Sequence alignment for CL0540

PF14609

MOD21_SCHPO/60-677M...........GI-QGREDLEMPLRNACEV.L----------------------NR..QTVSVK---------------
E4WX70_OIKDI/53-731VKDQIESVVDKFRM-HNFTAQANDFDDHMDDFV----------------------DRALVENGTG---------------
B6K1F8_SCHJY/48-653VISSVEGIAEKQSI-LGREDVANCLHARLAE.L----------------------DQ..VSSNWR---------------
E4YGB9_OIKDI/53-731VKDQIESVVDKFRM-HNFTAQANDFDDHMDDFV----------------------DRALVENGTG---------------

PF04130

Q7PX58_ANOGA/302-918--EI......LWMFTNPVDCK...LFRIDD.........................DQIWINTNVS............LSS
Q4WZU3_ASPFU/32-668--EI......LLSL.SGQP.S..PLFAFNTEE..........................DIVPED..............AF
Q4X128_ASPFU/183-784--DL......LFVF.MGFE.G..RYIHYHHTFDPTAE............KDRLAGPAFQLPSG.................
Q6MYK5_ASPFM/186-866--HA......LFRLGLGWN.S..VLFRYNKQR.......................KAFERVSDNIR...........VSG
Q74Z68_ASHGO/190-740--YI......SYTL.LATT.S..SLFPISN.........................QVIEIPPN.................
Q29HV5_DROPS/23-546--NV......LFSF.TGIQ.G..KFLRKNVVT.......................GRFKLDTAN..............TN
GCP5_MOUSE/273-942--ET......LWLL.SGVK.K...MFIFQLID.......................GKVTVRNNII............VTH
Q6BX70_DEBHA/183-753--YL......SYSL.LGLD.S..KLLSFSRDG.......................NSIELPPN.................
SPC97_DICDI/430-1044--DL......LSTM.IGIE.G..ECIHIGVVQENEDD............SLQSNLVSFVVEGE.................
Q0V2V1_PHANO/184-787--DL......LFVF.MGFE.G..QYIRFSETYNPHEE............KERLVGPQFRILPG.................
Q6BGV8_DEBHA/61-751--DL......LFSL.IGYE.G..CYIRYSEKYDPSEI............NSKIRGPDFKIAKH.................
Q2M0Y2_DROPS/276-1186--HL......KKAA.AGLQ.S.ETFECPAGGG.......................DQLQIKRNTT............VRT
Q0UQH9_PHANO/170-704--QS......LWNLGLGRS.S..ILFDFNTKL.......................KSFEPTVPQGR...........TSG
Q7PWU6_ANOGA/4-573--DI......LFTL.FSSN..AELPI.............................ENFTIPEVA..............ST
Q23AE3_TETTS/242-743--DL......LFVM.TGIE.G..NYIKKKA..DQYRK............PYIYCIEPYLETSTC..............ES
Q24CL5_TETTS/4-823--EI......LFGL.LGKS.G..NIIIEQN.........................DSFVLDPKI..............TF
Q7Q703_ANOGA/248-764--EV......LNCL.IGIK.G..TLITPRKGATTLDP.............DGALAVEFQLSNQ.................
Q7S8K3_NEUCR/231-856--AC......LLGLAQGRSSV...LFSWDSEK.......................GSFVKTAPQLR...........ISG
Q9C5H9_ARATH/70-583--DL......LSAL.VGIE.G..RYISIKR..FHG................KEDSIAFQVDPSM..............DL
Q16HU4_AEDAE/210-728--EL......LDCL.VGVK.G..SLIGPKK..TVRAT.............VGLFPVEFEVSDQI..............EE
Q0UBK8_PHANO/224-738--ET......LFML.AGLRTS...LYKLDPQQ.......................SSIRINPKYV............LAS
Q4P9B0_USTMA/319-997--ES......LSSL.MGSS..SMLYSRHSS.........................GQFTIDNSRK.............DP
GCP4_MEDTR/4-635--EL......LLAL.LGYT.G.DLIIDRRDNNLSANT.............PISDECTFKLAPDI...............S
A2E3S1_TRIVA/121-599--EL......ILLLKGGKS....................................SIFTIQNYQYM...........IDG
Q29G36_DROPS/282-800--EL......IHCL.CGTR.G..NFIVPLPPDANSTG.............IAKYETYFTIHAHL..............DK
SPC98_YEAST/187-740--YV......SYTL.LATT.S..ALFPFDHE.........................QIQIPSKI..............PN
GCP4_ARATH/4-645--EL......LLAL.LGFT.G.DLIVDEREQRKTLGLAFN.......SDSPLSDECTFKLAPDI...............S
A0C933_PARTE/4-693--DL......LFSL.LGKP.G.SFVKQFDNSP.........................FYIDESL...............N
O61208_CAEEL/304-799--CL......LSAL.LGIE..TRLFTPIH..........................REMKITST................A
Q4PG13_USTMA/283-861--DV......IFLM.QGINGR...HVRFQEEF.......................QYNTAAAAAAAAASE...AGESGPA
Q383E4_TRYB2/204-700--DM......LFMW.MGVDKT..KYFAYDNAC.......................CRYEMNSGY..............GT
Q0URZ7_PHANO/220-736--DL......PFTL.QGLS.S..TNLIFPSP........................TALNLPPSL..............PV
A0C8V4_PARTE/161-646--DL......IFSI.QGIESQ...YICYDPIN.......................DLFQVKKD................I
Q96UE2_NEUCS/231-743--EV......VFML.RGLP..TSLFD.............................LACKPVPDYV............LEG
Q560K8_CRYNB/68-851--EL......LLRATLGTV..TTGELMWDKKL.......................SAFVLGERSER...........VLG
A0BDB2_PARTE/150-660--DL......LYAM.MSIE.G..QYIKKKN..GSF................EYQIEGHLEQSTC..............DL
A8BD62_GIAIC/283-863--DC......IAVL.QGCM..QTTYLQVSEQN.......................KEYVVTIRKE............VAT
O94070_CANAX/153-677--YL......PYTM.LGSD.S..KIFTFSNNY.......................TRLEIPKDI..............NN
A2E1L0_TRIVA/46-541--DL......LYCL.IGAEGS...YIRLVDN........................QKYEIRCK.................
Q4UGA7_THEAN/233-712--DL......INVL.KGVDGK...YIKRMKTECR..................LVNSTLKISTD.................
Q2HBB4_CHAGB/228-739--EA......LFML.AGLE..TSLFD.............................FECNPITRYQ............LRG
Q4N4G5_THEPA/98-933--NT......DKII..................................................................
A2E313_TRIVA/240-732--EL......KKLL.LGDESK...ILLTNDDGKI...................TCEKYTIPHQ.................
ALP4_SCHPO/74-693--EL......LNAF.MGME.G..VFVHLQDMKASSEF............ETIIMPPSFYILPGF..............DL
Q2UDA7_ASPOR/4-644--EI......LLSL.SGQPSP..L...............................FEAHAEEDTVSE.........DAFP
Q05AR5_XENTR/4-571--EL......LLAL.SGYPGS...IFTWNKRT........................GLQVVQDV...............P
Q2M118_DROPS/72-608--NL......IYAF.SGVP.S..SHIKPEATIKQIATM..........QQSGLPNVRFKIDEGF..............NS
Q584R6_TRYB2/3-521--EL......QCAL.LGFHSASLPFEILKDSP.......................CDAGVTGTF...............S
Q6CIT0_KLULA/175-721--SI......PYLV.LGTP.S..TLFELKDK.........................KFTIPSNI..............PN
Q2UCE2_ASPOR/176-851--RS......LFRLGLGWS...SLFFRYNRER.......................QMFERVFDDIR...........LSG
Q6FLE0_CANGA/180-724--SI......PFVL.LGTT.S..ELFDIEYD.........................KIIIPSNI..............PN
Q4DZM8_TRYCC/106-657--DV......LAAV.IGYGG...................................SLLQASRDGFI...........VSR
Q0CNS1_ASPTN/283-794--DL......PFNL.QGLS.S..SNLEFTSS........................STLKLPPSL..............PI
Q2UAG9_ASPOR/234-750--ET......IFML.QGLP..TSLFWRHH..........................ESVEVDRKYS............LAH
Q0IG23_AEDAE/4-557--DI......LFTL.FSSN.S.DLPIENFTIP..........................EVAAN.................
GCP2_DROME/204-721--EL......LHCL.TGIR.E..SLLVPQKPIISAVG.............LAKYDTDFDIHTHL..............DR
Q8SU99_ENCCU/71-555--ML......CYVLADVADTSLSIMEELSKNV.......................KKGALGIEVSYFTES...GLSVLKE
Q55SK9_CRYNB/4-687--EI......LLIL.SGHP....................................SSFFIPYPSPPAVPFTCKASPSLTE
Q871F9_NEUCS/225-739--DL......PFTL.QGLS.S..ATLPFLND........................TTLKLPPTL..............PI
Q6CCF8_YARLI/159-656--DV......PYII.QGLH.....TKSYEWTA.......................EGIEMDKN.................
Q8MT65_DROME/266-1245--HL......KKAA.CGIE..SLTFPISSADK.......................LELRVRPNTT............LPT
Q9LM94_ARATH/47-872--GL......LQAL.QGFSSP...FIFWDRKE.......................QTFRAKSEIR............VSH
Q6C787_YARLI/102-681--DL......LNVL.MGHE.G..VYINYSDSYNPRLE............LDRLKGPDYRTARGL..............DP
Q4U9K6_THEAN/45-615--DL......LNVF.SGLGSS...FFIWSKNSE.....................NSSFDIENNPLINGNTIYNLFIIYLI
Q7XUI5_ORYSJ/65-1092--LA......LHAL.HGVKSS...LDEIEELS.......................VLFFSCPADRTSHRV...ANVWSRS
Q2H076_CHAGB/195-897--AC......LSNLALGRS...SVLFSWESEK.......................NSFVKTSPCLG...........ISG
Q01AM7_OSTTA/101-630--DV......LYAC.QGID.G..EFVKFSPAE.......................QAFVIAPNVNVS........AGRRN
GCP3_MOUSE/251-761--DI......LYVF.QGID.G..KNIKMSSTE.......................NCYKVEAKANLNK......SLRDTA
Q01B37_OSTTA/4-547--DL......LLAL.LGVP.GDVFIATDAPER......................APSLAVAEEL..............NF
A2DSV4_TRIVA/119-594--EL......ITLLQCG....NGNTIKYED.........................GKFVISSE.................
Q0JBZ2_ORYSJ/73-597--DL......LSAL.VGIE.G..RYISIKR..VRG................KEGYVVFQIDSSM..............DL
Q17IM7_AEDAE/330-1376--DV......KFLI.TGFS..SRCFEYD..DD.......................NRFRMVGNFT............VDG
Q2H2M0_CHAGB/4-638--EI......LLSL.SGHPSP..L...............................LRSASASSSTPPNSDNPNNNNTPTS
Q5AUB0_EMENI/232-744--EA......IFML.QGLP..TSLLRRID..........................GNVEIDRRYT............LPH
SPC98_DICDI/112-705--DI......IYVF.QGID.G..TYIKYNKQS.......................DSFKIDENTSNTL......VNGEPA
Q011F8_OSTTA/257-775--DL......LYAM.MGID.G..RYISAWR..RKP.................LARVKFEVEIGL..............EA
A8BFK8_GIAIC/197-740--DL......IYAM.QGLP.G..QYFELIKDPTS...................GISHFVLQRQYQ.............SL
A2F3R1_TRIVA/115-545--SF......IYVL.QGVNCR...SFEWSDSR.......................ERFVLLEKI..............PP
Q4PBJ3_USTMA/53-831--HL...................................................ATFYTRYNRV.............KS
A1D041_NEOFI/239-751--ET......LFML.QGLP..TSLFWRLD..........................DSIEVDRRYT............LTH
A2E6U4_TRIVA/44-540--DL......FSCL.LGGDGT...YIRRTKQ........................NKYLVQAI.................
GCP2_MOUSE/220-738--DL......LYVL.VGVD.G..RYITAQP..LAG.................RQNRTFLVDPNL..............DL
Q0CV34_ASPTN/4-641--EI......LLSL.SGQPSP..L...............................FNLRTDEDAISE.........DAFP
A2EPP8_TRIVA/122-554--DF......LFVL.QGFDSD...TFKWNHKA.......................DKFIYTLQV..............PQ
Q2GYC7_CHAGB/148-598--DL......PYTL.QGLS.K...........................................................
A1CPI0_ASPCL/179-855--HA......MFRLGLGWS...SIFFRYNRQQ.......................RKFERVSGGIR...........ISG
Q6FQY5_CANGA/70-712--DL......LDTM.MGLEGK...YIRYNNSYDPH................VDMMPAFRISKN.................
Q4RSJ3_TETNG/316-1146--DL......LNVL.IGVAST...TFPLNQSV.......................Q.FDVRPGVC............VSG
SPC97_YEAST/62-688--DL......LNVL.IGLEGT...YIRYFNDYEPSD...............PETPIEFKIAKK.................
GCP3_DROME/235-758--SA......IYSF.TGVQ.G..KYLKKDVVT.......................GRFKLDQQNIKFL......TTGQAG
Q6CHU8_YARLI/94-627--CL......VNVL.VGRESI...MFIWRWSS.......................RRFVSKHFAQPI.........KVPG
A0DAA4_PARTE/211-878--FV......IQML.LGFQNE...YFVFDIDQ.......................LSYIQQQTI..............YV
Q5BHX4_DROME/97-629--DL......IYAF.SGVP.S..AYVKPDIQIDQISEM..........SAVDIAKIRFRLKKTF..............TG
A1C7R2_ASPCL/32-668--EI......LLSL.SGQPSP..L...............................FNVHSEEDIISE.........NAFP
Q5KL44_CRYNJ/148-724--DT......LYLL.QGID.G..RYVHFAVSPPKEQNPYL......TERGREGEGTGFPLGKEGPIIEE....GYDDEVV
Q0UGY4_PHANO/31-649--EI......LLSL.SGHPSA..L...............................FDTGATSGHVNS.........TTSH
A1C564_ASPCL/237-752--ET......IFML.QGLP..TSLFWRLD..........................DNIEVDRRYT............LAH
Q6H548_ORYSJ/50-922--SV......FEVL.QGFDTV...LLYWDKTA.......................PGYCEKAGIY............VSH
Q4Q0X5_LEIMA/136-766--EV......LAAA.VGLGGL..................................FLQYTPAAPGTSSGISPKEGFQVSP
Q503S5_DANRE/270-933--ET......LWLF.SGVK....................................KLFIFQHNDGKVTVR...NDVVVTH
Q6CXD9_KLULA/57-697--DL......LLVL.QGYEGV...YIRYNSSYRRD................SMTGPEYKVVKM.................
Q389Z9_TRYB2/121-676--EV......LAAA.VGNGG...................................SLLQASRDGFV...........VSR
Q4N294_THEPA/45-610--DL......LNVF.SGLGSF...FFIWTKNSE.....................NSSYYIENNPL............IQD
Q7S902_NEUCR/140-744--DL......LFVF.MGFE.G..QYIRFAKGYNPYEE............RDRLSGPQWRILSGL..............DP
Q0D0R6_ASPTN/174-839--RS......LFRLGLGWS...SMFFRYNQQQ.......................AQFERVFKDVR...........VSG
Q60F24_ORYSJ/4-649--EL......LLAL.LGFT.G.DFVLDAASSPSATRRRRPVP..PEAAAGGDVGPASFRLAPDL...............T
Q6C7A5_YARLI/10-542--AGNISPLVTSSVLDGLENS..................................WHRTLHTA.................
Q7YYU8_CRYPV/251-795--DI......LYAL.QGFE.A..QFIKYDIST.......................DSYILDPSV..............YS
Q9FG37_ARATH/192-713--DV......LYAS.QGID.G..KYVKFNSEI.......................DGYAVQESVKVP........RATRI
Q4P4I8_USTMA/198-1067--SL......VNTATTGTSSD...HFQWDSDSASFVWAATLQHCKNVRQLRRRYKEQATLRASLAAAGDDVDPPPLLPTA
Q5BEM5_EMENI/175-843--QS......LFRVGLGWS...SMLFRFNKQR.......................QKFEKVVKDIR...........ISG
Q014J8_OSTTA/270-889--GA......LHALRAGGEDL..................................ERVSLPHV.................
Q560G7_CRYNB/181-812--DL......LFVL.QGVE.G..VLIRYDEGYDPFDE............EQRVKGAKWRVNPLL..............DA
Q5BBA4_EMENI/34-667--EI......LLSL.SGQQSS..L...............................FSFQTEEDAVSE.........ESFP
Q59PZ2_CANAL/94-759--EL......LFTL.LGHEGH...YIQYSKRYDPTSQ............ISRIEGPDYKIAKN.................
ALP6_SCHPO/196-713--SI......SYVL.QGIS.T..EYVQFKNE........................LAL.LSKRI..............PV
Q16YQ3_AEDAE/217-729--DV......IYAC.TGIQ.G..KYLRKHVVT.......................GEFKLDHIKGRTL......SIGDAG
Q756H1_ASHGO/63-723--DL......LHVL.VGLEGI...YIRYNNSYEPEQRRSG.......ALPYDIVGPDFKIAKN.................
GCP4_DROME/4-548--DL......LLAC.RSHN.PEQLGIKAFNET..........................TVIDQ.................
Q5CFR0_CRYHO/45-593--NI.........L.........................................PANIIKKN.................

PF14609

MOD21_SCHPO/60-677-QSILHAQ-------------ILKLFLELSKPPSDIHVPQIPVYKDCNKN------------------------------
E4WX70_OIKDI/53-731-NSDLHWE-------------ILHFLLEMSNSPTRAAEIKNPA.KRLNAS------------------------------
B6K1F8_SCHJY/48-653-VKLGIAN-------------VLHLLLTLSAHPRDVVWPKEEQEEDISDE------------------------------
E4YGB9_OIKDI/53-731-NSDLHWE-------------ILHFLLEMSNSPTRAAEIKNPA.KRLNAS------------------------------

PF04130

Q7PX58_ANOGA/302-918TTEHGIQT.............FLLNFTEYMTIAYRLR..NFCRSILEHTAR.............................
Q4WZU3_ASPFU/32-668PLSPPEKA.............LLTSLARLSRLHAKLR..EQTSLISSSH...............................
Q4X128_ASPFU/183-784.LDPTLRD.............LTSSMLKMATHYSALE..SFVE..VQSRA..............................
Q6MYK5_ASPFM/186-866VSLAVVNG.............LTEEVLRCGTAMYNLR..DFARRTRIKPE..............................
Q74Z68_ASHGO/190-740.VPNGESG.............VFHSIFEAALLYQYLS..NQVEKFKVASS..............................
Q29HV5_DROPS/23-546LLTTGDAG.............LMLRLSELGYYHDRVA..EFAD..PSKGY..............................
GCP5_MOUSE/273-942LTHSCLRS.............VLEQIAAYGQVVFRLQ..EFIDEVMGHSSESLPPGNG................PIPKKQ
Q6BX70_DEBHA/183-753.INSSYSG.............LLHSILEPGLVYKKLK..LFVD..SNKGK..............................
SPC97_DICDI/430-1044.VDPSNND.............LVQRILPLCSYYSFVN..DFIQIRYAYE...............................
Q0V2V1_PHANO/184-787.LDPSLRD.............LTKSMLKTATHYIAVE..TCIEVLSREE...............................
Q6BGV8_DEBHA/61-751.LDISLKC.............ITKKLVKFGKYYSGLN..GFLELYDRPE...............................
Q2M0Y2_DROPS/276-1186VLPEVLSD.............FVQPFLESGTAFRRLS..ARIK..SRGPR..............................
Q0UQH9_PHANO/170-704LSPVAAQS.............LVTRFIHTGNTFLYLR..SFAAKTFASAT..............................
Q7PWU6_ANOGA/4-573FLHPGEIH.............ILEELIRIANQYKEIK..KFVQQYGTLNAGLLKPKQ.................QKPTEE
Q23AE3_TETTS/242-743....SLKQ.............LVNKILEICLQYDKIQ..NYIA..QHQQF..............................
Q24CL5_TETTS/4-823.LTPAEKE.............IINSLCCLGYYYKNLE..QFLD..ENYNNFAKITYFMNKNNNFNENCDDQNDGPIAEVN
Q7Q703_ANOGA/248-764.LTESCRD.............MVVEVLPLAANYSAVQ..SFIE..GASVT..............................
Q7S8K3_NEUCR/231-856VSVQSIQG.............MDQFCLDCGNAVKALL..SFSESAYFES...............................
Q9C5H9_ARATH/70-583....ALQE.............LAKRIFPLCEYYLLID..QFVE..SSSQF..............................
Q16HU4_AEDAE/210-728....SLRD.............IVREILPLASHYSQVQ..DFIA..ASSSL..............................
Q0UBK8_PHANO/224-738AMSNTVQH.............LLSELVNIGRNVYRLR..QWTKRSQTL................................
Q4P9B0_USTMA/319-997.LTNSLTE.............QMEAVAYLASTLSILR..SFVKATVFQSIHTV..........................D
GCP4_MEDTR/4-635FIDPSDRE.............LIERIITLGFYYRELE..RFSA..KSRNLNWIRSEN.................ANPLEN
A2E3S1_TRIVA/121-599LIMPHHIN.............CVSKIMSNCICIDTLN..SIIG.....KL..............................
Q29G36_DROPS/282-800....SLTE.............LLQDILPLASYFIGIQ..KMMA..ATDG...............................
SPC98_YEAST/187-740....FESG.............LLHLIFEAGLLYQSLG..YKVE..KFRML..............................
GCP4_ARATH/4-645FIEPSERD.............LIERLIKLGFYYRELD..RFAK..KSRNLSWIRSVTSVHPL.......ERADELSKQSR
A0C933_PARTE/4-693LFSKPEIV.............QLNQIVNLGYHYQQID..NFL......QNQ.............................
O61208_CAEEL/304-799SLSTTHQA.............VCSRILPIANTYLLLSHKEPNNTGQ..................................
Q4PG13_USTMA/283-861KVVRIVFSEGEAGYINAPTKRIVHRLAELGQLYKRVS..EFSQQRSAMPA..............................
Q383E4_TRYB2/204-700...VRQRQ.............AFSAFQECGCLAHQID..DALR..G.GTS..............................
Q0URZ7_PHANO/220-736....PIIS.............LLHTLAEPAILYRGLA..EF.......VESA...........................D
A0C8V4_PARTE/161-646AISSASRK.............LLNAMCECGWLFKKIQ..AFTQNNYNS................................
Q96UE2_NEUCS/231-743VTWQTYDA.............LVNTFSECGRKLAPLR..IYASKKEKE................................
Q560K8_CRYNB/68-851LERETLSG.............FKTNFLTIGTSVRRLE..LIIDSQSNLP...............................
A0BDB2_PARTE/150-660....SLQQ.............MVSKILPMCSQHDFIE..NYIQ..QKIKF..............................
A8BD62_GIAIC/283-863ELPATLVA.............MTQRVLVHAHARFQIV..NTIY..THQVP..............................
O94070_CANAX/153-677....SFSS.............LLREVFEFAILYKQLA..IVVD..RYKGT..............................
A2E1L0_TRIVA/46-541.IHDSISS.............FVEKIIPICNDFCIIR..KYAEGHFAFH...............................
Q4UGA7_THEAN/233-712.....FKI.............AIVKITFMAKLYHTIK..LYLSQLNSL................................
Q2HBB4_CHAGB/228-739VSWDSYKA.............LVTSFSECGRKLAPLR..VYVENREQS................................
Q4N4G5_THEPA/98-933EIDTNFEE.............ITDELIEIDNNLNTKN..ELVTSS...................................
A2E313_TRIVA/240-732.....NSS.................LNYVSRIIKIVNQIRTSNESFTG................................
ALP4_SCHPO/74-693....GIKD.............IASEMLEMGSHYLSIT..AFIE..SRSHF..............................
Q2UDA7_ASPOR/4-644LLSPPEKA.............LLASLARLSRLHAKLR..AHTALISSSH...............................
Q05AR5_XENTR/4-571FLHPGETN.............VLNRLCKLGTDYIRFT..EFIEQYTGHVQQQDHHP...................SQQGQ
Q2M118_DROPS/72-608....TIRT.............LGNYLLPLVGHFISVQ..NFIE..TTNMT..............................
Q584R6_TRYB2/3-521QLHPSERS.............LVGEVLPLGEMCQTLR..ALATDFAVGRT..............................
Q6CIT0_KLULA/175-721....GESQ.............QLHDIVEAGLLYLHLQ..IRVE..YLKKH..............................
Q2UCE2_ASPOR/176-851VSVAALNS.............LTDEMIQCGTDMQRVR..NFVGKAPSKST..............................
Q6FLE0_CANGA/180-724....SESG.............ILHLIFEAGLLYKELG..NLCD..KYRRM..............................
Q4DZM8_TRYCC/106-657YVPVSMRS.............LCKTIVPVADSFVALRKVERAEYMGKS................................
Q0CNS1_ASPTN/283-794....PLVS.............ILNALAEPCLLYRGLS..TF.......VESS...........................S
Q2UAG9_ASPOR/234-750LSSETLSS.............LLRSFCSIGSKIDILR..RYNQVPRVI................................
Q0IG23_AEDAE/4-557FLHPGEIK.............ILEDLIRIANQYKELK..KFVH..QYGTQSAGLVKPK...............QQKPSEE
GCP2_DROME/204-721....SLTH.............QVREILPLASYFMGVQ..KIIA..ATDG...............................
Q8SU99_ENCCU/71-555NVGTHVYG.............IVFQIYQNACMYRRLRSETFLYSKAHS................................
Q55SK9_CRYNB/4-687YLHPGEVA.............SLNSLADLAFQYRKVK..TWANDTIDCGRKAILAESLPPSRKG....KEREVFMNDKGD
Q871F9_NEUCS/225-739....PIIS.............LLNTLAEPSLLYRGLN..EF.......TKTP...........................A
Q6CCF8_YARLI/159-656.MPIQLVS.............LVSEALEPALLYRQIR..EYLDTPTSG................................
Q8MT65_DROME/266-1245MLPEVLAD.............FANHFIRAGCAFLRLS..SRTK..WNNIAE.............................
Q9LM94_ARATH/47-872LSQSSLHV.............LLAGFLYAATCLKLVE..SIVSGINASLK..............................
Q6C787_YARLI/102-681....SFKD.............FTRACIKIASTYVSLS..AFVD..KMTRD..............................
Q4U9K6_THEAN/45-615YVGNEMIE.............VCHEILRI..HFDQLTLLEFVASSYTG................................
Q7XUI5_ORYSJ/65-1092SSTTSVGN.............ILKSIRTTGLSVLFLC..KFLHFYLFQSRELNGRGREGHEH........EVSDSEETEQ
Q2H076_CHAGB/195-897LSLETVKA.............VDKLCLDCGNSARHLQ..AFAEGAYSIA...............................
Q01AM7_OSTTA/101-630.....................LIKSLTEVGWLFKKVT..SSLG..DARTTGVD..........................V
GCP3_MOUSE/251-761.......................VRLAELGWLHNKIR..KYAD..QRSLD..............................
Q01B37_OSTTA/4-547FIKPHERE.............RLNNLIRIGASYGALE..RVTR..SERESVIDHD......................GLD
A2DSV4_TRIVA/119-594.....................ISPQFLKV..TLKILSTVQCIHELSQSRE..............................
Q0JBZ2_ORYSJ/73-597....ALQE.............LTRRIFPLCEDFVLVY..HFVE..SRSHF..............................
Q17IM7_AEDAE/330-1376VSPVTIKA.............VVDQFLELGTCFRRLH..KMTK..KNPYNYA............................
Q2H2M0_CHAGB/4-638PLTPPERA.............LLASLAHLSELHIQLL..TSTAHIAAAH...............................
Q5AUB0_EMENI/232-744LSHEALSS.............VLRSICACGTKIDILR..RFTRTPQSA................................
SPC98_DICDI/112-705YISKPKRD.............LVYRLCEFGWLFKKVR..LFI...TNNDF..............................
Q011F8_OSTTA/257-775....PLAA.............LVNNMLPLCTDAATVR..AFIE..SRQDF..............................
A8BFK8_GIAIC/197-740SVSQTAAT.............FCERIASCGFFYTRCT..ELLN..AVTKT..............................
A2F3R1_TRIVA/115-545....NLYI.............PAQIVSQIGSMVKMIR..DYIE..RRR................................
Q4PBJ3_USTMA/53-831FAEDQIEA.............ARQRAVRAALRANSLASRSASSAKEAQAQL.............................
A1D041_NEOFI/239-751TSAEALSS.............LLRSFSMIGAKVDVIR..RFIKITQVV................................
A2E6U4_TRIVA/44-540.LRDSTQS.............FIDQLIPICDKFYYCQ..KFSETHYYLK...............................
GCP2_MOUSE/220-738....SIRE.............LVNRILPVAASYSTVT..RFIE..EKSSF..............................
Q0CV34_ASPTN/4-641LLSPPEKA.............LLTSLARLSRLHAKLR..AHTASISASH...............................
A2EPP8_TRIVA/122-554....NFVY.............ITKKVSEIGCILRFLR..TFEQ..KMS................................
Q2GYC7_CHAGB/148-598........................................L.......CQVSS..........................K
A1CPI0_ASPCL/179-855VSLTAINS.............VVEQLLQCGTDMQRIR..EFARRTRVKSR..............................
Q6FQY5_CANGA/70-712.MDKSLKQ.............CCIKILKLSKSYIFIN..NCIQEWSRPS...............................
Q4RSJ3_TETNG/316-1146ASPESMSR.............LLVELAQYGTHYLRLS..HFSLQ....ST..............................
SPC97_YEAST/62-688.MDPSFKT.............FSRRIVRYGKQYMILT..RAYEKWSDTS...............................
GCP3_DROME/235-758.....................MLLRLSELGYYHDRVV..KFSD..VSTGF..............................
Q6CHU8_YARLI/94-627VSTMALQG.............LVDQCLEIGSLFTRLS..NTAKDIAKMVS..............................
A0DAA4_PARTE/211-878EDMTSLQQ.............ITQKFIELANYIQRLRFYLLTPSNTIL................................
Q5BHX4_DROME/97-629....AFRA.............LANETLPLIGYYISVQ..SYIE..ETNMS..............................
A1C7R2_ASPCL/32-668.LAPPEKA.............LLASLSRLSKLHAGLR..KHTALISSSH...............................
Q5KL44_CRYNJ/148-724VISQPTRT.............LLMQLSEMGMLYRRVT..NF.......VNSRQ.........................AG
Q0UGY4_PHANO/31-649LLSPPEAE.............LLSSIGHLSRLHRKVR..DHAARIATTH...............................
A1C564_ASPCL/237-752ASNESLTS.............LLQSLGVIGARIDVLR..QFTKTKQAV................................
Q6H548_ORYSJ/50-922LSQTSLRA.............VLKPFLFAATCLKQVE..LFVGRVRSCGH..............................
Q4Q0X5_LEIMA/136-766LVPASMRS.............LCETVLPVADAFMALRCIEKAEYSSCS................................
Q503S5_DANRE/270-933LTNNCLHS.............VLEHIAAYGQAVSRLQ..KFIDEVTGHSAEPCPPGLNS.............SSSSSKKS
Q6CXD9_KLULA/57-697.MNVTFKS.............FSKKLIKIGSIFVKLD..KFQQWCCDER...............................
Q389Z9_TRYB2/121-676YVPVSMRG.............LCKTIVPIADSFVALRKVERAEYMGKS................................
Q4N294_THEPA/45-610.VGDDMIE.............MCHEILRI..HFDQLTLLEFVASSYTG................................
Q7S902_NEUCR/140-744....SLLD.............LTQSMLRMASHYTALE..TFVD..VQSRE..............................
Q0D0R6_ASPTN/174-839ISLTALSG.............LVDEMIRCGTDMQRVR..NFVIKTPSGSG..............................
Q60F24_ORYSJ/4-649FLQPSERS.............AIERLISLGFYYRELN..RFAT..ESRDLSWINSPIDVSP.........THGEKTVKAK
Q6C7A5_YARLI/10-542.....ERQ.............LLNQFAECGRLFSSID..ERVKSTMYATSALSRR.....................EAGI
Q7YYU8_CRYPV/251-795..LETTRE.............IVTEICHFGTIYKRMT..QIVN..YYKQELEN.........................SY
Q9FG37_ARATH/192-713.....................MVRMLSELGWLFRKVK..TFIT..ESMDRFP............................
Q4P4I8_USTMA/198-1067MMQPWIGSERILGWSQAASDSVIRPLLDIGALLRRIDDRTLAIHRSSAT...............................
Q5BEM5_EMENI/175-843VSTLALSG.............IIDEMLQCGNNMQRVR..TFIGRVPTAAA..............................
Q014J8_OSTTA/270-889.SCVTLDG.............ALASIRRVVAVLVRVR..EINQASLKF................................
Q560G7_CRYNB/181-812....SLLS.............LVKRLLPLASFFTAVE..ASME..LRTAP..............................
Q5BBA4_EMENI/34-667LLSPPEKA.............LLASLARLSRLHARLQ..AHTALICSTH...............................
Q59PZ2_CANAL/94-759.LDISLKV.............ITKKLVKFGKFYSGLK..SFIQVFDNNK...............................
ALP6_SCHPO/196-713....QYLL.............QMRALSETGLLYQELK..VFSN..YDPSVSQSIDGD.................NVSKAF
Q16YQ3_AEDAE/217-729.....................MILQLAEVGHFHDRVV..KFTD..PKSDC..............................
Q756H1_ASHGO/63-723.MDPSLKS.............VAKRISKVGRLYVILS..EFINRFEQTR...............................
GCP4_DROME/4-548FIHPCERE.............IFMDIIKIIKVYQEVE..QFTH..SSGRKSDTHG......................ELP
Q5CFR0_CRYHO/45-593...PSLYP.............LSYKTLELSSLHRRIR..KFLKVHESGNS..............................

PF14609

MOD21_SCHPO/60-677-.EQEAIIQ.....LLTSCEGDHWL..MPDWSSMPDDE------------------------------------------
E4WX70_OIKDI/53-731-IEEEAEKSEDSENMEEFDNGDRWDDKLSEWSE.....------------------------------------------
B6K1F8_SCHJY/48-653-LASEKLINQDDTYLSAPFEGEHWD..IPNWESSDSDT------------------------------------------
E4YGB9_OIKDI/53-731-IEEEAEKSEDSENMEEFDNGDRWDDKLSEWSE.....------------------------------------------

PF04130

Q7PX58_ANOGA/302-918SLPAPHSFECYAAGVKSFLD.HMES.VMIRHEKELIKQE.........................................
Q4WZU3_ASPFU/32-668...PSIICRAVSSAINAHHLGGFQR.KILEVEKAILAEDSAY....................................VG
Q4X128_ASPFU/183-784..EYGAVNHALCATIRRILK.DYLI.LVAQLETQLLNH..........................................
Q6MYK5_ASPFM/186-866...GFSARSAFASAVAMIIY.TLEK.QIINYFKE..............................................
Q74Z68_ASHGO/190-740...LSPLKVNFLTVVSERLR.EYSR.VVNQLSSSIASE..........................................
Q29HV5_DROPS/23-546.SALGCMGQALTCFLRKELG.AYHG.EVALLHDQVNDFKKAQLKRGFA.......................DREQEWLDS
GCP5_MOUSE/273-942PDAPFRTYQAFMWALYKYFI.NFKE.ELTDIEKCVISS..........................................
Q6BX70_DEBHA/183-753..IVSPIKTAFLRSLESELN.YYVN.HINEYFNT..............................................
SPC97_DICDI/430-1044...WGIINHSLCFSIDQLLK.EYLV.LVSQLEGQLKS...........................................
Q0V2V1_PHANO/184-787...YGAVNHALCAAIRRLMK.DYLT.LIAQLEHQLLTN..........................................
Q6BGV8_DEBHA/61-751...FGKVVQRLCFAISEFLI.VYQQ.VIKHIEDEFKFN..........................................
Q2M0Y2_DROPS/276-1186..LEGPLNRAMRDTIIDFLA.TNRQ.FFLSLPAE..............................................
Q0UQH9_PHANO/170-704...SIPARVALATTVSSVLY.TLEE.QLGKYSSKIRS...........................................
Q7PWU6_ANOGA/4-573PLPQGLYLQAFVDGLELVVK.PYRD.LVVELEAKYLKR..........................................
Q23AE3_TETTS/242-743..SFGTVSQALCAALGLLLR.EYVV.MINQLDQEFQK...........................................
Q24CL5_TETTS/4-823VIGNSAYLKGFCLGLEQIIN.SYRE.KIIEIERDFLEN..........................................
Q7Q703_ANOGA/248-764..EGGVVLQALRSVLKTIMT.DYYL.SIAQLDDLRCR...........................................
Q7S8K3_NEUCR/231-856...PTPTSVALAKVVDQLVV.AVQT.EVAARSKAVRS...........................................
Q9C5H9_ARATH/70-583..KNGLVNHAFAAALRALLL.DYQA.MVAQLEHQFRLG..........................................
Q16HU4_AEDAE/210-728..ESGQVLQALRAALQAIIK.DYYL.SITQLEDLFLKQ..........................................
Q0UBK8_PHANO/224-738.....PLIQTFESTVRMRLV.AFDR.ALADVQQRYLT.P.........................................
Q4P9B0_USTMA/319-997ALTRTPAVEAFAEQLQALLE.NLCS.QFSELDADIAAGSTLAHP................................AVIR
GCP4_MEDTR/4-635KEKPSVYRRALANGIVEILA.VYSS.SILHIEQLLLSE..........................................
A2E3S1_TRIVA/121-599...YGIVGQSVETVLQKEKN.EYIT.EMQSLTSE..............................................
Q29G36_DROPS/282-800...HGQVVNSLNAALQDLTN.DFYV.LVVQSEQELQQQ..........................................
SPC98_YEAST/187-740..NISPMKKALIIEISEELQ.NYTA.FVNNLVSSG.TV..........................................
GCP4_ARATH/4-645EKKPSVYRRAIANGIGEILS.VYRS.AVLHIEQKLLAE..........................................
A0C933_PARTE/4-693.EEKSSYIKALVFGIDNSLN.DYRQ.TILTLEQEYLNE..........................................
O61208_CAEEL/304-799......MTEALMAAIRRIIG.DYIT.DIDALRRT..............................................
Q4PG13_USTMA/283-861...SGLIMQSLCHFISKELT.GFYR.LVASLEAQMSNGSKNSPGLAQDA.....................NVAAGVGSDA
Q383E4_TRYB2/204-700..ERSFLQQSLRGAVRRHLS.QYHT.LVASFRGRQTPP..........................................
Q0URZ7_PHANO/220-736GGLIG...QSFRSALAKELR.AYLG.LVATLEGQIRRALTQLSEG.............................PAHQGV
A0C8V4_PARTE/161-646.....LVLQALQNSIKEELN.EYYR.LIAYFENLLAE...........................................
Q96UE2_NEUCS/231-743....EPLLQVFQDSLQKALQ.SFDQ.ELTAIQGRFVA.I.........................................
Q560K8_CRYNB/68-851...LTSTHHALFHALGTYL..TYIKDRLACAATECHEQ..........................................
A0BDB2_PARTE/150-660..ENGYISQAFCSAIKELMQ.KYLL.MVNQLDYEFNQG..........................................
A8BD62_GIAIC/283-863..EYGRIANAFSQALRCIIK.EYDF.YLADLSKKHYGKMQS.....................................SA
O94070_CANAX/153-677..LVSAIKTAYIAILEAQLN.KYVN.DINNIFNN..KP..........................................
A2E1L0_TRIVA/46-541...HGRIMHALCSALRTVTS.EYQQ.TIAKFENA..............................................
Q4UGA7_THEAN/233-712....NPISSQSQHNLKKLT..DYIKLLNLLLNSE..............................................
Q2HBB4_CHAGB/228-739.....PLLQVFRACLQKALH.HLDL.ELSLIQTSLVA.I.........................................
Q4N4G5_THEPA/98-933.....YYLSCFANSIKSYLN.EYRN.YLTNLRNGTHSP..........................................
A2E313_TRIVA/240-732.....SIGRNMLDVIEKEFK.PIVE.QIENIDTNKT............................................
ALP4_SCHPO/74-693..EYGFVNHALCAALRKFVM.DYVV.LIMQCENQSRID..........................................
Q2UDA7_ASPOR/4-644...SSVICRAASTAISTQHLGDFQR.KVLEVEKSILVEDSGY....................................VG
Q05AR5_XENTR/4-571VGLHGIYLRAFCRGLDSILQ.PYRQ.ALLDLEQEFLAD..........................................
Q2M118_DROPS/72-608.PRSGRTSLALAAALNDKMQ.QYYD.LQATMETEMQQR..........................................
Q584R6_TRYB2/3-521...DGLYISAIASAVVQILR.SYEE.SVR...................................................
Q6CIT0_KLULA/175-721.VTTSTLKVAFLTLIQSKLR.DYSN.FVNNFSSHLHPL..........................................
Q2UCE2_ASPOR/176-851...KLSALSTLSSAVAVVIY.IVEK.RLLRDADNILS...........................................
Q6FLE0_CANGA/180-724..PISPMKKAFIIAVGSELN.TYNG.LINQLASND.KI..........................................
Q4DZM8_TRYCC/106-657.....LVAMALGEVVSEICT.SFAH.EIANLQRWAQG...........................................
Q0CNS1_ASPTN/283-794GGLLN...QSLRAALSNELR.SYLG.LVATLEGEIRRALTASGDL.............................SDPSNS
Q2UAG9_ASPOR/234-750.....PYLQTFHRGIEDRLR.EFDR.FLSNVQAQYLS.QS........................................
Q0IG23_AEDAE/4-557PLPQGLYLQAFADGLDLAVK.PYRD.LIVHLEAYYLKR..........................................
GCP2_DROME/204-721...LGQVMNSLNEALQELTH.DFYL.IIVQAEQELRHN..........................................
Q8SU99_ENCCU/71-555.........YFYEIVREELE.KYER.SVIGQSEE..............................................
Q55SK9_CRYNB/4-687SIKLNQYLVTLAASIIEVLN.GYEL.LIVETEAKVLSFDPAV...................................VQD
Q871F9_NEUCS/225-739NGLLG...QSLRAAISKELR.SYLT.LVATLETQIRRALSELDES.............................APRGGI
Q6CCF8_YARLI/159-656.....LTAQALKGVVEQELR.NYLG.VVSVLESEIRNK..........................................
Q8MT65_DROME/266-1245MRLERPLNRAMRETIMDYLS.TTRQ.FLLSLQAD..............................................
Q9LM94_ARATH/47-872...SPPTLMAFSNSASGWLE...AN.IALNEEVKINDSN.........................................
Q6C787_YARLI/102-681..RRGLVNGALAASIRKLLK.EYVK.LAQGLEYSLRFE..........................................
Q4U9K6_THEAN/45-615.....VICESITAEFVEILE.DLQE.CVTRFHDIHIT...........................................
Q7XUI5_ORYSJ/65-1092PAPYSLVNQAFAAAVEKVLE.GYFC.SLNTLPASIKLRRLEGQPDIPS.......................MTPDGASYN
Q2H076_CHAGB/195-897...STPTRVALAGVVDRLVT.AVRS.ELKNNSHGVRS...........................................
Q01AM7_OSTTA/101-630ETGEGSTRQAFQAAIQRELA.EYYK.LVAVLESQAQVPIIGFMPDGK..........................DAPAAKG
GCP3_MOUSE/251-761.RSFGLVGQSFCAALHQELK.EYYR.LLSVLHSQLQLEDDQGV..................................NLG
Q01B37_OSTTA/4-547VKSGSLYRRALASGVDEILD.AYEA.KILKLEQDALRRR.........................................
A2DSV4_TRIVA/119-594.KLTGIVGQTLSIHIMSEVS.KYIE.YISKYNYE..............................................
Q0JBZ2_ORYSJ/73-597..KSGLVNHALAAALRAFLL.DYQA.MVAQLEHQFRLG..........................................
Q17IM7_AEDAE/330-1376MILEGFVFKAFCDCVERILS.CFRV.VVTCYDGK..............................................
Q2H2M0_CHAGB/4-638...PSVICRAVASAVDALHLAAFRR.KVRAVEETLLRRDAAL....................................VG
Q5AUB0_EMENI/232-744.....AYMQTLHRSTEDCLH.KFDK.FLSEMQNKFLS.R.........................................
SPC98_DICDI/112-705.KKTGLTNQSFCSAINDELI.ELYR.IIAILETQVYKKFDMVNYGGGGGGSGGSGSGSGLESPSSVSSGGTTTSTEIPFI
Q011F8_OSTTA/257-775..KHGFVSHALAADLRELLN.DWST.LIVQLEHQRNIG..........................................
A8BFK8_GIAIC/197-740..NMGKTRASLCEALHTGLS.EYRQ.RISLLDSQLTEE..........................................
A2F3R1_TRIVA/115-545....CLTQIKISAVLKSLLV.DYLL.YISSIEQMY.............................................
Q4PBJ3_USTMA/53-831EQQPTLHLVPLCSTLLSILA.EYHE.LVLQTERLVLE.NHVE...................................LVA
A1D041_NEOFI/239-751.....PFMQTFHRCVEDCLN.QFDA.FLSEVQTQCIS.PG........................................
A2E6U4_TRIVA/44-540...YGKIVHTVCNAIRKYLL.QFME.QVSEIEAL..............................................
GCP2_MOUSE/220-738..EYGQVNHALAAAMRTLVK.EYLI.LVTQLEQLHRQG..........................................
Q0CV34_ASPTN/4-641...PSVVCRAVSTAISKHHLGNFQK.KILEVEEAILTEDSGY....................................VG
A2EPP8_TRIVA/122-554....SLIFQNAYNYVKELIT.MHCS.NVVSLNSKI.............................................
Q2GYC7_CHAGB/148-598GSDLG...RAYELPLTMSSG.TYLT.LVATLEAQIRRALSVIDES.............................APRGGI
A1CPI0_ASPCL/179-855...EFSARSAFSSTIAAIVY.TLEK.RLSGYSRGISS...........................................
Q6FQY5_CANGA/70-712...YGCILHRLTYEIRKFLKDGYLRFIVERLEKEYSS...........................................
Q4RSJ3_TETNG/316-1146.DKKGLVFQAFTGGLRKYLH.YYRA.CVLSTP................................................
SPC97_YEAST/62-688...FGMVLQRFAYEIRRFLEDVYLKTLVERLERDFNK...........................................
GCP3_DROME/235-758.NAIGSMGQALISKLKEELA.NFHG.QVAMLHDEMQRFRQASVNGIAN.......................KGKKDSGPD
Q6CHU8_YARLI/94-627..LEDSIMIAFRSALTDILA.AIQH.YIESLDA...............................................
A0DAA4_PARTE/211-878...............RSKIN.TILQSFVDEIEQKILQITI........................................
Q5BHX4_DROME/97-629.PNCGRTRLTLATALSDQLQ.DYYD.LQSKLETDLQDK..........................................
A1C7R2_ASPCL/32-668...PSVICRAVATNISAQHLGNFQK.KILDVEKAVLAEDSAY....................................VG
Q5KL44_CRYNJ/148-724DSKGGMIEQSLCHFLHHELS.EYHR.LLAVLESQMNTASSSG....................................EQ
Q0UGY4_PHANO/31-649...PSTVCRAVAAAVTSHHLESFQR.KILDVESRILKQDAST....................................VG
A1C564_ASPCL/237-752.....PFMQTFHRCIEGHLH.KFDA.FLSKIQSGFLP.QR........................................
Q6H548_ORYSJ/50-922...GTPTLSAFASSVDSWLM.RLRK.AALKEEEQLFLSV.........................................
Q4Q0X5_LEIMA/136-766.....LVLMALGEVVSEINT.SYAH.QVSKLQLWSEG...........................................
Q503S5_DANRE/270-933SEPPFRTYQAFVWALYKYFT.SFKE.ELNAIEKDIIAK..........................................
Q6CXD9_KLULA/57-697...YGRVMHRLGHEVRIFLYENYLS.CIKELEIRFQQD..........................................
Q389Z9_TRYB2/121-676.....LVAMALGEAVSEICT.SYAH.EIANLQRWSQK...........................................
Q4N294_THEPA/45-610.....VICETITAEFVDVLE.DLQE.CVSRFHDIHIT...........................................
Q7S902_NEUCR/140-744..EFGAVNHALCASIRRYLH.EYLV.MVVQLETQFLND..........................................
Q0D0R6_ASPTN/174-839...IPSALSTLSSAAAVIVY.TLEA.QLVRNYKQAVS...........................................
Q60F24_ORYSJ/4-649VRKGSAYRRAIANGIAEILS.VYRS.AVLQVEQNLLSD..........................................
Q6C7A5_YARLI/10-542SVAFTPCCQAVVEVLERRVVRKYLM.ELADLEKRLLG.GDVTYT................................STGG
Q7YYU8_CRYPV/251-795IQERSMLTKTLTEFTQDLLS.EYLQ.FIVSQQNEVQDSMIALSKLDPGV......................NPNLELLKS
Q9FG37_ARATH/192-713AEDVGTVGQAFCAALQDELS.DYYK.LLAVLEAQAMNPIPLVS.................................ESAS
Q4P4I8_USTMA/198-1067...LCSEATALAAALDTVVT.WFKA.ELATQSSTLVSNSS.......................................A
Q5BEM5_EMENI/175-843...EPSALSAFSTAASVIVY.TLEK.QLLHSFKQISS...........................................
Q014J8_OSTTA/270-889....GPTIQAFAHALDARGR.ALVS.ELAPLENRLSSDS.........................................
Q560G7_CRYNB/181-812..EYGMVSHALCSGIRAMLK.EFRV.LTAQLESLFLTS..........................................
Q5BBA4_EMENI/34-667...ASVICRAVSTAIRSHHLGAFQK.KILEVEKAILVEDSGY....................................VG
Q59PZ2_CANAL/94-759...FGKIVQKFCSEVRKFLS.SYQQ.VLINVEHEFKFN..........................................
ALP6_SCHPO/196-713INDQSLALQSLKSVISKELT.NFLA.LIASLDSQIR..ADA.....................................SL
Q16YQ3_AEDAE/217-729.YMKGNFGQGYIAALQRELT.QYYG.MLAILQEDLNRQRKERT.................................GLTG
Q756H1_ASHGO/63-723...YGTVLHRMCFVVRRFLTDDYLPFVVGKLERWFQED..........................................
GCP4_DROME/4-548DSLHGYYLLNLAKGIEMALE.EYYA.EIGRLEKYCLGN..........................................
Q5CFR0_CRYHO/45-593..QFGIISNTLCDSFRELLR.HFMI.KITKFESNLRK...........................................

PF14609

MOD21_SCHPO/60-677------TITEDSEEETFNGNANEITIPANI.HI-----------------------------------------------
E4WX70_OIKDI/53-731------.VTKSEESEEETDENERKNEASGFPEI-----------------------------------------------
B6K1F8_SCHJY/48-653------SVTFYEETPPVIPDNENIQDPQYYPHA-----------------------------------------------
E4YGB9_OIKDI/53-731------.VTKSEESEEETDENERKNEASGFPEI-----------------------------------------------

PF04130

Q7PX58_ANOGA/302-918PGKTH.TIIKLFHELE..PELFVLKKLYDIHKF.......SVLD..................................WT
Q4WZU3_ASPFU/32-668GYGIV.PLSTIVGEFS..PWTRRLEWLWDVTRF.......VLPE.................................NR.
Q4X128_ASPFU/183-784..SNF.TLHMLHLHTM..PTSQCLSQLYSLGQE.......LLRRNGLLDQDIDESIDDFDDVDNILEQLKEGGDLIPGA.
Q6MYK5_ASPFM/186-866...VS.SLIQIMTLFQ..RCGDLVGALSNIVEA...............................................
Q74Z68_ASHGO/190-740......SVKSIYIQIY..TQILVFRFYHGYLER...............................................
Q29HV5_DROPS/23-546QREQV.TLFKLLVWYT..KPLHRMQWLTKIAHS.......C.......................................
GCP5_MOUSE/273-942.DTTI.TLAIVVNKLA..PRLAQLKVLDKVFSTGVAEVPPDT......................................
Q6BX70_DEBHA/183-753..EPT.SLIAVYNALF..PFILKLRLLYSLTNE.......L.......................................
SPC97_DICDI/430-1044..ERL.SLQRMWFYLQ..PTIKTFEILYRVTSE.......IM......................................
Q0V2V1_PHANO/184-787..DSF.TLHVLNLHTK..QTSHMLFQLYTTGIE.......LLKANDILEDDKDED............SADDDSNDFENI.
Q6BGV8_DEBHA/61-751..STF.NLSIFETILN.QELSLKLSHFYDIVIA.......VHTETIERSKYKHQTSE.......SYFNNFIKSIQNDLK.
Q2M0Y2_DROPS/276-1186......SFSQLLMSAQ..PAMRLLQHLERMFET.......EPS.....................................
Q0UQH9_PHANO/170-704.......LIQLQHQFS..KPREVLLHVARMVDA.......TQ......................................
Q7PWU6_ANOGA/4-573..PNL.SLMFIFHQVS..QYRSLFGFLLQLISG.......V.......................................
Q23AE3_TETTS/242-743..AEL.TLQKLWFYIQ..PSLKVMEALYKLVSE...............................................
Q24CL5_TETTS/4-823..RVF.TIASLKIKLT..SHFDILPDLHKIVIK.......I.......................................
Q7Q703_ANOGA/248-764..RGL.SLQRLIQFLK..PVYPTMEELAATVSE.......I.......................................
Q7S8K3_NEUCR/231-856.......ILQLQSVVK..PAHAILTYFHALSKK.......L.......................................
Q9C5H9_ARATH/70-583...RL.SIQGLWFYCQ..PMMGSMRALAAVIQQ.......A.......................................
Q16HU4_AEDAE/210-728...QL.TFHKLLYFLR..PVFHTMEVLAETVTA.......I.......................................
Q0UBK8_PHANO/224-738NSPAAVSLLQLHTEVR..SMSAPLLRLAHLTSD.......V.......................................
Q4P9B0_USTMA/319-997TNRYT.TLTQLINFSY..SKAASVLLLARLLKD.......MGFISGHGG........................DTDVSL.
GCP4_MEDTR/4-635..TMP.ILATVTQGLN..KFFSLLPPLYELILK.......I.......................................
A2E3S1_TRIVA/121-599....M.SLLNLMAYSC.GPIKQSLEAAAFIAYT...............................................
Q29G36_DROPS/282-800...QL.TVQKLLYYLQ..PTIWVMEELWTTLVN.......V.......................................
SPC98_YEAST/187-740....V.SLKSLYREIY..ENIIRLRIYCRFTEH...............................................
GCP4_ARATH/4-645..TTP.ILATVTEGLN..KFFVLFPPLYEVILE.......I.......................................
A0C933_PARTE/4-693..KMF.IVSQLNVRLQ..AYYQILLNLHTSINI.......I.......................................
O61208_CAEEL/304-799..RGI.KFYQCLPLIDMWQNRLRLLKMAYKIRN...............................................
Q4PG13_USTMA/283-861STAYV.TLKRLSLWTD..EMTLRFRLMSTIVES.......C.......................................
Q383E4_TRYB2/204-700....M.AFGDLVVAFK..RVQPKLRVLHTMLKE...............................................
Q0URZ7_PHANO/220-736SKAGV.TLKRCMIWIR..EPTMGLRLMSLMVEE...............................................
A0C8V4_PARTE/161-646..STL.TLRKMYMWLK..QPMHHLVQINLVLSQ.......ILT.....................................
Q96UE2_NEUCS/231-743HKDVIVSLVAMLAELG..PSLAPLYVLSGIVQQ.......V.......................................
Q560K8_CRYNB/68-851..GPS.RWNSWMLATR..HVKQLAETLCGVPTS.......SPD.....................................
A0BDB2_PARTE/150-660...EI.TLQKFWYYTQ..PSIRIINSIYVLIQS...............................................
A8BD62_GIAIC/283-863ERGSL.SLQTLEVKTK..QIHIILENVADLCSR...............................................
O94070_CANAX/153-677....N.SILVVYNSIF..PWISILRFLYRVSNR...............................................
A2E1L0_TRIVA/46-541..RRL.TPSLLLGNLQ..NPAEMLHALSTLILA.......L.......................................
Q4UGA7_THEAN/233-712..DSL.TLLKLFELLH..KPYRKIRIIYSLL.................................................
Q2HBB4_CHAGB/228-739KEDVVVSLIGVLGELG..PKLAPLYGLADIVRQ.......V.......................................
Q4N4G5_THEPA/98-933....V.SLTTLSNFID..NQFKLLQLLYNIIVQ.......YEYK..................................S.
A2E313_TRIVA/240-732......SLLSLETQLT.GTIFEKLQALAIICY................................................
ALP4_SCHPO/74-693..PNF.SLQTLRLYTL..PTSRSLRQVY............LILRDLLLSMEKNASSSD.....DLGLSNIDDLLEQLNE.
Q2UDA7_ASPOR/4-644GYGIV.PLSTIVGEFS..PWTRRLEWLWEVARF.......ILPN..................................H.
Q05AR5_XENTR/4-571..PHL.SISHINYSLD..QFHLLFPSVMVVVEQ.......I.......................................
Q2M118_DROPS/72-608...KL.FLKDLVRQLR..PWVGILKVFSSMVTS.......A.......................................
Q584R6_TRYB2/3-521..AAV.TPSSVVSLRP..TYFLAFSLIMEMVQQ...............................................
Q6CIT0_KLULA/175-721....D.PLCFTYQHLY..PEVLKLRTYMEYIEN...............................................
Q2UCE2_ASPOR/176-851.......LIQVRALFQ..RCGELAGVLADLVEA.......V.......................................
Q6FLE0_CANGA/180-724....S.TNNGVYVSIY..DSINKLRVFYSIMLK...............................................
Q4DZM8_TRYCC/106-657..RAM.PLMGVVSEVL..RAGHHIVRLRQVLPT.......DTI...................................M.
Q0CNS1_ASPTN/283-794SKAGV.TLKRCVVWTR..DATMALRLMSLIVEE...............................................
Q2UAG9_ASPOR/234-750RTIAV.SLLQLYESVL..RESKLLLLLAEIVSN.......L.......................................
Q0IG23_AEDAE/4-557..PNL.SLIFIYHQVN..QYQSLFGFLLRLVSG.......V.......................................
GCP2_DROME/204-721...RL.TLQKLLYYLQ..PTMWVMHEVWSSLVI.......I.......................................
Q8SU99_ENCCU/71-555.......LLPFYAGMY..SPYIRIQIVHQLNEC...............................................
Q55SK9_CRYNB/4-687QQGYV.PLSSIVATFD..RWRAPLTALSQIVDQ.......LSS.....................................
Q871F9_NEUCS/225-739GKTGV.TLKRCVVWTR..EATMGLRLMSLIAEE...............................................
Q6CCF8_YARLI/159-656..GDV.TLRRCVLLLK..EATLALRVLFGLLRD...............................................
Q8MT65_DROME/266-1245......SLFQLLNNTS..TAIQLLCQLDRMFEN.......EPR.....................................
Q9LM94_ARATH/47-872VAVTP.TLLGLTSSLS..SLCSDAEYLFQVVRG.......AIPHA...............................YFE.
Q6C787_YARLI/102-681..SGL.TLHKFHLKLM..TIGGILHETHELAKD.......ILREDEVRFHNATLEPS.......NDLDALLAKFRENSV.
Q4U9K6_THEAN/45-615..SFL.GLQKLLNYLR..PSMQTLSTLASLVTE.......FDS...................................K.
Q7XUI5_ORYSJ/65-1092SNSEI.TLLEVYLHTE..ELRRHIKSLGNICFP.......KFAGLSLC..........................QEGLT.
Q2H076_CHAGB/195-897.......ILQLQSVVQ..PARSILLYFKGLVKK.......L.......................................
Q01AM7_OSTTA/101-630ADAYL.TLRRLFLWLA..DPLKTLRTLAILVDA...............................................
GCP3_MOUSE/251-761LESSL.TLRRLLVWTY..DPKIRLKTLAALVDH...............................................
Q01B37_OSTTA/4-547.GDAG.TLSSIESELS..EERAVIPALMELFGE.......VL......................................
A2DSV4_TRIVA/119-594...KT.TLIQLQSYLL.TPETENIHALTFIYFS.......I.......................................
Q0JBZ2_ORYSJ/73-597...RL.SVQGLWFFCQ..RMMSSLNALAVLVEK.......A.......................................
Q17IM7_AEDAE/330-1376......SLLQLQRNTD..PMRKQILALAKFCGI.......HPN.....................................
Q2H2M0_CHAGB/4-638AYDIV.PLTAVVAEFA..GWARRLEWLAGVVAV.......MVGGGGSGSG.....................SGSGSGSG.
Q5AUB0_EMENI/232-744DSSVAVSLLQLLDDVQ..RESKLLTLLADLVSN.......L.......................................
SPC98_DICDI/112-705DGDSL.TLIRLFVWIQ..SPLKRLKVLGTCVDS.......I.......................................
Q011F8_OSTTA/257-775...SL.SLQAAWFYCQ..PAAPALRLMANIASR...............................................
A8BFK8_GIAIC/197-740...QM.TLVELTAVAN..LIREEISTLAVIADN.......C.......................................
A2F3R1_TRIVA/115-545..SDL.TISQFLFLLN.NRQIDIIKSAAIIINT...............................................
Q4PBJ3_USTMA/53-831STGFV.SLANLRARFE..PWNAPLTALDDIVTL.......LARGPSKGRDIAF...............AKESDAQHATQ.
A1D041_NEOFI/239-751ATFSV.SLLQLAEDVR..SASAMLVLLADLISN.......L.......................................
A2E6U4_TRIVA/44-540..PVK.SLPVICINIS..KSAEFLDVLSEIVTK.......I.......................................
GCP2_MOUSE/220-738...LL.SLQKLWFYIQ..PAMRTIDILASLATS.......V.......................................
Q0CV34_ASPTN/4-641GYGIV.PLSTIVGEFS..PWTRRLEWLWEVARV.......IKPE..................................Q.
A2EPP8_TRIVA/122-554..EKL.STIEFLKFLK.NPLIDKLRAAAIICNT...............................................
Q2GYC7_CHAGB/148-598GKVGV.TLKRCVVWTR..EATMGLRLMSLIAEE...............................................
A1CPI0_ASPCL/179-855.......LLQITSLFE..RCGELVHALATIVEA.......V.......................................
Q6FQY5_CANGA/70-712..NVSFSIRDMEHMINDYELSKKMEILYNLCLR.......LNEEMNRRLNMNLDQ...........EDFNNFKRELEDV.
Q4RSJ3_TETNG/316-1146..PTL.SLLTIGFLFR..KVGRQLRYLSELCCV.......NGP...................................V.
SPC97_YEAST/62-688..VPNFSIRELEQIINETEVNKQMELLYNIYEE.......IFREIEERRTNQSSQE.........DFNNFMDSMKNESS.
GCP3_DROME/235-758AGDEM.TLFKLLAWYI..KPLHRMQWLTKIADA...............................................
Q6CHU8_YARLI/94-627..SDE.SLFPLLVHLR..PVSTVVHLLANILGC.......GDLS..................................R.
A0DAA4_PARTE/211-878LDEEM.TILHFQIYIK..HLNKQIKTIFDIFTA...............................................
Q5BHX4_DROME/97-629...KL.DLKDLVRQVR..PWLPILKTFSNMASS.......A.......................................
A1C7R2_ASPCL/32-668GYGIV.PLSTIVGEFS..PWTRRLEWLWEVVHF.......IIPE..................................Q.
Q5KL44_CRYNJ/148-724PDSGL.TLLRLRLWTE..DMKLKLKQMSTIVDE...............................................
Q0UGY4_PHANO/31-649AYNIV.PLAGIVGEFS..EWIRLLEWLWELSTF.......MLSPHV..............................QPN.
A1C564_ASPCL/237-752TSVSI.SLLQLAEDVR..NESRMLVILSDLISN.......L.......................................
Q6H548_ORYSJ/50-922.ERTI.TLLGLTDSMS..SLCSGAEHLYQVVQG.......AVPDA...............................FWN.
Q4Q0X5_LEIMA/136-766..RPM.PLMGVVSEIL..RVGHHVVRLRQVLPM.......DLICSALAEA......................AAAAADP.
Q503S5_DANRE/270-933.DETV.TLSSVLERLS..PHLAQITMLHRVFCT.......GVAE..................................V.
Q6CXD9_KLULA/57-697..VKF.SIRDLEMVLE.DGFIYKFRLLDQIVDR.......IMDSTRERSEMDRVQM.........DFNNFMDDLRRDTN.
Q389Z9_TRYB2/121-676..KAM.PLMGVVSEVL..RAGHHIVRLRQVLPT.......DSI...................................L.
Q4N294_THEPA/45-610..TFL.GLQKLLNYLR..PSTQTLSTLASLVTD.......FDT...................................K.
Q7S902_NEUCR/140-744..ENF.TLQQLNVHIL..PSSHLMAHMYGLALE.......LLKRNALLDDDSDESS.........DSSDDDFDHIIEQL.
Q0D0R6_ASPTN/174-839.......VLRIKSLFE..PCREIVAALANIIES.......I.......................................
Q60F24_ORYSJ/4-649..PLP.ILATVTHGLN..KFEVLLPPLHELVME.......I.......................................
Q6C7A5_YARLI/10-542AAETI.PLSQIQLKIT.SPWTRRLEYTHELLDF.......FYFSDLSE.........................EDRRAV.
Q7YYU8_CRYPV/251-795NKPML.TLRKLLHRMN..DQYHKKEKIFAILEG...............................................
Q9FG37_ARATH/192-713SNNYL.SLRRLSVWFA..EPMVKMRLMAVLVDK...............................................
Q4P4I8_USTMA/198-1067SVKCS.AVLNAHAELE..TCFAVLKNLGNLLSC.......GQPR.................................TP.
Q5BEM5_EMENI/175-843.......VLQIRALFQ..RCAELIGVLVNMMDA.......V.......................................
Q014J8_OSTTA/270-889TTAPP.TLLELRASVR..KLETKVDALEHVALN.......AFP.....................................
Q560G7_CRYNB/181-812..PTF.TLQTLYLHLH..PTLHTMSLLASLCHA.......LEADQAGQGTDDLSDDDD.....GLGGMAEELGLGGAGLK
Q5BBA4_EMENI/34-667GYGIV.PLATVVGEFA..PWTRRLEWLWEVVRF.......ILPT..................................E.
Q59PZ2_CANAL/94-759..KNF.NLNMLDSLLH.QEISNEMTHLYQIGIE.......ISRITEERQKMSQAEI.........MGNFEPTTLANTSM.
ALP6_SCHPO/196-713EKPMV.TIRRCIAWTQ..VAKLKLRILSSVVND...............................................
Q16YQ3_AEDAE/217-729GGDRL.TLKKLRLWLT..SPMERLQWLAQISES...............................................
Q756H1_ASHGO/63-723..ARF.GIRIMEQLLN.EEIIYKARLLYELVMC.......VVNEMERRDKVDLAEADF.....ENFIQDLKMGSDAGATG
GCP4_DROME/4-548..ERN.SLSYVYNALY..AKFPLLVFMRNLITE.......I.......................................
Q5CFR0_CRYHO/45-593..GQL.TVQNICAYSQ..QALITLKALDLISVQ.......V.......................................

PF14609

MOD21_SCHPO/60-677-------------PIIEESDNASNNKLCTLFKKSKQPNLDFL-----QIKPFMFWDSSLNETVRISERSI---IRD.SIY
E4WX70_OIKDI/53-731-------------PT..KFKNFEKIDRIYIFEEEAQKIADKY-----PEKK..........VYRIGEQPW---KGEKTIG
B6K1F8_SCHJY/48-653-------------KVSEHTEDYAYQQYEDPVSHASETLLQRI-----LEKE....SSGTPQLLQLSQQSM---LYE.IIY
E4YGB9_OIKDI/53-731-------------PT..KFKNFEKIDRIYIFEEEAQKIADKY-----PEKK..........VYRIGEQPW---KGEKTIG

PF04130

Q7PX58_ANOGA/302-918.............KFPAHIAVAHLLSGLFRSV....KLS.AN.....LEKG.N....LAFALLLAALKCY...MN.....
Q4WZU3_ASPFU/32-668............TSSAHGCTGSALIDYLRTES......QTGY.....LDLE.E....IALHLITVAESAW...IR.....
Q4X128_ASPFU/183-784............MSSKKICKGGNVLRLLTERL....ATFSGD.....PTTK.T....LLEKLLRDASRPY...MA.....
Q6MYK5_ASPFM/186-866..............VQKAASDAQVISAVIEKA..A.HYSEAF.....GSME.N....LFRELVARVIAPW...LQ.....
Q74Z68_ASHGO/190-740..............F.EQLRGDQLISEFDSLR......QHGD.....PLVK.N....LAEEIFSTLIDLY...ME.....
Q29HV5_DROPS/23-546.............MM...KKGGELTSVVWDFL......DNGH.....PAVD.K....LVIDLLTAMCRPL...TR.....
GCP5_MOUSE/273-942............RNV...VRASHLLNTLYKAILEYDNVGEAS.....EQTV.S....LLFSLWVETVRPY...LQ.....
Q6BX70_DEBHA/183-753..............N...LSGYEFLSKVYHLS.....KF.GD.....IRIK.D....LTHNIFSQISAPY...YE.....
SPC97_DICDI/430-1044............RCN...SHGVQVINLLLKLQ..S.KYS.SD.....KKTD.D....LFHYLIKATTLPF...LE.....
Q0V2V1_PHANO/184-787LESL....REGGNATKKLCKGGSVLGLITKRL..S.SMS.GD.....PAAR.T....LLTTLLREASRPY...MA.....
Q6BGV8_DEBHA/61-751ETGSI..DLATDNVNFEFCKGGILLKIIQDRI..N.AYQ.GD.....VISL.E....FLTKIFDVVSIDY...VS.....
Q2M0Y2_DROPS/276-1186............LNLHSGVSGTFILASIGSAI....D.TCSN.....TDFL.Q....LLMYLLKCMCQTY...FA.....
Q0UQH9_PHANO/170-704.............HA...KTNEQLASILHHRL..L.ELEDGD.....TDIR.Q....LSSRIMCEVAKPS...LE.....
Q7PWU6_ANOGA/4-573..............VTQRIHGCALLPYLQQHC..L...H.GN.....DANY.Q....AVKTIQKSVYVIF...LK.....
Q23AE3_TETTS/242-743..............T..E................N...........................YKKSFAPY...VQ.....
Q24CL5_TETTS/4-823..............VEENLKGGQLLDLMHSKS......QTGN.....TALR.E....VYQILTDQCYSVL...YQ.....
Q7Q703_ANOGA/248-764..............RRSNARGGQVLSLLHDRI..T.AKS.GT.....NHAQ.K....VLVHLVESAAAPF...ME.....
Q7S8K3_NEUCR/231-856..............A.EEKSEEGMLSCLFREA..QAAEYQGG......LLP.D....VICEVLRLASKPW...IE.....
Q9C5H9_ARATH/70-583..............STKQFVGSGVLNLLQSQA..K.AMA.GD.....NSVR.S....LLEKMTECASNAY...LS.....
Q16HU4_AEDAE/210-728..............RQTNCRGGTVLTLLYDKI..I.ATT.GD.....EKSR.K....VLIHLIEMAAVPY...ME.....
Q0UBK8_PHANO/224-738.............EVALLVNPFSHLEALFDQI..NLAQMTLE.....IRSF.Q....YLSSVFFDCLQTY...LK.....
Q4P9B0_USTMA/319-997IP........RGSSDRALIDGLQALLAFVHQ...QDELAHGD......MIL.T....DLSTCLLAACRPA...WR.....
GCP4_MEDTR/4-635..............ERGDIRGGELLNLLHKKC..H.C...GV.....PELQ.T....CIQRLLWHGHQVM...YN.....
A2E3S1_TRIVA/121-599..................ILNSDEDEDIFSIL..KSASNHGS.....PAVN.K....VAQKCFNEAKSAY...TD.....
Q29G36_DROPS/282-800..............QLNEFQGAAVLTHLHGRI..K.RLE.GD.....RAAQ.Q....IMIKLTHQAAEPY...MR.....
SPC98_YEAST/187-740..............L.EELSGDT.FLIELNIF..K.S.H.GD.....LTIR.K....IATNLFNSMISLY...YE.....
GCP4_ARATH/4-645..............ERDDIRGGQLLNVLNKRC..H.C...GV.....PELR.T....CLQRLLWNGHQVM...YN.....
A0C933_PARTE/4-693..............QQHNMRGGQILDYLYERT..L.T...GN.....DKLQ.L....IYQNILSACYEVL...FQ.....
O61208_CAEEL/304-799..................LPQLELLENLYILH....AAYSFD.....SDQK.S....ILDVILDYTLGVF...CN.....
Q4PG13_USTMA/283-861.............QD...AHGGLLVSLIHSYT......FNGD.....PFIR.K....FTSGLLDEVSKPF...FN.....
Q383E4_TRYB2/204-700..............T.ENVKGGE.LASKLQRL..V.Q.Q.GS.....RRLC.A....LLSDVYMEAVSPL...LH.....
Q0URZ7_PHANO/220-736..............S.KTKKGGE.LIALIHSF..S.LNH.GD.....PYVM.A....FAERLLSDVTRPF...YD.....
A0C8V4_PARTE/161-646............NVQ.LGTTSSLVISILCRYS......KHGC.....PLTS.Q....LFSRILHQTTIPI...VR.....
Q96UE2_NEUCS/231-743.............HRERNTKAFHYLELLYDAV..GMAQMEGS.....LDTY.R....LLGTIFLDCFQVY...LK.....
Q560K8_CRYNB/68-851............AHA.LPSRASALLTHLHGQFLAILSTSPSQ.....HHPSAI....ALAYLLSQASAPF...LN.....
A0BDB2_PARTE/150-660..............L.SKQIGGTLLSTITHFI..N.T.S.TD.....PQIV.E....VYSFLLQKSFLPY...MK.....
A8BD62_GIAIC/283-863..............L.GVVRGCALLQQLETAV..LQS...SG.....LSVK.E....VFQYLLSESLKPL...GR.....
O94070_CANAX/153-677..............L.NRLDGYE.FLTFIYSF..T.N.H.GD.....PKIR.G....IAVTAFTEVVKPY...YN.....
A2E1L0_TRIVA/46-541.............TD...KRGVPILSEIQKRL....ASFRGS.....PKIR.Q....LFTYLFQTASVPL...LD.....
Q4UGA7_THEAN/233-712..................SCDRLSPNFLYKFT......FTGN.....SELR.R....MYLRLLKKSLIPF...FE.....
Q2HBB4_CHAGB/228-739.............QQERNPHAFRYLELLYDAA..GIAQLQGS.....TATY.R....LLGTIFFDCFQVY...LK.....
Q4N4G5_THEPA/98-933L...........KYKDTFAKFKCLLEILYQDN...............PDEFIN....IVNSKLRYDLLGL...LK.....
A2E313_TRIVA/240-732..................AISSKFRPSLLNTI..SYCQKHGS.....PQIL.S....FGSQLIDAGIESL...LV.....
ALP4_SCHPO/74-693GNDISH.VVNATRSKKKVCKGGQVISFLTESL..T.KYA.GD.....PVAR.K....ILTYLLREASRPY...TK.....
Q2UDA7_ASPOR/4-644K...........KANNQSCTGAALIDYLRAES......QTGY.....IDIG.E....MALHLISAAETAW...MR.....
Q05AR5_XENTR/4-571..............KSQKIHGCQILETVYKHS......CGGL.....PPVR.S....ALEKILAVCHGVM...YK.....
Q2M118_DROPS/72-608..............R.GKKTSAQILSDINEIY..E.KLKPSD.....LELK.E....LLEKILNSVSSVY...MK.....
Q584R6_TRYB2/3-521..................QKNADLLLVTIQSF...............LSNR.EIPQKFRLWMGEAVWMSL...LY.....
Q6CIT0_KLULA/175-721..............F.EKSSAEG.LLSVCQLQ..K.S.N.GD.....PVLE.K....FASDALERLLQPY...MK.....
Q2UCE2_ASPOR/176-851..............E.GVVSDAQIFSIVLEKA..A.HYSQTF.....GHME.D....LFREIVIRTVYPF...LK.....
Q6FLE0_CANGA/180-724..............F.EGLTGDQ.LLSLLEQL..R.H.H.GD.....LTIE.N....IADKLFSTLLTLY...YD.....
Q4DZM8_TRYCC/106-657D...........EEGTLSMVGWRLLNHIHEQS....EKYSGS..........REDDELLLLLLRRASVPY...LR.....
Q0CNS1_ASPTN/283-794..............A.QNKKGGQ.LISLIHGF..S.TSH.GD.....PFVC.A....FAEKLLTHITRPF...YD.....
Q2UAG9_ASPOR/234-750.............RHDASDSPVRCLDLLYDSV..CMTQATGD.....ENEF.K....FLAQLFFSCFETY...AR.....
Q0IG23_AEDAE/4-557..............VTQRIHGCALLQYLQQNC..L.H...GN.....EKHY.Q....AVKLIQNAVYAIF...IK.....
GCP2_DROME/204-721..............QLSDSRDAEVLTYLHERI..K.RLE.GN.....KDAQ.Q....LIIGLVRKAAKPY...MR.....
Q8SU99_ENCCU/71-555..............F..RDNPKKPFEFLRFNF...............LSNH.P....FYSRVLESSCIHI...NN.....
Q55SK9_CRYNB/4-687F...........DEREDSWSPGRLIDLILLKS......QTGN.....PFLQ.N....IFSNLAKSLQDLF...LT.....
Q871F9_NEUCS/225-739..............S.KNKHGGQ.LVTLIHNF..S.SSH.GD.....PVVA.A....FAERLLVDVTRPF...YD.....
Q6CCF8_YARLI/159-656..............C.SGLLGGQILSVVYKLT......FDGE.....ETVS.K....FASRILILISASW...NG.....
Q8MT65_DROME/266-1245L...........NLNTGI.TGSFLLSSIWLAI..D...TCGN.....KDFL.H....LLIYFLRCISRNY...FI.....
Q9LM94_ARATH/47-872S..........SSAISTAEIAVHVLDYLYKRLDEVCLVQGGELVAVEGFHM.......LLQIFAGSLLPY...VE.....
Q6C787_YARLI/102-681EIDTR..GYGISLNGSSMCRGGITLKVIAERL..N.AHS.GD.....PTAN.Q....LLTRLLNDASKPY...LQ.....
Q4U9K6_THEAN/45-615R...........LIDNNSNIGVLILDSLDFRC....RSEVGS.....KKLL.......LQHILNSVLDSY...SL.....
Q7XUI5_ORYSJ/65-1092TD........SNLGFENFPWSTDLLSYLYVH...LRDAD........SVHY.G....LLKYLFVRSCEPY...CN.....
Q2H076_CHAGB/195-897..............A.QETSDEGMLSCLFQEA..Q.ASEYRD.....GLIE.D....VTREVLRVLSQPW...IE.....
Q01AM7_OSTTA/101-630..............T.YGHRGGA.ILAAIHKY..S.R.H.GD.....PSTT.T....LVRRILSASATPF...LG.....
GCP3_MOUSE/251-761..............C.QGRKGGE.LASAVHAY..T.K.T.GD.....PYMK.S....LVQHILSLVSHPV...LS.....
Q01B37_OSTTA/4-547.............DGARGVSGAEVLRRARDAW..LRA...GH.....PATR.A....ACERLYWRATQVM...MQ.....
A2DSV4_TRIVA/119-594..............V...KSSSNYMAAIALLN......GHGN.....PYVS.N....LANKLTEACYSAI...LE.....
Q0JBZ2_ORYSJ/73-597..............ISNNTSGSATLNLLQSQA..K.AMA.GD.....SAVR.S....LLEKMTECASAAY...LR.....
Q17IM7_AEDAE/330-1376Y...........ESDKEFPTGSVFLDHLYKEI..I...HITS.....SDVS.T....FLLHILKHCCNAY...FL.....
Q2H2M0_CHAGB/4-638SGG......GGSGGGEAGCTGARVMDFLRGEL......QTGY.....RDVE.E....AAGSLVGVAEAAW...VK.....
Q5AUB0_EMENI/232-744..............DRTAVDSVQCLDQLFDLV..CITQAAGD.....DENFAR.....LAEIFFASLETY...AR.....
SPC98_DICDI/112-705..............T.VDMKGGE.ILSKIDTL..S.K.H.GD.....QDIR.I....LIHNIMFKICQPL...FS.....
Q011F8_OSTTA/257-775..............A.FYLKGASVLNLLHREG..C.EHA.GD.....SAVL.A....LVQRLSKAAAKPY...IQ.....
A8BFK8_GIAIC/197-740.............LYDKSLTSPQILNIIFGY.....SLH.GD.....RKMH.H....IGQSLLIKASEPF...FD.....
A2F3R1_TRIVA/115-545..............I.KLESGGILVNRLMEIE..K.H...GD.....ELIK.I....VANKFRNAAFEVI...EK.....
Q4PBJ3_USTMA/53-831DGHD....GGASPYFPASWTGGLLIDLLSLKANTGVERVASH................MARLRNAVEDSW...MQ.....
A1D041_NEOFI/239-751.............KYNSPDDGVRCLDLLYDVV..CMKQATGD.....DDEF.R....FLANLFFSCLETY...IR.....
A2E6U4_TRIVA/44-540.............EN...LKGPKICTIIHQAI....STNRGL.....PYIREP.....LTALFNQSVQPI...LE.....
GCP2_MOUSE/220-738..............DKGECVGGSTLSLLHDRS..F.NYT.GD.....SQAQ.E....LCLYLTKAASAPY...FE.....
Q0CV34_ASPTN/4-641P...........QSKSHGCTGAALIDFLRAES......QTGY.....QDLE.E....MALHMIGVAEVAW...MR.....
A2EPP8_TRIVA/122-554..............T.FGLKGGYYYNKLHSLC..N.H...GD.....LEIK.T....VAQEMTNLSFKMI...EE.....
Q2GYC7_CHAGB/148-598..............S.KTKHGGQ.IISMIHGF..S.TSH.GD.....PVVA.A....FAERLLADVTRPF...YD.....
A1CPI0_ASPCL/179-855..............E.KAVSDAQVISVIIKKA..A.HFAQTL.....SSME.N....LFREIVARAITPW...LH.....
Q6FQY5_CANGA/70-712GQAIL...LPTDSSLSLTPKGGNIIKVVQEMI....AETLGD.....RNGV.Q....FLKDILNKIGEGY...LK.....
Q4RSJ3_TETNG/316-1146G...........AGHTTFPVGVKLLSYLYNEA..QNNCS........NENY.P....VLLSLLKTSCEPY...TRSVTAK
SPC97_YEAST/62-688LHLRL..MVAFDTTVYPVPKGGAILKIFQQKI....LENLGD.....RSSV.M....FLKKLLNNISQDY...CT.....
GCP3_DROME/235-758..............C.QVKKGGD.LASTVYDF..L.D.N.GN.....DMVN.K....LVEDLLTAICGPL...VR.....
Q6CHU8_YARLI/94-627A...........LSLQSLPNPVKLLSELHTRL...............SIYQTS.....DINLYILTAELF...KR.....
A0DAA4_PARTE/211-878..................DDCSQVNRALYERIIQINQRDEFLVKAFYELNN......FQLDIFAKGINSQDVDLQ.....
Q5BHX4_DROME/97-629..............R.GNLTSAQVLTLLDQFY..R.DLKDTD.....VDLK.E....RVNKILTSTSRAY...MK.....
A1C7R2_ASPCL/32-668G...........TGSAQGCTGAALINYLRTES......QTGY.....VDLE.E....MALHMIATAETAW...MR.....
Q5KL44_CRYNJ/148-724..............A.KNTHGGA.LVSKLHSH..T.S.N.GD.....PLIR.N....FTTQILEEVSKPF...FL.....
Q0UGY4_PHANO/31-649A..........EKGLVGASSGAQVIDKLRMEA......QTGH.....PTIE.E....AANQLGDVAETSW...LR.....
A1C564_ASPCL/237-752.............QCNASGNCVRCLDLLYDSV..CLNQATGD.....DSEF.K....VLAGLFLSCLETY...MR.....
Q6H548_ORYSJ/50-922S..........GAQMASSEVAVHAVNHLFKKLNEVCLVEDGEG...EPYHM.......LLVIFAGTLLPY...LQ.....
Q4Q0X5_LEIMA/136-766TSS.......TFASPSTGLVGPRILNHLCDQV....NKYSGS..........CEDHELLTLLLRRSLVPY...LR.....
Q503S5_DANRE/270-933P...........PGTPNVLRASHLLNTLYKAIIEYDSVGEAS.....EQSV.A....LLFSLWVETVRPY...LE.....
Q6CXD9_KLULA/57-697DELDL..RVLYDTRVSLFVKGGSLIIIVQQIM....EQEQGD.....IRHV.E....FLSLICDSLNRVY...GQ.....
Q389Z9_TRYB2/121-676E...........EEGTLSMAGWRLLNHIHEQA....EKHSGS..........REDDELLNLLLRRASVPY...LR.....
Q4N294_THEPA/45-610R...........LTDDNSNIGVLILDSLDFRC....RSEIGP.....KKLL.......LQHILNSVLDSY...SL.....
Q7S902_NEUCR/140-744RDGGD..LVPGNMTGKKICKGGVVLGLITKRL..E.SLS.GD.....PSAR.V....LLTTLLRDASRPY...MA.....
Q0D0R6_ASPTN/174-839..............E.GPTTESQIISIVLARA..A.HFSQTF.....AHME.N....LFREIATRVARPF...LD.....
Q60F24_ORYSJ/4-649..............EQKDIKGGQLLNLLHKRC..H.C...GV.....PELQ.S....CIQRLLWHGHQVM...FN.....
Q6C7A5_YARLI/10-542DP........NDLSTFPFVSGSTIYSRLQSDV......QVGY.....PDLQ.N....LVQECIIALEKCW...LR.....
Q7YYU8_CRYPV/251-795..............L..F...GQTCSSILSCL..NIHRNNGN.....QYQE.K....VFENLFHKCVSVW...LQ.....
Q9FG37_ARATH/192-713..............C.KVLRGGA.MAGAIHLH..A.Q.H.GD.....PLVH.D....FMMSLLRCVCSPL...FE.....
Q4P4I8_USTMA/198-1067P..........FRPLTWLESTHATLSHLHAHL..AASLASGA.....SSLPSA....VLAYLLDRTSVTW...RQ.....
Q5BEM5_EMENI/175-843..............E.TAGSEARIISSVFKLA..A.HYAQIY.....GQME.S....LFREIVFKVAQPW...LT.....
Q014J8_OSTTA/270-889M...........EGTPAAEAASHCLSAVYEAV..SYHQATAN.....IDGF.A....VTLRVFVDTLQPY...ME.....
Q560G7_CRYNB/181-812GLMKNLKAREGLIGDGGDVLGGEVLGIICERE..A.TMS.GD.....PTAS.T....LHSSLLLHASQPY...CK.....
Q5BBA4_EMENI/34-667K...........KKHTQSCTGAGLIDHLRRES......HTGY.....IDIE.E....IVLDLIGAAETAW...MR.....
Q59PZ2_CANAL/94-759NGINS..EPNLYYGKFDCCKGGLLLQVIQERM....VYYKGD.....PTSL.D....FLTQLFDIVSSDY...IG.....
ALP6_SCHPO/196-713..............N.MNQENKKRLIQVVSKY..N.V.H.GD.....PLIQ.E....LSDKILTEITGPL...YE.....
Q16YQ3_AEDAE/217-729..............C.KELKGGA.LATIVYDY..T.A.N.GD.....PENR.R....LAMELLRSACIPL...QQ.....
Q756H1_ASHGO/63-723DSSTNG.ILITDTRVSPVAKGGVVLQMVLEKM....KQNWGD.....QRNL.Q....FLHQVWQDISAPY...CE.....
GCP4_DROME/4-548..............HVLNLRGCVLLHNLHQQC..E.H...GD.....IQLE.K....AIKIIMKPVKNAF...FS.....
Q5CFR0_CRYHO/45-593.............LH...KKGCEIIDQVYKIA...NNEFKGE.....ESSQ.K....IANFVFNQVFLSW...FK.....

PF14609

MOD21_SCHPO/60-677MLIGYPSFFFLKNGSKIETRLSLLP....KLHHMSEEI--LRS-----------IMTELAD-------------------
E4WX70_OIKDI/53-731KLYG..............EILDHVP....VNDTLEYWI--EQT-----------NLLHKKG-------------------
B6K1F8_SCHJY/48-653MLMGYQGHIF....TCVEGVFRPAPFDYFQIQGLSTSM--QEH-----------ILSNFCN-------------------
E4YGB9_OIKDI/53-731KLYG..............EILDHVP....VNDTLEYWI--EQT-----------NLLHKKG-------------------

PF04130

Q7PX58_ANOGA/302-918.........................----...MIDTWW..TEG......R....LD....D.............W.....
Q4WZU3_ASPFU/32-668.........................----...QLSTWL..LYG......N....LPIFGKD...................
Q4X128_ASPFU/183-784.........................----...MLNEWL..HHG......D....IK....D.............P.....
Q6MYK5_ASPFM/186-866.........................----...YVEAWV.GLRT......ET.PALV....DL...........AA.....
Q74Z68_ASHGO/190-740.........................----...YLLYWL..VRG......Q....LK....S.............T.....
Q29HV5_DROPS/23-546.........................----...MISQWM..LDG......D....IT....D.............L.....
GCP5_MOUSE/273-942.........................----...TVDEWI..VHG......H....LW....D.............G.....
Q6BX70_DEBHA/183-753.........................----...VLEHWV..IKG......E....LI....D.............N.....
SPC97_DICDI/430-1044.........................----...MLDLWI..HQG......I....IR....D.............T.....
Q0V2V1_PHANO/184-787.........................----...MLNEWL..HHG......G....IK....D.............P.....
Q6BGV8_DEBHA/61-751.........................----...MLNKWL..ING......E....ID....D.............S.....
Q2M0Y2_DROPS/276-1186.........................----...QLQRWV..YKG......E....LD....E.............A.....
Q0UQH9_PHANO/170-704.........................----...LLAEWIGTMKE......QE..TIP....V.............T.....
Q7PWU6_ANOGA/4-573.........................----...QLYGWL..MHG......K....FV....D...................
Q23AE3_TETTS/242-743.........................----...MLSQWI..YYG......Q....ID....D...................
Q24CL5_TETTS/4-823.........................----...QLSGWI..LYG......N....LQ....D...................
Q7Q703_ANOGA/248-764.........................----...MLELWI..YRG......V....IN....D...................
Q7S8K3_NEUCR/231-856.........................----...FVEEWI.GLKN......EEGAPIS....K..............T....
Q9C5H9_ARATH/70-583.........................----...ILERWV..YEG......I....ID....D.............P.....
Q16HU4_AEDAE/210-728.........................----...MLQLWI..FNG......V....IH....D.............T.....
Q0UBK8_PHANO/224-738.........................----...PIRKWM..EAG......E....LGANDET...................
Q4P9B0_USTMA/319-997.........................----...SVCHLL..QRG......LSFAIHR....D...................
GCP4_MEDTR/4-635.........................----...QLASWM..VYG......I....LE....D.............R.....
A2E3S1_TRIVA/121-599.........................----...IVCDWV..LYG......R....LA....D.............P.....
Q29G36_DROPS/282-800.........................----...MLQLWI..QKG......V....IV....D.............R.....
SPC98_YEAST/187-740.........................----...YLMNWL..TKG......L....LR....A.............T.....
GCP4_ARATH/4-645.........................----...QLAAWM..VYG......I....LQ....D.............P.....
A0C933_PARTE/4-693.........................----...QLSSWL..QYG......Q....IL....D.............T.....
O61208_CAEEL/304-799.........................----...QMMEWM..TTG......E....IP....T...................
Q4PG13_USTMA/283-861.........................----...SLSLWI..YQG......ELQDPFR........................
Q383E4_TRYB2/204-700.........................----...MTVSSI..IKG......D....VS....D.............P.....
Q0URZ7_PHANO/220-736.........................----...MLRQWV..YDG......E....LS....D.............P.....
A0C8V4_PARTE/161-646.........................----...FINQWI..FDG......S....LS....D.............Q.....
Q96UE2_NEUCS/231-743.........................----...PIRFWM..EEG......E....LLAGDRT...................
Q560K8_CRYNB/68-851.........................----...LLQSWL.GFPG...........TD....D...................
A0BDB2_PARTE/150-660.........................----...QLSNWI..YYG......R....ID....D.............P.....
A8BD62_GIAIC/283-863.........................----...IMDRYI..NEA......V....IP....D............SD.....
O94070_CANAX/153-677.........................----...IVEHWI..VKG......E....LI....D.............N.....
A2E1L0_TRIVA/46-541.........................----...FIQKWI..YMG......I....VD....D.............P.....
Q4UGA7_THEAN/233-712.........................----...AIFQWL..YLG......E....LS....S...................
Q2HBB4_CHAGB/228-739.........................----...PIRLWM..EEG......K....LLPGDRT...................
Q4N4G5_THEPA/98-933.........................----..SQLTYWL..VYG......K....LI....DPFGEF...VISSPESDNPG
A2E313_TRIVA/240-732.........................----...YIRDWT..VFG......V....LK....D.............P.....
ALP4_SCHPO/74-693.........................----...MLNEWI..HLG......L....VN....D.............P.....
Q2UDA7_ASPOR/4-644.........................----...QLSTWL..LYGNLPVLGK..........D...................
Q05AR5_XENTR/4-571.........................----...QLSAWM..LHG......L....LL....D.............Q.....
Q2M118_DROPS/72-608.........................----...IVQLWT..QKG......I....IY....D.............L.....
Q584R6_TRYB2/3-521.........................----...TIGHYV..AHG......VVLHGRR....D...................
Q6CIT0_KLULA/175-721.........................----...NICDWL..IDG......K....LD....S............NV.....
Q2UCE2_ASPOR/176-851.........................----...HAETWI.GLRL......EASTLKE....L............AA.....
Q6FLE0_CANGA/180-724.........................----...YLSQWL..TLG......S....ID....N.............T.....
Q4DZM8_TRYCC/106-657.........................----...LLHRWM..HEG......LLEDPYG........................
Q0CNS1_ASPTN/283-794.........................----...MLRLWI..YDG......E....LS....D.............P.....
Q2UAG9_ASPOR/234-750.........................----...PIRLWM..EKG......E....LEETVQG.............S.....
Q0IG23_AEDAE/4-557.........................----...QLFGWL..LHG......K....FV....D.............Q.....
GCP2_DROME/204-721.........................----...MLQMWI..QKG......V....IV....D.............R.....
Q8SU99_ENCCU/71-555.........................----...CLREFL..LTG......S....FS....D.............D.....
Q55SK9_CRYNB/4-687.........................----...HLVSFI..LHG.....................................
Q871F9_NEUCS/225-739.........................----...ILRRWI..YDG......E....LL....D.............P.....
Q6CCF8_YARLI/159-656.........................----...ILRQWL..SHG......V....LN....D.............P.....
Q8MT65_DROME/266-1245.........................----...QLQRWI..YHG......E....LD....E.............S.....
Q9LM94_ARATH/47-872.........................----...SLDSWL..FEG......T....LD....D.............P.....
Q6C787_YARLI/102-681.........................----...MLSRWI..YQG......V....IL....D.............P.....
Q4U9K6_THEAN/45-615.........................----...LINHYINFFN.......FSQVDFTDFVTD...................
Q7XUI5_ORYSJ/65-1092.........................----...FIKSWI..YRA......S....VD....D.............P.....
Q2H076_CHAGB/195-897.........................----...FVEEWV.GLRA......ENGIAMT....K............TG.....
Q01AM7_OSTTA/101-630.........................----...MTQRWT..VSG......E....LD....D.............P.....
GCP3_MOUSE/251-761.........................----...FLYRWI..YDG......E....LE....D.............T.....
Q01B37_OSTTA/4-547.........................----...QLLGWC..AHG......T....IV....D.............P.....
A2DSV4_TRIVA/119-594.........................----...FIQSWV..IHG......I....ID....D.............P.....
Q0JBZ2_ORYSJ/73-597.........................----...MLERWV..YEG......V....ID....D.............P.....
Q17IM7_AEDAE/330-1376.........................----...LFQQWL..FGG......Q....LG....D.............P.....
Q2H2M0_CHAGB/4-638.........................----...QVSAWV..LYGRLPGFGE..........G...................
Q5AUB0_EMENI/232-744.........................----...PLYRWM..ETG......Q....LEDSSL....................
SPC98_DICDI/112-705.........................----...MIRLWM..FKG......E....IN....D.............P.....
Q011F8_OSTTA/257-775.........................----...AIELWV..YDG......Q....VD....D.............P.....
A8BFK8_GIAIC/197-740.........................----...YLKHWI..IEG......S....LL....S...................
A2F3R1_TRIVA/115-545.........................----...MSIDWS..TKG......R....VD....D.............P.....
Q4PBJ3_USTMA/53-831.........................----...HLTAWV..CRG......EIHRPGGIADSQASKRNLISRDQLVHWIEAT
A1D041_NEOFI/239-751.........................----...PIRRWM..EEG......R....LDSREGV...................
A2E6U4_TRIVA/44-540.........................----...YIEKWI..YEG......K....ID....D.............P.....
GCP2_MOUSE/220-738.........................----...ILEKWI..YRG......I....IH....D.............P.....
Q0CV34_ASPTN/4-641.........................----...QLSTWL..LYGNLPVLGR..........E...................
A2EPP8_TRIVA/122-554.........................----...MVREWI..SRG......E....II....D.............Q.....
Q2GYC7_CHAGB/148-598.........................----...ILRRWV..YDG......E....LS....D.............P.....
A1CPI0_ASPCL/179-855.........................----...YVEAWV.GLRA......ETPGLFE....A............TG.....
Q6FQY5_CANGA/70-712.........................----...MFDDWL..ING.................DI..........NDP.....
Q4RSJ3_TETNG/316-1146KTVPKGNSLVILQGFLRLSVCFCFC----SCSFVSDWV..YSG......V....FR....D.............V.....
SPC97_YEAST/62-688.........................----...MLYEWL..TQG......I....LN....D.............P.....
GCP3_DROME/235-758.........................----...MISKWI..LEG......G....IS....D.............M.....
Q6CHU8_YARLI/94-627.........................----...CLSPWMFKLHGVIGLNGSTYWKTPSKMVD.............P.....
A0DAA4_PARTE/211-878.........................----...IPQHFPPQFSS......TYANTVQ....SLALITQLKVLKVQHVEEIL
Q5BHX4_DROME/97-629.........................----...IVQLWM..QKG......V....LF....D.............T.....
A1C7R2_ASPCL/32-668.........................----...QLSTWL..LYGTLPVFGK..........E...................
Q5KL44_CRYNJ/148-724.........................----...TLQRWI..FSG......E....LH....D.............P.....
Q0UGY4_PHANO/31-649.........................----...QLSTWL..LYGRLPSFGA...I..........................
A1C564_ASPCL/237-752.........................----...PIHRWM..EEG......Q....LDSRQGT...................
Q6H548_ORYSJ/50-922.........................----...CLDSWL..YDG......I....LD....D.............P.....
Q4Q0X5_LEIMA/136-766.........................----...MLQRWM..HSG......VLDDPYG........................
Q503S5_DANRE/270-933.........................----...IVDEWI..VHG......H....LF....DP..........AKE.....
Q6CXD9_KLULA/57-697.........................----...MFVEWM..QEG......K....LN....D.............Y.....
Q389Z9_TRYB2/121-676.........................----...VLHRWV..HEG......VVEDPYG........................
Q4N294_THEPA/45-610.........................----...LINHYINFFN.......FSQVDFTEFVSD...................
Q7S902_NEUCR/140-744.........................----...MLNEWL..HHG......S....IN....D.............P.....
Q0D0R6_ASPTN/174-839.........................----...HIESWV.GFRS......ETPTSKE....F............AR.....
Q60F24_ORYSJ/4-649.........................----...QLTSWM..VYG......I....LQ....D.............Q.....
Q6C7A5_YARLI/10-542.........................----...QFSRWL..LYG......KLPSSFSA.AHD...................
Q7YYU8_CRYPV/251-795.........................----...DLNLIL..RHG......TSRRYLY....D.............P.....
Q9FG37_ARATH/192-713.........................----...MVRSWV..LEG......E....LE....D.............T.....
Q4P4I8_USTMA/198-1067.........................----...QVARWV....GFPGFESDRTGELD....D...................
Q5BEM5_EMENI/175-843.........................----...YVETWI.GFRP......ETSASIE....L............LT.....
Q014J8_OSTTA/270-889.........................----...TLHRWL..AFG......V....LD....D.............P.....
Q560G7_CRYNB/181-812.........................----...MLIQWI..ATG......H....LS....D.............P.....
Q5BBA4_EMENI/34-667.........................----...QLSTWL..LYGNLPILGK..........G...................
Q59PZ2_CANAL/94-759.........................----...MLNQWL..LEG......V....IN....D.............P.....
ALP6_SCHPO/196-713.........................----...MIENWI..YKG......E....LV....D.............P.....
Q16YQ3_AEDAE/217-729.........................----...ALIRWL..IDG......E....II....D.............P.....
Q756H1_ASHGO/63-723.........................----...MLNEWL..IKG.................DL..........KDP.....
GCP4_DROME/4-548.........................----...SLAHWL..LFG......V....ID....D.............V.....
Q5CFR0_CRYHO/45-593.........................----..HFLTPWL..KFG......TAFDHFS........................

PF14609

MOD21_SCHPO/60-677-YGSNLE----------------FFR.QK----------------------------------------LTSPSDSFFKS
E4WX70_OIKDI/53-731-FGKGFD----------------VMNYQV----------------------------------------ANERQCQIWLC
B6K1F8_SCHJY/48-653-WGRELH----------------ILN.RV----------------------------------------ASTKHCRFLPS
E4YGB9_OIKDI/53-731-FGKGFD----------------VMNYQV----------------------------------------ANERQCQIWLC

PF04130

Q7PX58_ANOGA/302-918.RE...E................FLVEKT........................................YGEHSPTGLQT
Q4WZU3_ASPFU/32-668......D................FFIQKD......................................N.SSQMDDSSSIT
Q4X128_ASPFU/183-784.HA...E................FLIKEQK.......WI.K.......................RE.KLEEDYTDEYWEK
Q6MYK5_ASPFM/186-866.KS...E................GFVAVER........Y.E........................G.R.AGSRSMKASSL
Q74Z68_ASHGO/190-740.HD...E................FFVSVN..........................................KSADPKLGM
Q29HV5_DROPS/23-546.HN...E................FFVESL........................................TDIGPDRLWHD
GCP5_MOUSE/273-942.AR...E................FIIQRN....................................KN..VPVNHRDFWYA
Q6BX70_DEBHA/183-753.SD...E................FFIAFN...........................................TEAQHIND
SPC97_DICDI/430-1044.YF...E................FMIEEN.........T.DL......................KRDNINRDFNDLYWEQ
Q0V2V1_PHANO/184-787.HS...E................FLIKEQ.........R.SI......................KRERLDQDYTDEYWEK
Q6BGV8_DEBHA/61-751.AE...E................FIIKMN.........R.FP.....................DNPDSPIRRNVEKYWDE
Q2M0Y2_DROPS/276-1186.VN...E................IFIRRR.........A.P........................LDRQIDECSKEFFDK
Q0UQH9_PHANO/170-704.SR...D................SFVTLE....................................PNPLNEDQP......
Q7PWU6_ANOGA/4-573HYG...E................FFIQQVESS....AKA.SIAAGGAAIA......NPPAGHTSVNTSDSASINTELW..
Q23AE3_TETTS/242-743LFQ...E................FFIQEN.........V.FV......................KRDNISKDFKENYWDQ
Q24CL5_TETTS/4-823YYD...E................FFIYRIE.......QT.KSQQS...............NAYDKNVVEQPNELEIDWDS
Q7Q703_ANOGA/248-764PQQ...E................FFIDHS....................................SMELTENELVDYWEK
Q7S8K3_NEUCR/231-856GSG...K................SFVKVA....................................DKMWIDDHGFELEEP
Q9C5H9_ARATH/70-583.YG...E................FFIAEN.........R.SL......................KKESLSQDSTAKYWSQ
Q16HU4_AEDAE/210-728.RK...E................FLVEHH....................................AMDLNENDMMDYWEK
Q0UBK8_PHANO/224-738.......................FFVFES.......................................DSGSDAASLWHD
Q4P9B0_USTMA/319-997.HD....................LLFDDRL.......VQ.HM.....................IRHDASISTSDSAFWTS
GCP4_MEDTR/4-635.HG...E................FFISRQEG.....RDV.ENSSSHQ............EISEKLSRLSTADASLSDWHM
A2E3S1_TRIVA/121-599.YN...E................FFVLEN.......................................EEHIRSCDWWDN
Q29G36_DROPS/282-800.NR...E................FLVEDN.........E.VV......................HQGELPEHYSDDYWEK
SPC98_YEAST/187-740.YG...E................FFIAEN....................................TD.TNGTDDDFIYHI
GCP4_ARATH/4-645.HG...E................FFIKRQDD.....GDL.DHRSSQE............EVSEKLARTSVHETSLTDWHS
A0C933_PARTE/4-693.SD...E................FFIQRID........E.KKK...................TDQHEY........NWDT
O61208_CAEEL/304-799.SD...K................WIIEKN.................................................EQ
Q4PG13_USTMA/283-861......E................FFVELNDDP....RKV.NQSRTHSN.........LADGDMPSFGD.LDGDAASLWQN
Q383E4_TRYB2/204-700.FN...E................FFVKSD....................................PR..VEDTSDTFWSS
Q0URZ7_PHANO/220-736.YG...E................FFVSEQS........E.DEI...................LEANGTEGKGGATSVWED
A0C8V4_PARTE/161-646.AQ...E................FFIERN...........D........................SNKIQIRDSGELWKN
Q96UE2_NEUCS/231-743.......................FFIGKS.......................................SARPQLHQIWEQ
Q560K8_CRYNB/68-851......E..............................................................DQSPGSQPWTD
A0BDB2_PARTE/150-660.FE...E................FLVAEK.........K.I.......................QKSSLETDYKNDFWDQ
A8BD62_GIAIC/283-863.AA...D................FFIRKS.........H.ST......................ELAEEQGKTTINTWMQ
O94070_CANAX/153-677.NN...E................FFIIFD....................................QE.QNEFNS......
A2E1L0_TRIVA/46-541.FD...E................FFITEDS........N.IT......................ADVL.GSEYESNFWSS
Q4UGA7_THEAN/233-712.DSSHIG................FFINFS.........E..........................GY.............
Q2HBB4_CHAGB/228-739.......................FFISES.......................................PAKLPLSQIWKG
Q4N4G5_THEPA/98-933LNSKSPN................FFINDL........................................LTYTPITSSSE
A2E313_TRIVA/240-732.EN...E................FFVTKH.......................................SGKLSSQDWWSN
ALP4_SCHPO/74-693.YD...E................FMIKIH.........K.GI......................TSMQLDEDYTDEYWEK
Q2UDA7_ASPOR/4-644......D................FFIQED......................................SIAESNRTPAVAQ
Q05AR5_XENTR/4-571.YE...E................FFVRQGPSS...NLAA.SSEEDDDDLGIG.GLTGKQLRELQDLRLIEEENMLAPSLK
Q2M118_DROPS/72-608.QH...E................FFVEDSE........R.SNS...................MSSTLLAPEQCCHAYWEN
Q584R6_TRYB2/3-521.......................FFISVK.............................................SKGGKE
Q6CIT0_KLULA/175-721.SS...D................FFV..............................................QNDEKEPL
Q2UCE2_ASPOR/176-851.NG...R................SFVVLE....................................PSEENPKTTSQSTRL
Q6FLE0_CANGA/180-724.NN...E................LFI..E....................................VE.QENTDGEVIF..
Q4DZM8_TRYCC/106-657......E................FFISEARPPA..GKAS.VSATLNENTT......TGMRNVVSRIFP.NTAAADDYGEA
Q0CNS1_ASPTN/283-794.YK...E................FFVVE..........P.EF.....................RPSTDPR.RIATSVWED
Q2UAG9_ASPOR/234-750.......................FFIRDN......................................RNNDLDLRTLWHG
Q0IG23_AEDAE/4-557.FG...E................FFIQHVDNT....KTA.GIGSLQGTTG......GTGTHLSVNSFSDNTSINTE..LW
GCP2_DROME/204-721.HR...E................FLVVDN.........E.VI......................HRDELPEHYSDDYWER
Q8SU99_ENCCU/71-555.TN...E................FFISRK...........................................MSVDLWEE
Q55SK9_CRYNB/4-687.IAPSEP................LMTSPS.........I.G........................RT..VGVDPLSPQHR
Q871F9_NEUCS/225-739.HM...E................FFVREQN........P.LD.....................EERKDAKAKGQMSVWNS
Q6CCF8_YARLI/159-656.YG...D................FFVTFR........................................TSESDAEYQEL
Q8MT65_DROME/266-1245.VN...E................IFISRC.........L.N.......................TSPSFTNQCSKEFFDK
Q9LM94_ARATH/47-872.FE...E................LFFTAN....................................QS..VSVSDAEFWEK
Q6C787_YARLI/102-681.YG...E................FCIQEN.........G.D.......................LATG.NEGAYDEYWEQ
Q4U9K6_THEAN/45-615.......................FFIKTCE........N.YE......................FSPS.NERDDGTGWNL
Q7XUI5_ORYSJ/65-1092.YE...E................FLITQA....................................KN.KRTQGGSSDPVD
Q2H076_CHAGB/195-897.PS...K................GFVNIV....................................DKMWIDDQGFELEEA
Q01AM7_OSTTA/101-630.SR...E................YFVRVD....................................HA....VPDKDLWRR
GCP3_MOUSE/251-761.YH...E................FFVASD....................................PT....VKTDRLWHD
Q01B37_OSTTA/4-547.CD...E................FFVRTID.......RC.EGLRT...............KEDDGGGI.........WHE
A2DSV4_TRIVA/119-594.YH...E................FFIEED.........H.S........................VNV.KMKDPASWWTT
Q0JBZ2_ORYSJ/73-597.YG...E................FFIAEN.........K.SL......................QKESLTQDYDAKYWQQ
Q17IM7_AEDAE/330-1376.SG...E................LFIYFV.........D.H.......................YRPK.....TKHFFDK
Q2H2M0_CHAGB/4-638......D................FFVRRV...........................................VGEEGREE
Q5AUB0_EMENI/232-744.......................FFVSAN.......................................HEKNDLRTLWHD
SPC98_DICDI/112-705.YQ...E................FFIRQY....................................ES....VQLEKTWKE
Q011F8_OSTTA/257-775.YD...E................FLILEQ.........Q.EM......................KKQSLNDDYNSAYWTK
A8BFK8_GIAIC/197-740..T...E................YFIQPTTS......NS.TDILI...............LQTNNLLVSRSIFINSNWYN
A2F3R1_TRIVA/115-545.FG...E................FFVKTR....................................AK...ATTPGEWWSD
Q4PBJ3_USTMA/53-831DADAHTD................HLATAA........................................ASGDGLGDWAA
A1D041_NEOFI/239-751.......................SFIIDR.......................................RDDKDLRSLWRE
A2E6U4_TRIVA/44-540.YN...E................FFIQTN.........D.I........................SPD.IPDPHRTYWND
GCP2_MOUSE/220-738.YS...E................FMVEEH.........E.L.......................RKEKIQEDYNDKYWDQ
Q0CV34_ASPTN/4-641......D................FFIQEE.......................................PMDGNTPSVAPS
A2EPP8_TRIVA/122-554.YE...E................FFIKKN....................................PD...VHVCSEWWER
Q2GYC7_CHAGB/148-598.HL...E................FFVREQS........P.ND.....................EDHMESKAKGHASVWNS
A1CPI0_ASPCL/179-855.NS...A................GFVVTE...........R........................RDGRSTSKRSRTTTV
Q6FQY5_CANGA/70-712.HE...E................FMIRDMMK......DV.NV......................TDTN.AMMTTDRLWET
Q4RSJ3_TETNG/316-1146.YG...E................FMIQVN....................................AE.YLGFRDKHFWVQ
SPC97_YEAST/62-688.YQ...E................FMTYDDL........E.G.......................KTDN.IFDTRDRAWDT
GCP3_DROME/235-758.HR...E................FFVKSI....................................KD....VGVDRLWHD
Q6CHU8_YARLI/94-627......E................MFVVQE.........P.N........................SG.............
A0DAA4_PARTE/211-878TICQISE................LYLQQN........................................LKQKNQYIQTI
Q5BHX4_DROME/97-629.QH...E................FFVEDTE........P.SST...................MSSTLLAPEKCCHAYWAE
A1C7R2_ASPCL/32-668......D................FFIQED......................................KSSDPDSSSAVTQ
Q5KL44_CRYNJ/148-724.FK...E................FFVQLNPEN....VSF.REGQISPTG........DVGFEMGMDADGGEEEAYKLWEK
Q0UGY4_PHANO/31-649......D................FFVHRD...........................................EEDSGELL
A1C564_ASPCL/237-752.......................FFIIDN.......................................HNDNDLRSLWRE
Q6H548_ORYSJ/50-922.NE...E................MFFYAN....................................KA..VTIDQPAFWEM
Q4Q0X5_LEIMA/136-766......E................FFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPSATSAGRDGELGASGASTASQG
Q503S5_DANRE/270-933.......................FIIQRN.........K...........................D..VPVNHRDFWYA
Q6CXD9_KLULA/57-697.HE...E................FLISDTV.......AD.VD.....................EEKLA.NTIDNERLWDT
Q389Z9_TRYB2/121-676......E................FFISDASLPT..GAAS.TTTAAPVSAVA....GMKKSAVRRIFPP.CGGGGDDYGET
Q4N294_THEPA/45-610.......................FFIKINQ........D.DE.....................YSPSD.AYGDEGTEWNL
Q7S902_NEUCR/140-744.HS...E................FLIKEQ.........K.SI......................RRERLEQDYTDEYWER
Q0D0R6_ASPTN/174-839.SG...R................SFVSLR....................................HPEESDKQISKAEMD
Q60F24_ORYSJ/4-649.YN...E................FFIRRQED.....RDK.ENDSSQV............DVADKFTQKSAKETSLTSWHT
Q6C7A5_YARLI/10-542.......................FMVLPV........................................ADLDRDEVTAE
Q7YYU8_CRYPV/251-795.GS...TNSRSKTVIDFENKLGEFFIKGN....................................IA............E
Q9FG37_ARATH/192-713.FG...E................FFV.VG....................................QP....VKVDLLWRE
Q4P4I8_USTMA/198-1067......R................PSVLKS........................................GSSSNTAHIST
Q5BEM5_EMENI/175-843.NG...R................SFVSLE....................................KSE.SNGKISSQERH
Q014J8_OSTTA/270-889.SE...E................LFIAKG....................................RAVDDFVGSKEHWLH
Q560G7_CRYNB/181-812.FD...E................FMVKES.........G.HI......................TKGVLESDYTDEYWER
Q5BBA4_EMENI/34-667......D................FFIQEA......................................DTKENEGPVSTVQ
Q59PZ2_CANAL/94-759.FD...E................FMIREKR........V.PD.....................SFMEI.FQSKSEYYWNE
ALP6_SCHPO/196-713.YQ...E................FFVKEK.........N.GS......................ESHDHQGQGDV.VWKG
Q16YQ3_AEDAE/217-729.NG...E................FFIEEI....................................CE....VGFDQLWHQ
Q756H1_ASHGO/63-723.YE...E................FLISDTS........Q.DN......................NIVL.NSLNSERLWDT
GCP4_DROME/4-548.HS...E................FFIKFTPT......DA.VDGSSF..............SKSATCSLLSAEKNPEDYIW
Q5CFR0_CRYHO/45-593.......................EFINYN........................................LSTKKKKFNKE

PF14609

MOD21_SCHPO/60-677---------DD............------QST--------------------------------------KN----E---
E4WX70_OIKDI/53-731---------DSCMGITENPLINW------DEE--------------------------------------KQ----E---
B6K1F8_SCHJY/48-653---------SPS...........------DIE--------------------------------------RL----P---
E4YGB9_OIKDI/53-731---------DSCMGITENPLINW------DEE--------------------------------------KQ----E---

PF04130

Q7PX58_ANOGA/302-918.........G..........YQA......RMFSKCKIRSFY....................VSSAISEVIEN....D...
Q4WZU3_ASPFU/32-668.........N..........FVM......QTS......................................LL....P...
Q4X128_ASPFU/183-784.........R..........YTI......RDN......................................EV....P...
Q6MYK5_ASPFM/186-866.........Q..........YRY......HPE......................................QM....P...
Q74Z68_ASHGO/190-740.........N..........FAI......LKE......................................SI....P...
Q29HV5_DROPS/23-546.........K..........FRV......RTA......................................MQ....P...
GCP5_MOUSE/273-942.........T..........YTL......YSVSEKTENEDKVSDSAS........ASSGSDQGPSSRQHTMV........
Q6BX70_DEBHA/183-753.........I..........IEY......LPQ......................................RI....P...
SPC97_DICDI/430-1044.........R..........YQI......RQD......................................QI....P...
Q0V2V1_PHANO/184-787.........R..........YTM......RDA......................................LV....P...
Q6BGV8_DEBHA/61-751.........L..........YVT......RTD......................................GV....I...
Q2M0Y2_DROPS/276-1186.........G..........YQV......HEE......................................EV....P...
Q0UQH9_PHANO/170-704.........E..........YVY......RSE......................................MM....P...
Q7PWU6_ANOGA/4-573.........R..........YEI......RRE......................................ML....P...
Q23AE3_TETTS/242-743.........R..........FIL......REK......................................QV....P...
Q24CL5_TETTS/4-823.........I..........FSL......RYA......................................ML....P...
Q7Q703_ANOGA/248-764.........Q..........YTI......RNE......................................KV....P...
Q7S8K3_NEUCR/231-856.........E..........FFL......DED......................................RM....P...
Q9C5H9_ARATH/70-583.........R..........YSL......K.D......................................TI....P...
Q16HU4_AEDAE/210-728.........Q..........YII......RTD......................................KV....P...
Q0UBK8_PHANO/224-738.........R..........YVL......RRD.....................................AQNSLQCP...
Q4P9B0_USTMA/319-997.........G..........YVV......NQPSIDEVD.........................NMVNPGYSS....P...
GCP4_MEDTR/4-635.........G..........FHI......SLD......................................ML....P...
A2E3S1_TRIVA/121-599.........Q..........YYI......EPI......................................RI....P...
Q29G36_DROPS/282-800.........R..........YTV......RRD......................................RI....P...
SPC98_YEAST/187-740.........P..........IEF......NQE......................................RV....P...
GCP4_ARATH/4-645.........G..........FHI......SLD......................................ML....P...
A0C933_PARTE/4-693.........S..........FTL......NIQ......................................ML....P...
O61208_CAEEL/304-799.........S..........GEL......FLR......................................KI....P...
Q4PG13_USTMA/283-861.........K..........FVF......RKE......................................ML....P...
Q383E4_TRYB2/204-700.........K..........FSL......LPD......................................ML....P...
Q0URZ7_PHANO/220-736.........K..........YRL......NDK......................................MV....P...
A0C8V4_PARTE/161-646.........E..........FKV......NQD......................................KI....P...
Q96UE2_NEUCS/231-743.........Q.........FHQL......VSS......................................EGVLNAP...
Q560K8_CRYNB/68-851LGISRKLVGDA.......WKYEF......SAG......................................RM....P...
A0BDB2_PARTE/150-660.........R..........FAL......RNS......................................QI....P...
A8BD62_GIAIC/283-863.........M..........FKV......DDA......................................QV....P...
O94070_CANAX/153-677.........I..........IKL......LPK......................................KI....P...
A2E1L0_TRIVA/46-541.........K..........YEL......NTS......................................RL....P...
Q4UGA7_THEAN/233-712....................FKF......DDS......................................KLFLFFP...
Q2HBB4_CHAGB/228-739.........Q..........FNL......LRS.....................................PEGKLHAP...
Q4N4G5_THEPA/98-933.........SNHFLLINNIVYHS......RIN......................................NNVTFGP...
A2E313_TRIVA/240-732.........K..........YTR......VQE......................................KI....P...
ALP4_SCHPO/74-693.........R..........YVI......RED......................................QV....P...
Q2UDA7_ASPOR/4-644....................FVL......RTD......................................LQ....P...
Q05AR5_XENTR/4-571.........Q..........FSL......RAE......................................ML....P...
Q2M118_DROPS/72-608.........R..........YTL......LPE......................................RL....P...
Q584R6_TRYB2/3-521.........D..........HTL......HSD......................................LL....P...
Q6CIT0_KLULA/175-721.........G..........LVF......LPQ......................................KI....P...
Q2UCE2_ASPOR/176-851.........E..........YRY......NPA......................................EM....P...
Q6FLE0_CANGA/180-724.....................KL......NTD......................................KI....P...
Q4DZM8_TRYCC/106-657.........TLEEANAFERRFSM......NKN......................................MI....P...
Q0CNS1_ASPTN/283-794.........K..........YKL......DDG......................................MV....P...
Q2UAG9_ASPOR/234-750.........W..........YTL......DES......................................AWISSAP...
Q0IG23_AEDAE/4-557.........R..........YEI......RHE......................................ML....P...
GCP2_DROME/204-721.........R..........YTL......RDE......................................QI....P...
Q8SU99_ENCCU/71-555....................FSI......DFG......................................LI....P...
Q55SK9_CRYNB/4-687........V...........YAL......NVD......................................ML....P...
Q871F9_NEUCS/225-739.........K..........YEL......VED......................................MV....P...
Q6CCF8_YARLI/159-656........IRQGKGGDRSGLFTF......DKS......................................NI....P...
Q8MT65_DROME/266-1245.........S..........YQV......DNE......................................AI....P...
Q9LM94_ARATH/47-872.........S..........YLLTRVLGPKSNVTSLNQKKGMSGND.........SNSVSDKDKEQNNRVLC....P...
Q6C787_YARLI/102-681.........R..........YSV......RKD......................................EL....P...
Q4U9K6_THEAN/45-615.........CSFCREVGWPRVWV......DER......................................YV....P...
Q7XUI5_ORYSJ/65-1092.........N..........FTL......LSLKGA................................NHVSA....P...
Q2H076_CHAGB/195-897.........D..........YFL......DED......................................RV....P...
Q01AM7_OSTTA/101-630.........K..........YEF......DEN......................................ML....P...
GCP3_MOUSE/251-761.........K..........YTL......RKS......................................MI....P...
Q01B37_OSTTA/4-547.........S..........HRV......ALE......................................RL....P...
A2DSV4_TRIVA/119-594.........Q..........YTL......VVD......................................KI....P...
Q0JBZ2_ORYSJ/73-597.........R..........YSL......K.D......................................GI....P...
Q17IM7_AEDAE/330-1376.........A..........FLI......RRQ......................................AV....P...
Q2H2M0_CHAGB/4-638....................YGC......EMA......................................LL....P...
Q5AUB0_EMENI/232-744.........W..........YLL......ETK......................................PELAKIP...
SPC98_DICDI/112-705.........K..........FAI......VAR......................................LL....P...
Q011F8_OSTTA/257-775.........R..........YSL......R.E......................................EF....P...
A8BFK8_GIAIC/197-740.........K..........FHI......SSSPDL...............................KTHPLL....S...
A2F3R1_TRIVA/115-545.........L..........YYL......SEL......................................EV....P...
Q4PBJ3_USTMA/53-831SS....SNT...........WNF......RPD......................................AL....P...
A1D041_NEOFI/239-751.........W..........YAV......DDS......................................FG...LP...
A2E6U4_TRIVA/44-540.........H..........FTC......NEE......................................NA....P...
GCP2_MOUSE/220-738.........R..........YTV......LPQ......................................QI....P...
Q0CV34_ASPTN/4-641....................FAL......HVD......................................LQ....P...
A2EPP8_TRIVA/122-554.........Q..........YSL......ITA......................................EA....P...
Q2GYC7_CHAGB/148-598.........K..........YEV......VDR......................................MV....P...
A1CPI0_ASPCL/179-855.........D..........YRY......HPD......................................QM....P...
Q6FQY5_CANGA/70-712.........R..........YLI......RKD......................................GL........
Q4RSJ3_TETNG/316-1146.........G..........YTL......ISKDV..................................EDCV....P...
SPC97_YEAST/62-688.........Q..........YFI......RKD......................................VL....L...
GCP3_DROME/235-758.........K..........FRL......RLP......................................ML....P...
Q6CHU8_YARLI/94-627....................FLI.....TDKD......................................RL....P...
A0DAA4_PARTE/211-878....................YKS......KEQS...................................LKEIIRKFQ...
Q5BHX4_DROME/97-629.........R..........YRL......LPD......................................RL....P...
A1C7R2_ASPCL/32-668....................FVM......QTN......................................LL....P...
Q5KL44_CRYNJ/148-724.........K..........YVF......VKK......................................MV....P...
Q0UGY4_PHANO/31-649....................FVI......NHQ......................................LL....P...
A1C564_ASPCL/237-752.........W..........YTL......DET......................................SGLEHIP...
Q6H548_ORYSJ/50-922.........S..........YMLRV.RGPRTDSSSTLADNESIRKKELINQETTAAAALLKSSNQGCADILC....P...
Q4Q0X5_LEIMA/136-766RFGLKRRAAAQQDVVAFDRRFSL......NKS......................................LV....P...
Q503S5_DANRE/270-933.........T..........YTL......YSVSEMVESEERLSDAAS........GSSGGEQTSSSRQHTMV........
Q6CXD9_KLULA/57-697.........R..........FVI......RKD......................................GL....L...
Q389Z9_TRYB2/121-676.........GMDDAHAFERRFSM......NKN......................................MV....P...
Q4N294_THEPA/45-610.........SSLCREIGLPRVSI......DER......................................YV....P...
Q7S902_NEUCR/140-744.........R..........YTI......RDH......................................DV....P...
Q0D0R6_ASPTN/174-839.........H..........YIY......CPE......................................QM....P...
Q60F24_ORYSJ/4-649.........G..........FHV......SLD......................................ML....P...
Q6C7A5_YARLI/10-542....................YEI......VKG................................................
Q7YYU8_CRYPV/251-795.........G..........IKI......DES......................................RV....P...
Q9FG37_ARATH/192-713.........G..........YKL......HPA......................................ML....P...
Q4P4I8_USTMA/198-1067PWSGAVVDWSLDERGEEDVGYTL......KPS......................................AV....P...
Q5BEM5_EMENI/175-843.........E..........YAY......LPE......................................QM....P...
Q014J8_OSTTA/270-889.........G..........YVL......RHD.....................................IET....P...
Q560G7_CRYNB/181-812.........R..........YTL......RDG......................................AI....PGSS
Q5BBA4_EMENI/34-667....................FTI......HTQ......................................LI....P...
Q59PZ2_CANAL/94-759.........L..........FLI......KID......................................GL....L...
ALP6_SCHPO/196-713.........K..........YFL......DKE......................................LI....P...
Q16YQ3_AEDAE/217-729.........K..........YRI......RKS......................................ML....P...
Q756H1_ASHGO/63-723.........Q..........YVI......RKD......................................GL....T...
GCP4_DROME/4-548.........Q..........YEV......NMS......................................QL....P...
Q5CFR0_CRYHO/45-593.........NIHS....KNFYRE......KER......................................KIYFILP...

PF14609

MOD21_SCHPO/60-677-------------------------------PFL--------SVVFIYPQIKPHLLSCLKNTHQELIKLETEV...----
E4WX70_OIKDI/53-731-------------------------------AFV--------NEFTLVQHATPNWHGYIK....RLLPLITNVRKV----
B6K1F8_SCHJY/48-653-------------------------------PF.--------....IFQIMTVWMNETVQN...ELLRMELLVRKH----
E4YGB9_OIKDI/53-731-------------------------------AFV--------NEFTLVQHATPNWHGYIK....RLLPLITNVRKV----

PF04130

Q7PX58_ANOGA/302-918...............................PII..KLL...LHHSLEAGYTLNILNGLDRISDMRKEQGTDENLIYTSF
Q4WZU3_ASPFU/32-668...............................KFV.SLHT...ASSILFIGKTLNHITAKRKGATMGFDSGAPPVT.....
Q4X128_ASPFU/183-784...............................PQL..EGV...KDKVLLAGKYLNVVRECGGVDISQKVTDV.........
Q6MYK5_ASPFM/186-866...............................TFI.PAEQ...ADLIFETGRSLRLLRRYHPQHPIANDAILTKDSPNLRC
Q74Z68_ASHGO/190-740...............................GFI.PPAV...AQQIYTVGKSYIYLETYLKEIEWASNFSNKY.......
Q29HV5_DROPS/23-546...............................KFI.GQEL...ADKILRTGKSINFLREVCEMNELVKGQGELKNIM....
GCP5_MOUSE/273-942...............................SFL..KPV...LKQIIMAGKSMQLLKNLNCAEGPACQAAARDAERKSLY
Q6BX70_DEBHA/183-753...............................DFFVSMNET.MAYKIYQIGKMLIFLLKYCKELKWISDYSMKYSTY....
SPC97_DICDI/430-1044...............................KYL..QSH...ALKILTTGKYLNVVRECNQSISQQQQHNKSDNNNNNNN
Q0V2V1_PHANO/184-787...............................PQL..EAV...KDKVLLAGKYLNVVRECGGVDVSKIVQD..........
Q6BGV8_DEBHA/61-751...............................DQFSSKDI...QLKILATGKYLNIFKTCTGLYDFQQLNELI........
Q2M0Y2_DROPS/276-1186...............................DFL..SGC...ETVILHCGKYNRLLKAFNAQHPAFDVSYPDIVVCLS..
Q0UQH9_PHANO/170-704...............................RFILPED....GNMAFETGQSLRFLKTQHPGHPLVRLHDAEISPP....
Q7PWU6_ANOGA/4-573...............................YYF.PASW...AEKVLFVGQTVLMCHFDPRQQIADRAASKGSRKGAALA
Q23AE3_TETTS/242-743...............................AFL..YLW...KEMVFKTGKYLSVLSEHEGKVVSSPFEL..........
Q24CL5_TETTS/4-823...............................QSIVSHKQ...AEKILFIGKGIRILRNTQKEYENSFLPPQQ........
Q7Q703_ANOGA/248-764...............................CFL..AKH...ADIILRTGKYLNVVRVATARTTTAV.............
Q7S8K3_NEUCR/231-856...............................SFV.PQDM...ARSIFDTGRNLRFLKEHHPDHSLSKRNVVALTQPPKLE
Q9C5H9_ARATH/70-583...............................GFL..ANI...AATILTTGKYLNVMRECGHNVQVPISERS.........
Q16HU4_AEDAE/210-728...............................CFL..NEY...ADIILRTGKYLNVIRECGSSVDYQQNVCV.........
Q0UBK8_PHANO/224-738...............................SFL..QPA...VKKIFNTGKSIIFLKELGIRGAGAQPFGSEPRLDHE..
Q4P9B0_USTMA/319-997...............................AFL..QSI...MQDVLTTAKGVGLLRSLGVDALGGVQPDPNLGHVLGLR
GCP4_MEDTR/4-635...............................EYI.PMRV...AESILFAGKAVRVLRNPSPSFLSQDDVYPQEPKRFPKI
A2E3S1_TRIVA/121-599...............................SFVKSDTL...AAQIASCGRAWNFIRYFKRIAMENGGARASL.......
Q29G36_DROPS/282-800...............................SFL..EKY...SDKILRTGKYLNVIRQCGKRVMPTQQME..........
SPC98_YEAST/187-740...............................AFI.PKEL...AYKIFMIGKSYIFLEKYCKEVQWTNEFSKKYH......
GCP4_ARATH/4-645...............................DYI.PMRL...GESILFAGKAIRVLRNPSPAFQFQKDKSFQQTMRGSQR
A0C933_PARTE/4-693..............................LHFI.TLQM...ADKILFIGKAVKVLKGQQELFINEHQQLI.........
O61208_CAEEL/304-799...............................IFITDSD....ARILLEIGKSLPHVESASDSDLEAIDKATTVV......
Q4PG13_USTMA/283-861...............................SFLQESF....GRKIFSTGKSLNFIRQSCGDGDWVGMRHTIA.......
Q383E4_TRYB2/204-700...............................TTV.SYSL...AERIRLVAKNVSFIRNCCRCKQWHMDPSI.........
Q0URZ7_PHANO/220-736...............................TIV.TEDF...AKKVFLIGKTLNFIRYGCGDAAWVDTYSKE........
A0C8V4_PARTE/161-646...............................YMI.SLND...SFKIYDTGRVINWLRKQCKFTQFNQNYDL.........
Q96UE2_NEUCS/231-743...............................RFL..SPA...VDRIVRAGKSIVVLKHLKRYSPVADRMKAEEPPMEF..
Q560K8_CRYNB/68-851...............................GFV.PKEA...RRILYEAGKGLRTLKVATNGLHPLCNIRQAIDIRWIWG
A0BDB2_PARTE/150-660...............................KFL..EKY...QDIILRTGKYINVIGQKESPFDNFLIKN..........
A8BD62_GIAIC/283-863...............................LFL..NNI...KTHLCDIGRSTVLLKWKKKQYIDKGPNASGQELLLLSA
O94070_CANAX/153-677...............................AFI.KSSD.....KIFQIGKTLIFLNKYCRELKWVNQYNVKYSAI....
A2E1L0_TRIVA/46-541...............................HFISAAAL..K..SILSAGKCISVLTICGLQMPNPPK............
Q4UGA7_THEAN/233-712...............................RTL........AKDIFEKGLLLNQLNRMKKTNPTTTTLNTFLQLLNLQS
Q2HBB4_CHAGB/228-739...............................RFL..DPS...IHQIFEAGKSIVVLKHMKQHESTKKYRATAEPSMDF..
Q4N4G5_THEPA/98-933..................................VNYNT...ANTILMIGKIIPIVNYLNKNGLKTKVLKRLIDD.....
A2E313_TRIVA/240-732...............................VFLNENSI...IRKILNAGRARNFVIKYKDSCMKYVDNFGSTAPF....
ALP4_SCHPO/74-693...............................PQL..LDL...QNKVLFAGKYLNVVLECRKGVNNLASLNAKDDT.....
Q2UDA7_ASPOR/4-644...............................KFVSPDA....ASSILFIGKTLNLIRAKRSGSRTGPPAGLSTTPVTL..
Q05AR5_XENTR/4-571...............................SYI.PVRV...AEKILFVGESVQMFENQNANMSRTGSILKNQEDTF...
Q2M118_DROPS/72-608...............................DFL..NPL...AAEIFHAGKYLNILRQCNVKLTLMQTP...........
Q584R6_TRYB2/3-521...............................HGI.PMEL...GLLILSVGKERRVLLSDAESHGKEYLEQLALGAQDEAA
Q6CIT0_KLULA/175-721...............................KFI.PSLV...AKKIYIIGKSLRYLEHCCSEVEWIGKFANKYS......
Q2UCE2_ASPOR/176-851...............................SFI.PTDQ...AELIFESGRSLRLLKRFHPQHPIASDEICNGDVPRLSC
Q6FLE0_CANGA/180-724...............................SFL.TYMQ...ARQIFVIGKSYIFVQKYCKELEYSNEFSNRYK......
Q4DZM8_TRYCC/106-657...............................NFLLKTSK..IAKMVFYAGKYCCLLREYNGTLPAFGDLAE.........
Q0CNS1_ASPTN/283-794...............................SII.TQDF...AKKVFLIGKSLNFIRYGCGDSGWVEAYSKE........
Q2UAG9_ASPOR/234-750...............................KFV..QPV...ARKIFVAGKSMVFLRHLDVSGDDEHARKSSLTLGDV..
Q0IG23_AEDAE/4-557...............................YYL.PTSW...AEKVLFVGQTVLMLNCDPRDHTDKRTTGDRKFAAIKDS
GCP2_DROME/204-721...............................SFL..AKY...SDKILRTGKYLNVIRQCGKRVMPTQEMN..........
Q8SU99_ENCCU/71-555...............................YFI.GNRV...AQKILYIGKCSSLLGTHRAEKTFSHDVACQARMNAAQQ
Q55SK9_CRYNB/4-687...............................TSIGENT....RESTLYVGRVVATLKREGKSLPKGLVDSLRG.......
Q871F9_NEUCS/225-739...............................SII.TRNF...ADKVFLIGKSLNFIRHSCGDHKWVEDYSKN........
Q6CCF8_YARLI/159-656...............................EYI.PEKV...AKQIFATGKSLYFVRVDCGLANWVERRKVEL.......
Q8MT65_DROME/266-1245...............................EFL..VGC...EEEILQCGKYNLVLRAYNAQHPVFDVQYPDIVVCLTEQ
Q9LM94_ARATH/47-872...............................LFI..KDI...CKSIVSAGKSLQLMQHIPSTSSENCEKIQYHGRNGFGN
Q6C787_YARLI/102-681...............................LLLSQSNL...LEKVLLAGKYLNIVRECGGGDTSKDAAV..........
Q4U9K6_THEAN/45-615...............................KFL..KNV...AVSVLEIGVLLKLLDNKVQHHFLLDTKASGISNS....
Q7XUI5_ORYSJ/65-1092...............................CFL..KDV...CGPLLRTGQQLQVLMKLLESCNLSDTGGDAHASRHIIH
Q2H076_CHAGB/195-897...............................TFI.PEDM...ARSIFETGQNLRFLREHHPEHPLARPDLVSLAMPPKLE
Q01AM7_OSTTA/101-630...............................SFI.TQEQ...GRTIMRLGKSINFLRRCCDDSSWAPERAEILNE.....
GCP3_MOUSE/251-761...............................SFI.TMDQ...SRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSA....
Q01B37_OSTTA/4-547...............................PGI.ELST...AEAVSFIGRGVRILTRSINQRTPSFSFDAEAYAAR...
A2DSV4_TRIVA/119-594...............................PKFFDKET...LMMILSCGKALNFIKEFKTNNFNEGY............
Q0JBZ2_ORYSJ/73-597...............................SFL..TNV...AATILTTGKYLNVMRECEYTVQVPLSESS.........
Q17IM7_AEDAE/330-1376...............................GFL..KGF...EEDILLCGKYTMLLKAFKKSHPIFSLKIPKLEVCLSYR
Q2H2M0_CHAGB/4-638...............................RFVTAAT....AASMLFIGRSLNQIRAKSVGDYTLRGNDHLSTQ.....
Q5AUB0_EMENI/232-744...............................KFI..RPF...AHKIFITGKSRVFLNRLNLADSLEAPRKTALSFEDI..
SPC98_DICDI/112-705...............................SFI.SLPL...SKRILIIGKSINYMKQFCNNFKEDKNDRYYYYNQEDDD
Q011F8_OSTTA/257-775...............................QFI.GEQL...AQKILTTGRYLNAVRETSLASLAELPAKPSDGL.....
A8BFK8_GIAIC/197-740...............................PYV........TKLCFEIGRASAFLREDCNNITWRFPESIVALIRE...
A2F3R1_TRIVA/115-545...............................KSM.LKSS...VGNVFSSGLCLNFVRQWEENIELD..............
Q4PBJ3_USTMA/53-831...............................SSISDST....ADSILYVGRALYTIRNASTSSAHHLDTPTHHALPSGPP
A1D041_NEOFI/239-751...............................QFM..RPV...APKIFTAGKSMVFLQHLNALETLGDSKTIPLTLERI..
A2E6U4_TRIVA/44-540...............................MFI.PSAI...INLIIATGKVQSIIADCNKQQLKQTN............
GCP2_MOUSE/220-738...............................SFL..QKV...AGKILSTGKYLNVVRECGHDVTCPVAKE..........
Q0CV34_ASPTN/4-641...............................KFVSSHT....ASSILFIGKTLNLIRAKRNNSITSPLVGLSISPASL..
A2EPP8_TRIVA/122-554...............................LCF.NSTQ...VQQIFDTGKILNFLRRWYHLVDLN..............
Q2GYC7_CHAGB/148-598...............................SIT.TADF...AQKVFLIGKSLNFIRHSCGDSQWVDAYSKT........
A1CPI0_ASPCL/179-855...............................SFI.PEDQ...AQLIFESGRGLRLLRRYHPQHPVASGTPLRKDRRPALS
Q6FQY5_CANGA/70-712...............................LESFHEEL...LSKILVTGKLLNIVKVTMELTSIPVDGKYALRR.....
Q4RSJ3_TETNG/316-1146...............................LFL..KHF...ANDVYVCGKTINLLKICCPQHYVCSSELPVPRIAVTFS
SPC97_YEAST/62-688...............................RDCDSEEDKNLLFKMLRTGILLKVVRASLQIPTIPSNSSDITI......
GCP3_DROME/235-758...............................KFV.PMDM...ANKILMTGKSINFLREICEEQGMMKERDELMKVM....
Q6CHU8_YARLI/94-627...............................TFVCPED....AQICVEILTALHILYSLGDTTVVDTNVDSKPVMPQVES
A0DAA4_PARTE/211-878...............................IFVTEKEKQEQVRRKIEFQRIQMQVRIQQQKYLESQQAKQASQKHQKNE
Q5BHX4_DROME/97-629...............................GFL..LSQ...ADDIFLAGKYLNILRQCNVSLKLLQRP...........
A1C7R2_ASPCL/32-668...............................QFVSLQT....ASSILFIGKTLNHIKAKRTSSIAELSNGFSTSPVTL..
Q5KL44_CRYNJ/148-724...............................GFV.GEDF...AKKIFSTGRSLNFIRYSCHDSDWIETQAKIANAGRGEF
Q0UGY4_PHANO/31-649...............................KFVTRQT....ASSILFVGKSLNQIRSVPPSIRADNAPSNISELDLL..
A1C564_ASPCL/237-752...............................QFM..KPF...ARQIFTAGKSMVFLQHLNALDEVEQHQKTALTFEGM..
Q6H548_ORYSJ/50-922...............................VFL..KDI...ARAILSAGKSFQLVQHVQETHRIQTREVIHEFNIDQHG
Q4Q0X5_LEIMA/136-766...............................VFLNTPSR..IAKMAFFAGKYCCILREYGAALPAFRPASVPGGAGAA..
Q503S5_DANRE/270-933...............................SFL..KPV...LKQIIMAGKSMQLLKNLDCKETEQSDGSSRDAERKSLY
Q6CXD9_KLULA/57-697...............................PQFRDKEL...QQKILMTGKIWNLIAICCGNTALKPRSWGT........
Q389Z9_TRYB2/121-676...............................NFILTNTK..MAKIVFYTGKYCCLLREYNGALPSFGELSN.........
Q4N294_THEPA/45-610...............................KFL..KNV...AVCVLEIGVLLKFLDNPIQYHFLLDNQNTKTSQSNP..
Q7S902_NEUCR/140-744...............................PQL..EAV...KDKVLLAGKYLNVVRECGGVDVSRKMQD..........
Q0D0R6_ASPTN/174-839...............................SFV.PSDQ...AKLIFESGRSLRLLKRFHPRHPIANGKFRNSTLDCARS
Q60F24_ORYSJ/4-649...............................EYI.HMRV...AESILFAGKAIRVLRNPSPGATLQESMNQSQNVKGSYR
Q6C7A5_YARLI/10-542...............................SFLHPISEQ.STNDALSVGMLIAQASNNNDTEMLKSVGKLAKSIC....
Q7YYU8_CRYPV/251-795...............................SFL.LIET...AHQIIHICETRIIIKTLLPPDEDVKLVDEFGIP.....
Q9FG37_ARATH/192-713...............................SFI.SPSL...AQRILRTGKSINFLRVCCDDHGWADAASEAAAAS....
Q4P4I8_USTMA/198-1067...............................SFLPFRH....ARAFLEAGRALRLLKKAAPQDHPLVHQWSLNAQERASA
Q5BEM5_EMENI/175-843...............................SFV.PPDQ...AYLIYESGRSLRLLKRYHPHHPLAGEQVRIDSPKLACA
Q014J8_OSTTA/270-889...............................CFL..REF...AVQTLDIGRSIVLLHHTESRTGKVPKLEVHLCESFCEQ
Q560G7_CRYNB/181-812KVSARNSTPSISAGVPPPRQGTNRLPGGACIPQF.LQPW...KHKILLAGKYLNVIRECGIEVKKPGEVDE.........
Q5BBA4_EMENI/34-667...............................QFVSSHT....AASILFIGKTLNLMRAKRSPTGHTPDGLLTSPVTLQ..
Q59PZ2_CANAL/94-759...............................NQFQNSTI...QSKILNTGKYLNIFKRCTGLHNFESLKEK.........
ALP6_SCHPO/196-713...............................SFL.SEEL...VDKIFLIGKSLNFARYGCGDFDWAQEHYQK........
Q16YQ3_AEDAE/217-729...............................SFV.SDGI...ARRILVIGKSINYLREVCQDKTPVKARNDLKQCL....
Q756H1_ASHGO/63-723...............................EQFQDRQL...QYKVLMTGKLLNLFKRSCGLATLPHALEHER.......
GCP4_DROME/4-548...............................GFF.SIVL...AEKVLFVGQTVLVFKMGRNVKVKNKTDPLAAKLAELDS
Q5CFR0_CRYHO/45-593...............................SFM..HEL...VEKVNYIGLVSHFVSHINHLHSQNLSFDAVKENGMLNC

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918LKTIVDELERFRTENPKESGCDSDPQASLAVEV...............................................
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866AGSWSDIERIQKKAQQYE..............................................................
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942TLFLESIQLRLQHGEDSAPHIVNEDQTTKENLIKMQS...........................................
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044NVKLNSQQQLLL....................................................................
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573AAA.............................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856WQFSWDAITMLETRVNEYKAAVTRLVQNAASGDQFSTRPST.......................................
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997TTIAQTSLNPLQSLVERGADDPINTEAEAGHEEIVAALCF........................................
GCP4_MEDTR/4-635HGFEGRFNFQREPI..................................................................
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645IRGFMHSDFPETET..................................................................
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851DSEKSELRNHLRHIQRQVDHWHRHQLSRSSSNRLTQIPSQKEDETDYMESNERNTP........................
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863EASGETT.........................................................................
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712ELSQLQNMSNTDT...................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851ASTWTDIERIQEKAKIYENRLRSEILRYNRGRPSATKNLIINSQPP..................................
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557LW..............................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555QDV.............................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245QLKNMRRNLADKYAIIYKRFGWCSMQSIFEDRMATKRVFANLMVKRTQAHLDAWAQKQRE....................
Q9LM94_ARATH/47-872SGCGILLAGKNSFRSIADLSLSEIFCLSLAGLIGHGDHVSRYLWKDETDEWEISPTLASYISGKLVNGT...........
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092LEEILPWFDTSIESSMNSFTFSKSRVEAVICQRDAMYKSMIEKLHHFFSNVEV...........................
Q2H076_CHAGB/195-897WEFNWDAVSQLEARVNQYQNAVVRAIKGTLSGTPQAAPYGANKRK...................................
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376AVDRLKARWLQYVAKARDVCGPSLAVRELYERKEREREEFLRQVEANFRRSMEQWRQDQDAEALELRKKKE.........
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705DDDEDHDDNDDDDE..................................................................
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855CAGTWSDIERIQKKAQFYEAELRSEILKYTRGQTTDNALAASHAQK..................................
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146LRRLERIAKHSATSREKQVLRHNYIVLTCNRIFVRKKQARQELINQVKESAAKTLETIRGRQVSQRLAEQARKR......
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627QETLIPPLDFESSLER................................................................
A0DAA4_PARTE/211-878LLVQIEVNRINRKYNKLIENQEERNLQLEQELNEKKKLQKEKEQLLMQLADLGINIQDAKKNNEISV.............
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922NYISQQKFRPDTSSIRIQDKREDIIEESTGQFGNNACKMDFLTLSESFLICLSGLLENGDHVDDYLRKLCADNAPVNKTI
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933TLFLESVQTRLRRGEESPTNTVTEQQATKKSLIKMQS...........................................
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839WAEIERIQSKAQTYERELRAEILKYNRHGSFEKERCDFTPE.......................................
Q60F24_ORYSJ/4-649MQSLIGGSGALKEL..................................................................
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067KRVSLPTWRWSLLESKLQVDAIEDHILQFKREIVRWRRQRRKTIDGSVGTFSTTSSPLDSSPALPQPAGETD........
Q5BEM5_EMENI/175-843GTWAELERIQMKARDYEARLRAEVLKYNRNGPSEHVMNIEKPN.....................................
Q014J8_OSTTA/270-889VRVALGATRDVVDDVMSIEDSSKR........................................................
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548DDIY............................................................................
Q5CFR0_CRYHO/45-593K...............................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918....................................................SRKVLCKAYRLTEASEPSQSSAARSDRT
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866...................................................................TQLRSEILKYSQG
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942................................................IAERHLELDDIHDPLLAINFARLYLEQSDFHE
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044.........................................................................LKLNTTQ
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573................................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856............................................THEPNEYKLTYFGKSEEEVAAAVLASINQLAQPLHN
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997.............................................TPEVATENLRRLLFARGTQLAEQTETKTYVEDVLP
GCP4_MEDTR/4-635........................................................................INTGMRVE
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645.......................................................................ELDADLTGG
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851.............................RHEEYALYPRPESDIGDLWSLFNQPPGSQLSLSHPHHSHSEFPLWGPTPLT
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863..............................................................................QG
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712........................................................................DNKYTEDT
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851........................................AHTEASDTLKDTFDLFDIDDAQNMTGLLANPSSIEKDELS
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557................................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555................................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245.........................LQIKANAQKKLQNDQLNAEQERIQQNHLEKRRQDNVNELAFQRECERMEDKLLER
Q9LM94_ARATH/47-872.................GDLLTYSERMWYKLLVGAVQEKKSIEAKSELQSPCCVTCVKEEKNVLAAEKVLQGLFCHENLV
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092................................IPFDAALNVLHISTSPLDTAVSDVELFYHGTNALPACNVVAELKDNDA
Q2H076_CHAGB/195-897........................................YDVAELEYFGKDETQVRENILASIRQLDQSLGNPEPRDEL
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376...............RQMEELLGHLNEIRESKLAAKKQELELEQKYQHEGLEFENRRLMAENLEREKAVEGYRELNRMMD
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705.......................................................................NENQGEDDE
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855.......................................SDSAVEDRNGPENYEMFDIDDSRNTTGLLTQHSTLNCDELV
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146............ELFEEMKQQLEHQQEWRSAAKKRQEDDDFGFAREVRDREKRLHAMEEQLEERARKELIAQYSRLTEEA
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627......................................................................DTTSLLAPAQ
A0DAA4_PARTE/211-878..................ELNPTPIQLITKKAVDTLLEETPKMQNQEELLTDGLQEQIEDNHIMEEQIEKQNESEKNPQI
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922VHSKSNVQETEEVCGENSSEKTWLKLLRDATSGRDYDGMEKTLAKNAVMRDPTFVPGDHQDVSSTEVESYFNLSCYENPG
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933................................................IVARHLELDDIHDPLLAINFARLYLEQNDFHE
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839.............................................HLVLDGDNVVSGAFDLFDMDSAKVTGLLNNQASVE
Q60F24_ORYSJ/4-649.......................................................................PNFPNISAE
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067.............KHMGRVQTNEAPLDPVDDQLARMSQLFASLPGVTNSTLSAAIFTDTEQEPLLSSKADLAKKQEESLV
Q5BEM5_EMENI/175-843..........................................TIESKELPDAFSLFDINDAQHMTGLLASDASLEKAKLG
Q014J8_OSTTA/270-889..............................................................ASDLISTAKVESTGLIGV
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548................................................................................
Q5CFR0_CRYHO/45-593................................................................................

PF14609

MOD21_SCHPO/60-677---------.YNATKNCTLFQFFQHVKKFVDPLLC---------------------------------------------
E4WX70_OIKDI/53-731---------RDFIWQ...LTGSTRHENKF......---------------------------------------------
B6K1F8_SCHJY/48-653---------AYNILK...LEHDVTDLIVFVEL...---------------------------------------------
E4YGB9_OIKDI/53-731---------RDFIWQ...LTGSTRHENKF......---------------------------------------------

PF04130

Q7PX58_ANOGA/302-918LSNAYTLYMKLNSISTLQLPLEHVLFNAIKNL................................................
Q4WZU3_ASPFU/32-668........LQGEHIAHLASLGSPISASKLSNA................................................
Q4X128_ASPFU/183-784....................PHTLDDPRFLDN................................................
Q6MYK5_ASPFM/186-866QRVGQVEMDKVLAEEQMQKFVSAGDDPAISPAFELFDIDDSKHTTGLLASDSSLENDELGPLFD................
Q74Z68_ASHGO/190-740.............MNKFADLPKSAIGQPFYDL................................................
Q29HV5_DROPS/23-546.............ESNAGDIFSYTQDTKWHAA................................................
GCP5_MOUSE/273-942KFAGGDICVDRSSESVTCQTFELTLRSCLYPH................................................
Q6BX70_DEBHA/183-753.............IFQNNQGIQSMPSNVIIDL................................................
SPC97_DICDI/430-1044QQQQQQLSSTSASMIPTTIIEYSKNENVYIDK................................................
Q0V2V1_PHANO/184-787...................APTSFDDPRFLDN................................................
Q6BGV8_DEBHA/61-751..................QPIDRLYSQDLELK................................................
Q2M0Y2_DROPS/276-1186.......EQQLTAMRRNLNDKYNRIRQTFEKCSMKSIFEERMASKLRFKNRMVERTESFIAAWEEEQRELLLESNAKKRL
Q0UQH9_PHANO/170-704...................KFQWAFGWQDIEA................................................
Q7PWU6_ANOGA/4-573..GKDNLWGDHEQQLFRKFHQLQSEENLNVTKFE..............................................
Q23AE3_TETTS/242-743..................DLVQNYETYLQMQDFS..............................................
Q24CL5_TETTS/4-823.................MLTLIEEIRQYDSFKFQ..............................................
Q7Q703_ANOGA/248-764.....................KRLQYAHFDQSYL..............................................
Q7S8K3_NEUCR/231-856NEFHDELTTMLHNRLYSTVDHNKEEGFNPHWSLVPLL...........................................
Q9C5H9_ARATH/70-583..................KLTIFGSNHHYLEC................................................
Q16HU4_AEDAE/210-728.................SLKYTHSDHQTYIKA................................................
Q0UBK8_PHANO/224-738.......SVCGLSDDVPVPPFAELFQAAFDRW................................................
Q4P9B0_USTMA/319-997QTPISRPDTEPLWDVSITRNHRHLSHRLLEPL................................................
GCP4_MEDTR/4-635DLLPQSEADKIENMLLDLKESSEFHKRSFECA................................................
A2E3S1_TRIVA/121-599...............MLHAQTESLEKNFDLNL................................................
Q29G36_DROPS/282-800...................LQLDPTDERHVYV................................................
SPC98_YEAST/187-740..............VLYQSNSYRGISTNFFEI................................................
GCP4_ARATH/4-645ELLPQSEADKIEAMLKDLKESSEFHKRSFECT................................................
A0C933_PARTE/4-693..................REIEVYDSFTFNRI................................................
O61208_CAEEL/304-799...............RTQLGPKAIFSKILGQI................................................
Q4PG13_USTMA/283-861...............GASAELRYTDLAGLEST................................................
Q383E4_TRYB2/204-700.................VAAAQSATFDTLDSV................................................
Q0URZ7_PHANO/220-736................ASKELRYGDTANLERS................................................
A0C8V4_PARTE/161-646..................ITIDLLGTEQFSLF................................................
Q96UE2_NEUCS/231-743........AAVCSDGTSFAPFSELFGNAFNKW................................................
Q560K8_CRYNB/68-851HLHEFISRHSSPNHPLLPPSCPTLSIFISNQIL...............................................
A0BDB2_PARTE/150-660...................QGHIVQNQDFSHL................................................
A8BD62_GIAIC/283-863FRHGEETVASLVCGDGSTGDLELAHIRLYKQL................................................
O94070_CANAX/153-677.............LFNNHQGLASMTTNEMIKL................................................
A2E1L0_TRIVA/46-541.....................LNLEALQRETI................................................
Q4UGA7_THEAN/233-712NTKATPFGAGTDTVNNNNEINEIDEEWTLECT................................................
Q2HBB4_CHAGB/228-739........ATVCPDGFEFAPFSELFGAAFQAW................................................
Q4N4G5_THEPA/98-933.............CIFNYWNEVTLDTEKFSSA................................................
A2E313_TRIVA/240-732...........AINFTSQKSKEEINNEWVGPP................................................
ALP4_SCHPO/74-693..............QNQLLWPSTFDDDNFTLN................................................
Q2UDA7_ASPOR/4-644.........HGEHIEHFATLKSPISTAKLSNS................................................
Q05AR5_XENTR/4-571...........AAELHRLKQQPLFSLVDFESV................................................
Q2M118_DROPS/72-608...................LNYNPKEQGHVEI................................................
Q584R6_TRYB2/3-521......DAVFRAIYHPSLCVNGFLVVDELETR................................................
Q6CIT0_KLULA/175-721...............LQYRLLGPSMDHKFFEL................................................
Q2UCE2_ASPOR/176-851RLIEQGNHKDLEVPEDHRCNFGPELASALYLSLA..............................................
Q6FLE0_CANGA/180-724..............QIYDGLRKNGISIEFIEA................................................
Q4DZM8_TRYCC/106-657..................HMLVWTDADKLHRK................................................
Q0CNS1_ASPTN/283-794................ASKELRYGDTASLEDS................................................
Q2UAG9_ASPOR/234-750.........FPEDSASVYMPFSALLDSAFGRI................................................
Q0IG23_AEDAE/4-557....GDQECAFFKKFHQLQLDENLNIAKFEHI................................................
GCP2_DROME/204-721...................LEFDPTSERHVSV................................................
Q8SU99_ENCCU/71-555..ESAKDAGLLGEDAEPNSKQINILNPDLEEN................................................
Q55SK9_CRYNB/4-687...............ELMAVKSLEVGGGLKEA................................................
Q871F9_NEUCS/225-739................ASRELKYGDTATLEAW................................................
Q6CCF8_YARLI/159-656...............TAEEITDLRVCGSLKKL................................................
Q8MT65_DROME/266-1245EKQELQKKVVQLAAVLSSSPDRSTVSDLSFASCIEEPDCLAESSSDKDDANTENSEDEATKQLDKTLNVPLEQPEAEYQA
Q9LM94_ARATH/47-872VSASKMDLERNKNAWHVLNLSENYCLPSLNDKSLLSAVFEGSGVAPKFVGTNYKYGFQFGRSEYLSSQDDTKILETLFPF
Q6C787_YARLI/102-681...................NWESIQDPALVPS................................................
Q4U9K6_THEAN/45-615.............NDVNFRKYKFHSVDEFALL................................................
Q7XUI5_ORYSJ/65-1092SSTSQESSDKVDALESSESSSSYSSIDDIEDEIDTACDNMPSSMFSSYRASSGEAKCSSVTTKLLSYETCSVSDGINPAS
Q2H076_CHAGB/195-897TRLLRHRLYQTPETSHSPRGLTPHWTLVPLLSFG..............................................
Q01AM7_OSTTA/101-630..............VEKAGGLDFENPDALAVL................................................
GCP3_MOUSE/251-761............ESPRDAADLFTDLENAFQGK................................................
Q01B37_OSTTA/4-547..........ATARIRKLASAESFDPREFDAV................................................
A2DSV4_TRIVA/119-594....................VPFKGKFFDLSM................................................
Q0JBZ2_ORYSJ/73-597..................KLMGFGSNHQYLEC................................................
Q17IM7_AEDAE/330-1376EKVEKAEREVERLKVQLAGVGGSGGDSSDFESCVGSVTEDDAGSVYEDAQKSPLSDKSEDRTVKEITESDVVNSNDVISE
Q2H2M0_CHAGB/4-638.............LTRLAALRHPIDSATFART................................................
Q5AUB0_EMENI/232-744.........YPSNLSSTCLPFYALLESALNDV................................................
SPC98_DICDI/112-705IIERKLLIKESKIIKEKTKELNYINKEVLQEI................................................
Q011F8_OSTTA/257-775.............GRMQFGPNMIVGTGKYADR................................................
A8BFK8_GIAIC/197-740...........ANFAKLLSSYSSDASEGTVKL................................................
A2F3R1_TRIVA/115-545.......................IEAENFDAL................................................
Q4PBJ3_USTMA/53-831.....DKVIQLHESALARPQVRPSRPADLDRA................................................
A1D041_NEOFI/239-751........YGDDSSSLLCLPFAAICESAISKL................................................
A2E6U4_TRIVA/44-540....................KITISSIQYEGE................................................
GCP2_MOUSE/220-738...................IIYTLKERAYVEQ................................................
Q0CV34_ASPTN/4-641.........HGEHIAQLASLKSPISTAKLSNA................................................
A2EPP8_TRIVA/122-554......................VDESLKLNEY................................................
Q2GYC7_CHAGB/148-598................SSKPLSYGDTATLETW................................................
A1CPI0_ASPCL/179-855PLLNTAQPQKSESLESRRSKFGPEMISAIYLSLA..............................................
Q6FQY5_CANGA/70-712..............AGEFDFVHLLEGTNLELY................................................
Q4RSJ3_TETNG/316-1146ARRERRAMWRVQRMRLDEARAQFFKRDELQIQVCSRSGGVGEQPAEGSGPAGCALSPGDMSEQDYLLALSAQYEVEHYED
SPC97_YEAST/62-688..............QEINDFADLMEGSNLELY................................................
GCP3_DROME/235-758.............ESSASQIFSYTPDTSWHAA................................................
Q6CHU8_YARLI/94-627LFTDTLSFLKLEKAESISLFESDDPLKDFQVS................................................
A0DAA4_PARTE/211-878KVENQQEKFEEELLDNCQYSFQLQLEVCIGMH................................................
Q5BHX4_DROME/97-629...................LAYSQGDLGHEEI................................................
A1C7R2_ASPCL/32-668.........QGEHIKHLASLESPISASRLSNA................................................
Q5KL44_CRYNJ/148-724......MGCKRGSMSDRVVALKYSDLAGLERS................................................
Q0UGY4_PHANO/31-649..........PSHVEMLSVVRAPIIAAELAEA................................................
A1C564_ASPCL/237-752........SNDEHASLVYLPFAATFGSALDKV................................................
Q6H548_ORYSJ/50-922ITACQEMLERNKNSWSDLNISKSFHLPPLNDENIRKSIFGDRDSSGTIPGDTLSTTYFPRLDGTDYKFGFQFDDSEYIRQ
Q4Q0X5_LEIMA/136-766........VGSRPDGPGDALLTWSGANQLQRQ................................................
Q503S5_DANRE/270-933KFSGGSVILDRSSESVTCQTFELTLRSCLYPH................................................
Q6CXD9_KLULA/57-697................SVTNIDITNMTFLKGY................................................
Q389Z9_TRYB2/121-676..................QILIWSGVDELHRR................................................
Q4N294_THEPA/45-610.........NSSSNPKDVRKYKFRTVEELSLL................................................
Q7S902_NEUCR/140-744...................VPNSFDDNRFLEN................................................
Q0D0R6_ASPTN/174-839SDPLGQLVDAGSIVTGNENAFGPELAASLYLSMA..............................................
Q60F24_ORYSJ/4-649ELLPQAEADKIDAMLKELKHSSEFHKRLFESA................................................
Q6C7A5_YARLI/10-542.............GYSEKTMAFPMKTLAIEEL................................................
Q7YYU8_CRYPV/251-795..............EITSEMITDLNRTPLHLT................................................
Q9FG37_ARATH/192-713............GTTTRRGGLGYGETDALEHL................................................
Q4P4I8_USTMA/198-1067LYLSSAACPPNAQDAISQSAFDRVTQASLVAP................................................
Q5BEM5_EMENI/175-843QLLNEADHDIEKQSGKLETNFAPEVTSSLYLSLA..............................................
Q014J8_OSTTA/270-889FQNYTSLVGVRSISTEQVRDTIVSQPTRIVASRNLQTKTPLQACVDELNSWLDK..........................
Q560G7_CRYNB/181-812..................KEMVAMNDPNFYKR................................................
Q5BBA4_EMENI/34-667..........SEHISHLAGLKSPISASELSNT................................................
Q59PZ2_CANAL/94-759.................LTTITSLAAPDLELK................................................
ALP6_SCHPO/196-713................LVKKLSYRDPHSLETV................................................
Q16YQ3_AEDAE/217-729.............ENDMDSIFSTISTTKLHQL................................................
Q756H1_ASHGO/63-723................SDIATQLPEGTQLLVY................................................
GCP4_DROME/4-548.QLWSGRESEFFKMVVDLSNEDTINVFRLEKV................................................
Q5CFR0_CRYHO/45-593....KLENTLEQMLHSLSNKSDLIRNEEVKLY................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918................................................................................
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942................................................................................
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186LYDKINAEQELQQRNRVQQRRLEVVQELQHQRDRERYEDQLLEREKLALINKIQVLRQRDLAAEDASGWEMAESPDNKLN
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573................................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856................................................................................
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997................................................................................
GCP4_MEDTR/4-635................................................................................
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645................................................................................
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851................................................................................
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863................................................................................
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557................................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555................................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245DVDVDQPRGKECSLPNVFQYQRSHSDVINSNEHPTTQAEFNRNRQHGLSSDQFQQCHATVHLQESDLLKTAASTSSGLHA
Q9LM94_ARATH/47-872PTL.............................................................................
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092PINENKKKDDLSYGHVPMHSQSIEHDVVCDALELDNQYSEFWPFDSFLKNSFDISSGKMSLAEEFLYTGDKGAEQVSHAN
Q2H076_CHAGB/195-897................................................................................
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376SEQNRKRILGSNLGEYLAEDHANANIEAIKETAAAGLRQMTEAQRNKMKIMTEEFGLREGVVTAVDINSNQTEERHRNRQ
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705................................................................................
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146CYDIM...........................................................................
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627................................................................................
A0DAA4_PARTE/211-878................................................................................
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922EDDRRTLEAL......................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q014J8_OSTTA/270-889................................................................................
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548................................................................................
Q5CFR0_CRYHO/45-593................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918................................................................................
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942................................................................................
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186RNRRKMLSSALVQECQSEESSSTGTELRAFLPPDINMNLNRLEETTEQSDLQRNRQRMLQHDGFNAFNSMEDVHTERVKC
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573................................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856................................................................................
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997................................................................................
GCP4_MEDTR/4-635................................................................................
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645................................................................................
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851................................................................................
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863................................................................................
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557................................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555................................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245EIPQDINANLNCPDTKELTELQRNRKRNEHHDGFFSF...........................................
Q9LM94_ARATH/47-872................................................................................
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092VVCRHSESGSPRLPNRDNDEKSINIKQPWN..................................................
Q2H076_CHAGB/195-897................................................................................
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376RILISDYTSREEEDPVKASGEMTELQKNRIKIMSQEYNVVVDDHDRGSKKDRKPEMYLNLET........DRAKNRRRIL
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705................................................................................
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146................................................................................
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627................................................................................
A0DAA4_PARTE/211-878................................................................................
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q014J8_OSTTA/270-889................................................................................
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548................................................................................
Q5CFR0_CRYHO/45-593................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918................................................................................
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942................................................................................
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186QLRSDSPLARNRRRVMASEFDIPSICRKITIPLFSIAESGLHLPLELNKLHVEVPLDAATPMSTTSDVDIDGLSDHNPFK
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573................................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856................................................................................
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997................................................................................
GCP4_MEDTR/4-635................................................................................
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645................................................................................
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851................................................................................
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863................................................................................
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557................................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555................................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245...............NSTEDEHTHRLRSLLNSNTERGRNRLRVMETEFGLGYKNTDIETKATPCLPLEIDKLHVEIPLAV
Q9LM94_ARATH/47-872................................................................................
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092.....................TNIPYNFSINPIVKNAVSCHTEHDLHGNRKNQALIGFNFESVTNPCEAYCGRSTSSLDE
Q2H076_CHAGB/195-897................................................................................
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376ECEYDIVTGAQNFVDTPMSVDSDTISEDIQVPVIVIDDVPQDVNANPIAGDDGQLKLDTTAAQEKFNESRFGVPDTAVLA
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705................................................................................
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146................................................................................
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627................................................................................
A0DAA4_PARTE/211-878................................................................................
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q014J8_OSTTA/270-889................................................................................
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548................................................................................
Q5CFR0_CRYHO/45-593................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------
E4YGB9_OIKDI/53-731--------------------------------------------------------------------------------

PF04130

Q7PX58_ANOGA/302-918................................................................................
Q4WZU3_ASPFU/32-668................................................................................
Q4X128_ASPFU/183-784................................................................................
Q6MYK5_ASPFM/186-866....................................................................ASTLEVSRPIHP
Q74Z68_ASHGO/190-740................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP5_MOUSE/273-942................................................................................
Q6BX70_DEBHA/183-753................................................................................
SPC97_DICDI/430-1044................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q2M0Y2_DROPS/276-1186EEESETDATDYNGHALISNAGHEQDPAPLLPTNPLAVEPAQASVERRVTSMTSRLPAVNWPTNFGKIAEHEEPQISAVLV
Q0UQH9_PHANO/170-704................................................................................
Q7PWU6_ANOGA/4-573................................................................................
Q23AE3_TETTS/242-743................................................................................
Q24CL5_TETTS/4-823................................................................................
Q7Q703_ANOGA/248-764................................................................................
Q7S8K3_NEUCR/231-856................................................................................
Q9C5H9_ARATH/70-583................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q4P9B0_USTMA/319-997................................................................................
GCP4_MEDTR/4-635................................................................................
A2E3S1_TRIVA/121-599................................................................................
Q29G36_DROPS/282-800................................................................................
SPC98_YEAST/187-740................................................................................
GCP4_ARATH/4-645................................................................................
A0C933_PARTE/4-693................................................................................
O61208_CAEEL/304-799................................................................................
Q4PG13_USTMA/283-861................................................................................
Q383E4_TRYB2/204-700................................................................................
Q0URZ7_PHANO/220-736................................................................................
A0C8V4_PARTE/161-646................................................................................
Q96UE2_NEUCS/231-743................................................................................
Q560K8_CRYNB/68-851................................................................................
A0BDB2_PARTE/150-660................................................................................
A8BD62_GIAIC/283-863................................................................................
O94070_CANAX/153-677................................................................................
A2E1L0_TRIVA/46-541................................................................................
Q4UGA7_THEAN/233-712................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q4N4G5_THEPA/98-933................................................................................
A2E313_TRIVA/240-732................................................................................
ALP4_SCHPO/74-693................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q05AR5_XENTR/4-571................................................................................
Q2M118_DROPS/72-608................................................................................
Q584R6_TRYB2/3-521................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q6FLE0_CANGA/180-724................................................................................
Q4DZM8_TRYCC/106-657................................................................................
Q0CNS1_ASPTN/283-794................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q0IG23_AEDAE/4-557................................................................................
GCP2_DROME/204-721................................................................................
Q8SU99_ENCCU/71-555................................................................................
Q55SK9_CRYNB/4-687................................................................................
Q871F9_NEUCS/225-739................................................................................
Q6CCF8_YARLI/159-656................................................................................
Q8MT65_DROME/266-1245LTPMSTTSDVDFGDPSPRELPEIADTANNNNVSGSIESLSPELPKPVLAIAKPTSLLPKLDFGMKDERETEQDRDKVSTL
Q9LM94_ARATH/47-872................................................LPSFQSKLHMSEFLPYQKNSTLPSRVLSWILR
Q6C787_YARLI/102-681................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q7XUI5_ORYSJ/65-1092FEVRSAMAVQSNAQASKQFDCSSKLLQSKTTSHAYLTSPGDISAQTNLLENPSGGAFWEKSLEYTAKSMEIAGDTTSSSD
Q2H076_CHAGB/195-897................................................................................
Q01AM7_OSTTA/101-630................................................................................
GCP3_MOUSE/251-761................................................................................
Q01B37_OSTTA/4-547................................................................................
A2DSV4_TRIVA/119-594................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
Q17IM7_AEDAE/330-1376KLTPESGLISAGLQAKRGFEFPIVQEGSELEIRSEASYEDDEIYREFVEAMEKRNLNLCELPSMTGDLGNVTELKEIDTE
Q2H2M0_CHAGB/4-638................................................................................
Q5AUB0_EMENI/232-744................................................................................
SPC98_DICDI/112-705................................................................................
Q011F8_OSTTA/257-775................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2F3R1_TRIVA/115-545................................................................................
Q4PBJ3_USTMA/53-831................................................................................
A1D041_NEOFI/239-751................................................................................
A2E6U4_TRIVA/44-540................................................................................
GCP2_MOUSE/220-738................................................................................
Q0CV34_ASPTN/4-641................................................................................
A2EPP8_TRIVA/122-554................................................................................
Q2GYC7_CHAGB/148-598................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q4RSJ3_TETNG/316-1146...............................................ASSPECQLLKRVTRAPWGLPMDPTLRRATDTTA
SPC97_YEAST/62-688................................................................................
GCP3_DROME/235-758................................................................................
Q6CHU8_YARLI/94-627................................................................................
A0DAA4_PARTE/211-878................................................................................
Q5BHX4_DROME/97-629................................................................................
A1C7R2_ASPCL/32-668................................................................................
Q5KL44_CRYNJ/148-724................................................................................
Q0UGY4_PHANO/31-649................................................................................
A1C564_ASPCL/237-752................................................................................
Q6H548_ORYSJ/50-922..........................................YTFPTLLPCVNENVPLSEILPLQKDSTLASRALKFIQS
Q4Q0X5_LEIMA/136-766................................................................................
Q503S5_DANRE/270-933................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q389Z9_TRYB2/121-676................................................................................
Q4N294_THEPA/45-610................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0D0R6_ASPTN/174-839................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q6C7A5_YARLI/10-542................................................................................
Q7YYU8_CRYPV/251-795................................................................................
Q9FG37_ARATH/192-713................................................................................
Q4P4I8_USTMA/198-1067................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q014J8_OSTTA/270-889..............................................................................FL
Q560G7_CRYNB/181-812................................................................................
Q5BBA4_EMENI/34-667................................................................................
Q59PZ2_CANAL/94-759................................................................................
ALP6_SCHPO/196-713................................................................................
Q16YQ3_AEDAE/217-729................................................................................
Q756H1_ASHGO/63-723................................................................................
GCP4_DROME/4-548................................................................................
Q5CFR0_CRYHO/45-593................................................................................

PF14609

MOD21_SCHPO/60-677--------------------FRFAYEKSA--TNMWDF------------VKTLEFIYS---TRNYS...........SQM
E4WX70_OIKDI/53-731--------------------FRPAFLDFG--EQVMDL------------LQSRVFIFF---RRWQNHARTDDSVCSTSLL
B6K1F8_SCHJY/48-653--------------------LTKRLISGC--TSVDEF------------LHCIFNIHI---GRRSN...........SLH
E4YGB9_OIKDI/53-731--------------------FRPAFLDFG--EQVMDL------------LQSRVFIFF---RRWQNHARTDDSVCSTSLL

PF04130

Q7PX58_ANOGA/302-918....................METKRHAAN..HYVTYI............YKDEF.HVM...DH.LKNIRKV.......LL
Q4WZU3_ASPFU/32-668....................VDSIRLSLS..QSVLSK............LLPLP.KIL...EI.LSVLHDF.......LL
Q4X128_ASPFU/183-784....................VNAAYTYAN..ASLLNL............LLTKN.SLT...TR.FRSLKHY.......FF
Q6MYK5_ASPFM/186-866HRKNFGPEMISAVSLSLAPLLSSQALLVD..FSCLHL............LFKEH.KLR...YH.LTLQWRF.......QL
Q74Z68_ASHGO/190-740....................VNEQHAEIT..AFINDI............LKSKY.YYD...ET.VTVLKDI.......LL
Q29HV5_DROPS/23-546....................IEICYQNTA..KHVLDY............MVGPH.KLL...EH.LQCMRRY.......LL
GCP5_MOUSE/273-942....................IDKQYLHCC..GNLMQT............LKRDF.RLV...EY.LQAMRNF.......FL
Q6BX70_DEBHA/183-753....................INLQYEEIL..NYFTIV............LQEKH.SMF...HH.LQNFKRF.......LL
SPC97_DICDI/430-1044....................IEKAYDYAS..GILLNL............LINER.HLI...SR.LKAIKHY.......FL
Q0V2V1_PHANO/184-787....................VSSSYAYAN..SSLLNL............LLTTH.QLP...AR.LRSLKHY.......FF
Q6BGV8_DEBHA/61-751....................INEYYRRAN..KLLMKL............LFEGY.QFP...SL.IDGFQTL.......FL
Q2M0Y2_DROPS/276-1186PESCNPFMARRCLQMSVMEPVSAHYALLR..NEVLRI.............FKEQ.HIY...EH.FRMLRNY.......FF
Q0UQH9_PHANO/170-704....................ISNKAKQYE..HRLRTS............LLAYS.SGS...AV.NNLPRQY.......HL
Q7PWU6_ANOGA/4-573..................HLVDEIKEQVT..KHMSTI............VIEKA.DLE...RQ.LRLMKDF.......FL
Q23AE3_TETTS/242-743..................QPIQKAYEWAN..AQIMHL............VVVDQ.DLQ...GR.LKSIKNY.......FF
Q24CL5_TETTS/4-823..................NTIESLRYEIA..KQMLEL............VLKNQ.NLM...NH.LNTLNNY.......FL
Q7Q703_ANOGA/248-764..................DEIEEAYNFAS..SSLLNL............IMNKY.DLM...GR.LLSVKRY.......FL
Q7S8K3_NEUCR/231-856...............SFGSLVDTQFKLVN..DECMKL............LLGPH.KLR...VH.TNLMRQY.......FL
Q9C5H9_ARATH/70-583....................IKAAHEFAS..IELVNL............IKDKY.DLV...GR.LRSIKHY.......LL
Q16HU4_AEDAE/210-728....................IEDAYNYAS..SSLLNL............IMDKY.NLM...GR.LFSVKRY.......FL
Q0UBK8_PHANO/224-738....................MQSKYSQAS..SVLREH............LVETS.GLM...RT.SVILETL.......YL
Q4P9B0_USTMA/319-997....................LGRLLQEHL..SPISALVRKRVTEVLLSPVTEGGYALQ...SH.VQACHGL.......FF
GCP4_MEDTR/4-635....................VDSIQAIAA..SHLWQL............VVVRA.DLN...GH.LKALKDY.......FL
A2E3S1_TRIVA/121-599....................LSKYSNESM..KNVLNI............VKNII.WLP...GH.IKTITDF.......IL
Q29G36_DROPS/282-800....................INDAYYFAA..RMLLDV............LLTEN.DLM...GH.LQSVKNY.......LL
SPC98_YEAST/187-740....................INDQYSEIV..NHTNQI............LNQKF.HYR...DV.VFALKNI.......LL
GCP4_ARATH/4-645....................VDSVRAIAA..SHLWQL............VVVRA.DLN...GH.LKALKDY.......FL
A0C933_PARTE/4-693....................IDQLQKQVG..EQLVQV............IVDKQ.ELF...IH.LKNFYLF.......IL
O61208_CAEEL/304-799....................LRILRDVVC..GIVMRM............VMETG.RLK...EH.VLKSTSF.......FF
Q4PG13_USTMA/283-861....................IEGAFNSAS..KRLLDI............FLDEF.RLL...EH.LRALKDY.......LM
Q383E4_TRYB2/204-700....................VRDAMRFTN..TAVLRL............IREEF.HLD...NV.LRMVNAF.......LL
Q0URZ7_PHANO/220-736....................IGDAYKTTM..ARLIDL............MANKF.KLF...DH.LQALKQY.......ML
A0C8V4_PARTE/161-646....................VDQVNKEYN..KQLIQL............IKPNF.KIT......LNAIKRF.......LL
Q96UE2_NEUCS/231-743....................IQSKYHSAS..ITLLDI............LFDSY.GLS...RA.FGALRCL.......YL
Q560K8_CRYNB/68-851..................DPLLAHATLIS..TSLVSL............YLHDL.RFL...DH.LDVLRAF.......WL
A0BDB2_PARTE/150-660....................V.SCFEWAN..KEIINL............LFQKE.NIH...KR.LKTIKTF.......FL
A8BD62_GIAIC/283-863....................IDINARVQT..KVLDFF............INPEYLDFR...GH.LQNIYAF.......YL
O94070_CANAX/153-677....................IDSQYNEIL..TFLTQI............IQGNN.KLF...TH.VYNFKRF.......YF
A2E1L0_TRIVA/46-541....................IDSAFLSAS..LRLVSV............LREKY.DLL...KY.AKMFRSV.......FL
Q4UGA7_THEAN/233-712....................LTSLKNIVS....................TLKYSEEIA......SCFIKEY.......QL
Q2HBB4_CHAGB/228-739....................IQSKHHSAA..ATLREL............LFSSY.GLF...ES.LDALQHI.......YL
Q4N4G5_THEPA/98-933....................IESYRLHIS..TLLWDV............YNPKY.NIL...NK.IRMLKGI.......YF
A2E313_TRIVA/240-732....................FELSMVPLFYKDAVNSM............RYMTL.DIVWIPGH.LRTLVDF.......IL
ALP4_SCHPO/74-693....................IMNAYVYAN..ESLLQL............LQSSQ.SLY...AH.LYSLKHY.......FF
Q2UDA7_ASPOR/4-644....................INSIRLSLS..QSTLSK............LLPLP.KIL...EI.LAVLHDF.......LL
Q05AR5_XENTR/4-571....................LDRIRSTVA..EHLWKL............MVEES.DLL...GQ.LKIIKDF.......YL
Q2M118_DROPS/72-608....................IRSSYELPG..KKLLDY............LKTEH.HLE...WH.LGNLHGY.......FL
Q584R6_TRYB2/3-521....................VEETHALWS..KALWLK............VSKQV.DLR...KH.IDAMRAM.......FL
Q6CIT0_KLULA/175-721....................VNQQYGEIN..HYINTT............LRSKF.YYF...ET.LNLLKDI.......LL
Q2UCE2_ASPOR/176-851..................PLLSSQALLID..FSCLHL............LFKEH.KLR...YH.LSLQWRF.......QL
Q6FLE0_CANGA/180-724....................VNTQFKEIV..SYIDTI............ICTKF.HYH...DV.LKTLRNI.......LL
Q4DZM8_TRYCC/106-657....................IEESYEIAS..GEVLQL............FLGPQVDLL...GH.LISLKCY.......FL
Q0CNS1_ASPTN/283-794....................IDEAYKTTM..ARLIYL............MDDKF.KLF...DH.LRALKKY.......LL
Q2UAG9_ASPOR/234-750....................VDENHSFTS..SLLRRE............LDQQC.GLW...IS.LQALEHI.......YH
Q0IG23_AEDAE/4-557....................VDEIKLCVT..EQMSEI............AIKEA.DLI...KQ.LKLIKDY.......YL
GCP2_DROME/204-721....................INDAYYFAA..RMLLDV............LLTEN.DLM...GH.LQSVKRY.......LL
Q8SU99_ENCCU/71-555....................IDIMLHKIN..KKIEHV............FLNSP.SIR...NQ.IEGIKNT.......FL
Q55SK9_CRYNB/4-687....................VEKARAEVG..EWLWRH............ILTGP.QVA...ES.IEMFGSF.......FL
Q871F9_NEUCS/225-739....................IDEAHRETM..SHLMRL............LNDQF.RVF...DH.LEALKRY.......IL
Q6CCF8_YARLI/159-656....................VDSIYQEVV..SYLNTV............LRDKF.HLD...DH.LQGIKSY.......LL
Q8MT65_DROME/266-1245PEACNPFMARRCLQLSVMAPLNAYYGLLR..NEVLRI.............FQEQ.RIY...EH.FRKLRNY.......FF
Q9LM94_ARATH/47-872TEPRNTLLPVVIMQECFTINIRRQVDNIS..KVIFSK............LMNEW.KLM...HE.LAVLRAI.......YL
Q6C787_YARLI/102-681....................IASASDESN..RALLSL............LLSSH.NLF...DR.LASLKHY.......FF
Q4U9K6_THEAN/45-615....................IQNVHKNVM..DEVYFG............LKRNS.QLL...TN.LKLVFDY.......FL
Q7XUI5_ORYSJ/65-1092MPLDIAIDKCIIQEVLLQYK......YVS..SFTMKL............LEDGF.DLC...GH.LQALRRY.......HF
Q2H076_CHAGB/195-897..................PVIETQSVLIN..SECMKL............LFSAH.HLR...VH.IDLLKQY.......FL
Q01AM7_OSTTA/101-630....................ILETSKCID..GIVRRV............LFERY.KLG...EH.CQALKRY.......LL
GCP3_MOUSE/251-761....................IDAAYFETS..KYLLDV............LNKKY.SLL...EH.MQAMRRY.......LL
Q01B37_OSTTA/4-547....................VESMRSEIA..EGLGEV............LLHRS.GLV...AH.LTAMTEF.......YF
A2DSV4_TRIVA/119-594....................VDSFLMTSM..NAVINL............IIREN.WLL...GH.LKVINDF.......ML
Q0JBZ2_ORYSJ/73-597....................IKSAYDFAS..GELLTL............MKDKY.DLI...GK.LRSLKRY.......LL
Q17IM7_AEDAE/330-1376LRSLDVLTVTRFLQSSLVIPLKAHMEVVN..SEILKM............CLNDL.DIL...GH.FESLRNY.......FL
Q2H2M0_CHAGB/4-638....................IADIRHFLS..RTTLQR............LLPLS.RVL...ET.LQLLRDF.......FL
Q5AUB0_EMENI/232-744....................INENHAFTS..SLLRKE............LDERC.GLW...IS.LQALEHI.......HL
SPC98_DICDI/112-705....................IELVSRQSS..ERLLKI............VLNRF.KFM...NH.VKALKKY.......LL
Q011F8_OSTTA/257-775....................IAERFEHAA..SKLLHI............MWQEG.DLK...AR.LESMKMY.......FL
A8BFK8_GIAIC/197-740....................IRSIHMLSS..KAVVAI............IKRQF.LLF...DH.LNGILYI.......LL
A2F3R1_TRIVA/115-545....................VKKASEISN..SHMMTL............FIDHE.KII...SR.LNDAVDF.......VL
Q4PBJ3_USTMA/53-831....................IQSLRNDVS..EWIFRH............ILTTS.VVR...TS.LQCLGDY.......FL
A1D041_NEOFI/239-751....................VEANHSFAS..DLLRKE............LDQQC.GLW...RS.LQALEHI.......YL
A2E6U4_TRIVA/44-540....................LQEIYKSAS..NILISE............MFSQY.RLM...DI.FNTIWNV.......IL
GCP2_MOUSE/220-738....................IEKAFNYAS..KVLLDF............LMEEK.ELV...AH.LRSIKRY.......FL
Q0CV34_ASPTN/4-641....................ISSIRLSLS..QSTLSK............LLPLP.KIL...EI.LSVLHDF.......ML
A2EPP8_TRIVA/122-554....................IDKCSE..K..AEKIII............DIMHE.KKL...NQNLHHIYSY.......LL
Q2GYC7_CHAGB/148-598....................IDEAYKTTM..RR...............................................
A1CPI0_ASPCL/179-855..................PLLSSQALLID..FSCLHL............LFKEH.RLR...YH.LTLQWRF.......QL
Q6FQY5_CANGA/70-712....................VSRWYSRAN..ELCIRL............FFEGY.NFG...RFLRDIFCNY.......LY
Q4RSJ3_TETNG/316-1146VQLSEMVSLPVLIKHSVTAPLITHVSLVN..KAVVDY............FFVDL.GVE...RH.FEALRHF.......LL
SPC97_YEAST/62-688....................VDKCYSRAN..EIFLKL............FFQGY.DLI...NV.LKHLQQI.......FL
GCP3_DROME/235-758....................VETCYQQTS..KHVLDI............MVGPH.KLL...DH.LHGMRRY.......LL
Q6CHU8_YARLI/94-627....................IEQQQQAVN..DSL...............MSHVKKYLF...TH.LESAKRF.......FL
A0DAA4_PARTE/211-878....................ARLHNQLVN..KSIHFL............LFEQL.NFL...QL.WNNIKKY.......YF
Q5BHX4_DROME/97-629....................IKTSYELPA..QKFLKV............LVEEH.NLP...LH.IRNLKSY.......FL
A1C7R2_ASPCL/32-668....................IDSIRLSLS..QSTLSK............LLPLP.KIL...EI.LAVLHDF.......LL
Q5KL44_CRYNJ/148-724....................IDDAYSIAS..QRLLEI............FFDKF.RLL...DH.LRALKSY.......LM
Q0UGY4_PHANO/31-649....................VTKIRLSLS..RNLLQY............LLPRN.RII...ET.LTVLHQF.......FL
A1C564_ASPCL/237-752....................VKANQSFTS..NLLHQE............LDRQC.GLW...TS.LNALEHI.......YL
Q6H548_ORYSJ/50-922MSLRDPLQPVGIIQECLSKCIKRQVDHIG..KQILSK............LMGDW.RLM...DE.LFVLRAI.......YL
Q4Q0X5_LEIMA/136-766....................VQESFEISS..GAVIQL............LFSPSVDLL...GH.LKSLKLY.......FL
Q503S5_DANRE/270-933....................IERRYVECC..GNLMRT............LKKDY.RLL...GY.LQAMRNY.......FL
Q6CXD9_KLULA/57-697....................VNECYQQAN..EKCLKM............YYEGY.HMD...KF.LNLIHDQSYVHGVIDQ
Q389Z9_TRYB2/121-676....................IEESYEIAS..GEVLQL............FLGPQVDLL...GH.LTSLKSY.......FL
Q4N294_THEPA/45-610....................IKNAHNEVM..HEVYPG............SKENF.PFS...RT.LRMIFDY.......FL
Q7S902_NEUCR/140-744....................ISSAYAHAN..GSLMQL............LLTTH.ELP...AR.LRSLKHY.......FF
Q0D0R6_ASPTN/174-839..................PFLSSQASLID..FSCLHM............LFKEH.QLR...YH.LGLQWRF.......QL
Q60F24_ORYSJ/4-649....................VGSIRTMAA..NNLWQL............VVVRA.DLN...GH.LKALKDY.......FL
Q6C7A5_YARLI/10-542....................IRYTKKQVY..SNLLDS............ILPTA.EVQ...KL.LTLFRGI.......YL
Q7YYU8_CRYPV/251-795....................LNRLQAQLD..TKLKDL............ITDNG.SLI...SR.LKIIRDY.......FI
Q9FG37_ARATH/192-713....................VTEAAKRID..KHLLDV............LYKRY.KFK...EH.CLAIKRY.......LL
Q4P4I8_USTMA/198-1067....................FESWARLIN..MSLISV............FFQDL.GLG...TY.LETCKRF.......LL
Q5BEM5_EMENI/175-843..................PLLSSQALLID..FSCLHL............LFKEH.NLK...DH.LLLQWRF.......QL
Q014J8_OSTTA/270-889TKRMPACPMHLLVQGAIGSFITRRADEIM..LVLSKA............LRDEL.NIE...KE.LYALRAV.......FL
Q560G7_CRYNB/181-812....................IEDAYIYAN..KTLLKL............MVEEQ.ELI...PH.LRSMKHF.......FF
Q5BBA4_EMENI/34-667....................VDSIRTSLS..QSTLSK............LLPLP.KIL...EI.LSLLHNF.......LL
Q59PZ2_CANAL/94-759....................IDEFYHRAN..KMLMKL............LFDGY.NFP...SV.VNIFQRL.......FL
ALP6_SCHPO/196-713....................VDKAYTESI..NHLVYL............MEEVF.HLT...DH.LKAIKKY.......LL
Q16YQ3_AEDAE/217-729....................IDSAYLNTS..KQVLDI............VLGPH.RLL...DH.LQALRNY.......LL
Q756H1_ASHGO/63-723....................VDKWYQRAN..QMCWDL............LQEGY.QLP...RIMYQLHKHF.......ML
GCP4_DROME/4-548....................IIDIKNYVS..ARLSEI............AVNEV.DLE...RQ.MGLIKDF.......FL
Q5CFR0_CRYHO/45-593....................INSMFFE....SQL...............LIYSVCNSITDVRYCINKFYEI.......FF

PF14609

MOD21_SCHPO/60-677F.....KLYKASA.IAMLLWMVNQASQITSSMTIARPLYNIL............ILCKDFPNNFLEKDNI..........
E4WX70_OIKDI/53-731VSAALKQAYGEGMKITEIALEIISVDRSTNPWDISSRTLSILFEHFPTIYKRFESILPEYS..FLLKKCMWRYVNCIQLF
B6K1F8_SCHJY/48-653FGEFFSKLYYETL......STFLNISKIDAGYALPTPLLYIIKTSQRVNRQAAKSLLKQTSEKYFAESCS..........
E4YGB9_OIKDI/53-731VSAALKQAYGEGMKITEIALEIISVDRSTNPWDISSRTLSILFEHFPTIYKRFESILPEYS..FLLKKCMWRYVNCIQLF

PF04130

Q7PX58_ANOGA/302-918L....EASDLMDYFYSDLFRRIEAGENWANPYLLTIQLNDILASRFNDM...............................
Q4WZU3_ASPFU/32-668L....GRGEFATALVSHADARLSERHRIPELLAGRVRAQTELEGLVVKDGDVVHALAHTWAELYSLQNEEDPVDE.....
Q4X128_ASPFU/183-784L....DRSDFFSYFLELGSSELRKPAKNVNENKLQSLLDLVLRQPGSIAASDPFKEDVKVRMNKIGLT............
Q6MYK5_ASPFM/186-866L....GDGFFASRLSHSLFDPEMESGERRSGVVRSGVHTGLRLGNRDTWPPASSELRLVLIGLLSDCNMDE.........
Q74Z68_ASHGO/190-740M....GRGDFIENIIINASDFLMEPVHQLQSYQLTKCLQESVQRSSLRNYLN............................
Q29HV5_DROPS/23-546L....GQGDFVSIFIEHMKDELEKPGTEIFAHDLSAMLDTALRCTNAQY...............................
GCP5_MOUSE/273-942M....EGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPED...............................
Q6BX70_DEBHA/183-753M....NSNDFIESIIEKGIVLFNEPANSLTSNQLAKVLIESINNSSVKN...............................
SPC97_DICDI/430-1044L....CKGDFFSHFMDTTYDELKKPLDQINMVKMNSLLQLSLRTSSISEEDEFKDDLECEFIPYKLVDQLLNIININ...
Q0V2V1_PHANO/184-787L....DRSDFFTYFLEMGELELKKPAKAVNVGKLQSLLDLATRHAGSVAVEDPYKEDIKVHMNDTG..............
Q6BGV8_DEBHA/61-751F....KDSSKIDVFLEKSFNDLRKNKHAISTSRLSKLYDDTLQHKKDDFQVKDINKQNSISDNKMNDVLSYCSGLSIDFT
Q2M0Y2_DROPS/276-1186L....LNGEFGTQLTGGIFGNIRAGMDPRSLCQKGVLDVILNNALGGCAASD............................
Q0UQH9_PHANO/170-704I....GDGVFSSLLATALFDPERESAERHKGQMRSA.LRGVLSESYYSSSLYQSLLKTGEVAQA................
Q7PWU6_ANOGA/4-573L....GRGELFSEFLTQTQSLKLLIGKEINDGTTRDLNRALKLAANSINLGEDI..........................
Q23AE3_TETTS/242-743L....ERGDFFVYFLDSSEEELIKQARQVSKEKLESLLEMSIRTSSLSSDPYVEDLTYEFSQY.................
Q24CL5_TETTS/4-823M....GNGEFFKAFYEESRSLMQLPPKPESEGHLNNVIVPHTLIRLRNDDEIVNAFKNFQFKIKNNGFEFKDFSQVNELN
Q7Q703_ANOGA/248-764L....QQGDFITEFMDAVEEDLRKSVDTLHPIRLANLLDVTLGLSSAKYDEYHDDLKTM.....................
Q7S8K3_NEUCR/231-856L....GNGMLCSRLSHALFDPDLESAERKAGVAFSG............................................
Q9C5H9_ARATH/70-583L....DQGDFLVHFMDIAREELNKKVHEISVEKLQSLLDLALRTTAAAADPRHEDLT.......................
Q16HU4_AEDAE/210-728L....QQGDFIDQFMDICEEDLNKDVDELRPMRLENLLEVTLNMSSARYDEYNDDLKTM.....................
Q0UBK8_PHANO/224-738G....KNGAVFEDFANALFERMDGGRRGWNDRYVLTEITRTIFGTVMPH...............................
Q4P9B0_USTMA/319-997M....RRGAEMASWLESLFMDLDRRNGMLRATNHHRLHSGFNDALEIHQQSNGGEA........................
GCP4_MEDTR/4-635L....AKGDFFQCFLEESRQLMRLPPRQSTAEADLMVPFQLASLKTIGEEDKYFSKVSLRMPSY................
A2E3S1_TRIVA/121-599L....RRGDFVVSLFENFLHEGAPISLLDHVIRDICQDSVYINKRTS.................................
Q29G36_DROPS/282-800L....NQGDFTMQFMDACEDELSKNVDLVLPMTLENLLGLTLRLSSARNDPYKDDLHC......................
SPC98_YEAST/187-740M....GKSDFMDALIEKANDILATPSDSLPNYKLTRVLQEAVQLSSLRHLM.............................
GCP4_ARATH/4-645L....EKGDFFQCFLEESRQLMRLPPRQSTGESDLMVPFQLAATKTIAEEDKYFSRVSLRM...................
A0C933_PARTE/4-693L....NNGNFIQQFLSDCQSILQLPQTQQALQELNFNLHKMDYDQTEKMDMFIYNNGFEYKTFQSLNNLQIKNNVIQTIN
O61208_CAEEL/304-799L....SDPRFTTTLYTIIKEASQGLRVGSTTLSRQTVSSALAAALESCQSTQNISD........................
Q4PG13_USTMA/283-861L....ARGDFVDLLMASLGPSLSRPANSLFRHNLTASLETAIRGSNAQH...............................
Q383E4_TRYB2/204-700V....GNGDFYEVLIHKLDPVLGRMSHMVQTSLVRDHMQSALLDITPHT...............................
Q0URZ7_PHANO/220-736L....GAGDFIAVLMESLSSNLDRPANTQYRHTLTAQLEHAVRNSNAQF...............................
A0C8V4_PARTE/161-646L....GQGEFIHTLMELLQTELNKPAQQCYRHTLLSILESAFKNI...................................
Q96UE2_NEUCS/231-743M....SDGATSDAFASTIFRQLDNFSTSWNDKFTLTEIAQEAFSQCVAGHR.............................
Q560K8_CRYNB/68-851A....GDVGFTERVSSALFGKDSAGAGEAVGLGKRARIRARLGLGEDDDKQDRDSDWGIGLGIGLSERSRWPPGGAEL..
A0BDB2_PARTE/150-660F....DSGDFFIHFIEAAESELVKDIREISKEKLESLFDLAVRSIASNDAYKDDLVCYI.....................
A8BD62_GIAIC/283-863V....MAGDFLSCFVESAISELVLSRSVANILRIRSKFKMVIKTSSLANLPYNERMNVI.....................
O94070_CANAX/153-677M....ETNDFIDAIMVKGKDVFNESSVNISSTYLRKVLQDAIQISSVK................................
A2E1L0_TRIVA/46-541C....GRGDWVAKFNHLAAQTMSVSRDKAHIPAIDANFAASLPSDYSKYFSAFLEQDTL.....................
Q4UGA7_THEAN/233-712F.......EYTKNVLLRIITPSSPPMNNYSTKNNIN............................................
Q2HBB4_CHAGB/228-739M....SDGSMSNSFASSVFRRLDALNNSWQDRFTLTEVAQEAFSTCLDSYR.............................
Q4N4G5_THEPA/98-933L....FNESLYDKFFEQSYDIMAMDFGDNELKSVNKSFTTLFNRLKDDMSGENREENQNSDKFELIKCVNHFNINSSFKL
A2E313_TRIVA/240-732F....GRGDFAKALFTNFDEAEDGDAAALFVHAMKDSTPMATTYINP.................................
ALP4_SCHPO/74-693L....DQSDFFTTFLDNAQHELRKPAKYISITKLQSQLDLALRQPGTITATDPHKEYVTVEVNQTSLIDWLMHIVS....
Q2UDA7_ASPOR/4-644L....RRGEFASALVSHADARLLERHRRPGNLASKGKFAEGLQGLSIKEGDVANALSQALAELYSLQNEEDP........
Q05AR5_XENTR/4-571L....GRGELFQAFIDIAQNMLKTPPTAVTEHDINVAFQLSAHKVLLDDDNLLPLLNL......................
Q2M118_DROPS/72-608L....QNQEFAEALLANYQEHMQRGVDRMIPETLQSLLMETLQKFDDPFKDLMRCQLKDRDVAS................
Q584R6_TRYB2/3-521C....HRGDFWHTFVETAFSTFVDDTISRSTVTEAVVNRTAADAFAYALEMSGLGDVRVF....................
Q6CIT0_KLULA/175-721M....GKSDVIDSIIQNSENLFNQPSQLLESHHLTKCLQIAIQQSSLRNRL.............................
Q2UCE2_ASPOR/176-851L....GDGFFTSLLSHALFDPEMQSGERKSGVVRSSVHTGLRLGSRDTWPPASSELRLVLIGLLSECHG...........
Q6FLE0_CANGA/180-724M....GRGDLINTLITKLSSALTSSSDLLSDYSLTRILQESVQQSSLRSLI.............................
Q4DZM8_TRYCC/106-657H....QRGDWLVDFLDSSEELLVKSPVHVKAHSVRVLLQAAIARCCETDPYHSTIGCSFSD...................
Q0CNS1_ASPTN/283-794L....GQGDFIALLMESLASNLDRPANSQYRHTLTAQLEHAIRASNAQY...............................
Q2UAG9_ASPOR/234-750C....KDMSVYGPIDHKIFDLIDRGRGAWDDRYLLTELAQSAFSTLPFIDP.............................
Q0IG23_AEDAE/4-557L....GRGELFLELLRQTKSLKTLFSKGITDGSSRDMNRAFQLAANSVNITE............................
GCP2_DROME/204-721L....NQGDFTMQFMDACEDELTKNVDHVLPMTLENLLGLTLRISSARNDPYKDDLH.......................
Q8SU99_ENCCU/71-555F....GRCDFIETLFLYLKDSRDLSKKSFSYILDLAIRNTYGDV....................................
Q55SK9_CRYNB/4-687L....RKTDYCIAVIRGISQLRLDKLITSNPHSSSSIIREQDLDLILRRASVGTSAELDSQLDSLHYK............
Q871F9_NEUCS/225-739L....GQGDFIALLMESLAPNLDRPAGAQYRHTLTAQLEHAIRGSNAQY...............................
Q6CCF8_YARLI/159-656I....GQGDFFQTLLDNISPTLARPSNTLFRHDLTSALEASIRESNARF...............................
Q8MT65_DROME/266-1245L....VDGQFGATLTNEILGRIRAGVGPRSLSQKGILDTILTNALAACSADE............................
Q9LM94_ARATH/47-872L....GSGDLLQHFLTVIFDRLGKGESSNDDFELNIIIQESIRNSADTMLLSSPDALVVS....................
Q6C787_YARLI/102-681L....DRADYYINFQDIAWTELARPASQSSVTKLQYLLDLCLRQPGSITSTDQYKDDVVASL..................
Q4U9K6_THEAN/45-615L.....QKSYIQDIVNNFNTGGLSDLNKRLQIHVDRDWDNSPGSFRPKLYLKCDDLYNFAGALE................
Q7XUI5_ORYSJ/65-1092M....ELADWADSFIVSIYKKKWSFVKSEHKRAEIQGLLDLALQRSSCDSDP............................
Q2H076_CHAGB/195-897L....DNGLLVSRLTHALFDPDLSTAERRAGVALGSGTMGLRLGSRQTWPPASSELRLALMGVLSDCYE...........
Q01AM7_OSTTA/101-630L....GQGDLHESLMDLIGPSLDEPANSLSVFKLSGVLEQAVRSSSVQS...............................
GCP3_MOUSE/251-761L....GQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQF...............................
Q01B37_OSTTA/4-547L....GKGDFYSIFVDEAKELLALPPKLGNATRELATPFAQSAVTAMPSNIAIYSTFKLV....................
A2DSV4_TRIVA/119-594F....CRGDFATSLFYAINESDDISSVYILTRALKGIDFGKCYTN...................................
Q0JBZ2_ORYSJ/73-597L....DQGDFLVHFMDIAREELTKKPEEISVEKLQSLVDIALRSTAAASDPSHEDLTCCVER..................
Q17IM7_AEDAE/330-1376L....MDGEFSCYVCDNIFKMLEEVRSPDELLNYQTLHTILDSALCSSAAGA............................
Q2H2M0_CHAGB/4-638L....RRGEFAMALTQQADEKIRSRWKRAENLAYQKRDGLSTVTVKEGEVAAVLARTWAAMGSMQGDHAE..........
Q5AUB0_EMENI/232-744C....KDISLIGPIDTKIFELIDRRKGGWNDRFLLTELAQDTFGSLPII...............................
SPC98_DICDI/112-705L....GQGDFIQYLMDLIGEDLLKPTSQIQRHKLVGWMDTAIRNSNAQF...............................
Q011F8_OSTTA/257-775H....ARGDYLVFFLDTAAAELKRDSDDIRLSKLDTLLDLALKSSSAANDLHSDDMSCS.....................
A8BFK8_GIAIC/197-740G....MQGDFIPSLCSILSSTSGGDKYKLSMLEKIEQAMMSCNV....................................
A2F3R1_TRIVA/115-545F....RRGDFATVLLENSANAEKRLPLILHDYIGRK............................................
Q4PBJ3_USTMA/53-831H....RNGSYTLSLLGEVEAMKKNKLYRARSAAASMIRSSDLELSLRRATVGTWAEDDPSLQRLRFVLPKG.........
A1D041_NEOFI/239-751C....KDLSVSAIIDNKVFDLMDRGRGAWSDRYLLTELAQSAFSSMSFI...............................
A2E6U4_TRIVA/44-540F....RRTDLFNIFYRVAGNKMRRDKSEISPADLEDLMSIVYKPFEFISVKLEKQQ........................
GCP2_MOUSE/220-738M....DQGDFFVHFMDLTEEELRKPVEDIILTRLEALLELALRMSTANTDPFKDDLKIEL....................
Q0CV34_ASPTN/4-641L....RRGEFASALVSHADARLYDRRRRPETLASRGKSREGLELITIKEGDVLSALSQAWAELYSLQNDED.........
A2EPP8_TRIVA/122-554L....GRGDFANSFMAIDDDAKHIQLNRIAYEVARQ............................................
Q2GYC7_CHAGB/148-598...........ATLLPSSWNDRPRPSIGLARHNVTANRFQLPAEHAFGDSN.............................
A1CPI0_ASPCL/179-855L....GDGHFTSRLSHSLFDPEMESGERRSGVVRSGVHTGLRLGSRDTWPPASSELRLVLMGLLSDCNM...........
Q6FQY5_CANGA/70-712V....NNGNKFNKFLLRNHFDLGKEYSESRSVLRRLEQSWDVEVDDRSLVQRLVSLRYSTVSFRESLLQVQRDEIARED.
Q4RSJ3_TETNG/316-1146M....EDGEFAQS.LSDLLFEKLASGQTPGELLTPLVLNSILHKALQYSLHG............................
SPC97_YEAST/62-688G...YQSGHNVLKFLTKNMG