASRNLQTK.TPLQACV........D...ELNSWLDKFLTKRMPACPMHLLVQG
GCP5_MOUSE/273-942....................TCQ...TFEL..TLR.SCLYPHI........D...KQYLHCCGNLMQ.............
F1QBQ4_DANRE/270-933....................TCQ...TFEL..TLR.SCLYPHI........E...RRYVECCGNLMR.............
C3ZYG0_BRAFL/302-1685TGDPPNLQEGSAHGEGQNTPGLAPEGSQPVQLALQ.RCLYPHI........L...QRCSTISRLLVE.............
Q7PX58_ANOGA/302-918SAARSDRTLSNAYTLYMKLNSIS...TLQL..PLE.HVLFNAI........KNLMETKRHAANHYVT.............
Q4P9B0_USTMA/319-997PISRPDTEPLWDVSITRNHRHLS...HRLLEPLLG.RLLQEHL........S...PISALVRKRVTE.............
Q9VTS3_DROME/266-1244KDERETEQDRDKVST..LPEACN...PFMARRCLQ.LSVMAPL........N...AYYGLLRNEVLR.............
Q2M0Y2_DROPS/276-1186NFGKIAEHEEPQISAVLVPESCN...PFMARRCLQ.MSVMEPV........S...AHYALLRNEVLR.............
Q17IM7_AEDAE/330-1376SMTGDLGNVTELKEIDTELRSLD...VLTVTRFLQ.SSLVIPL........K...AHMEVVNSEILK.............
Q0UQH9_PHANO/170-704.......................................................SLLAYSSGSAVN.............
Q5BEM5_EMENI/175-843..........................APEVTSSLY.LSLAPLL........S...SQALLIDFSCLH.............
Q2UCE2_ASPOR/176-851..........................GPELASALY.LSLAPLL........S...SQALLIDFSCLH.............
Q0D0R6_ASPTN/174-839..........................GPELAASLY.LSMAPFL........S...SQASLIDFSCLH.............
A1CPI0_ASPCL/179-855..........................GPEMISAIY.LSLAPLL........S...SQALLIDFSCLH.............
Q4WSG8_ASPFU/170-850..........................GPEMISAVS.LSLAPLL........S...SQALLVDFSCLH.............
Q2H076_CHAGB/195-897L...............................VPL.LSFGPVI........E...TQSVLINSECMK.............
Q4P4I8_USTMA/198-1067SKADLAKKQEESLVLYLSSAACP...PNAQDAISQ.SAFDRVTQASLVAPFE...SWARLINMSLIS.............
A8BFK8_GIAIC/197-740CNNITWRFPESIVALIREANFAK...LLSS..YSS.DASEGTV........KLIRSIHMLSSKAVVA.............
A2E6U4_TRIVA/44-540................CNKQQLK...QTNKITISS.IQYEGEL........Q...EIYKSASNILIS.............
GACP2_ARATH/70-583..............CGHNVQVPISERSKLTIFGSN.HHYLECI........K...AAHEFASIELVN.............
Q0JBZ2_ORYSJ/73-597..............CEYTVQVPLSESSKLMGFGSN.HQYLECI........K...SAYDFASGELLT.............
Q011F8_OSTTA/257-775................TSLASLAELPAKPSDGLGR.MQFGPNMIVGTGKYADRIAERFEHAASKLLH.............
GCP2_DROME/204-721................CGKRVMPTQEMNLEFDPTS.ERHVSVI........N...DAYYFAARMLLD.............
Q29G36_DROPS/282-800................CGKRVMPTQQMELQLDPTD.ERHVYVI........N...DAYYFAARMLLD.............
Q16HU4_AEDAE/210-728..............CGSSVDYQQNVCVSLKYTHSDHQTYIKAI........E...DAYNYASSSLLN.............
Q7Q703_ANOGA/248-764.................ATARTTTAVKRLQYAHFD.QSYLDEI........E...EAYNFASSSLLN.............
GCP2_MOUSE/220-738................CGHDVTCPVAKEIIYTLKE.RAYVEQI........E...KAFNYASKVLLD.............
SPC97_DICDI/430-1044LLKLNTTQQQQQQQLSSTSASMIPTTIIEYS.KNE.NVYIDKI........E...KAYDYASGILLN.............
A0BDB2_PARTE/150-660................KESPFDNFLIKNQGHIVQN.QDFSHLV............SCFEWANKEIIN.............
Q23AE3_TETTS/242-771...........HEGKVVSSPFELDLVQNYETYLQM.QDFSQPI........Q...KAYEWANAQIMH.............
SPC97_YEAST/62-688SLQIPTIPSNSSDITIQEINDFA...DL....MEG.SNLELYV........D...KCYSRANEIFLK.............
Q6FQY5_CANGA/70-712...TMELTSIPVDGKYALRRAGE...FDFVHLLEG.TNLELYV........S...RWYSRANELCIR.............
Q756H1_ASHGO/63-723.......SCGLATLPHALEHERS...DIATQLPEG.TQLLVYV........D...KWYQRANQMCWD.............
Q6CXD9_KLULA/57-697........CCGNTALKPRSWGTS...VTNIDITNM.TFLKGYV........N...ECYQQANEKCLK.............
Q6BGV8_DEBHA/61-751........CTGLYDFQQLNELIQ...PIDR..LYS.QDLELKI........N...EYYRRANKLLMK.............
Q59PZ2_CANAL/94-759........CTGLHNFESLKEKLT...TITS..LAA.PDLELKI........D...EFYHRANKMLMK.............
Q6C787_YARLI/102-681................CGGGDTSKDAAVNWESIQD.PALVPSI........A...SASDESNRALLS.............
ALP4_SCHPO/74-693......CRKGVNNLASLNAKDDTQNQLLWPSTFDD.DNFTLNI........M...NAYVYANESLLQ.............
Q4X128_ASPFU/183-784................CGGVDISQKVTDVPHTLDD.PRFLDNV........N...AAYTYANASLLN.............
Q7S902_NEUCR/140-744................CGGVDVSRKMQDVPNSFDD.NRFLENI........S...SAYAHANGSLMQ.............
Q0V2V1_PHANO/184-787................CGGVDVSKIVQDAPTSFDD.PRFLDNV........S...SSYAYANSSLLN.............
Q5KPG7_CRYNJ/181-812..............CGIEVKKPGEVDEKEMVTMND.PNFYKRI........E...DAYIYANKTLLK.............
Q4Q0X5_LEIMA/136-766AFRPASVPGGAGAAVGSRPDGPG...DALLTWSGA.NQLQRQV........Q...ESFEISSGAVIQ.............
Q7XUI5_ORYSJ/65-1092FWEKSLEYTAKSMEIAGDTTSSS...DMPLDIAID.KCIIQEV........L...LQYKYVSSFTMK.............
Q9VS91_DROME/97-627..............CNVSLKLLQ...RPLAYSQGD.LGHEEII........K...TSYELPAHKFLK.............
Q2M118_DROPS/72-608..............CNVKLTLMQ...TPLNYNPKE.QGHVEII........R...SSYELPGKKLLD.............
Q5CFR0_CRYHO/45-593NLSFDAVKENGMLNCKKLENTLE...QMLHSLSNK.SDLIRNE............EVKLYINSMFFES............
Q29HV5_DROPS/23-546................................TQD.TKWHAAI........E...ICYQNTAKHVLD.............
GCP3_DROME/235-758................................TPD.TSWHAAV........E...TCYQQTSKHVLD.............
Q16YQ3_AEDAE/217-729................................IST.TKLHQLI........D...SAYLNTSKQVLD.............
GCP3_MOUSE/251-761................................DLE.NAFQGKI........D...AAYFETSKYLLD.............
Q1K720_NEUCR/225-737................................GDT.ATLEAWI........D...EAHRETMSHLMR.............
ALP6_SCHPO/196-713................................RDP.HSLETVV........D...KAYTESINHLVY.............
Q4PG13_USTMA/283-861................................TDL.AGLESTI........E...GAFNSASKRLLD.............
Q5KL44_CRYNJ/148-724................................SDL.AGLERSI........D...DAYSIASQRLLE.............
Q01AM7_OSTTA/101-630................................ENP.DALAVLI........L...ETSKCIDGIVRR.............
GACP3_ARATH/192-713................................GET.DALEHLV........T...EAAKRIDKHLLD.............
SPC98_DICDI/112-705................................INK.EVLQEII........E...LVSRQSSERLLK.............
Q383E4_TRYB2/204-700................................ATF.DTLDSVV........R...DAMRFTNTAVLR.............
Q6FLE0_CANGA/180-724................................GIS.IEFIEAV........N...TQFKEIVSYIDT.............
SPC98_YEAST/187-740................................GIS.TNFFEII........N...DQYSEIVNHTNQ.............
Q74Z68_ASHGO/190-740................................AIG.QPFYDLV........N...EQHAEITAFIND.............
Q6CIT0_KLULA/175-721................................SMD.HKFFELV........N...QQYGEINHYINT.............
Q6BX70_DEBHA/183-753................................MPS.NVIIDLI........N...LQYEEILNYFTI.............
Q4U9K6_THEAN/45-615LDTKASGISNSNDVNFRKYKF...........HSV.DEFALLI........Q...NVHKNVMDEVYF.............
Q4N294_THEPA/45-610LDNQNTKTSQSNPNSSSNPKDVR...KYKF..RTV.EELSLLI........K...NAHNEVMHEVYP.............
A8BD62_GIAIC/283-863GETTQGFRHGEETVASLVCGDGS...TGDLELAHI.RLYKQLI............DINARVQTKVLD.............
Q0UGY4_PHANO/31-649RADNAPSNISELDLLPSHVEMLS...VVRAP.IIA.AELAEAV........T...KIRLSLSRNLLQ.............
Q2H2M0_CHAGB/4-638.KSVGDYTLRGNDHLSTQLTRLA...ALRHP.IDS.ATFARTI........A...DIRHFLSRTTLQ.............
Q2UDA7_ASPOR/4-644TGPPAGLSTTPVTLHGEHIEHFA...TLKSP.IST.AKLSNSI........N...SIRLSLSQSTLS.............
Q0CV34_ASPTN/4-641TSPLVGLSISPASLHGEHIAQLA...SLKSP.IST.AKLSNAI........S...SIRLSLSQSTLS.............
Q4WZU3_ASPFU/32-668MGFDSG..APPVTLQGEHIAHLA...SLGSP.ISA.SKLSNAV........D...SIRLSLSQSVLS.............
A1C7R2_ASPCL/32-668AELSNGFSTSPVTLQGEHIKHLA...SLESP.ISA.SRLSNAI........D...SIRLSLSQSTLS.............
C8VMB1_EMENI/4-637HTPD.GLLTSPVTLQSEHISHLA...GLKSP.ISA.SELSNTV........D...SIRTSLSQSTLS.............
Q5KH00_CRYNJ/4-686..EGKSLPKGLVDSLRGELMAVK...SLEV....G.GGLKEAV........E...KARAEVGEWLWR.............
Q584R6_TRYB2/3-521EQLALGAQDEAADAVFRAIYHPS...LCVNGFLVV.DELETRV........E...ETHALWSKALWL.............
Q0IG23_AEDAE/4-557...KDSLWGDQECAFFKKFHQLQ...LDEN..LNI.AKFEHIV........D...EIKLCVTEQMSE.............
Q7PWU6_ANOGA/4-573AAGKDNLWGDHEQQLFRKFHQLQ...SEEN..LNV.TKFEHLV........D...EIKEQVTKHMST.............
GCP4_DROME/4-548SDDIYQLWSGRESEFFKMVVDLS...NEDT..INV.FRLEKVI........I...DIKNYVSARLSE.............
GACP4_ARATH/4-645LTGGELLPQSEADKIEAMLKDLK...ESSE..FHK.RSFECTV........D...SVRAIAASHLWQ.............
Q60F24_ORYSJ/4-649....ELLPQAEADKIDAMLKELK...HSSE..FHK.RLFESAV........G...SIRTMAANNLWQ.............
Q05AR5_XENTR/4-571MSRTGSILKNQEDTFAAELHRLK...QQPL..FSL.VDFESVL........D...RIRSTVAEHLWK.............
Q01B37_OSTTA/4-547TPSFSFDAEAYAARATARIRKLA...SAES..FDP.REFDAVV........E...SMRSEIAEGLGE.............
A0C933_PARTE/4-693...........QQELFINEHQQL...IREIEVYDS.FTFNRII........D...QLQKQVGEQLVQ.............
Q24CL5_TETTS/4-831..TQKEYENSFLPPQQMLT.LIE...EIRQ..YDS.FKFQNTI........E...SLRYEIAKQMLE.............

PF14609

MOD21_SCHPO/60-677--------------FVKT---LEFIYSTRNYS...........SQMF.----....KLYKASA.----------------
E4WX70_OIKDI/53-731--------------LLQS---RVFIFFRRWQNHARTDDSVCSTSLLVS----AALKQAYGEGMK----------------
B6K1F8_SCHJY/48-653--------------FLHC---IFNIHIGRRSN...........SLHFG----EFFSKLYYETL.----------------

PF04130

Q2UAG9_ASPOR/234-750..............ELDQ...QCGL..WISLQALEHIYHC.KDMSVYG....PIDHKIFDLIDR................
Q4WEE6_ASPFU/229-741..............ELDQ...QCGL..WRSLQALEHIYLC.KDLSVSA....IIDNKVFDLMDR................
A1C564_ASPCL/237-752..............ELDR...QCGL..WTSLNALEHIYLC.KDISVSG....AIDGKIFDLMDR................
Q5AUB0_EMENI/232-744..............ELDE...RCGL..WISLQALEHIHLC.KDISLIG....PIDTKIFELIDR................
Q0UBK8_PHANO/224-738..............HLVE...TSGL..MRTSVILETLYLG.KNGAVFE....DFANALFERMDG................
Q2HBB4_CHAGB/228-739..............LLFS...SYGL..FESLDALQHIYLM.SDGSMSN....SFASSVFRRLDA................
Q1K6Z8_NEUCR/239-749..............ILFD...SYGL..SRAFGALRCLYLM.SDGATSD....AFASTIFRQLDN................
F4HUK8_ARATH/48-872..............KLMN...EWKL..MHELAVLRAIYLL.GSGDLLQ....HFLTVIFDRLGK................
Q6H548_ORYSJ/50-922..............KLMG...DWRL..MDELFVLRAIYLL.GSGDMLQ....QFLVTIFDKLDK................
Q014J8_OSTTA/270-889AIGSFITRRADEIMLVLSKALRDELNIEKELYALRAVFLG.GAGDAAT....HFYSAVFNILDDP...............
GCP5_MOUSE/273-942..............TLKR...DFRL..VEYLQAMRNFFLM.EGGDTMY....DFYTSIFDKIRE................
F1QBQ4_DANRE/270-933..............TLKK...DYRL..LGYLQAMRNYFLL.EAGDTMY....DFYTAIFDKVLE................
C3ZYG0_BRAFL/302-1685..............LLKT...EYQL..EDYLQAMQKFFLM.EAGDAMH....NFYMPLFAKLSA................
Q7PX58_ANOGA/302-918..............YIYK..DEFHV..MDHLKNIRKVLLL.EASDLMD....YFYSDLFRRIEA................
Q4P9B0_USTMA/319-997..............VLLSPVTEGGYALQSHVQACHGLFFM.RRGAEMA....SWLESLFMDLDRRNGMLRATN.......
Q9VTS3_DROME/266-1244...............IFQ...EQRI..YEHFRKLRNYFFL.VDGQFGA....TLTNEILGRIRAG...............
Q2M0Y2_DROPS/276-1186...............IFK...EQHI..YEHFRMLRNYFFL.LNGEFGT....QLTGGIFGNIRAG...............
Q17IM7_AEDAE/330-1376..............MCLN...DLDI..LGHFESLRNYFLL.MDGEFSC....YVCDNIFKMLEEV...............
Q0UQH9_PHANO/170-704...............................NLPRQYHLI.GDGVFSS....LLATALFDPERESAERHKGQMRSALRG.
Q5BEM5_EMENI/175-843..............LLFK...EHNL..KDHLLLQWRFQLL.GDGYFMS....RLSQSLFDPEMESGERKIGVVRSGVHTG
Q2UCE2_ASPOR/176-851..............LLFK...EHKL..RYHLSLQWRFQLL.GDGFFTS....LLSHALFDPEMQSGERKSGVVRSSVHTG
Q0D0R6_ASPTN/174-839..............MLFK...EHQL..RYHLGLQWRFQLL.GDGFFAS....RLSHSLFDPEMKSGERKTGVVRSEVHAG
A1CPI0_ASPCL/179-855..............LLFK...EHRL..RYHLTLQWRFQLL.GDGHFTS....RLSHSLFDPEMESGERRSGVVRSGVHTG
Q4WSG8_ASPFU/170-850..............LLFK...EHKL..RYHLTLQWRFQLL.GDGFFAS....RLSHSLFDPEMESGERRSGVVRSGVHTG
Q2H076_CHAGB/195-897..............LLFS...AHHL..RVHIDLLKQYFLL.DNGLLVS....RLTHALFDPDLSTAERRAGVALGSGTMG
Q4P4I8_USTMA/198-1067..............VFFQ...DLGL..GTYLETCKRFLLL.GSLHFER....QVVSSLFDVDQASVLDAASASSGRAVVA
A8BFK8_GIAIC/197-740..............IIKR...QFLL..FDHLNGILYILLG.MQGDFIP................................
A2E6U4_TRIVA/44-540..............EMFS...QYRL..MDIFNTIWNVILF.RRTDLFN....IFYRVAGNKMRR................
GACP2_ARATH/70-583..............LIKD...KYDL..VGRLRSIKHYLLL.DQGDFLV....HFMDIAREELNK................
Q0JBZ2_ORYSJ/73-597..............LMKD...KYDL..IGKLRSLKRYLLL.DQGDFLV....HFMDIAREELTK................
Q011F8_OSTTA/257-775..............IMWQ...EGDL..KARLESMKMYFLH.ARGDYLV....FFLDTAAAELKR................
GCP2_DROME/204-721..............VLLT...ENDL..MGHLQSVKRYLLL.NQGDFTM....QFMDACEDELTK................
Q29G36_DROPS/282-800..............VLLT...ENDL..MGHLQSVKNYLLL.NQGDFTM....QFMDACEDELSK................
Q16HU4_AEDAE/210-728..............LIMD...KYNL..MGRLFSVKRYFLL.QQGDFID....QFMDICEEDLNK................
Q7Q703_ANOGA/248-764..............LIMN...KYDL..MGRLLSVKRYFLL.QQGDFIT....EFMDAVEEDLRK................
GCP2_MOUSE/220-738..............FLME...EKEL..VAHLRSIKRYFLM.DQGDFFV....HFMDLTEEELRK................
SPC97_DICDI/430-1044..............LLIN...ERHL..ISRLKAIKHYFLL.CKGDFFS....HFMDTTYDELKK................
A0BDB2_PARTE/150-660..............LLFQ...KENI..HKRLKTIKTFFLF.DSGDFFI....HFIEAAESELVK................
Q23AE3_TETTS/242-771..............LVVV...DQDL..QGRLKSIKNYFFL.ERGDFFV....YFLDSSEEELIK................
SPC97_YEAST/62-688..............LFFQ...GYDL..INVLKHLQQIFLGYQSGHNVL....KFLTKNMGELTK................
Q6FQY5_CANGA/70-712..............LFFE...GYNF..GRFLRDIFCNYLYVNNGNKFN....KFLLRNHFDLGK................
Q756H1_ASHGO/63-723..............LLQE...GYQL..PRIMYQLHKHFMLYNCGEFQN....KFFMKSMVELTR................
Q6CXD9_KLULA/57-697..............MYYE...GYHM..DKFLNLIHDQSYV..HGVIDQLWNTKFLSKTLFELTR................
Q6BGV8_DEBHA/61-751..............LLFE...GYQF..PSLIDGFQTLFLF.KDSSKID....VFLEKSFNDLRK................
Q59PZ2_CANAL/94-759..............LLFD...GYNF..PSVVNIFQRLFLF.ADSFQID....NFIDSTFSELKR................
Q6C787_YARLI/102-681..............LLLS...SHNL..FDRLASLKHYFFL.DRADYYI....NFQDIAWTELAR................
ALP4_SCHPO/74-693..............LLQS...SQSL..YAHLYSLKHYFFL.DQSDFFT....TFLDNAQHELRK................
Q4X128_ASPFU/183-784..............LLLT...KNSL..TTRFRSLKHYFFL.DRSDFFS....YFLELGSSELRK................
Q7S902_NEUCR/140-744..............LLLT...THEL..PARLRSLKHYFFL.DPSDYFN....YFLELGTSELRK................
Q0V2V1_PHANO/184-787..............LLLT...THQL..PARLRSLKHYFFL.DRSDFFT....YFLEMGELELKK................
Q5KPG7_CRYNJ/181-812..............LMVE...EQEL..IPHLRSMKHFFFL.NQSDFLT....NFLDLAASELRK................
Q4Q0X5_LEIMA/136-766..............LLFS..PSVDL..LGHLKSLKLYFLQ.ERGDWVV....DFLDSAESLLAE................
Q7XUI5_ORYSJ/65-1092..............LLED...GFDL..CGHLQALRRYHFM.ELADWAD....SFIVSIYKKKWS................
Q9VS91_DROME/97-627..............VLVE...EHNL..PLHIRNLKSYFLL.QEEGFSE....TFLHKCHEYLKY................
Q2M118_DROPS/72-608..............YLKT...EHHL..EWHLGNLHGYFLL.QNQEFAE....ALLANYQEHMQR................
Q5CFR0_CRYHO/45-593.............QLLIYSVCNSITDVRYCINKFYEIFFC.ANDSLIQ....EFIEHIHKLVFRGERADFNS........
Q29HV5_DROPS/23-546..............YMVG...PHKL..LEHLQCMRRYLLL.GQGDFVS....IFIEHMKDELEK................
GCP3_DROME/235-758..............IMVG...PHKL..LDHLHGMRRYLLL.GQGDFIS....ILIENMKNELER................
Q16YQ3_AEDAE/217-729..............IVLG...PHRL..LDHLQALRNYLLL.GQGNFAD....ILMENLQAELDR................
GCP3_MOUSE/251-761..............VLNK...KYSL..LEHMQAMRRYLLL.GQGDFIR....HLMDLLKPELVR................
Q1K720_NEUCR/225-737..............LLND...QFRV..FDHLEALKRYILL.GQGDFIA....LLMESLAPNLDR................
ALP6_SCHPO/196-713..............LMEE...VFHL..TDHLKAIKKYLLL.GQGDFVD....LLMESLGNSLDQ................
Q4PG13_USTMA/283-861..............IFLD...EFRL..LEHLRALKDYLML.ARGDFVD....LLMASLGPSLSR................
Q5KL44_CRYNJ/148-724..............IFFD...KFRL..LDHLRALKSYLML.GAGDFTE....LLMEAMAPRLSK................
Q01AM7_OSTTA/101-630..............VLFE...RYKL..GEHCQALKRYLLL.GQGDLHE....SLMDLIGPSLDE................
GACP3_ARATH/192-713..............VLYK...RYKF..KEHCLAIKRYLLL.GQGDFVQ....YLMDIVGPKLSE................
SPC98_DICDI/112-705..............IVLN...RFKF..MNHVKALKKYLLL.GQGDFIQ....YLMDLIGEDLLK................
Q383E4_TRYB2/204-700..............LIRE...EFHL..DNVLRMVNAFLLV.GNGDFYE....VLIHKLDPVLGR................
Q6FLE0_CANGA/180-724..............IICT...KFHY..HDVLKTLRNILLM.GRGDLIN....TLITKLSSALTS................
SPC98_YEAST/187-740..............ILNQ...KFHY..RDVVFALKNILLM.GKSDFMD....ALIEKANDILAT................
Q74Z68_ASHGO/190-740..............ILKS...KYYY..DETVTVLKDILLM.GRGDFIE....NIIINASDFLME................
Q6CIT0_KLULA/175-721..............TLRS...KFYY..FETLNLLKDILLM.GKSDVID....SIIQNSENLFNQ................
Q6BX70_DEBHA/183-753..............VLQE...KHSM..FHHLQNFKRFLLM.NSNDFIE....SIIEKGIVLFNE................
Q4U9K6_THEAN/45-615..............GLKR...NSQL..LTNLKLVFDYFLL..QKSYIQDIVNNFNTGGLSDLNK................
Q4N294_THEPA/45-610..............GSKE...NFPF..SRTLRMIFDYFLL.QKSCYIQDVINNFKSNCYSDLNK................
A8BD62_GIAIC/283-863..............FFIN...PEYLDFRGHLQNIYAFYLV.MAGDFLS....CFVESAISELVL................
Q0UGY4_PHANO/31-649..............YLLP...RNRI..IETLTVLHQFFLL.GRGEFAM....TLITEADARISAR...............
Q2H2M0_CHAGB/4-638..............RLLP...LSRV..LETLQLLRDFFLL.RRGEFAM....ALTQQADEKIRSRWK.............
Q2UDA7_ASPOR/4-644..............KLLP...LPKI..LEILAVLHDFLLL.RRGEFAS....ALVSHADARLLERHRR............
Q0CV34_ASPTN/4-641..............KLLP...LPKI..LEILSVLHDFMLL.RRGEFAS....ALVSHADARLYDRRRR............
Q4WZU3_ASPFU/32-668..............KLLP...LPKI..LEILSVLHDFLLL.GRGEFAT....ALVSHADARLSERHRI............
A1C7R2_ASPCL/32-668..............KLLP...LPKI..LEILAVLHDFLLL.RRGEFAT....ALVKNADSRLLERHRR............
C8VMB1_EMENI/4-637..............KLLP...LPKI..LEILSLLHNFLLL.QRGEFAT....ALVLHADARLRERQRG............
Q5KH00_CRYNJ/4-686..............HILT...GPQV..AESIEMFGSFFLL.RKTDYCI....AVIRGISQLRL.................
Q584R6_TRYB2/3-521..............KVSK...QVDL..RKHIDAMRAMFLC.HRGDFWH....TFVETAFSTF..................
Q0IG23_AEDAE/4-557..............IAIK...EADL..IKQLKLIKDYYLL.GRGELFL....ELLRQTKSLKTL................
Q7PWU6_ANOGA/4-573..............IVIE...KADL..ERQLRLMKDFFLL.GRGELFS....EFLTQTQSLKLL................
GCP4_DROME/4-548..............IAVN...EVDL..ERQMGLIKDFFLL.GRGEFYL....EFCSQMVGTMETYRE.............
GACP4_ARATH/4-645..............LVVV...RADL..NGHLKALKDYFLL.EKGDFFQ....CFLEESRQLMRL................
Q60F24_ORYSJ/4-649..............LVVV...RADL..NGHLKALKDYFLL.AKGDFFQ....CFLEESRQLMRL................
Q05AR5_XENTR/4-571..............LMVE...ESDL..LGQLKIIKDFYLL.GRGELFQ....AFIDIAQNMLKT................
Q01B37_OSTTA/4-547..............VLLH...RSGL..VAHLTAMTEFYFL.GKGDFYS....IFVDEAKELLAL................
A0C933_PARTE/4-693..............VIVD...KQEL..FIHLKNFYLFILL.NNGNFIQ....QFLSDCQSILQL................
Q24CL5_TETTS/4-831..............LVLK...NQNL..MNHLNTLNNYFLM.GNGEFFK....AFYEESRSLMQL................

PF14609

MOD21_SCHPO/60-677--------------------------------------IAMLLWMVNQASQITSSMTIAR--------PLYNIL...---
E4WX70_OIKDI/53-731--------------------------------------ITEIALEIISVDRSTNPWDISS--------RTLSILFEH---
B6K1F8_SCHJY/48-653--------------------------------------.....STFLNISKIDAGYALPT--------PLLYIIKTS---

PF04130

Q2UAG9_ASPOR/234-750......................................GRGAWDDR..........YLLT........ELAQSAFST...
Q4WEE6_ASPFU/229-741......................................GRGTWSDR..........YLLT........ELAQSAFSS...
A1C564_ASPCL/237-752......................................GRGAWSDR..........YLLT........ELAQSAFSR...
Q5AUB0_EMENI/232-744......................................RKGGWNDR..........FLLT........ELAQDTFGS...
Q0UBK8_PHANO/224-738......................................GRRGWNDR..........YVLT........EITRTIFGT...
Q2HBB4_CHAGB/228-739......................................LNNSWQDR.........FTLTE........VAQEAFSTCLDS
Q1K6Z8_NEUCR/239-749......................................FSTSWNDK.........FTLTE........IAQEAFSQCVAG
F4HUK8_ARATH/48-872......................................GESSNDDF..........ELNI........IIQESIRNS...
Q6H548_ORYSJ/50-922......................................GNPWDDDF..........ELNT........LLQESIRNS...
Q014J8_OSTTA/270-889....................................VKIKAKWNDA..........TLNE........LLVDAFSMDNSG
GCP5_MOUSE/273-942......................................KETWQNVS..........FLNV........QLQEAVGQR...
F1QBQ4_DANRE/270-933......................................KESWQQLA..........FLNV........QLQESVGQR...
C3ZYG0_BRAFL/302-1685......................................GEEWQDVS..........VLNS........QLHSAIQQH...
Q7PX58_ANOGA/302-918......................................GENWANPY..........LLTI........QLNDILASR...
Q4P9B0_USTMA/319-997.............................HHRLHSGFNDALEIHQQSNGGEAWIDVNLVRFCTVNDDMDRAAAIRQR...
Q9VTS3_DROME/266-1244....................................VGPRSLSQKG..........ILDT........ILTNALAAC...
Q2M0Y2_DROPS/276-1186....................................MDPRSLCQKG..........VLDV........ILNNALGGC...
Q17IM7_AEDAE/330-1376....................................RSPDELLNYQ..........TLHT........ILDSALCS....
Q0UQH9_PHANO/170-704......................VLSESYYSSSLYQSLLKTGEVAQANTTISGRDNDELPG........QLNFAIRNL...
Q5BEM5_EMENI/175-843LRLGSR..........DTWPPASSELRLVLMGILNECYS.GEYADGSGNPEFEKEKELPG........GLSFSIREL...
Q2UCE2_ASPOR/176-851LRLGSR..........DTWPPASSELRLVLIGLLSECHGFDDRSESSAGNEPRKERELPG........GLSFSIREL...
Q0D0R6_ASPTN/174-839LRLGSR..........DTWPPASSELRLVLIGLLDECYNADDQRDSTENAEFRREKELPG........GLSFSIREL...
A1CPI0_ASPCL/179-855LRLGS...........RDTWPPASSELRLVLMGLLSDCNMDERLDNSGNVEFLKERELPG........GLSFAIRDL...
Q4WSG8_ASPFU/170-850LRLGN...........RDTWPPASSELRLVLIGLLSDCNMDERLDNSSNAEFLRERELPG........GLSFSIRDL...
Q2H076_CHAGB/195-897LRLGSRQTWPPASSELRLALMGVLSDCYESPTPRLDTNAGANNSSS..........TLPG........DLSFTVRDL...
Q4P4I8_USTMA/198-1067MNQRLTAEGAWPPNDSLLSSALNTAVIETVSSMRHAHEEKLHRTGKTEDAISLAFKDLDE........RLSFAVVEP...
A8BFK8_GIAIC/197-740......................................SLCSILSSTSGGDKYKLSMLE.........KIEQAMMSC...
A2E6U4_TRIVA/44-540......................................DKSEISPA..........DLED........LMSIVY......
GACP2_ARATH/70-583......................................KVHEISVE..........KLQS........LLDLALRTT...
Q0JBZ2_ORYSJ/73-597......................................KPEEISVE..........KLQS........LVDIALRST...
Q011F8_OSTTA/257-775......................................DSDDIRLS..........KLDT........LLDLALKSS...
GCP2_DROME/204-721......................................NVDHVLPM..........TLEN........LLGLTLRIS...
Q29G36_DROPS/282-800......................................NVDLVLPM..........TLEN........LLGLTLRLS...
Q16HU4_AEDAE/210-728......................................DVDELRPM..........RLEN........LLEVTLNMS...
Q7Q703_ANOGA/248-764......................................SVDTLHPI..........RLAN........LLDVTLGLS...
GCP2_MOUSE/220-738......................................PVEDIILT..........RLEA........LLELALRMS...
SPC97_DICDI/430-1044......................................PLDQINMV..........KMNS........LLQLSLRTS...
A0BDB2_PARTE/150-660......................................DIREISKE..........KLES........LFDLAVR.....
Q23AE3_TETTS/242-771......................................QARQVSKE..........KLES........LLEMSIRTS...
SPC97_YEAST/62-688......................................HYRNDNNA......................NYDKLLQNF...
Q6FQY5_CANGA/70-712......................................EYSESRSVL........RRLEQ........SWDVEVDDR...
Q756H1_ASHGO/63-723......................................SRSESIQL..........KLQR........NWQQCQKNT...
Q6CXD9_KLULA/57-697......................................SPTESTLH..........KIQR........HFDDILKEI...
Q6BGV8_DEBHA/61-751......................................NKHAISTS..........RLSK........LYDDTLQHKKDD
Q59PZ2_CANAL/94-759......................................GKLKISVS..........RLQK........QYDDIFKEKI..
Q6C787_YARLI/102-681......................................PASQSSVT..........KLQY........LLDLCLRQP...
ALP4_SCHPO/74-693......................................PAKYISIT..........KLQS........QLDLALRQP...
Q4X128_ASPFU/183-784......................................PAKNVNEN..........KLQS........LLDLVLRQP...
Q7S902_NEUCR/140-744......................................PVKVVNTG..........KLQS........LLDLVLRQP...
Q0V2V1_PHANO/184-787......................................PAKAVNVG..........KLQS........LLDLATRHA...
Q5KPG7_CRYNJ/181-812......................................PAKSASII..........KLQS........LLDLAVRNP...
Q4Q0X5_LEIMA/136-766......................................HPDRIKQH..........SMQV........LLQAAVARSCSS
Q7XUI5_ORYSJ/65-1092.....................................FVKSEHKRA..........EIQG........LLDLALQRSSCD
Q9VS91_DROME/97-627......................................NVERLIPE..........KLQT........LLAETLHKS...
Q2M118_DROPS/72-608......................................GVDRMIPE..........TLQS........LLMETLQKF...
Q5CFR0_CRYHO/45-593..............................SSNITRKWSELMVKYYGVSNDSDKSDRFVC........KVEKNLITE...
Q29HV5_DROPS/23-546......................................PGTEIFAH..........DLSA........MLDTALRCT...
GCP3_DROME/235-758......................................PGLDIYAN..........DLTS........MLDSALRCT...
Q16YQ3_AEDAE/217-729......................................PASEIYQH..........DLFS........ILAAAVRNS...
GCP3_MOUSE/251-761......................................PATTLYQH..........NLTG........ILETAVRAT...
Q1K720_NEUCR/225-737......................................PAGAQYRH..........TLTA........QLEHAIRGS...
ALP6_SCHPO/196-713......................................PANTLFRH..........NLTA........SLESAIRSS...
Q4PG13_USTMA/283-861......................................PANSLFRH..........NLTA........SLETAIRGS...
Q5KL44_CRYNJ/148-724......................................PAINLYRH..........HLTS........DLESAIRGS...
Q01AM7_OSTTA/101-630......................................PANSLSVF..........KLSG........VLEQAVRSS...
GACP3_ARATH/192-713......................................PANNISSF..........ELAG........FLEAAIRAS...
SPC98_DICDI/112-705......................................PTSQIQRH..........KLVG........WMDTAIRNS...
Q383E4_TRYB2/204-700......................................MSHMVQTS..........LVRD........HMQSALLDI...
Q6FLE0_CANGA/180-724......................................SSDLLSDY..........SLTR........ILQESVQQS...
SPC98_YEAST/187-740......................................PSDSLPNY..........KLTR........VLQEAVQLS...
Q74Z68_ASHGO/190-740......................................PVHQLQSY..........QLTK........CLQESVQRS...
Q6CIT0_KLULA/175-721......................................PSQLLESH..........HLTK........CLQIAIQQS...
Q6BX70_DEBHA/183-753......................................PANSLTSN..........QLAK........VLIESINNS...
Q4U9K6_THEAN/45-615........................................................RLQI........HVDRDWDNSPGS
Q4N294_THEPA/45-610........................................................SLQS........HVDRDFCNSTDT
A8BD62_GIAIC/283-863......................................SRSVANIL..........RIRS........KFKMVIKTS...
Q0UGY4_PHANO/31-649....................................HRGPLPIRSNTTKGVVIREAEISQ........TLARSLAVL...
Q2H2M0_CHAGB/4-638...................................RAENLAYQKRDGLSTVTVKEGEVAA........VLARTWAAM...
Q2UDA7_ASPOR/4-644..................................PGNLASKGKFAEGLQGLSIKEGDVAN........ALSQALAEL...
Q0CV34_ASPTN/4-641..................................PETLASRGKSREGLELITIKEGDVLS........ALSQAWAEL...
Q4WZU3_ASPFU/32-668..................................PELLAGRVRAQTELEGLVVKDGDVVH........ALAHTWAEL...
A1C7R2_ASPCL/32-668..................................PELFSARANTHTGLEGLVVKEGDVLS........TLTQSWTEL...
C8VMB1_EMENI/4-637..................................PESSSAR.HVSNSVDGLAIKEGDVAT........TLTKTWAEL...
Q5KH00_CRYNJ/4-686......................................DKLITSNPHSSSSIIREQDLDL........ILRRASVGT...
Q584R6_TRYB2/3-521......................................VDDTISRS......................TVTEAVVNR...
Q0IG23_AEDAE/4-557......................................FSKGITDGS........SR...........DMNRAFQLA...
Q7PWU6_ANOGA/4-573......................................IGKEINDGT........TR...........DLNRALKLA...
GCP4_DROME/4-548...................................ERFK.............................NVTRSFELA...
GACP4_ARATH/4-645......................................PPRQSTGE..........S...........DLMVPFQLA...
Q60F24_ORYSJ/4-649......................................PPRQSTAE..........A...........DLMVPFQLA...
Q05AR5_XENTR/4-571......................................PPTAVTEH......................DINVAFQLS...
Q01B37_OSTTA/4-547......................................PPKLGNAT..........R...........ELATPFAQS...
A0C933_PARTE/4-693......................................PQTQQALQ......................ELNFNLHKM...
Q24CL5_TETTS/4-831......................................PPKPESEG......................HLNNVIVPH...

PF14609

MOD21_SCHPO/60-677---------.........ILCKDFPNNFLEKDNI..........ALQLGS...IVFDQSPTLNNLLVEMEILI-------
E4WX70_OIKDI/53-731---------FPTIYKRFESILPEYS..FLLKKCMWRYVNCIQLFASQR.NFMKVVPTFPLRFTNTEKDSENFI-------
B6K1F8_SCHJY/48-653---------QRVNRQAAKSLLKQTSEKYFAESCS..........ESQAPSFLVFVLRYQQALYELTTIQETEK-------

PF04130

Q2UAG9_ASPOR/234-750..............LPFIDPSRVIVRSSKDPT....................NKAHTHSRSVKLLQ..............
Q4WEE6_ASPFU/229-741..............MPFIDHSRIIVRSHQD........................SQGRSRSVKALK..............
A1C564_ASPCL/237-752..............LSFVDPSRLIVRSHQD........................PEGLGRSVKMLR..............
Q5AUB0_EMENI/232-744..............LPIIDSSRLIVRSAKD........................HDTRSRSVKVLS..............
Q0UBK8_PHANO/224-738..............VMPHQDAERIVARSSK........................VKATSQSVKDLA..............
Q2HBB4_CHAGB/228-739YRLSANIDPRGLGRSALVARS......................................SVRHSLP..............
Q1K6Z8_NEUCR/239-749HRLSADIDQRYIADSPAASRA......................................SVRNTLP..............
F4HUK8_ARATH/48-872..............ADTMLLSSPDALVVSISSEGCLDRDKDDKGDVKSLSSPRESSVNNYAIDCLE..............
Q6H548_ORYSJ/50-922..............ADKMLLTAPDSLVVSLAKHDTRND.......EETTSISRKGRAQGFGIEALD..............
Q014J8_OSTTA/270-889EFPKDRGVQVEIVPEAERNLFSRVVL...............................GTGALEKIA..............
GCP5_MOUSE/273-942..............YPEDSLRLSISFENVD........................TTKKKLPVHILD..............
F1QBQ4_DANRE/270-933..............HPEDSHRLSIFLETID........................PARKKQPVNNLD..............
C3ZYG0_BRAFL/302-1685..............................................................HNLR..............
Q7PX58_ANOGA/302-918..............FNDMTSLFTVEVNRTAG......................YKLDTTTVLLAID..............
Q4P9B0_USTMA/319-997...........................................................SRIHRLA..............
Q9VTS3_DROME/266-1244..............SA.DETTVSENLTLNCTT....................IPDTLNFLSVEATS..............
Q2M0Y2_DROPS/276-1186..............AASDDTLVAQNLTLDCTK....................IPDGLDFMSLEATG..............
Q17IM7_AEDAE/330-1376..............SAAGADKNADRLSFNVEL....................IPERFDLYHPNVVS..............
Q0UQH9_PHANO/170-704..............TEAEQEKVMDP..................................DALSALD..............
Q5BEM5_EMENI/175-843..............TEAEIAKCKNP..................................NAIEALD..............
Q2UCE2_ASPOR/176-851..............TAEEVTKCKDP..................................NAIEALD..............
Q0D0R6_ASPTN/174-839..............TDEEAVKCKDP..................................DAIEALD..............
A1CPI0_ASPCL/179-855..............TDEEITKCKDP..................................NAIEALD..............
Q4WSG8_ASPFU/170-850..............TDEEIVKCKDP..................................HAIEALD..............
Q2H076_CHAGB/195-897..............SPQEIDRCMDP..................................HGLEALD..............
Q4P4I8_USTMA/198-1067........................RSTSSSTRSKSK...........TKPRSKPTWTDPSSIDALD..............
A8BFK8_GIAIC/197-740..............NVSNLPS......................................HVLGCVDVRID..........
A2E6U4_TRIVA/44-540...........................................................KPFEFISVKLEKQQLLSVYTT
GACP2_ARATH/70-583...................AAAAD...................................PRHEDLTCCVDRASLLTTLGM
Q0JBZ2_ORYSJ/73-597...................AAASD...................................PSHEDLTCCVERSSLLKKLST
Q011F8_OSTTA/257-775...................SAAND...................................LHSDDMSCSVEGHRLTQQLSE
GCP2_DROME/204-721...................SARND...................................PYKDDLHCELLPYDLVTQMSK
Q29G36_DROPS/282-800...................SARND...................................PYKDDLHCELLTYDLVTQMSK
Q16HU4_AEDAE/210-728...................SARYD...................................EYNDDLKTMLLPYGIVTQISK
Q7Q703_ANOGA/248-764...................SAKYD...................................EYHDDLKTMLLPYGIVTQISK
GCP2_MOUSE/220-738...................TANTD...................................PFKDDLKIELMPHDLITQLLR
SPC97_DICDI/430-1044..................SISEED...................................EFKDDLECEFIPYKLVDQLLN
A0BDB2_PARTE/150-660..................SIASND...................................AYKDDLVCYIDQYTISEQIYA
Q23AE3_TETTS/242-771...................SLSSD...................................PYVEDLTYEFSQYTLKEQLFA
SPC97_YEAST/62-688..............ELERQSENPNN..................................LMRQLLMIQFDTETLPQVLSH
Q6FQY5_CANGA/70-712...........................................................SLVQRLVSLRYSTVSFRESLL
Q756H1_ASHGO/63-723........................TEH.............................KDSLILQLMTVRLDQMSLAEVIMQ
Q6CXD9_KLULA/57-697..............SVEDTYRH.....................................MILSKLTSVKIDTCPFYETLR
Q6BGV8_DEBHA/61-751FQVKDINKQNSISDNKMN............................................DVLSYCSGLSIDFTNFYD
Q59PZ2_CANAL/94-759.............ENKVGVRP......................................SVYDVLKKNQKLSVTSESLYK
Q6C787_YARLI/102-681.................GSITSTD...................................QYKDDVVASLAPTTVWDYLLQ
ALP4_SCHPO/74-693.................GTITATD...................................PHKEYVTVEVNQTSLIDWLMH
Q4X128_ASPFU/183-784.................GSIAASD...................................PFKEDVKVRMNKIGLTKWLMQ
Q7S902_NEUCR/140-744.................GSIVCLD...................................KFKEDVKVEMNEVTLLKSLQR
Q0V2V1_PHANO/184-787.................GSVAVED...................................PYKEDIKVHMNDTGLTNWLMK
Q5KPG7_CRYNJ/181-812.................SSSSSND...................................PFKDDLKVVMQSQGLYDWLLK
Q4Q0X5_LEIMA/136-766DPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTTAAAVGEGATTALPSRRSMGGSGGEVDARRSLE..............
Q7XUI5_ORYSJ/65-1092SDPYKERLFVYMNEQPVVSLKAST...................................CGLDVLD..............
Q9VS91_DROME/97-627.............ND............................................FIKDNVRCQLKVCDVATLLGR
Q2M118_DROPS/72-608.............DD............................................PFKDLMRCQLKDRDVASQLQK
Q5CFR0_CRYHO/45-593..............SATEELFNPAKWEIKSVLFEEG............FKFIQKDKQNISCSDAFK..............
Q29HV5_DROPS/23-546..............NAQYDDP......................................EILNHLDVVAQPPF.......
GCP3_DROME/235-758..............NAQYDDP......................................DILNHLDVIVQRPF.......
Q16YQ3_AEDAE/217-729..............FSEQEEP......................................EVLNYLDVHFLTHY.......
GCP3_MOUSE/251-761..............NAQFDSP......................................EILKRLDVRLLEVS.......
Q1K720_NEUCR/225-737..............NAQYDDP......................................EITNRLDARMLQLS.......
ALP6_SCHPO/196-713..............NASYEPE......................................YVLKRLDARLLELS.......
Q4PG13_USTMA/283-861..............NAQHDDA......................................EILRRLDARILEFS.......
Q5KL44_CRYNJ/148-724..............NAQYDSP......................................DILRRLDARILEYS.......
Q01AM7_OSTTA/101-630..............SVQSDSS......................................EFIDRLRVRLMPHL.......
GACP3_ARATH/192-713..............NAQYDDR......................................DMLDRLRVKMMPHG.......
SPC98_DICDI/112-705..............NAQFEEQ......................................DIVNRLDIALLPER.......
Q383E4_TRYB2/204-700..............T............................................PHTKNLDTDLFTMLHCE....
Q6FLE0_CANGA/180-724..............SLRSLINRGDN.................................NYIINKLDARLLDLG.......
SPC98_YEAST/187-740..............SLRHLMNSPRN.................................SSVINGLDARVLDLG.......
Q74Z68_ASHGO/190-740..............SLRNYLNKHDN.................................NVIINKLDARLLESG.......
Q6CIT0_KLULA/175-721..............SLRNRLNKSDN.................................NLLVNRLDARILELA.......
Q6BX70_DEBHA/183-753..............SVKNYRS......................................DYKNRLDARILDLS.......
Q4U9K6_THEAN/45-615FR.......PKLYLKCDDLYNFAGALEYYSHYGRDVGSMKVETLDGLETTGFEQDNSLGEWNNSLDF.............
Q4N294_THEPA/45-610FK.......PKLYFKCDNLDNFAGALKYFSHYARDLGVSQLENWNSLESGELRHDKSLGEGNNSFDF.............
A8BD62_GIAIC/283-863..............SLANLPYNERMNVIVCPELFKHHLNS....VLYPQTYVPDRATDSPDPKVLN..............
Q0UGY4_PHANO/31-649..............STLSGNDEHTDDI..............................LEVAARVLHLTLKESPSNRPGTP
Q2H2M0_CHAGB/4-638..............GSMQGDHAEEDEG..............................LELARDLLRLSMAKSRTATPMTP
Q2UDA7_ASPOR/4-644..............YSLQNEEDPVDDE..............................LDLARSLLQLSMNDKRKGHSVAA
Q0CV34_ASPTN/4-641..............YSLQNDEDPGDDA..............................LDLAKDLFKLSVYDKRHATASGT
Q4WZU3_ASPFU/32-668..............YSLQNEEDPVDES..............................LDLARDLVRLSITDSKNRHTVAT
A1C7R2_ASPCL/32-668..............YSLQNEEDPADEA..............................LDLAKDLIRLSISGKDNGQVASS
C8VMB1_EMENI/4-637..............YSLQNEEDPVDDE..............................LDLARELVRLSLKPRDHGQNPGF
Q5KH00_CRYNJ/4-686..............SAELD........................................SQLDSLHYKMEKGPLRAMLPT
Q584R6_TRYB2/3-521...........................................................TAADAFAYALEMSGLGDVRVF
Q0IG23_AEDAE/4-557..............ANSVNITEDVEQFSFALPP.................KEEVDSFCYETKGILS..............
Q7PWU6_ANOGA/4-573..............ANSINLGEDIEQFSFELPCGSR............DGSGEESSFCYETKSAVG..............
GCP4_DROME/4-548..............ATVTGITDDLDKFSLICQR..................STSEPDDTSDFNFLQ..............
GACP4_ARATH/4-645..............ATKTIAEEDKYFSRVSLRMPSF............GVTVRSSQADMVRS...KVSLTGKANL.....
Q60F24_ORYSJ/4-649..............ALKTIGDEDKYFARVSLRMSSF............GIKASTSQKDLQKSSTPEISSQGKAT......
Q05AR5_XENTR/4-571..............AHKVLLDDDNLLPLLNLTIDYH............GKEHKDMSQPREGPSRDTSPREP.........
Q01B37_OSTTA/4-547..............AVTAMPSNIAIYSTFKLVYSSA............LTRSEENAAERPTTPSTAFLPRVHV.......
A0C933_PARTE/4-693........................DYDQTEKMDMF.............IYNNGFEYKTFQSLNNLQIKNNVIQTINILRM
Q24CL5_TETTS/4-831..............TLIRLRNDDEIVNAFKNFQFK.............IKNNGFEFKDFSQVNELNIFGNVHQQRNNYIR

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540IQSVT...........................................................................
GACP2_ARATH/70-583HK..............................................................................
Q0JBZ2_ORYSJ/73-597LKDLDCAY........................................................................
Q011F8_OSTTA/257-775MDDG............................................................................
GCP2_DROME/204-721IMK.............................................................................
Q29G36_DROPS/282-800IMN.............................................................................
Q16HU4_AEDAE/210-728IVKK............................................................................
Q7Q703_ANOGA/248-764IVNN............................................................................
GCP2_MOUSE/220-738VLAIET..........................................................................
SPC97_DICDI/430-1044IININNFNNPTTTTTTNTSSNNIT........................................................
A0BDB2_PARTE/150-660IRNLR...........................................................................
Q23AE3_TETTS/242-771YQNSQMNPN.......................................................................
SPC97_YEAST/62-688YLQIYPEVPENNSANDDSDPLMH.........................................................
Q6FQY5_CANGA/70-712QVQRDEIAREDVTMRDESSDDNDALLRAS...................................................
Q756H1_ASHGO/63-723FEEDEIPEDQLNSNGNDVDHGDSTNGGSGVAGPTADGI..........................................
Q6CXD9_KLULA/57-697QFIDEQETGLLNADNFQQLK............................................................
Q6BGV8_DEBHA/61-751LAEEILNVKSFDAEEAFKNGQNSN........................................................
Q59PZ2_CANAL/94-759VVEELMEKNSDYLISDNNLR............................................................
Q6C787_YARLI/102-681IVCATDP.........................................................................
ALP4_SCHPO/74-693IVSISGLEEGTSSQGNEVWNESI.........................................................
Q4X128_ASPFU/183-784VVSVSGIDQDN.....................................................................
Q7S902_NEUCR/140-744VVNITGIE........................................................................
Q0V2V1_PHANO/184-787IVNVQGLDQDA.....................................................................
Q5KPG7_CRYNJ/181-812IVSKTGSLTEEG....................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627QHKAQRAVED......................................................................
Q2M118_DROPS/72-608LVNREHGEADK.....................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649GRAKD...........................................................................
Q2H2M0_CHAGB/4-638VLPE............................................................................
Q2UDA7_ASPOR/4-644TPSAG...........................................................................
Q0CV34_ASPTN/4-641GSS.............................................................................
Q4WZU3_ASPFU/32-668HSDEI...........................................................................
A1C7R2_ASPCL/32-668FSELS...........................................................................
C8VMB1_EMENI/4-637SGAAA...........................................................................
Q5KH00_CRYNJ/4-686VPVKTPKQTD......................................................................
Q584R6_TRYB2/3-521ERFSTFVRLPI.....................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693GPARGPEDWSGVFRDVKQSIENGFTLQIVFKFKQQLSKPLGGYSILQVPQDLSTSLVLLFCQDEENGVFIRLKLDQQKVS
Q24CL5_TETTS/4-831FQPLKNSKLSGSLWYKFKQNIEMGFKLSFTFRFKKERNYLPINQFSKLGSPNINLLQSSTKGSVNLLQSEEQSPLKSRFS

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693SLSVESKIK.......................................................................
Q24CL5_TETTS/4-831YFTSSIAQDETNENGLLIVFQNTKEISSYKKAAPYRLQDMNEYVAIKFYTKETNKKGAASVAKEINDQKCSIQMVVCNNG

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q014J8_OSTTA/270-889................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
Q4P9B0_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
Q4P4I8_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q011F8_OSTTA/257-775................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044..................................................................ATTNTSSNNTTINT
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688...................................................................ANNFKNMNAILFD
Q6FQY5_CANGA/70-712..............................................................NFENVKRILFEDRHHTDE
Q756H1_ASHGO/63-723.....................................................DSLRFADTTVNTNRHSILQARNFNNLK
Q6CXD9_KLULA/57-697......................................................................GMLVAEEQNH
Q6BGV8_DEBHA/61-751...................................................................IFKALLNNSLERD
Q59PZ2_CANAL/94-759......................................................................GIFHRVASLR
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693....................................................................TKQADVGNETRN
Q4X128_ASPFU/183-784...............................................................................P
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787...............................................................................A
Q5KPG7_CRYNJ/181-812..............................................................................EL
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608...............................................................................N
Q5CFR0_CRYHO/45-593................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
Q4PG13_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q01AM7_OSTTA/101-630................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521...............................................................................E
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693.FKEEIIYKWKLDKIDFSEGDLHSLKINYQNDELSLIIDDTQSDTQCKTDILPPSQWKKVAFKFQKYFQLELGRCMVGIK
Q24CL5_TETTS/4-831KPTYIKNHEFDCDRVNFLDGQLQVIKINYDGENIALHLEDIDNMNRGLQSQLFTFPFKFNKFLNLDMGRAYVGFIQDSNN

PF14609

MOD21_SCHPO/60-677--------RSKI.......LKLGK.SLDLSFDF.............QSLMGEFENLIKQQEEAKKSLWSKRFSRFYYGHY
E4WX70_OIKDI/53-731--------DECVARSNNYPVPPLEPALSLLYEIMRMRAVLKNWGVEERFSDRFFSLETAFDENWDELSEKYFGKRIVHDD
B6K1F8_SCHJY/48-653--------QSDLTVQDTSQLSAGSFSLELSDTL.............QSYTLRF.......KEAYLALNQKKANKYVYGHL

PF04130

Q2UAG9_ASPOR/234-750.........................AISFDYVL-------P.WPVANIIT...KDAILSYQRLSTFLMQIRRAKHTIVKQ
Q4WEE6_ASPFU/229-741.........................TISFDYIL-------P.WPIANIIP...KDAIHRYRRISTFLMQIRRAKHLIVKQ
A1C564_ASPCL/237-752.........................MISFDYIL-------P.WPVANIIT...KDAIQSYQRISIFFMQIRRAKQLVVKQ
Q5AUB0_EMENI/232-744.........................SLSFDYIL-------P.WPVANIIT...KDGIAAYQRVSNFLMQIRRAKYSIVKQ
Q0UBK8_PHANO/224-738.........................AVSLDFAL-------S.WPIQNIIQ...RSSLPVYQQVLTFLLQSYRAKYLLQRA
Q2HBB4_CHAGB/228-739.........................FIRLNYRL-------S.WPVQIVVP...EEDIQGYQTLFTFQLQTQRALSLLQYP
Q1K6Z8_NEUCR/239-749.........................AIRLIYHL-------P.WPIQMIIS...PAEVKGYQTMFVFLLQTRRAIYLLKHP
F4HUK8_ARATH/48-872.........................SLKFTYKV-------P.WPLELIAN...SEAIKKYNQ.......VKRAKYVLD.K
Q6H548_ORYSJ/50-922.........................VLNFTYKV-------S.WPLDLIVN...TEALKKYNQVMAFLLKVKRAKFILD.E
Q014J8_OSTTA/270-889.........................SMRFSFDV-------K.WPHNIVVP...PSAMAQYNAVAVFLGQLRRAHIAMQ.T
GCP5_MOUSE/273-942.........................GLTLSYKV-------P.WPVDIVIS...VECQKIYNQVFLLLLQIKWAKYSLDVL
F1QBQ4_DANRE/270-933.........................GLTLSYKV-------P.WPVDIVIS...SECQKIYNQVFLLLLQIKWAKYSLDTL
C3ZYG0_BRAFL/302-1685.........................SPDVQAET-------D.QPEE.......SDDIPARQK..................
Q7PX58_ANOGA/302-918.........................EIRVLYNP-------S.HDLSNMIN...DDTMASYNSVFRFLLKVKWALGTLEML
Q4P9B0_USTMA/319-997.........................DVKVEYEV-------P.WPLTFVFP...TGCMRFYQYIFSTLLQANYAQWKLA.S
Q9VTS3_DROME/266-1244.........................MLKLNCKI-------D.WPLNMVIS...SETISKYGQIFGYLLKLRHVSFVLD.G
Q2M0Y2_DROPS/276-1186.........................MLTLKCKV-------N.WPLNLVIS...GETITKYGQIFEHLLKLRHVTFVLE.G
Q17IM7_AEDAE/330-1376.........................MLNLSYRV-------E.WPLNLILN...PETIEQYTNIFKYLVKVRRVSFVLG.K
Q0UQH9_PHANO/170-704.........................FLRLQYVP-------P.TPLNLIIT...TEALDKYDLVFKFLLRLLRMLFVIS.H
Q5BEM5_EMENI/175-843.........................FLCLQYKP-------S.NVLEVIIT...QRSLRKYDQLFKQLLRLLRMVSVVK.G
Q2UCE2_ASPOR/176-851.........................FLRLQYKP-------S.DVLEAIIT...SRSLNKYDRLFKHLLRLLRMVSVVK.G
Q0D0R6_ASPTN/174-839.........................FLRLQYKP-------S.DVISTIIT...YRSLAKYDRLFKHLLRLLRMVSVVK.S
A1CPI0_ASPCL/179-855.........................FLRLQYKP-------S.AVLETIIT...QRSLTQYDRLFKHLLRLIRMVSVVK.G
Q4WSG8_ASPFU/170-850.........................FLRLEYTP-------S.PVLETIIT...QRSLDQYDRLFKHLLRLIRMVSVVK.G
Q2H076_CHAGB/195-897.........................FLRLSYKP-------P.ATLRPIMS...PAILLKYDRIFKLLLRVLRMLYVAN.Q
Q4P4I8_USTMA/198-1067.........................WLTLSFHP-------P.PLISPLLT...QLAQSRYQRLWNMLLRIKRCKVAMR.S
A8BFK8_GIAIC/197-740.....................NSKSNFYVTYSI-------K.DPLTSIIT...PGQIRIYETIFQIQWRLRSADDKLD.Q
A2E6U4_TRIVA/44-540.....IKGATKQKNIRITSGTTQWEFFTLAPKV-------S.WPISIVIS...KEFQEKYALFFRFILLWKRIERKFS.N
GACP2_ARATH/70-583........DTDSNSIEDPMSITGLETFSLSYKV-------Q.WPLSIVIS...KKALSKYQLIFRFLFHCKHVERQLC.G
Q0JBZ2_ORYSJ/73-597...PSDKLVAADVDHPMPLSVTGLETFCLSYKV-------Q.WPLSLVIS...RKSLTKYQLIFRLLFHCKHVSRQLC.T
Q011F8_OSTTA/257-775.......DGVTPPSTSNADELTGFDTFVLDYDA-------P.WPASVVLN...RRAVTMYQILFRHLFGFKYAERELC.A
GCP2_DROME/204-721........KEENWQAQPRLDLSGLECFAFTYEV-------K.WPCSLVLN...HISISKYQMLFRQLFYCKHVERQLC.K
Q29G36_DROPS/282-800.......QKEEYWQSQDRLDLSGLECFAFTYEV-------K.WPVSLVLN...HIAISKYQMLFRQLFFCKHVERQLC.K
Q16HU4_AEDAE/210-728.......EDVFLDTLGDTSQLKGIECFTFNYNA-------Q.WPVSIVLN...RWTISKYQMIFRQLFYLKYVERILC.R
Q7Q703_ANOGA/248-764.......EDAFVDTLSDTSQLKGVECFTFTYKA-------Q.WPVSIVLN...LWTISKYQMIFRQLFYLKYVERILC.R
GCP2_MOUSE/220-738.....KQEKAMTHADPTELTLSGLEAFSFDYMV-------K.WPLSLIIN...RKALTRYQMLFRHMFYCKHVERQLC.S
SPC97_DICDI/430-1044TVNTTLIQSTSAHEVLKTNKLFGIESLAFNYNV-------G.WPLSLIIS...RKSLIKYQIIFRHLFLCKHVEKVLV.D
A0BDB2_PARTE/150-660......GIDINENKPPRNQKLKGIELFTLDIKV-------E.WPANLIFS...RASLLNYQILFRSLMSLNYLLKQLN.E
Q23AE3_TETTS/242-771..LLNDQNQEKFKIHTPALTLKGLDLFSLDYRI-------K.WPLNLIFN...RKTLTKYQLIFRHLFNCKYIERQLS.N
SPC97_YEAST/62-688ELSKERTGAYHGSNLELYTPKSAIYHLKFDINI-------P.YPLNIIIS...RTCMIKYQIILRYQLVLQYHSRLLD.E
Q6FQY5_CANGA/70-712YDDHGQQGHEQGREQRREPALSNIHYLEFDLVV-------P.YPLNILIN...HSCMIQLRILQRYMNILAHTQLSVD.K
Q756H1_ASHGO/63-723DMLLKELDHTVTGSSQRKRKLHSVHHLQFELVM-------P.FPLNALVS...KPFIVEYQIIQRHLLLLMYYNRLLE.D
Q6CXD9_KLULA/57-697TSQGSNELDEGRKSKKKKNATPTAMYVQFETSI-------P.YPLNIIWT...KPVMVQYQMIQRLLLILSYHERLLE.D
Q6BGV8_DEBHA/61-751QINSAGSNISPNSYDPDHSDEYTISGVNLDMDL-------P.FPLNMIVG...QNYVLEYQLIFKLQMIVKFINKLID.N
Q59PZ2_CANAL/94-759DDSRLTISSTADSATENVKDEPTITSVDLTIPL-------P.FPLNLVLN...QQLSYQYEIMFKLLINIKFISKYNS.S
Q6C787_YARLI/102-681....NESGWESDSRKMSMDDMPVSCAFQLDFKV-------P.FPLSLVIS...RRALIRYQILFRHLAELKNLERLLS.I
ALP4_SCHPO/74-693FESEHNRSTQGTSKVGSDKDINGFETMQLCYKV-------P.FPLSLILS...RKAIIRYQLLFRYFLLLRHVEMQLE.N
Q4X128_ASPFU/183-784EAVLERYQAPQTQGGEDDKDIVGFDALELDYSV-------P.FPLSLVIS...RKTVLRYQLIFRHLLSLRHLETLLT.T
Q7S902_NEUCR/140-744..QGEALQLTSNQPLEGDKNATGFTSLQLDYTV-------P.FPVSLVIS...RKTIWRYQALFRYLLSLRYLETQLS.V
Q0V2V1_PHANO/184-787AASISNYTPANTAPITDDSNITGFQALQFDYAM-------P.FPLSLVVS...RVTLTRYQLLFRYLLSLKHLETDLA.K
Q5KPG7_CRYNJ/181-812DFALGDIHEEEGSKREKERPLIAIDALAFDYSV-------K.FPLSLIIS...RKTIARYQLIFRFLLHLHHLESALS.A
Q4Q0X5_LEIMA/136-766.........................LLQLETDL-------Q.WPLTLVLD...GKVTHRLNIIFRLLMWVKTCERHLF.E
Q7XUI5_ORYSJ/65-1092.........................DILLGYKV-------D.WPVNIVIT...EEALKTYAEIFRYLVQVRLAVFSLT.E
Q9VS91_DROME/97-627.EEEEEKESCSEQDPPEVLNLYGYEALALGYET-------K.WPLSFIIY...PELLEQLQMLQRVLFFLHYVKHHLT.V
Q2M118_DROPS/72-608EVNTSNTTSDDDGDPFGRFTLYGYEAFALRYEP-------K.WPLSFVLH...SEPLQKMQLLQRVILFLRYVQRQLQ.A
Q5CFR0_CRYHO/45-593.........................YLTIEFHE-------I.KTFGLIWP...RELLYKYEVIFRLVFHLKYINYLLN.N
Q29HV5_DROPS/23-546..................LGDTGWDIVSLQYVV-------Q.GPLATML....EPTMSTYKALFKPLWRMKHMEFVLSTK
GCP3_DROME/235-758..................NGDIGWNIISLQYIV-------H.GPLAAML....ESTMPTYKVLFKPLWRMKHMEFVLSMK
Q16YQ3_AEDAE/217-729..................EGESGWDVFGLTYKV-------S.GPLSTIL....EPSLCRYQTFFKHLWNMKHIQFILS.R
GCP3_MOUSE/251-761..................PGDTGWDVFSLDYHV-------D.GPIATVFT...RECMSHYLRVFNFLWRAKRMEYILT.D
Q1K720_NEUCR/225-737..................HGDIGWDCFTLEYKI-------D.APVDVVVT...EWGNRQYLKVFNFLWRIKRVEFALA.S
ALP6_SCHPO/196-713..................HGETGWDVFTLEYKV-------D.SPINVIIT...PYCSRQYLKIFNFLWRLKRIEFALA.H
Q4PG13_USTMA/283-861..................TGDTGWDTFTLEYKL-------D.SPVNTVLD...NQAMVGYQTIFTHLWKIKRVESSLN.S
Q5KL44_CRYNJ/148-724..................HGETGWDCFALQYKV-------E.AP