Sequence alignment for CL0540

PF14609

MOD21_SCHPO/60-677-M...........GIQGREDLEMPLRNACEV.LNR-----------------------------..QTVSVKQ-------
E4WX70_OIKDI/53-731-VKDQIESVVDKFRMHNFTAQANDFDDHMDDFVDR-----------------------------ALVENGTGN-------
B6K1F8_SCHJY/48-653-VISSVEGIAEKQSILGREDVANCLHARLAE.LDQ-----------------------------..VSSNWRV-------

PF04130

Q2UAG9_ASPOR/234-750ETIFMLQG.LPTSL.FWR.............HHES.............................VEVDRKYSL.......
Q4WEE6_ASPFU/229-741ETLFMLQG.LPTSL.FWR.............LDDN.............................IEVDRRYTL.......
A1C564_ASPCL/237-752ETIFMLQG.LPTSL.FWR.............LDDN.............................IEVDRRYTL.......
Q5AUB0_EMENI/232-744EAIFMLQG.LPTSL.LRR.............IDGN.............................VEIDRRYTL.......
Q0UBK8_PHANO/224-738ETLFMLAG.LRTSL.YKL.............DPQQS...........................SIRINPKYVL.......
Q2HBB4_CHAGB/228-739EALFMLAG.LETSL.FDFECNPIT.............................................RYQL.......
Q1K6Z8_NEUCR/239-749.VVFMLRG.LPTSL.FDLACKPVP.............................................DYVL.......
F4HUK8_ARATH/48-872.LLQALQG.FSSPF.IFWDRKEQTF..RAKS......................................EIRV.......
Q6H548_ORYSJ/50-922SVFEVLQG.FDTVL.LYWDKTAPGY..CEKA......................................GIYV.......
GCP5_MOUSE/273-942ETLWLLSG.VKKMF.IFQ.............LIDGK............................VTVRNNIIV.......
F1QBQ4_DANRE/270-933ETLWLFSG.VKKLF.IFQ.............HNDGK............................VTVRNDVVV.......
C3ZYG0_BRAFL/302-1685ESLWVLGG.CQQSF.LYRSREQKLL..LMN.......................................NIKV.......
Q7PX58_ANOGA/302-918EILWMFTNPVDCKL.FRI.............DDDQ.............................IWINTNVSL.......
A0A0D1E2A2_USTMA/319-997ESLSSLMG.SSSML.YSRHSSGQFT..IDNSRK..................................DPL..........
Q9VTS3_DROME/266-1244HLKKAACG.IESLT.F..PISSADK..LELRVRPNT............................TLPTML..........
Q2M0Y2_DROPS/276-1186HLKKAAAG.LQSET.FECPAGGGDQ..LQ..IKRNT............................TVRTVL..........
Q17IM7_AEDAE/330-1376DVKFLITG.FSSRC.FEYDDDNRFR..MVG.......................................NFTV.......
Q0UQH9_PHANO/170-704QSLWNLGLGRSSIL.FDFNTKLKSF..EPTVP.....................................QGRT.......
Q5BEM5_EMENI/175-843QSLFRVGLGWSSML.FRFNKQRQKF..EKVVK.....................................DIRI.......
Q2UCE2_ASPOR/176-851RSLFRLGLGWSSLF.FRYNRERQMF..ERVFD.....................................DIRL.......
Q0D0R6_ASPTN/174-839RSLFRLGLGWSSMF.FRYNQQQAQF..ERVFK.....................................DVRV.......
A1CPI0_ASPCL/179-855HAMFRLGLGWSSIF.FRYNRQQRKF..ERVSG.....................................GIRI.......
Q4WSG8_ASPFU/170-850HALFRLGLGWNSVL.FRYNKQRKAF..ERVSD.....................................NIRV.......
Q2H076_CHAGB/195-897ACLSNLALGRSSVL.FSWESEKNSF..VKTSP.....................................CLGI.......
A0A0D1BZI3_USTMA/198-1067SLVNTATTGTSSDH.FQWDSDSASFVWAATLQHCKNVRQLRRRYKEQATLRASLAAAGDDVDPPPLLPTAMMQPWIG...
A8BFK8_GIAIC/197-740DLIYAMQG.LPGQY.FELIKDPTSG..ISHFVLQRQ............................YQSLSV..........
A2E6U4_TRIVA/44-540DLFSCLLG.GDGTY.IRRTKQNKYL..VQAIL................................................
GACP2_ARATH/70-583DLLSALVG.IEGRY.ISIKRFHGKE..DSIAFQV................................DPSM..........
Q0JBZ2_ORYSJ/73-597DLLSALVG.IEGRY.ISIKRVRGKE..GYVVFQI................................DSSM..........
GCP2_DROME/204-721ELLHCLTG.IRESLLVPQKPIISAV..GLAKYDTDF............................DIHTHL..........
Q29G36_DROPS/282-800ELIHCLCG.TRGNFIVPLPPDANST..GIAKYETYF............................TIHAHL..........
Q16HU4_AEDAE/210-728ELLDCLVG.VKGSL.IGPKKTVRAT..VGLFPVEF.............................EVSDQI..........
Q7Q703_ANOGA/248-764EVLNCLIG.IKGTL.ITPRKGATTLDPDGALAVEF.............................QLSNQL..........
GCP2_MOUSE/220-738DLLYVLVG.VDGRY.ITAQPLAGRQ..NRTFLVD.................................PNL..........
SPC97_DICDI/430-1044DLLSTMIG.IEGEC.IHIGVVQENE..DDSLQSNLVS..........................FVVEGEV..........
A0BDB2_PARTE/150-660DLLYAMMS.IEGQY.IKK....KNG..SFEYQIEGH............................LEQSTC..........
Q23AE3_TETTS/242-771DLLFVMTG.IEGNY.IKKKADQYRK..PYIYCIEPY............................LETSTC..........
SPC97_YEAST/62-688DLLNVLIG.LEGTY.IRYFNDYEPS......DPETPI..........................EFKIAKKM.........
Q6FQY5_CANGA/70-712DLLDTMMG.LEGKY.IRYNNSYDPH..VDMMPAFR...............................ISKNM.........
Q756H1_ASHGO/63-723DLLHVLVG.LEGIY.IRYNNSYEPE......QRRSGALPYD..................IVGPDFKIAKNM.........
Q6CXD9_KLULA/57-697DLLLVLQG.YEGVY.IRYNSSYRRD......SMTGPE..........................YKVVKMM..........
Q6BGV8_DEBHA/61-751DLLFSLIG.YEGCY.IRYSEKYDPS..EINSKIRGPD..........................FKIAKHL..........
Q59PZ2_CANAL/94-759ELLFTLLG.HEGHY.IQYSKRYDPT..SQISRIEGPD..........................YKIAKNL..........
Q6C787_YARLI/102-681DLLNVLMG.HEGVY.INYSDSYNPR..LELDRLKGPD..........................YRTARGL..........
ALP4_SCHPO/74-693ELLNAFMG.MEGVF.VHLQDMKASS..EFETIIMPPS..........................FYILPGF..........
Q4X128_ASPFU/183-784DLLFVFMG.FEGRY.IHYHHTFDPT..AEKDRLAGPA..........................FQLPSGL..........
Q7S902_NEUCR/140-744DLLFVFMG.FEGQY.IRFAKGYNPY..EERDRLSGPQ..........................WRILSGL..........
Q0V2V1_PHANO/184-787DLLFVFMG.FEGQY.IRFSETYNPH..EEKERLVGPQ..........................FRILPGL..........
Q5KPG7_CRYNJ/181-812DLLFVLQG.VEGVL.IRYDEGYDPF..DEEQRVKGAK..........................WRVNPLL..........
Q4Q0X5_LEIMA/136-766EVLAAAVG.LGGLF.LQYTPAAPGT..SSGISPKEG...........................FQVSPLV..........
Q7XUI5_ORYSJ/65-1092LALHALHG.VKSSL.................DEIEELSVLFF...............SCPADRTSHRVANVWS.......
Q9VS91_DROME/97-627DLIYAFSG.VPSAY.VKPDIQIDQI..SEMSAVDIAKI........................RFRLKKTF..........
Q2M118_DROPS/72-608NLIYAFSG.VPSSH.IKPEATIKQI..ATMQQSGLPNV........................RFKIDEGF..........
Q29HV5_DROPS/23-546NVLFSFTG.IQGKF.LRKNVVTGRF..KLDTANT.................................NLL..........
GCP3_DROME/235-758SAIYSFTG.VQGKY.LKKDVVTGRF..KLDQQNI.................................KFL..........
Q16YQ3_AEDAE/217-729DVIYACTG.IQGKY.LRKHVVTGEF..KLDHIKG.................................RTL..........
GCP3_MOUSE/251-761DILYVFQG.IDGKN.IKMSSTENCY..KVEAKA...................................NL..........
Q1K720_NEUCR/225-737DLPFTLQG.LSSAT.LPFLNDTTLK..LPPTL................................................
ALP6_SCHPO/196-713SISYVLQG.ISTEY.VQFKNELALL..SKRI.................................................
A0A0D1E4X1_USTMA/283-861DVIFLMQG.INGRH.VRFQEEFQYN..TAAAAAAAAASEAGESGP.........AKVVRIVFSEGEAGYI..........
Q5KL44_CRYNJ/148-724DTLYLLQG.IDGRY.VHFAVSPPKE..QNPYLTERGREGEGTGFPLG......KEGPIIEEGYDDEVVVI..........
GACP3_ARATH/192-713DVLYASQG.IDGKY.VKFNSEIDGY..AVQESV...................................KV..........
SPC98_DICDI/112-705DIIYVFQG.IDGTY.IKYNKQSDSF..KIDENTSNTL.........................VNGEPAYI..........
Q383E4_TRYB2/204-700DMLFMWMGVDKTKY.FAYDNACCRY..EMNSG....................................YG..........
Q6FLE0_CANGA/180-724SIPFVLLG.TTSEL.FDI.............EYDK.............................IIIPSNI.........
SPC98_YEAST/187-740YVSYTLLA.TTSAL.FPF.............DHEQ.............................IQIPSKI.........
Q74Z68_ASHGO/190-740YISYTLLA.TTSSL.FPI.............SNQV.............................IEIPPNV.........
Q6CIT0_KLULA/175-721SIPYLVLG.TPSTL.FEL.............KDKK.............................FTIPSNI.........
Q6BX70_DEBHA/183-753YLSYSLLG.LDSKL.LSF.............SRDGN...........................SIELPPNI.........
Q4U9K6_THEAN/45-615DLLNVFSG.LGSSF.FIWSKNSE..............................................NSSFDIENNPL
Q4N294_THEPA/45-610DLLNVFSG.LGSFF.FIWTKNSE..............................................NSSYYIEN...
A8BD62_GIAIC/283-863DCIAVLQGCMQTTY.LQVSEQNKEY..VVTIRKEV...............................ATEL..........
Q0UGY4_PHANO/31-649EILLSLSG.HPSAL.FDTGATSGHV..NSTTSH...................................LL..........
Q2H2M0_CHAGB/4-638EILLSLSG.HPSPL.LRSASASSST..PPNSDNPNNN..........................NTPTSPL..........
Q2UDA7_ASPOR/4-644EILLSLSG.QPSPL.FEAHAEEDTV..SEDAFP...................................LL..........
Q0CV34_ASPTN/4-641EILLSLSG.QPSPL.FNLRTDEDAI..SEDAFP...................................LL..........
Q4WZU3_ASPFU/32-668EILLSLSG.QPSPL.FAFNTEEDIV..PEDAF....................................PL..........
A1C7R2_ASPCL/32-668EILLSLSG.QPSPL.FNVHSEEDII..SENAF....................................PL..........
C8VMB1_EMENI/4-637EILLSLSG.QQSSL.FSFQTEEDAV..SEESFP...................................LL..........
Q5KH00_CRYNJ/4-686EILLILSG.HPSSFFIPYPSPPAVP..FTCKASPS..............................LTEYL..........
Q584R6_TRYB2/3-521ELQCALLGFHSASLPFEILKDSPCD..AGVTGTF.................................SQL..........
Q0IG23_AEDAE/4-557DILFTLFS..............................................................SNSDLPIENF
Q7PWU6_ANOGA/4-573DILFTLFS..............................................................SNAELPIENF
GCP4_DROME/4-548DLLLACRS..............................................................HNPEQLGIKA
GACP4_ARATH/4-645ELLLALLG.FTGDL.I.VDEREQRK..TLGLAFNSDSPLS....................DECTFKLAPDISF.......
Q60F24_ORYSJ/4-649ELLLALLG.FTGDF.V.LDAASSPS......ATRRRRPVPPEAA...........AGGDVGPASFRLAPDLTF.......
Q05AR5_XENTR/4-571ELLLALSG.YPGSI.FTWNKRTGLQ..VVQ.......................................DVPF.......
Q01B37_OSTTA/4-547DLLLALLG.VPGDV.FIATDAPERA..PSLAVAEE..............................LNFFI..........
A0C933_PARTE/4-693DLLFSLLG.KPGSF.VKQFDNSPFY..IDESLN...................................LF..........
Q24CL5_TETTS/4-831EILFGLLG.KSGNI.IIE.............QNDS.............................FVLDPKITF.......

PF14609

MOD21_SCHPO/60-677-----------------SILHAQILKLFLELSKPPSDIHVPQIPVY---------------------------KDCNKN.
E4WX70_OIKDI/53-731-----------------SDLHWEILHFLLEMSNSPTRAAEIKNPA.---------------------------KRLNASI
B6K1F8_SCHJY/48-653-----------------KLGIANVLHLLLTLSAHPRDVVWPKEEQE---------------------------EDISDEL

PF04130

Q2UAG9_ASPOR/234-750.............AHLSSETLSSLLRSFCSIGSKIDILRRYNQVPR..................................
Q4WEE6_ASPFU/229-741.............AHTSSEALSSLLRSFSMIGARLDVVRRFVKITQ..................................
A1C564_ASPCL/237-752.............AHASNESLTSLLQSLGVIGARIDVLRQFTKTKQ..................................
Q5AUB0_EMENI/232-744.............PHLSHEALSSVLRSICACGTKIDILRRFTRTPQ..................................
Q0UBK8_PHANO/224-738.............ASAMSNTVQHLLSELVNIGRNVYRLRQWTKRSQ..................................
Q2HBB4_CHAGB/228-739.............RGVSWDSYKALVTSFSECGRKLAPLRVYVENRE..................................
Q1K6Z8_NEUCR/239-749.............EGVTWQTYDALVNTFSECGRKLAPLRIYASKKE..................................
F4HUK8_ARATH/48-872.............SHLSQSSLHVLLAGFLYAATCLKLVESIVSGIN...............................ASL
Q6H548_ORYSJ/50-922.............SHLSQTSLRAVLKPFLFAATCLKQVELFVGRVR...............................SCG
GCP5_MOUSE/273-942.............THLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESLP..............PGNGPIPKKQPD
F1QBQ4_DANRE/270-933.............THLTNNCLHSVLEHIAAYGQAVSRLQKFIDEVTGHSAEPCPPG...........LNSSSSSSKKSSE
C3ZYG0_BRAFL/302-1685.............SHITPDALQSILQKLAWYGDITHKLHHMIDSVITRSF......................GCHDNGEP
Q7PX58_ANOGA/302-918.............SSTTEHGIQTFLLNFTEYMTIAYRLRNFCRSILEH...........................TARSL
A0A0D1E2A2_USTMA/319-997.................TNSLTEQMEAVAYLASTLSILRSFVKATVFQS........................IHTVDAL
Q9VTS3_DROME/266-1244.................PEVLADFANHFIRAGCAFLRLSSRTKWNNI.............................AEMR
Q2M0Y2_DROPS/276-1186.................PEVLSDFVQPFLESGTAFRRLSARIKSRG................................PR
Q17IM7_AEDAE/330-1376.............DGVSPVTIKAVVDQFLELGTCFRRLHKMTKKNPY............................NYAMI
Q0UQH9_PHANO/170-704.............SGLSPVAAQSLVTRFIHTGNTFLYLRSFAAKTF...............................ASA
Q5BEM5_EMENI/175-843.............SGVSTLALSGIIDEMLQCGNNMQRVRTFIGRVP...............................TAA
Q2UCE2_ASPOR/176-851.............SGVSVAALNSLTDEMIQCGTDMQRVRNFVGKAP...............................SKS
Q0D0R6_ASPTN/174-839.............SGISLTALSGLVDEMIRCGTDMQRVRNFVIKTP...............................SGS
A1CPI0_ASPCL/179-855.............SGVSLTAINSVVEQLLQCGTDMQRIREFARRTR...............................VKS
Q4WSG8_ASPFU/170-850.............SGVSLAVVNGLTEEVLRCGTAMYNLRDFARRTR...............................IKP
Q2H076_CHAGB/195-897.............SGLSLETVKAVDKLCLDCGNSARHLQAFAEGAY................................SI
A0A0D1BZI3_USTMA/198-1067.........SERILGWSQAASDSVIRPLLDIGALLRRIDDRTLAIH..............................RSSA
A8BFK8_GIAIC/197-740.................SQTAATFCERIASCGFFYTRCTELLNAVT................................KT
A2E6U4_TRIVA/44-540.................RDSTQSFIDQLIPICDKFYYCQKFSETHY................................YL
GACP2_ARATH/70-583.................DLALQELAKRIFPLCEYYLLIDQFVESSS................................QF
Q0JBZ2_ORYSJ/73-597.................DLALQELTRRIFPLCEDFVLVYHFVESRS................................HF
GCP2_DROME/204-721.................DRSLTHQVREILPLASYFMGVQKIIAATD..................................
Q29G36_DROPS/282-800.................DKSLTELLQDILPLASYFIGIQKMMAATD..................................
Q16HU4_AEDAE/210-728.................EESLRDIVREILPLASHYSQVQDFIAASS................................SL
Q7Q703_ANOGA/248-764.................TESCRDMVVEVLPLAANYSAVQSFIEGAS................................VT
GCP2_MOUSE/220-738.................DLSIRELVNRILPVAASYSTVTRFIEEKS................................SF
SPC97_DICDI/430-1044.................DPSNNDLVQRILPLCSYYSFVNDFIQIRY................................AY
A0BDB2_PARTE/150-660.................DLSLQQMVSKILPMCSQHDFIENYIQQKI................................KF
Q23AE3_TETTS/242-771.................ESSLKQLVNKILEICLQYDKIQNYIAQHQ................................QF
SPC97_YEAST/62-688.................DPSFKTFSRRIVRYGKQYMILTRAYEKWS................................DT
Q6FQY5_CANGA/70-712.................DKSLKQCCIKILKLSKSYIFINNCIQEWS................................RP
Q756H1_ASHGO/63-723.................DPSLKSVAKRISKVGRLYVILSEFINRFE................................QT
Q6CXD9_KLULA/57-697.................NVTFKSFSKKLIKIGSIFVKLDKFQQWCC................................DE
Q6BGV8_DEBHA/61-751.................DISLKCITKKLVKFGKYYSGLNGFLELYD................................RP
Q59PZ2_CANAL/94-759.................DISLKVITKKLVKFGKFYSGLKSFIQVFD................................NN
Q6C787_YARLI/102-681.................DPSFKDFTRACIKIASTYVSLSAFVDKMT................................RD
ALP4_SCHPO/74-693.................DLGIKDIASEMLEMGSHYLSITAFIESRS................................HF
Q4X128_ASPFU/183-784.................DPTLRDLTSSMLKMATHYSALESFVEVQS................................RA
Q7S902_NEUCR/140-744.................DPSLLDLTQSMLRMASHYTALETFVDVQS................................RE
Q0V2V1_PHANO/184-787.................DPSLRDLTKSMLKTATHYIAVETCIEVLS................................RE
Q5KPG7_CRYNJ/181-812.................DASLLSLVKRLLPLASFFTAVEASMELRT................................AP
Q4Q0X5_LEIMA/136-766.................PASMRSLCETVLPVADAFMALRCIEKAEY.................................S
Q7XUI5_ORYSJ/65-1092.............RSSSTTSVGNILKSIRTTGLSVLFLCKFLHFYLFQSRELNGRGRE......GHEHEVSDSEETEQPA
Q9VS91_DROME/97-627.................TGAFRALANETLPLIGYYISVQSYIEETN...............................MSP
Q2M118_DROPS/72-608.................NSTIRTLGNYLLPLVGHFISVQNFIETTN...............................MTP
Q29HV5_DROPS/23-546.................TTGDAGLMLRLSELGYYHDRVAEFADPSK...............................GYS
GCP3_DROME/235-758.................TTGQAGMLLRLSELGYYHDRVVKFSDVST...............................GFN
Q16YQ3_AEDAE/217-729.................SIGDAGMILQLAEVGHFHDRVVKFTDPKS...............................DCY
GCP3_MOUSE/251-761.................NKSLRDTAVRLAELGWLHNKIRKYADQRS...............................LDR
Q1K720_NEUCR/225-737.................PIPIISLLNTLAEPSLLYRGLNEFTKTPA..................................
ALP6_SCHPO/196-713.................PVQYLLQMRALSETGLLYQELKVFSNYDPSVSQSID.................GDNVSKAFIN
A0A0D1E4X1_USTMA/283-861.................NAPTKRIVHRLAELGQLYKRVSEFSQQRS...............................AMP
Q5KL44_CRYNJ/148-724.................SQPTRTLLMQLSEMGMLYRRVTNFVNSRQ..............................AGDS
GACP3_ARATH/192-713.................PRATRIMVRMLSELGWLFRKVKTFITESMD............................RFPAE
SPC98_DICDI/112-705.................SKPKRDLVYRLCEFGWLFKKVRLFITNND................................FK
Q383E4_TRYB2/204-700.................TVRQRQAFSAFQECGCLAHQIDDALRGGT.................................S
Q6FLE0_CANGA/180-724.................PNSESGILHLIFEAGLLYKELGNLCDKYR................................RM
SPC98_YEAST/187-740.................PNFESGLLHLIFEAGLLYQSLGYKVEKFR................................ML
Q74Z68_ASHGO/190-740.................PNGESGVFHSIFEAALLYQYLSNQVEKFK...............................VAS
Q6CIT0_KLULA/175-721.................PNGESQQLHDIVEAGLLYLHLQIRVEYLK...............................KHV
Q6BX70_DEBHA/183-753.................NSSYSGLLHSILEPGLVYKKLKLFVDSNK................................GK
Q4U9K6_THEAN/45-615INGNTIYNLFIIYLIYVGNEMIEVCHEILRIHFDQLTLLEFVASSY..................................
Q4N294_THEPA/45-610..........NPLIQDVGDDMIEMCHEILRIHFDQLTLLEFVASSY..................................
A8BD62_GIAIC/283-863.................PATLVAMTQRVLVHAHARFQIVNTIYTHQ................................VP
Q0UGY4_PHANO/31-649.................SPPEAELLSSIGHLSRLHRKVRDHAARIA................................TT
Q2H2M0_CHAGB/4-638.................TPPERALLASLAHLSELHIQLLTSTAHIA................................AA
Q2UDA7_ASPOR/4-644.................SPPEKALLASLARLSRLHAKLRAHTALIS................................SS
Q0CV34_ASPTN/4-641.................SPPEKALLTSLARLSRLHAKLRAHTASIS................................AS
Q4WZU3_ASPFU/32-668.................SPPEKALLTSLARLSRLHAKLREQTSLIS................................SS
A1C7R2_ASPCL/32-668.................APPEKALLASLSRLSKLHAGLRKHTALIS................................SS
C8VMB1_EMENI/4-637.................SPPEKALLASLARLSRLHARLQAHTALIC................................ST
Q5KH00_CRYNJ/4-686.................HPGEVASLNSLADLAFQYRKVKTWANDTIDCGRKAILAESLPP..SRKGKEREVFMNDKGDSI
Q584R6_TRYB2/3-521.................HPSERSLVGEVLPLGEMCQTLRALATDFA...............................VGR
Q0IG23_AEDAE/4-557......TIPEVAANFLHPG.EIKILEDLIRIANQYKELKKFVHQYGTQSAGLVK...............PKQQKPSEEPL
Q7PWU6_ANOGA/4-573......TIPEVASTFLHPG.EIHILEELIRIANQYKEIKKFVQQYGTLNAGLLK...............PKQQKPTEEPL
GCP4_DROME/4-548F.....NETTVIDQFIHPC.EREIFMDIIKIIKVYQEVEQFTHSSGRKSD......................THGELPDS
GACP4_ARATH/4-645..............IEPS..ERDLIERLIKLGFYYRELDRFAKKSRNLSWIRSVTSVH.......PLERADELSKQSREK
Q60F24_ORYSJ/4-649..............LQPS..ERSAIERLISLGFYYRELNRFATESRDLSWINSPIDV.........SPTHGEKTVKAKVR
Q05AR5_XENTR/4-571..............LHPG..ETNVLNRLCKLGTDYIRFTEFIEQYTGHVQQQD.................HHPSQQGQVG
Q01B37_OSTTA/4-547.................KPHERERLNNLIRIGASYGALERVTRSERESVI......................DHDGLDVK
A0C933_PARTE/4-693.................SKPEIVQLNQIVNLGYHYQQIDNFLQNQE..................................
Q24CL5_TETTS/4-831..............LTPA..EKEIINSLCCLGYYYKNLEQFLDENYNNFAKITYFMNKNNNFNENCDDQNDGPIAEVNVI

PF14609

MOD21_SCHPO/60-677EQEAIIQ.....LLTSCEGDHWL..MPDWSSMPDDET-------------------------------------------
E4WX70_OIKDI/53-731EEEAEKSEDSENMEEFDNGDRWDDKLSEWSE......-------------------------------------------
B6K1F8_SCHJY/48-653ASEKLINQDDTYLSAPFEGEHWD..IPNWESSDSDTS-------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750.VIPYLQTFHRGIEDRLR.EFDR.FLSNVQAQY....LSQS.....................................RT
Q4WEE6_ASPFU/229-741.VVPYMQTFHRCVEDCLS.QFDA.FLSEVQTQC....ISQG.....................................AP
A1C564_ASPCL/237-752.AVPFMQTFHRCIEGHLH.KFDA.FLSKIQSGF....LPQR.....................................TS
Q5AUB0_EMENI/232-744.SAAYMQTLHRSTEDCLH.KFDK.FLSEMQNKF....LSRD.....................................SS
Q0UBK8_PHANO/224-738.TLPLIQTFESTVRMRLV.AFDR.ALADVQQRY....LTPN.....................................SP
Q2HBB4_CHAGB/228-739.QSPLLQVFRACLQKALH.HLDL.ELSLIQTSLVAIKED.........................................
Q1K6Z8_NEUCR/239-749KEEPLLQVFQDSLQKALQ.SFDQ.ELTAIQGRFVAIHKD.........................................
F4HUK8_ARATH/48-872KSPPTLMAFSNSASGWLE...AN.IALNEEVKINDSNVA.........................................
Q6H548_ORYSJ/50-922HGTPTLSAFASSVDSWLM.RLRK.AALKEEEQLFLS.VE.........................................
GCP5_MOUSE/273-942APFRTYQAFMWALYKYFI.NFKE.ELTDIEKCVISSDT..........................................
F1QBQ4_DANRE/270-933PPFRTYQAFVWALYKYFT.SFKE.ELNAIEKDIIAKDE..........................................
C3ZYG0_BRAFL/302-1685SVSRTQQAFTSALLRCLQ.DFNK.KLAALEKRLVLQEE..........................................
Q7PX58_ANOGA/302-918PAPHSFECYAAGVKSFL..DHMESVMIRHEKELIKQEPG.........................................
A0A0D1E2A2_USTMA/319-997TRTPAVEAFAEQLQALLE.NLCS.QFSELDADIAAGSTLAHPA................................VIRTN
Q9VTS3_DROME/266-1244LERPLNRAMRETIMDYLS.TTRQ.FLLSLQA.................................................
Q2M0Y2_DROPS/276-1186LEGPLNRAMRDTIIDFLA.TNRQ.FFLSLPA.................................................
Q17IM7_AEDAE/330-1376LEGFVFKAFCDCVERILS.CFRV.VVTCYDG.................................................
Q0UQH9_PHANO/170-704TSIPARVALATTVSSVLY.TLEE.QLGKYSSKI...............................................
Q5BEM5_EMENI/175-843AEPSALSAFSTAASVIVY.TLEK.QLLHSFKQI...............................................
Q2UCE2_ASPOR/176-851TKLSALSTLSSAVAVVIY.IVEK.RLLRDADNI...............................................
Q0D0R6_ASPTN/174-839GIPSALSTLSSAAAVIVY.TLEA.QLVRNYKQA...............................................
A1CPI0_ASPCL/179-855REFSARSAFSSTIAAIVY.TLEK.RLSGYSRGI...............................................
Q4WSG8_ASPFU/170-850EGFSARSAFASAVAMIIY.TLEK.QIINYFKEV...............................................
Q2H076_CHAGB/195-897ASTPTRVALAGVVDRLVT.AVRS.ELKNNSHGV...............................................
A0A0D1BZI3_USTMA/198-1067TLCSEATALAAALDTVVT.WFKA.ELATQSSTLVSNSSAS.......................................V
A8BFK8_GIAIC/197-740NMGKTRASLCEALHTGLS.EYRQ.RISLLDSQLTEEQ...........................................
A2E6U4_TRIVA/44-540KYGKIVHTVCNAIRKYLL.QFME.QVSEIEALPV..............................................
GACP2_ARATH/70-583KNGLVNHAFAAALRALLL.DYQA.MVAQLEHQFRLGR...........................................
Q0JBZ2_ORYSJ/73-597KSGLVNHALAAALRAFLL.DYQA.MVAQLEHQFRLGR...........................................
GCP2_DROME/204-721GLGQVMNSLNEALQELTH.DFYL.IIVQAEQELRHNR...........................................
Q29G36_DROPS/282-800GHGQVVNSLNAALQDLTN.DFYV.LVVQSEQELQQQQ...........................................
Q16HU4_AEDAE/210-728ESGQVLQALRAALQAIIK.DYYL.SITQLEDLFLKQQ...........................................
Q7Q703_ANOGA/248-764EGGVVLQALRSVLKTIMT.DYYL.SIAQLDDLRCRRG...........................................
GCP2_MOUSE/220-738EYGQVNHALAAAMRTLVK.EYLI.LVTQLEQLHRQGL...........................................
SPC97_DICDI/430-1044EWGIINHSLCFSIDQLLK.EYLV.LVSQLEGQLKSER...........................................
A0BDB2_PARTE/150-660ENGYISQAFCSAIKELMQ.KYLL.MVNQLDYEFNQGE...........................................
Q23AE3_TETTS/242-771SFGTVSQALCAALGLLLR.EYVV.MINQLDQEFQKAE...........................................
SPC97_YEAST/62-688SFGMVLQRFAYEIRRFLEDVYLKTLVERLERDFNKVPN..........................................
Q6FQY5_CANGA/70-712SYGCILHRLTYEIRKFLKDGYLRFIVERLEKEYSSNVS..........................................
Q756H1_ASHGO/63-723RYGTVLHRMCFVVRRFLTDDYLPFVVGKLERWFQEDAR..........................................
Q6CXD9_KLULA/57-697RYGRVMHRLGHEVRIFLYENYLS.CIKELEIRFQQDVK..........................................
Q6BGV8_DEBHA/61-751EFGKVVQRLCFAISEFLI.VYQQ.VIKHIEDEFKFNST..........................................
Q59PZ2_CANAL/94-759KFGKIVQKFCSEVRKFLS.SYQQ.VLINVEHEFKFNKN..........................................
Q6C787_YARLI/102-681RRGLVNGALAASIRKLLK.EYVK.LAQGLEYSLRFESG..........................................
ALP4_SCHPO/74-693EYGFVNHALCAALRKFVM.DYVV.LIMQCENQSRIDPN..........................................
Q4X128_ASPFU/183-784EYGAVNHALCATIRRILK.DYLI.LVAQLETQLLNHSN..........................................
Q7S902_NEUCR/140-744EFGAVNHALCASIRRYLH.EYLV.MVVQLETQFLNDEN..........................................
Q0V2V1_PHANO/184-787EYGAVNHALCAAIRRLMK.DYLT.LIAQLEHQLLTNDS..........................................
Q5KPG7_CRYNJ/181-812EYGMVSHALCSGIRAMLK.EFRV.LTAQLESLFLTSPT..........................................
Q4Q0X5_LEIMA/136-766SCSLVLMALGEVVSEINT.SYAH.QVSKLQLWSEGRP...........................................
Q7XUI5_ORYSJ/65-1092PYSLVNQAFAAAVEKVLE.GYFC.SLNTLPASIKLRRLEGQPDIPSMT.......................PDGASYNSN
Q9VS91_DROME/97-627NCGRTRLTLATALSDQLQ.DYYD.LQSKLETDLQDKK...........................................
Q2M118_DROPS/72-608RSGRTSLALAAALNDKMQ.QYYD.LQATMETEMQQRK...........................................
Q29HV5_DROPS/23-546ALGCMGQALTCFLRKELG.AYHG.EVALLHDQVNDFKKAQLKRGFADR.......................EQEWLDSQR
GCP3_DROME/235-758AIGSMGQALISKLKEELA.NFHG.QVAMLHDEMQRFRQASVNGIANKG.......................KKDSGPDAG
Q16YQ3_AEDAE/217-729MKGNFGQGYIAALQRELT.QYYG.MLAILQEDLNRQRKERTGL.................................TGGG
GCP3_MOUSE/251-761SFGLVGQSFCAALHQELK.EYYR.LLSVLHSQLQLEDDQGVN..................................LGLE
Q1K720_NEUCR/225-737.NGLLGQSLRAAISKELR.SYLT.LVATLETQIRRALSELDESAP.............................RGGIGK
ALP6_SCHPO/196-713DQSLALQSLKSVISKELT.NFLA.LIASLDSQIRADASLE.......................................K
A0A0D1E4X1_USTMA/283-861ASGLIMQSLCHFISKELT.GFYR.LVASLEAQMSNGSKNSPGLAQDANV.....................AAGVGSDAST
Q5KL44_CRYNJ/148-724KGGMIEQSLCHFLHHELS.EYHR.LLAVLESQMNTASSSGE....................................QPD
GACP3_ARATH/192-713DVGTVGQAFCAALQDELS.DYYK.LLAVLEAQAMNPIPLVSES.................................ASSN
SPC98_DICDI/112-705KTGLTNQSFCSAINDELI.ELYR.IIAILETQVYKKFDMVNYGGGGGGSGGSGSGSGLESPSSVSSGGTTTSTEIPFIDG
Q383E4_TRYB2/204-700ERSFLQQSLRGAVRRHLS.QYHT.LVASFRGRQTPP............................................
Q6FLE0_CANGA/180-724PISPMKKAFIIAVGSELN.TYNG.LINQLASNDKI.............................................
SPC98_YEAST/187-740NISPMKKALIIEISEELQ.NYTA.FVNNLVSSGTV.............................................
Q74Z68_ASHGO/190-740SLSPLKVNFLTVVSERLR.EYSR.VVNQLSSSIAS.............................................
Q6CIT0_KLULA/175-721TTSTLKVAFLTLIQSKLR.DYSN.FVNNFSSHLHPL............................................
Q6BX70_DEBHA/183-753IVSPIKTAFLRSLESELN.YYVNHINEYFNTEP...............................................
Q4U9K6_THEAN/45-615.TGVICESITAEFVEILE.DLQE.CVTRFHDIHITSF...........................................
Q4N294_THEPA/45-610.TGVICETITAEFVDVLE.DLQE.CVSRFHDIHITTF...........................................
A8BD62_GIAIC/283-863EYGRIANAFSQALRCIIK.EYDF.YLADLSKKHYGKMQSSA.....................................ER
Q0UGY4_PHANO/31-649HPSTVCRAVAAAVTSHHLESFQR.KILDVESRILKQDASTV....................................GAY
Q2H2M0_CHAGB/4-638HPSVICRAVASAVDALHLAAFRR.KVRAVEETLLRRDAALV....................................GAY
Q2UDA7_ASPOR/4-644HSSVICRAASTAISTQHLGDFQR.KVLEVEKSILVEDSGYV....................................GGY
Q0CV34_ASPTN/4-641HPSVVCRAVSTAISKHHLGNFQK.KILEVEEAILTEDSGYV....................................GGY
Q4WZU3_ASPFU/32-668HPSIICRAVSSAINAHHLGGFQR.KILEVEKAILAEDSAYV....................................GGY
A1C7R2_ASPCL/32-668HPSVICRAVATNISAQHLGNFQK.KILDVEKAVLAEDSAYV....................................GGY
C8VMB1_EMENI/4-637HASVICRAVSTAIRSHHLGAFQK.KILEVEKAILVEDSGYV....................................GGY
Q5KH00_CRYNJ/4-686KLNQYLVTLAASIIEVLN.GYEL.LIVETEAKVLSFDPAVVQ...................................DQQ
Q584R6_TRYB2/3-521TDGLYISAIASAVVQILR.SYEE.SVRAA...................................................
Q0IG23_AEDAE/4-557PQGLYLQAFADGLDLAVK.PYRD.LIVHLEAYY....LK........................................R
Q7PWU6_ANOGA/4-573PQGLYLQAFVDGLELVVK.PYRD.LVVELEAKY....LK........................................R
GCP4_DROME/4-548LHGYYLLNLAKGIEMALE.EYYA.EIGRLEKYC....LG........................................N
GACP4_ARATH/4-645KPSVYRRAIANGIGEILS.VYRS.AVLHIEQKL....LA........................................E
Q60F24_ORYSJ/4-649KGSAYRRAIANGIAEILS.VYRS.AVLQVEQNL....LS........................................D
Q05AR5_XENTR/4-571LHGIYLRAFCRGLDSILQ.PYRQ.ALLDLEQEF....LA........................................D
Q01B37_OSTTA/4-547SGSLYRRALASGVDEILD.AYEA.KILKLEQDA....LRR......................................RG
A0C933_PARTE/4-693EKSSYIKALVFGIDNSLN.DYRQ.TILTLEQEYLNEKM..........................................
Q24CL5_TETTS/4-831GNSAYLKGFCLGLEQIIN.SYRE.KIIEIERDF....LE........................................N

PF14609

MOD21_SCHPO/60-677--ITEDSEEETFNG--NANEITIPANI.HIPIIEESDNASNNKLC-----------------------------------
E4WX70_OIKDI/53-731--VTKSEESEEETD--ENERKNEASGFPEIPT..KFKNFEKIDRI-----------------------------------
B6K1F8_SCHJY/48-653--VTFYEETPPVIP--DNENIQDPQYYPHAKVSEHTEDYAYQQYE-----------------------------------

PF04130

Q2UAG9_ASPOR/234-750IAVSLLQLYESVLR..ESKLLLLLAEIV............SNLRHDAS................................
Q4WEE6_ASPFU/229-741FSVSLLQLAEDVRT..ASAMLVLLADLI............SNLEYDSP................................
A1C564_ASPCL/237-752VSISLLQLAEDVRN..ESRMLVILSDLI............SNLQCNAS................................
Q5AUB0_EMENI/232-744VAVSLLQLLDDVQR..ESKLLTLLADLV............SNLDRTA.................................
Q0UBK8_PHANO/224-738AAVSLLQLHTEVRS..MSAPLLRLAHLT............SDVEV...................................
Q2HBB4_CHAGB/228-739VVVSLIGVLGELGP..KLAPLYGLADIV............RQVQQERN................................
Q1K6Z8_NEUCR/239-749VIVSLVAMLAELGP..SLAPLYVLSGIV............QQVHRERN................................
F4HUK8_ARATH/48-872VTPTLLGLTSSLSS..LCSDAEYLFQVVRGAIPHAYFESSSAIST...................................
Q6H548_ORYSJ/50-922RTITLLGLTDSMSS..LCSGAEHLYQVVQGAVPDAFWNSGAQMAS...................................
GCP5_MOUSE/273-942.TITLAIVVNKLAP..RLAQLKVLDKVF................STGVAE..............................
F1QBQ4_DANRE/270-933.TVTLSSVLERLSP..HLAQITMLHRVF................CTGVAE..............................
C3ZYG0_BRAFL/302-1685.LITLSTMMGTLQE..QFGDLEMLYTVYQLGVVSPSTDKTNDVLKASRLLSVLYQNILQYNTLGDAANTKYNTLGDAANT
Q7PX58_ANOGA/302-918KTHTIIKLFHELEP..ELFVLKKLYDIH................KFSVL...............................
A0A0D1E2A2_USTMA/319-997RYTTLTQLINFSYS..KAASVLLLARLLKDMGFISGHGGDTDVSLIPRGS..............................
Q9VTS3_DROME/266-1244..DSLFQLLNNTST..AIQLLCQLDRMF................ENEPR...............................
Q2M0Y2_DROPS/276-1186..ESFSQLLMSAQP..AMRLLQHLERMF................ETEPS...............................
Q17IM7_AEDAE/330-1376..KSLLQLQRNTDP..MRKQILALAKFC................GIHPN...............................
Q0UQH9_PHANO/170-704..RSLIQLQHQFSK..PREVLLHVARMV............DATQH...................................
Q5BEM5_EMENI/175-843..SSVLQIRALFQR..CAELIGVLVNMM............DAVET...................................
Q2UCE2_ASPOR/176-851..LSLIQVRALFQR..CGELAGVLADLV............EAVEG...................................
Q0D0R6_ASPTN/174-839..VSVLRIKSLFEP..CREIVAALANII............ESIEG...................................
A1CPI0_ASPCL/179-855..SSLLQITSLFER..CGELVHALATIV............EAVEK...................................
Q4WSG8_ASPFU/170-850..SSLIQIMTLFQR..CGDLVGALSNIV............EAVQK...................................
Q2H076_CHAGB/195-897..RSILQLQSVVQP..ARSILLYFKGLV............KKLAQ...................................
A0A0D1BZI3_USTMA/198-1067KCSAVLNAHAELET..CFAVLKNLGNLL................SCGQPRT.............................
A8BFK8_GIAIC/197-740..MTLVELTAVANL..IREEISTLAVIADNCLYDKSLTSPQ.......................................
A2E6U4_TRIVA/44-540..KSLPVICINISK..SAEFLDVLSEIV............TKIEN...................................
GACP2_ARATH/70-583..LSIQGLWFYCQP..MMGSMRALAAVIQQA......STKQ.......................................
Q0JBZ2_ORYSJ/73-597..LSVQGLWFFCQR..MMSSLNALAVLVEKA......ISNN.......................................
GCP2_DROME/204-721..LTLQKLLYYLQP..TMWVMHEVWSSLVII......QLSD.......................................
Q29G36_DROPS/282-800..LTVQKLLYYLQP..TIWVMEELWTTLVNV......QLNE.......................................
Q16HU4_AEDAE/210-728..LTFHKLLYFLRP..VFHTMEVLAETVTAI......RQTN.......................................
Q7Q703_ANOGA/248-764..LSLQRLIQFLKP..VYPTMEELAATVSEI......RRSN.......................................
GCP2_MOUSE/220-738..LSLQKLWFYIQP..AMRTIDILASLATSV......DKGE.......................................
SPC97_DICDI/430-1044..LSLQRMWFYLQP..TIKTFEILYRVTSEI......MRCN.......................................
A0BDB2_PARTE/150-660..ITLQKFWYYTQP..SIRIINSIYVLIQS........LSK.......................................
Q23AE3_TETTS/242-771..LTLQKLWFYIQP..SLKVMEALYKLVSE........TEN.......................................
SPC97_YEAST/62-688..FSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNES.....................
Q6FQY5_CANGA/70-712..FSIRDMEHMINDYELSKKMEILYNLCLRLNEEMNRRLNMNLDQEDFNNFKRELEDV......................
Q756H1_ASHGO/63-723..FGIRIMEQLLNE.EIIYKARLLYELVMCVVNEMERRDKVDLAEADFENFIQDLKMGSDAG..................
Q6CXD9_KLULA/57-697..FSIRDLEMVLED.GFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDT.....................
Q6BGV8_DEBHA/61-751..FNLSIFETILNQ.ELSLKLSHFYDIVIAVHTETIERSKYKHQTSESYFNNFIKSIQND....................
Q59PZ2_CANAL/94-759..FNLNMLDSLLHQ.EISNEMTHLYQIGIEISRITEERQKMSQ.AEIMGNFEPTTLANTS....................
Q6C787_YARLI/102-681..LTLHKFHLKLMT..IGGILHETHELAKDILREDEVRFHNATLEPSNDLDALLAKFREN....................
ALP4_SCHPO/74-693..FSLQTLRLYTLP..TSRSLRQVYLILRDLLLSMEKNASSSDDLGLSNIDDLLEQLNE.....................
Q4X128_ASPFU/183-784..FTLHMLHLHTMP..TSQCLSQLYSLGQELLRRNGLLDQDIDESIDDFDDVDNILEQL.....................
Q7S902_NEUCR/140-744..FTLQQLNVHILP..SSHLMAHMYGLALELLKRNALLDDDSDESSDSSDDDFDHIIEQ.....................
Q0V2V1_PHANO/184-787..FTLHVLNLHTKQ..TSHMLFQLYTTGIELLKANDILEDDKDEDSADDDSNDFENI.......................
Q5KPG7_CRYNJ/181-812..FTLQTLYLHLHP..TLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLGGMAEELGLGGAG.................
Q4Q0X5_LEIMA/136-766..MPLMGVVSEILR..VGHHVVRLRQVLPMDLICSALAEAAAAAADPTSS..............................
Q7XUI5_ORYSJ/65-1092SEITLLEVYLHTEE..LRRHIKSLGNICFPKFAGLSLCQEGLTTDSNLGF..............................
Q9VS91_DROME/97-627..LDLKDLVRQVRP..WLPILKTFSNMA...........SS.......................................
Q2M118_DROPS/72-608..LFLKDLVRQLRP..WVGILKVFSSMV...........TS.......................................
Q29HV5_DROPS/23-546EQVTLFKLLVWYTK..PLHRMQWLTKIA............HSCMM...................................
GCP3_DROME/235-758DEMTLFKLLAWYIK..PLHRMQWLTKIA............DACQV...................................
Q16YQ3_AEDAE/217-729DRLTLKKLRLWLTS..PMERLQWLAQIS............ESCKE...................................
GCP3_MOUSE/251-761SSLTLRRLLVWTYD..PKIRLKTLAALV............DHCQG...................................
Q1K720_NEUCR/225-737TGVTLKRCVVWTRE..ATMGLRLMSLIA............EESKN...................................
ALP6_SCHPO/196-713PMVTIRRCIAWTQV..AKLKLRILSSVV............NDNMN...................................
A0A0D1E4X1_USTMA/283-861AYVTLKRLSLWTDE..MTLRFRLMSTIV............ESCQD...................................
Q5KL44_CRYNJ/148-724SGLTLLRLRLWTED..MKLKLKQMSTIV............DEAKN...................................
GACP3_ARATH/192-713NYLSLRRLSVWFAE..PMVKMRLMAVLV............DKCKV...................................
SPC98_DICDI/112-705DSLTLIRLFVWIQS..PLKRLKVLGTCV............DSITV...................................
Q383E4_TRYB2/204-700..MAFGDLVVAFKR..VQPKLRVLHTML............KETEN...................................
Q6FLE0_CANGA/180-724..STNNGVYVSIYD..SINKLRVFYSIM............LKFEG...................................
SPC98_YEAST/187-740..VSLKSLYREIYE..NIIRLRIYCRFT............EHLEE...................................
Q74Z68_ASHGO/190-740..ESVKSIYIQIYT..QILVFRFYHGYL............ERFEQ...................................
Q6CIT0_KLULA/175-721..DPLCFTYQHLYP..EVLKLRTYMEYI............ENFEK...................................
Q6BX70_DEBHA/183-753..TSLIAVYNALFP..FILKLRLLYSLT............NELNL...................................
Q4U9K6_THEAN/45-615..LGLQKLLNYLRP..SMQTLSTLASLVTEFDSKRLIDNNSNIGV...................................
Q4N294_THEPA/45-610..LGLQKLLNYLRP..STQTLSTLASLVTDFDTKRLTDDNSNIGV...................................
A8BD62_GIAIC/283-863GSLSLQTLEVKTKQ..IHIILENVADLC............SRLGV...................................
Q0UGY4_PHANO/31-649NIVPLAGIVGEFSE..WIRLLEWLWELSTFMLSPHVQPNAEKGLV...................................
Q2H2M0_CHAGB/4-638DIVPLTAVVAEFAG..WARRLEWLAGVVAVMVGGGGSGSGSGSGSGSGSGG.............................
Q2UDA7_ASPOR/4-644GIVPLSTIVGEFSP..WTRRLEWLWEVARFILPNHKKANNQS......................................
Q0CV34_ASPTN/4-641GIVPLSTIVGEFSP..WTRRLEWLWEVARVIKPEQPQSKSHG......................................
Q4WZU3_ASPFU/32-668GIVPLSTIVGEFSP..WTRRLEWLWDVTRFVLPENRTSSAHG......................................
A1C7R2_ASPCL/32-668GIVPLSTIVGEFSP..WTRRLEWLWEVVHFIIPEQGTGSAQG......................................
C8VMB1_EMENI/4-637GIVPLATVVGEFAP..WTRRLEWLWEVVRFILPTEKKKHTQS......................................
Q5KH00_CRYNJ/4-686GYVPLASIVATFDR..WRAPLTALSQIVDQLSSFDEREDSWSPGR...................................
Q584R6_TRYB2/3-521..VTPSSVVSLRPT..YFLAFSLIMEMV................Q...................................
Q0IG23_AEDAE/4-557PNLSLIFIYHQVNQ..YQSLFGFLLRLV............SGVVT...................................
Q7PWU6_ANOGA/4-573PNLSLMFIFHQVSQ..YRSLFGFLLQLI............SGVVT...................................
GCP4_DROME/4-548ERNSLSYVYNALYA..KFPLLVFMRNLI............TEIHV...................................
GACP4_ARATH/4-645TTPILATVTEGLNK..FFVLFPPLYEVI............LEIER...................................
Q60F24_ORYSJ/4-649PLPILATVTHGLNK..FEVLLPPLHELV............MEIEQ...................................
Q05AR5_XENTR/4-571PHLSISHINYSLDQ..FHLLFPSVMVVV............EQIKS...................................
Q01B37_OSTTA/4-547DAGTLSSIESELSE..ERAVIPALMELF............GEVLD...................................
A0C933_PARTE/4-693..FIVSQLNVRLQA..YYQILLNLHTSI............NIIQQ...................................
Q24CL5_TETTS/4-831RVFTIASLKIKLTS..HFDILPDLHKIV............IKIVE...................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685KVCTILKASRLLSVLYQNILQYNTLGDAANTKNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVC
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685TILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQ
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942...............................................................................V
F1QBQ4_DANRE/270-933...............................................................................V
C3ZYG0_BRAFL/302-1685YNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKYNTLGDAANTKVCILKASRLLSVLYQNILQYNTLGDAA
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067...............................................................................P
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688......................................................................SLHLRLMVAF
Q6FQY5_CANGA/70-712........................................................................GQAILLPT
Q756H1_ASHGO/63-723...................................................................ATGDSSTNGILIT
Q6CXD9_KLULA/57-697......................................................................NDELDLRVLY
Q6BGV8_DEBHA/61-751.....................................................................LKETGSIDLAT
Q59PZ2_CANAL/94-759......................................................................MNGINSEPNL
Q6C787_YARLI/102-681.....................................................................SVEIDTRGYGI
ALP4_SCHPO/74-693......................................................................GNDISHVVNA
Q4X128_ASPFU/183-784.......................................................................KEGGDLIPG
Q7S902_NEUCR/140-744......................................................................LRDGGDLVPG
Q0V2V1_PHANO/184-787.........................................................................LESLREG
Q5KPG7_CRYNJ/181-812...................................................................LKGLMKNLKAREG
Q4Q0X5_LEIMA/136-766...............................................................................T
Q7XUI5_ORYSJ/65-1092...............................................................................E
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638..............................................................................GG
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677----TLFKKSKQPNLDFLQIKPFMFWDSSLNETVRISERSIIRD.SIYMLIGYPSFFFLKNGSKIETRLSLLP....KLH
E4WX70_OIKDI/53-731----YIFEEEAQKIADKYPEKK..........VYRIGEQPWKGEKTIGKLYG..............EILDHVP....VND
B6K1F8_SCHJY/48-653----DPVSHASETLLQRILEKE....SSGTPQLLQLSQQSMLYE.IIYMLMGYQGHIF....TCVEGVFRPAPFDYFQIQ

PF04130

Q2UAG9_ASPOR/234-750..DSPVR......CLDLLYDSVCMT..QATGD.ENE.FK..FLAQLFFSCFE--------------------T----YAR
Q4WEE6_ASPFU/229-741..DDGVR......CLDLLYDVVCMK..QATGD.DVE.FT..FLAKLFFSCLE--------------------T----YIR
A1C564_ASPCL/237-752..GNCVR......CLDLLYDSVCLN..QATGD.DSE.FK..VLAGLFLSCLE--------------------T----YMR
Q5AUB0_EMENI/232-744..VDSVQ......CLDQLFDLVCIT..QAAGD.DEN.FA..RLAEIFFASLE--------------------T----YAR
Q0UBK8_PHANO/224-738....ALLVNPFS.HLEALFDQINLA..QMTLE.IRS.FQ..YLSSVFFDCLQ--------------------T----YLK
Q2HBB4_CHAGB/228-739..PHAFR......YLELLYDAAGIA..QLQGS.TAT.YR..LLGTIFFDCFQ--------------------V----YLK
Q1K6Z8_NEUCR/239-749..TKAFH......YLELLYDAVGMA..QMEGS.LDT.YR..LLGTIFLDCFQ--------------------V----YLK
F4HUK8_ARATH/48-872.......AEIAVHVLDYLYKRLDEVCLVQGGELVAV.EGFHMLLQIFAGSLL--------------------P----YVE
Q6H548_ORYSJ/50-922.......SEVAVHAVNHLFKKLNEVCLVEDGE...G.EPYHMLLVIFAGTLL--------------------P----YLQ
GCP5_MOUSE/273-942PPDTRNVVRASH.LLNTLYKAILEY..DNVGE.ASE.QTVSLLFSLWVETVR--------------------P----YLQ
F1QBQ4_DANRE/270-933PPGTPNVLRASH.LLNTLYKAIIEY..DSVGE.ASE.QSVALLFSLWVETVR--------------------P----YLE
C3ZYG0_BRAFL/302-1685NTKVCTILKASR.LLSVLYQNILQY..NTLGDAANTKLP..LLLPLWIQTLR--------------------P----YLE
Q7PX58_ANOGA/302-918DWTKFPAHIAVAHLLSGLFRSVKLSANLEKGN.........LAFALLLAALK--------------------C----YMN
A0A0D1E2A2_USTMA/319-997SDRALID......GLQALLAFVHQQDELAHGDMILT.....DLSTCLLAACR--------------------P----AWR
Q9VTS3_DROME/266-1244.LNLNTGITGSF.LLSSIWLAIDTCGNKDFLH.........LLIYFLRCISR--------------------N----YFI
Q2M0Y2_DROPS/276-1186.LNLHSGVSGTF.ILASIGSAIDTCSNTDFLQ.........LLMYLLKCMCQ--------------------T----YFA
Q17IM7_AEDAE/330-1376.YESDKEFPTGSVFLDHLYKEIIHITSSDVST.........FLLHILKHCCN--------------------A----YFL
Q0UQH9_PHANO/170-704.......AKTNEQLASILHHRLLEL.....EDGDTDIRQ..LSSRIMCEVAK--------------------P----SLE
Q5BEM5_EMENI/175-843.......AGSEARIISSVFKLAAHYAQIYGQM.....ES..LFREIVFKVAQ--------------------P----WLT
Q2UCE2_ASPOR/176-851.......VVSDAQIFSIVLEKAAHYSQTFGHM.....ED..LFREIVIRTVY--------------------P----FLK
Q0D0R6_ASPTN/174-839.......PTTESQIISIVLARAAHFSQTFAHM.....EN..LFREIATRVAR--------------------P----FLD
A1CPI0_ASPCL/179-855.......AVSDAQVISVIIKKAAHFAQTLSSM.....EN..LFREIVARAIT--------------------P----WLH
Q4WSG8_ASPFU/170-850.......AASDAQVISAVIEKAAHYSEAFGSM.....EN..LFRELVARVIA--------------------P----WLQ
Q2H076_CHAGB/195-897.......ETSDEGMLSCLFQEAQAS.....EYRDGLIED..VTREVLRVLSQ--------------------P----WIE
A0A0D1BZI3_USTMA/198-1067PFRPLTWLESTHATLSHLHAHLAASLASGASSLPSA.....VLAYLLDRTSV--------------------T----WRQ
A8BFK8_GIAIC/197-740.............ILNIIFGYSLH......GD.RKM.HH..IGQSLLIKASE--------------------P----FFD
A2E6U4_TRIVA/44-540.......LKGPK.ICTIIHQAISTN....RGL.PYI.RE..PLTALFNQSVQ--------------------P----ILE
GACP2_ARATH/70-583.......FVGSG.VLNLLQSQAKA....MAGD.NSV.RS..LLEKMTECASN--------------------A----YLS
Q0JBZ2_ORYSJ/73-597.......TSGSA.TLNLLQSQAKA....MAGD.SAV.RS..LLEKMTECASA--------------------A----YLR
GCP2_DROME/204-721.......SRDAE.VLTYLHERIKR....LEGN.KDA.QQ..LIIGLVRKAAK--------------------P----YMR
Q29G36_DROPS/282-800.......FQGAA.VLTHLHGRIKR....LEGD.RAA.QQ..IMIKLTHQAAE--------------------P----YMR
Q16HU4_AEDAE/210-728.......CRGGT.VLTLLYDKIIA....TTGD.EKS.RK..VLIHLIEMAAV--------------------P----YME
Q7Q703_ANOGA/248-764.......ARGGQ.VLSLLHDRITA....KSGT.NHA.QK..VLVHLVESAAA--------------------P----FME
GCP2_MOUSE/220-738.......CVGGS.TLSLLHDRSFN....YTGD.SQA.QE..LCLYLTKAASA--------------------P----YFE
SPC97_DICDI/430-1044.......SHGVQ.VINLLLKLQSK....YSSD.KKT.DD..LFHYLIKATTL--------------------P----FLE
A0BDB2_PARTE/150-660.......QIGGT.LLSTITHFINT.....STD.PQI.VE..VYSFLLQKSFL--------------------P----YMK
Q23AE3_TETTS/242-771.......YKGGE.LLSKLYDLLKNTSDKQIVD.........IYYYVLQKSFA--------------------P----YVQ
SPC97_YEAST/62-688DTTVYPVPKGGA.ILKIFQQKILEN....LGD.RSS.VM..FLKKLLNNISQ--------------------D----YCT
Q6FQY5_CANGA/70-712DSSLSLTPKGGN.IIKVVQEMIAET....LGD.RNG.VQ..FLKDILNKIGE--------------------G----YLK
Q756H1_ASHGO/63-723DTRVSPVAKGGV.VLQMVLEKMKQN....WGD.QRN.LQ..FLHQVWQDISA--------------------P----YCE
Q6CXD9_KLULA/57-697DTRVSLFVKGGS.LIIIVQQIMEQE....QGD.IRH.VE..FLSLICDSLNR--------------------V----YGQ
Q6BGV8_DEBHA/61-751DNVNFEFCKGGI.LLKIIQDRINAY....QGD.VIS.LE..FLTKIFDVVSI--------------------D----YVS
Q59PZ2_CANAL/94-759YYGKFDCCKGGL.LLQVIQERMVYY....KGD.PTS.LD..FLTQLFDIVSS--------------------D----YIG
Q6C787_YARLI/102-681SLNGSSMCRGGI.TLKVIAERLNA....HSGD.PTA.NQ..LLTRLLNDASK--------------------P----YLQ
ALP4_SCHPO/74-693TRSKKKVCKGGQ.VISFLTESLTK....YAGD.PVA.RK..ILTYLLREASR--------------------P----YTK
Q4X128_ASPFU/183-784AMSSKKICKGGN.VLRLLTERLAT....FSGD.PTT.KT..LLEKLLRDASR--------------------P----YMA
Q7S902_NEUCR/140-744NMTGKKICKGGV.VLGLITKRLES....LSGD.PSA.RV..LLTTLLRDASR--------------------P----YMA
Q0V2V1_PHANO/184-787GNATKKLCKGGS.VLGLITKRLSS....MSGD.PAA.RT..LLTTLLREASR--------------------P----YMA
Q5KPG7_CRYNJ/181-812LIGDGGDVLGGE.VLGIICEREAT....MSGD.PTA.ST..LHSSLLLHASQ--------------------P----YCK
Q4Q0X5_LEIMA/136-766FASPSTGLVGPR.ILNHLCDQVNKY........SGSCEDHELLTLLLRRSLV--------------------P----YLR
Q7XUI5_ORYSJ/65-1092NFPWSTD......LLSYLYVHLRDADSVHYG..........LLKYLFVRSCE--------------------P----YCN
Q9VS91_DROME/97-627.......ARGNLTSAQVLTLLDQFYRDLKDTD.IDL.KE..RVNKILTSTSR--------------------A----YMK
Q2M118_DROPS/72-608.......ARGKKTSAQILSDINEIYEKLKPSD.LEL.KE..LLEKILNSVSS--------------------V----YMK
Q29HV5_DROPS/23-546.......KKGGE.LTSVVWDFLDN......GH.PAV.DK..LVIDLLTAMCR--------------------P----LTR
GCP3_DROME/235-758.......KKGGD.LASTVYDFLDN......GN.DMV.NK..LVEDLLTAICG--------------------P----LVR
Q16YQ3_AEDAE/217-729.......LKGGA.LATIVYDYTAN......GD.PEN.RR..LAMELLRSACI--------------------P----LQQ
GCP3_MOUSE/251-761.......RKGGE.LASAVHAYTKT......GD.PYM.KS..LVQHILSLVSH--------------------P----VLS
Q1K720_NEUCR/225-737.......KHGGQ.LVTLIHNFSSS.....HGD.PVV.AA..FAERLLVDVTR--------------------P----FYD
ALP6_SCHPO/196-713.......QENKKRLIQVVSKYNVH......GD.PLI.QE..LSDKILTEITG--------------------P----LYE
A0A0D1E4X1_USTMA/283-861.......AHGGL.LVSLIHSYTFN......GD.PFI.RK..FTSGLLDEVSK--------------------P----FFN
Q5KL44_CRYNJ/148-724.......THGGA.LVSKLHSHTSN......GD.PLI.RN..FTTQILEEVSK--------------------P----FFL
GACP3_ARATH/192-713.......LRGGA.MAGAIHLHAQH......GD.PLV.HD..FMMSLLRCVCS--------------------P----LFE
SPC98_DICDI/112-705......DMKGGE.ILSKIDTLSKH......GD.QDI.RI..LIHNIMFKICQ--------------------P----LFS
Q383E4_TRYB2/204-700.......VKGGE.LASKLQRLVQQ......GS.RRL.CA..LLSDVYMEAVS--------------------P----LLH
Q6FLE0_CANGA/180-724.......LTGDQ.LLSLLEQL......RHHGD.LTI.EN..IADKLFSTLLT--------------------L----YYD
SPC98_YEAST/187-740.......LSGDT.FLIELNIF......KSHGD.LTI.RK..IATNLFNSMIS--------------------L----YYE
Q74Z68_ASHGO/190-740.......LRGDQ.LISEFDSL......RQHGD.PLV.KN..LAEEIFSTLID--------------------L----YME
Q6CIT0_KLULA/175-721........SSAEGLLSVCQLQ......KSNGD.PVL.EK..FASDALERLLQ--------------------P----YMK
Q6BX70_DEBHA/183-753........SGYE.FLSKVYHL......SKFGD.IRI.KD..LTHNIFSQISA--------------------P----YYE
Q4U9K6_THEAN/45-615................LILDSLDFRCRSEVGS.KKL.....LLQHILNSVLD--------------------S----YSL
Q4N294_THEPA/45-610................LILDSLDFRCRSEIGP.KKL.....LLQHILNSVLD--------------------S----YSL
A8BD62_GIAIC/283-863.......VRGCA.LLQQLETAVLQSSGLSVKE.........VFQYLLSESLK--------------------P----LGR
Q0UGY4_PHANO/31-649.....GASSGAQ.VIDKLRMEAQT......GH.PTI.EE..AANQLGDVAET--------------------S----WLR
Q2H2M0_CHAGB/4-638SGGGEAGCTGAR.VMDFLRGELQT......GY.RDV.EE..AAGSLVGVAEA--------------------A----WVK
Q2UDA7_ASPOR/4-644.......CTGAA.LIDYLRAESQT......GY.IDI.GE..MALHLISAAET--------------------A----WMR
Q0CV34_ASPTN/4-641.......CTGAA.LIDFLRAESQT......GY.QDL.EE..MALHMIGVAEV--------------------A----WMR
Q4WZU3_ASPFU/32-668.......CTGSA.LIDYLRTESQT......GY.LDL.EE..IALHLITVAES--------------------A----WIR
A1C7R2_ASPCL/32-668.......CTGAA.LINYLRTESQT......GY.VDL.EE..MALHMIATAET--------------------A----WMR
C8VMB1_EMENI/4-637.......CTGAG.LIDHLRRESHT......GY.IDI.EE..IVLDLIGAAET--------------------A----WMR
Q5KH00_CRYNJ/4-686.............LIDLILLKSQT......GN.PFL.QN..IFSNLAKSLQD--------------------L----FLT
Q584R6_TRYB2/3-521......QQKNADLLLVTIQSFLSN.........REIPQK..FRLWMGEAVWM--------------------S----LLY
Q0IG23_AEDAE/4-557.....QRIHGCA.LLQYLQQNCLH......GN.EKH.YQ..AVKLIQNAVYA--------------------I----FIK
Q7PWU6_ANOGA/4-573.....QRIHGCA.LLPYLQQHCLH......GN.DAN.YQ..AVKTIQKSVYV--------------------I----FLK
GCP4_DROME/4-548.....LNLRGCV.LLHNLHQQCEH......GD.IQL.EK..AIKIIMKPVKN--------------------A----FFS
GACP4_ARATH/4-645.....DDIRGGQ.LLNVLNKRCHC......GV.PEL.RT..CLQRLLWNGHQ--------------------V----MYN
Q60F24_ORYSJ/4-649.....KDIKGGQ.LLNLLHKRCHC......GV.PEL.QS..CIQRLLWHGHQ--------------------V----MFN
Q05AR5_XENTR/4-571.....QKIHGCQ.ILETVYKHSCG......GL.PPV.RS..ALEKILAVCHG--------------------V----MYK
Q01B37_OSTTA/4-547......GARGVS.GAEVLRRARDAW..LRAGH.PAT.RA..ACERLYWRATQ--------------------V----MMQ
A0C933_PARTE/4-693.....HNMRGGQ.ILDYLYERTLT......GN.DKL.QL..IYQNILSACYE--------------------V----LFQ
Q24CL5_TETTS/4-831.....ENLKGGQ.LLDLMHSKSQT......GN.TAL.RE..VYQILTDQCYS--------------------V----LYQ

PF14609

MOD21_SCHPO/60-677HMSEEILR--------S--IMTE---------LADYGSN---------------------------------------LE
E4WX70_OIKDI/53-731TLEYWIEQ--------T--NLLH---------KKGFGKG---------------------------------------FD
B6K1F8_SCHJY/48-653GLSTSMQE--------H--ILSN---------FCNWGRE---------------------------------------LH

PF04130

Q2UAG9_ASPOR/234-750PIRLWMEK........G..ELEETV.......QGSFFIR.........................................
Q4WEE6_ASPFU/229-741PIRRWMEE........G..RLDP.R.......EGVSFII.........................................
A1C564_ASPCL/237-752PIHRWMEE........G..QLDS.R.......QGTFFII.........................................
Q5AUB0_EMENI/232-744PLYRWMET........G..QLED.S........SLFFVS.........................................
Q0UBK8_PHANO/224-738PIRKWMEA........G..ELGA.N.......DETFFVF.........................................
Q2HBB4_CHAGB/228-739PIRLWMEE........G..KLLP.G.......DRTFFIS.........................................
Q1K6Z8_NEUCR/239-749PIRFWMEE........G..ELLA.G.......DRTFFIG.........................................
F4HUK8_ARATH/48-872SLDSWLFE........G..TLDD.P.......FEELFFT.........................................
Q6H548_ORYSJ/50-922CLDSWLYD........G..ILDD.P.......NEEMFFY.........................................
GCP5_MOUSE/273-942TVDEWIVH........G..HLWD.G.......AREFIIQ.........................................
F1QBQ4_DANRE/270-933IVDEWIVH........G..HLFD.P.......AKEFIIQ.........................................
C3ZYG0_BRAFL/302-1685IIDGWVNK........G..NLID.P.......AMEFIIQ.........................................
Q7PX58_ANOGA/302-918MIDTWWTE........G..RLDD.W.......REEFLVEKTY....................................GE
A0A0D1E2A2_USTMA/319-997SVCHLLQRGLSFAIHRDHDLLFDDR.......LVQHMIR.........................................
Q9VTS3_DROME/266-1244QLQRWIYH........G..ELDE.S.......VNEIFISRCL.....................................N
Q2M0Y2_DROPS/276-1186QLQRWVYK........G..ELDE.A.......VNEIFIRRR.......................................
Q17IM7_AEDAE/330-1376LFQQWLFG........G..QLGD.P.......SGELFIY.........................................
Q0UQH9_PHANO/170-704LLAEWI..........G..TMKEQETI..PVTSRDSFVT.........................................
Q5BEM5_EMENI/175-843YVETWI..........G..FRPETSASIELLTNGRSFVS.........................................
Q2UCE2_ASPOR/176-851HAETWI..........G..LRLEASTLKELAANGRSFVV.........................................
Q0D0R6_ASPTN/174-839HIESWV..........G..FRSETPTSKEFARSGRSFVS.........................................
A1CPI0_ASPCL/179-855YVEAWV..........G..LRAETPGLFEATGNSAGFVV.........................................
Q4WSG8_ASPFU/170-850YVEAWV..........G..LRTETPALVDLAAKSEGFVA.........................................
Q2H076_CHAGB/195-897FVEEWV..........G..LRAENGIAMTKTGPSKGFVN.........................................
A0A0D1BZI3_USTMA/198-1067QVARWVGFPGFESDRTG..ELDDRP.............SVL.......................................
A8BFK8_GIAIC/197-740YLKHWIIE........G..SLL..........STEYFIQPTTSNSTD...........................ILILQT
A2E6U4_TRIVA/44-540YIEKWIYE........G..KIDD.P.......YNEFFIQT........................................
GACP2_ARATH/70-583ILERWVYE........G..IIDD.P.......YGEFFIAENR.....................................S
Q0JBZ2_ORYSJ/73-597MLERWVYE........G..VIDD.P.......YGEFFIAENK.....................................S
GCP2_DROME/204-721MLQMWIQK........G..VIVD.R.......HREFLVVDNE.....................................V
Q29G36_DROPS/282-800MLQLWIQK........G..VIVD.R.......NREFLVEDNE.....................................V
Q16HU4_AEDAE/210-728MLQLWIFN........G..VIHD.T.......RKEFLVEH........................................
Q7Q703_ANOGA/248-764MLELWIYR........G..VIND.P.......QQEFFIDH........................................
GCP2_MOUSE/220-738ILEKWIYR........G..IIHD.P.......YSEFMVEEH......................................E
SPC97_DICDI/430-1044MLDLWIHQ........G..IIRD.T.......YFEFMIEENT.....................................D
A0BDB2_PARTE/150-660QLSNWIYY........G..RIDD.P.......FEEFLVAEK......................................K
Q23AE3_TETTS/242-771MLSQWIYY........G..QIDD.L.......FQEFFIQENV.....................................F
SPC97_YEAST/62-688MLYEWLTQ........G..ILND.P.......YQEFMTYDD......................................L
Q6FQY5_CANGA/70-712MFDDWLIN........G..DIND.P.......HEEFMIRDMMK...................................DV
Q756H1_ASHGO/63-723MLNEWLIK........G..DLKD.P.......YEEFLISDTS.....................................Q
Q6CXD9_KLULA/57-697MFVEWMQE........G..KLND.Y.......HEEFLISDTVA...................................DV
Q6BGV8_DEBHA/61-751MLNKWLIN........G..EIDD.S.......AEEFIIKMNR....................................FP
Q59PZ2_CANAL/94-759MLNQWLLE........G..VIND.P.......FDEFMIREKR....................................VP
Q6C787_YARLI/102-681MLSRWIYQ........G..VILD.P.......YGEFCIQEN.......................................
ALP4_SCHPO/74-693MLNEWIHL........G..LVND.P.......YDEFMIKIHK.....................................G
Q4X128_ASPFU/183-784MLNEWLHH........G..DIKD.P.......HAEFLIKEQK.....................................W
Q7S902_NEUCR/140-744MLNEWLHH........G..SIND.P.......HSEFLIKEQK.....................................S
Q0V2V1_PHANO/184-787MLNEWLHH........G..GIKD.P.......HSEFLIKEQR.....................................S
Q5KPG7_CRYNJ/181-812MLIQWIAT........G..HLSD.P.......FDEFMVKESG.....................................H
Q4Q0X5_LEIMA/136-766MLQRWMHS........G..VLDD.P.......YGEFFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPSATSAGRDGE
Q7XUI5_ORYSJ/65-1092FIKSWIYR........A..SVDD.P.......YEEFLIT.........................................
Q9VS91_DROME/97-627IVQLWMQK........G..VLFD.T.......QHEFFVEDTEPS.................................STM
Q2M118_DROPS/72-608IVQLWTQK........G..IIYD.L.......QHEFFVEDSERS.................................NSM
Q29HV5_DROPS/23-546MISQWMLD........G..DITD.L.......HNEFFVE.........................................
GCP3_DROME/235-758MISKWILE........G..GISD.M.......HREFFVK.........................................
Q16YQ3_AEDAE/217-729ALIRWLID........G..EIID.P.......NGEFFIE.........................................
GCP3_MOUSE/251-761FLYRWIYD........G..ELED.T.......YHEFFVA.........................................
Q1K720_NEUCR/225-737ILRRWIYD........G..ELLD.P.......HMEFFVREQNP...................................LD
ALP6_SCHPO/196-713MIENWIYK........G..ELVD.P.......YQEFFVKEK......................................N
A0A0D1E4X1_USTMA/283-861SLSLWIYQ........G..ELQD.P.......FREFFVELNDDPRKVNQS....................RTHSNLADGD
Q5KL44_CRYNJ/148-724TLQRWIFS........G..ELHD.P.......FKEFFVQLNPENVSFREGQ..................ISPTGDVGFEM
GACP3_ARATH/192-713MVRSWVLE........G..ELED.T.......FGEFFVV.........................................
SPC98_DICDI/112-705MIRLWMFK........G..EIND.P.......YQEFFIR.........................................
Q383E4_TRYB2/204-700MTVSSIIK........G..DVSD.P.......FNEFFVK.........................................
Q6FLE0_CANGA/180-724YLSQWLTL........G..SIDN.T.......NNELFIE.........................................
SPC98_YEAST/187-740YLMNWLTK........G..LLRA.T.......YGEFFIA.........................................
Q74Z68_ASHGO/190-740YLLYWLVR........G..QLKS.T.......HDEFFVS.........................................
Q6CIT0_KLULA/175-721NICDWLID........G..KLDSNV.......SSDFFVQ.........................................
Q6BX70_DEBHA/183-753VLEHWVIK........G..ELID.N.......SDEFFIA.........................................
Q4U9K6_THEAN/45-615LINHYINFFNFSQVDFT..DF...........VTDFFIKTCE.....................................N
Q4N294_THEPA/45-610LINHYINFFNFSQVDFT..EF...........VSDFFIKINQ....................................DD
A8BD62_GIAIC/283-863IMDRYINE........A..VIPDSD.......AADFFIRKSH.....................................S
Q0UGY4_PHANO/31-649QLSTWLLY........G..RLPSFG.......AIDFFVH.........................................
Q2H2M0_CHAGB/4-638QVSAWVLY........G..RLPGFG.......EGDFFVR.........................................
Q2UDA7_ASPOR/4-644QLSTWLLY........G..NLPVLG.......KDDFFIQ.........................................
Q0CV34_ASPTN/4-641QLSTWLLY........G..NLPVLG.......REDFFIQ.........................................
Q4WZU3_ASPFU/32-668QLSTWLLY........G..NLPIFG.......KDDFFIQ.........................................
A1C7R2_ASPCL/32-668QLSTWLLY........G..TLPVFG.......KEDFFIQ.........................................
C8VMB1_EMENI/4-637QLSTWLLY........G..NLPILG.......KGDFFIQ.........................................
Q5KH00_CRYNJ/4-686HLVSFILH........G..IAPSEPLMTSPSIGRTVGVD.........................................
Q584R6_TRYB2/3-521TIGHYVAH........G.VVLHG.........RRDFFIS.........................................
Q0IG23_AEDAE/4-557QLFGWLLH........G..KFVD.Q.......FGEFFIQHVDNTKTAGIGSL................QGTTGGTGTHLS
Q7PWU6_ANOGA/4-573QLYGWLMH........G..KFVD.H.......YGEFFIQQVESSAKASIAAGG...............AAIANPPAGHTS
GCP4_DROME/4-548SLAHWLLF........G..VIDD.V.......HSEFFIKFTPTDAVDG........................SSFSKSAT
GACP4_ARATH/4-645QLAAWMVY........G..ILQD.P.......HGEFFIKRQDDGDLDHR.......................SSQEEVSE
Q60F24_ORYSJ/4-649QLTSWMVY........G..ILQD.Q.......YNEFFIRRQEDRDKEND.......................SSQVDVAD
Q05AR5_XENTR/4-571QLSAWMLH........G..LLLD.Q.......YEEFFVRQGPSSNLAA........................SSEEDDDD
Q01B37_OSTTA/4-547QLLGWCAH........G..TIVD.P.......CDEFFVRTID.....................................R
A0C933_PARTE/4-693QLSSWLQY........G..QILD.T.......SDEFFIQR........................................
Q24CL5_TETTS/4-831QLSGWILY........G..NLQD.Y.......YDEFFIYRIEQTKS............................QQSNAY

PF14609

MOD21_SCHPO/60-677FFR.QKLTSPSDSFFKSDD............-------------------------------------------QST---
E4WX70_OIKDI/53-731VMNYQVANERQCQIWLCDSCMGITENPLINW-------------------------------------------DEE---
B6K1F8_SCHJY/48-653ILN.RVASTKHCRFLPSSPS...........-------------------------------------------DIE---

PF04130

Q2UAG9_ASPOR/234-750..DNRNNDLDLRTLWHG...............WYTL.......................................DESAW
Q4WEE6_ASPFU/229-741..DQR.DDKDLRSLWRD...............WYAV.......................................DDS..
A1C564_ASPCL/237-752..DNH.NDNDLRSLWRE...............WYTL.......................................DETSG
Q5AUB0_EMENI/232-744..ANH.EKNDLRTLWHD...............WYLL.......................................ETKPE
Q0UBK8_PHANO/224-738...ESDSGSDAASLWHD...............RYVL......................................RRDAQN
Q2HBB4_CHAGB/228-739...ESPAKLPLSQIWKG...............QFNL......................................LRSPEG
Q1K6Z8_NEUCR/239-749...KSSARPQLHQIWEQ...............QFHQ......................................LVSSEG
F4HUK8_ARATH/48-872..ANQSVSVSDAEFWEK...............SYLLTRVLGPKSNVTSLNQK.....KGMSGNDSNSVSDKDKEQNNR..
Q6H548_ORYSJ/50-922..ANKAVTIDQPAFWEM...............SYMLRVRGPRTDSSSTLADNESIRKKELINQETTAAAALLKSSNQGCA
GCP5_MOUSE/273-942..RNKNVPVNHRDFWYA...............TYTLYSVSEKTENEDKVS.........DSASASSGSDQGPSSRQH...
F1QBQ4_DANRE/270-933..RNKDVPVNHRDFWYA...............TYTLYSVSEMVESEERLS.........DAASGSSGGEQTSSSRQH...
C3ZYG0_BRAFL/302-1685..RNGKVDVFHEDFWES...............AFLVSCSPMHQDDTTESSMK......EDGQEENLDDGKTDKDTRENQE
Q7PX58_ANOGA/302-918HSPTGLQTGYQARMFSKCK...........IRSFYV.......................................SS...
A0A0D1E2A2_USTMA/319-997..HDASISTSDSAFWTS...............GYVVNQPS..............................IDEVDNMVNP
Q9VTS3_DROME/266-1244TSP.SFTNQCSKEFFDK...............SYQV......................................DNE...
Q2M0Y2_DROPS/276-1186APLDRQIDECSKEFFDK...............GYQV......................................HEE...
Q17IM7_AEDAE/330-1376..FVDHYRPKTKHFFDK...............AFLI......................................RRQ...
Q0UQH9_PHANO/170-704................LEPNPL.....NEDQPEYVY......................................RSE...
Q5BEM5_EMENI/175-843.............LEKSESNGKI...SSQERHEYAY......................................LPE...
Q2UCE2_ASPOR/176-851.............LEPSEENPKT..TSQSTRLEYRY......................................NPA...
Q0D0R6_ASPTN/174-839.............LRHPEESDKQ..ISKAEMDHYIY......................................CPE...
A1CPI0_ASPCL/179-855.............TERRDGRSTSK.RSRTTTVDYRY......................................HPD...
Q4WSG8_ASPFU/170-850.............VERYEGRAGSR.SMKASSLQYRY......................................HPE...
Q2H076_CHAGB/195-897.........IVDKMWIDDQGF......ELEEADYFL......................................DED...
A0A0D1BZI3_USTMA/198-1067KSGSSSNTAHISTPWSGAVVDWSLDERGEEDVGYTL......................................KPS...
A8BFK8_GIAIC/197-740NNLLVSRSIFINSNWYN...............KFHI......................................SSS...
A2E6U4_TRIVA/44-540NDISPDIPDPHRTYWND...............HFTC......................................NEE...
GACP2_ARATH/70-583LKKESLSQDSTAKYWSQ...............RYSL.......................................KD...
Q0JBZ2_ORYSJ/73-597LQKESLTQDYDAKYWQQ...............RYSL.......................................KD...
GCP2_DROME/204-721IHRDELPEHYSDDYWER...............RYTL......................................RDE...
Q29G36_DROPS/282-800VHQGELPEHYSDDYWEK...............RYTV......................................RRD...
Q16HU4_AEDAE/210-728.HAMDLNENDMMDYWEK...............QYII......................................RTD...
Q7Q703_ANOGA/248-764.SSMELTENELVDYWEK...............QYTI......................................RNE...
GCP2_MOUSE/220-738LRKEKIQEDYNDKYWDQ...............RYTV......................................LPQ...
SPC97_DICDI/430-1044LKRDNINRDFNDLYWEQ...............RYQI......................................RQD...
A0BDB2_PARTE/150-660IQKSSLETDYKNDFWDQ...............RFAL......................................RNS...
Q23AE3_TETTS/242-771VKRDNISKDFKENYWDQ...............RFIL......................................REK...
SPC97_YEAST/62-688EGKTDNIFDTRDRAWDT...............QYFI......................................RKD...
Q6FQY5_CANGA/70-712NVTDTNAMMTTDRLWET...............RYLI......................................RKD...
Q756H1_ASHGO/63-723DNNIVLNSLNSERLWDT...............QYVI......................................RKD...
Q6CXD9_KLULA/57-697DEEKLANTIDNERLWDT...............RFVI......................................RKD...
Q6BGV8_DEBHA/61-751DNPDSPIRRNVEKYWDE...............LYVT......................................RTD...
Q59PZ2_CANAL/94-759DSFMEIFQSKSEYYWNE...............LFLI......................................KID...
Q6C787_YARLI/102-681GDLATGNEGAYDEYWEQ...............RYSV......................................RKD...
ALP4_SCHPO/74-693ITSMQLDEDYTDEYWEK...............RYVI......................................RED...
Q4X128_ASPFU/183-784IKREKLEEDYTDEYWEK...............RYTI......................................RDN...
Q7S902_NEUCR/140-744IRRERLEQDYTDEYWER...............RYTI......................................RDH...
Q0V2V1_PHANO/184-787IKRERLDQDYTDEYWEK...............RYTM......................................RDA...
Q5KPG7_CRYNJ/181-812ITKGVLESDYTDEYWER...............RYTLRDGAIPGSSKVSARN........NTPSISAGVPPPRQGTNRLPG
Q4Q0X5_LEIMA/136-766LGASGASTASQGRFGLKRRAAAQQ.DVVAFDRRFSL......................................NKS...
Q7XUI5_ORYSJ/65-1092...............QAKNKRTQG.GSSDPVDNFTL.....................................LSLKGAN
Q9VS91_DROME/97-627SSTLLAPEKCCHAYWAE...............RYRL......................................LPD...
Q2M118_DROPS/72-608SSTLLAPEQCCHAYWEN...............RYTL......................................LPE...
Q29HV5_DROPS/23-546....SLTDIGPDRLWHD...............KFRV......................................RTA...
GCP3_DROME/235-758....SIKDVGVDRLWHD...............KFRL......................................RLP...
Q16YQ3_AEDAE/217-729....EICEVGFDQLWHQ...............KYRI......................................RKS...
GCP3_MOUSE/251-761....SDPTVKTDRLWHD...............KYTL......................................RKS...
Q1K720_NEUCR/225-737EERKDAKAKGQMSVWNS...............KYEL......................................VED...
ALP6_SCHPO/196-713GSESHDHQGQGDVVWKG...............KYFL......................................DKE...
A0A0D1E4X1_USTMA/283-861MPSFGDLDGDAASLWQN...............KFVF......................................RKE...
Q5KL44_CRYNJ/148-724GMDADGGEEEAYKLWEK...............KYVF......................................VKK...
GACP3_ARATH/192-713.....GQPVKVDLLWRE...............GYKL......................................HPA...
SPC98_DICDI/112-705....QYESVQLEKTWKE...............KFAI......................................VAR...
Q383E4_TRYB2/204-700..SDPRVEDTSDTFWSS...............KFSL......................................LPD...
Q6FLE0_CANGA/180-724...VEQENTDGEVIFKL.........................................................NTD...
SPC98_YEAST/187-740.ENTDTNGTDDDFIYHI...............PIEF......................................NQE...
Q74Z68_ASHGO/190-740......VNKSADPKLGM...............NFAI......................................LKE...
Q6CIT0_KLULA/175-721.......NDEKEPL..................GLVF......................................LPQ...
Q6BX70_DEBHA/183-753...FNTEAQHINDIIEY.........................................................LPQ...
Q4U9K6_THEAN/45-615YEFSPSNERDDGTGWNLCSFCR.....EVGWPRVWV......................................DER...
Q4N294_THEPA/45-610EYSPSDAYGDEGTEWNLSSLCR.....EIGLPRVSI......................................DER...
A8BD62_GIAIC/283-863TELAEEQGKTTINTWMQ...............MFKV......................................DDA...
Q0UGY4_PHANO/31-649................RDEED.......SGELLFVI......................................NHQ...
Q2H2M0_CHAGB/4-638................RVVGE.......EGREEYGC......................................EMA...
Q2UDA7_ASPOR/4-644................EDSIAES..NRTPAVAQFVL......................................RTD...
Q0CV34_ASPTN/4-641................EEPMDGN...TPSVAPSFAL......................................HVD...
Q4WZU3_ASPFU/32-668................KDNSSQM..DDSSSITNFVM......................................QTS...
A1C7R2_ASPCL/32-668................EDKSSDP..DSSSAVTQFVM......................................QTN...
C8VMB1_EMENI/4-637................EADTKEN..EGPVSTVQFTI......................................HTQ...
Q5KH00_CRYNJ/4-686................PLSP.........QHRVYAL......................................NVD...
Q584R6_TRYB2/3-521................VKSK........GGKEDHTL......................................HSD...
Q0IG23_AEDAE/4-557VNSFSDNTSINTELW.................RYEI......................................RHE...
Q7PWU6_ANOGA/4-573VNT.SDSASINTELW.................RYEI......................................RRE...
GCP4_DROME/4-548CSLLSAEKNPEDYIW.................QYEV......................................NMS...
GACP4_ARATH/4-645KLARTSVHETSLTDWHS...............GFHI......................................SLD...
Q60F24_ORYSJ/4-649KFTQKSAKETSLTSWHT...............GFHV......................................SLD...
Q05AR5_XENTR/4-571LGIGGLTGKQLRELQDLRLIEEEN.MLAPSLKQFSL......................................RAE...
Q01B37_OSTTA/4-547CEGLRTKEDDGGGIWHE...............SHRV......................................ALE...
A0C933_PARTE/4-693.IDEKKKTDQHEYNWDT...............SFTL......................................NIQ...
Q24CL5_TETTS/4-831DKNVVEQPNELEIDWDS...............IFSL......................................RYA...

PF14609

MOD21_SCHPO/60-677--KNE-PFLSVVFIYPQIKPHLLSCLKNTHQELIKL--------------------------------------------
E4WX70_OIKDI/53-731--KQE-AFVNEFTLVQHATPNWHGYIK....RLLPL--------------------------------------------
B6K1F8_SCHJY/48-653--RLP-PF.....IFQIMTVWMNETVQN...ELLRM--------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750ISSAP.KFVQPV......ARKIFVAGKSM--VFLRHL...........................................
Q4WEE6_ASPFU/229-741CGL.P.QFMRPV......AQKIFTTGKSM--VFLQHL...........................................
A1C564_ASPCL/237-752LEHIP.QFMKPF......ARQIFTAGKSM--VFLQHL...........................................
Q5AUB0_EMENI/232-744LAKIP.KFIRPF......AHKIFITGKSR--VFLNRL...........................................
Q0UBK8_PHANO/224-738SLQCP.SFLQPA......VKKIFNTGKSI--IFLKELG..........................................
Q2HBB4_CHAGB/228-739KLHAP.RFLDPS......IHQIFEAGKSI--VVLKHM...........................................
Q1K6Z8_NEUCR/239-749VLNAP.RFLSPA......VDRIVRAGKSI--VVLKHL...........................................
F4HUK8_ARATH/48-872.VLCP.LFIKDI......CKSIVSAGKSL--QLMQHIPSTSSENCEKIQYHGRNGFGNSGCGILLAGKNSFRSIADLSLS
Q6H548_ORYSJ/50-922DILCP.VFLKDI......ARAILSAGKSF--QLVQHVQETHRIQTREVIHEFNIDQHGNYISQQKFRPDTSSIRIQDKRE
GCP5_MOUSE/273-942..TMV.SFLKPV......LKQIIMAGKSM--QLLKNLNCAEGPACQAAARDAERKSLYTLFLESIQLRLQHGEDSAPHIV
F1QBQ4_DANRE/270-933..TMV.SFLKPV......LKQIIMAGKSM--QLLKNLDCKETEQSDGSSRDAERKSLYTLFLESVQTRLRRGEESPTNTV
C3ZYG0_BRAFL/302-1685EEFIP.VFLKSV......FKEIILAGKSM--ELLKALGKMGGRVEFPVPLYEEFVQSLQTFLEVTDDLDQTGSSLCPPDH
Q7PX58_ANOGA/302-918..AIS.EVIENDPIIKLLLHHSLEAGYTL--NILNGLDRISDMRKEQGTDENLIYTSFLKTIVDELERFR..........
A0A0D1E2A2_USTMA/319-997GYSSP.AFLQSI......MQDVLTTAKGV--GLLRSLGVDALGGVQPDPNLGHVLGLRTTIAQTSLNPLQSLVERGADDP
Q9VTS3_DROME/266-1244..AIP.EFLVGC......EEEILQCGKYN--LVLRAYNAQHPVFDVQYPDIVVCLTEQQLKNMRRNLADKYAIIYKRFGW
Q2M0Y2_DROPS/276-1186..EVP.DFLSGC......ETVILHCGKYN--RLLKAFNAQHPAFDVSYPDIVVCLSEQQLTAMRRNLNDKYNRIRQTFEK
Q17IM7_AEDAE/330-1376..AVP.GFLKGF......EEDILLCGKYT--MLLKAFKKSHPIFSLKIPKLEVCLSYRAVDRLKARWLQYVAKARDVCGP
Q0UQH9_PHANO/170-704..MMP.RFILPE.....DGNMAFETGQSL--RFLKTQHPGHPLVRLHDAEISPPKFQW......................
Q5BEM5_EMENI/175-843..QMP.SFVPPD.....QAYLIYESGRSL--RLLKRYHPHHPLAGEQVRIDSPKLACAGTWAELERIQMKARDYEARLRA
Q2UCE2_ASPOR/176-851..EMP.SFIPTD.....QAELIFESGRSL--RLLKRFHPQHPIASDEICNGDVPRLSCASTWTDIERIQEKAKIYENRLR
Q0D0R6_ASPTN/174-839..QMP.SFVPSD.....QAKLIFESGRSL--RLLKRFHPRHPIANGKFRNSTLDCARSWAEIERIQSKAQTYERELRAEI
A1CPI0_ASPCL/179-855..QMP.SFIPED.....QAQLIFESGRGL--RLLRRYHPQHPVASGTPLRKDRRPALSCAGTWSDIERIQKKAQFYEAEL
Q4WSG8_ASPFU/170-850..QMP.TFIPAE.....QADLIFETGRSL--RLLRRYHPQHPIANDAILTKDSPNLRCAGSWSDIERIQKKAQQYETQLR
Q2H076_CHAGB/195-897..RVP.TFIPED.....MARSIFETGQNL--RFLREHHPEHPLARPDLVSLAMPPKLEWEFNWDAVSQLEARVNQYQNAV
A0A0D1BZI3_USTMA/198-1067..AVP.SFLPFR.....HARAFLEAGRAL--RLLKKAAPQDHPLVHQWSLNAQERASAKRVSLPTWRWSLLESKLQVDAI
A8BFK8_GIAIC/197-740....P.DLKTHPLLSPYVTKLCFEIGRAS--AFLRE............................................
A2E6U4_TRIVA/44-540..NAP.MFIPSA.....IINLIIATGKVQ--SIIAD............................................
GACP2_ARATH/70-583..TIP.GFLANI......AATILTTGKYL--NVMRE............................................
Q0JBZ2_ORYSJ/73-597..GIP.SFLTNV......AATILTTGKYL--NVMRE............................................
GCP2_DROME/204-721..QIP.SFLAKY......SDKILRTGKYL--NVIRQ............................................
Q29G36_DROPS/282-800..RIP.SFLEKY......SDKILRTGKYL--NVIRQ............................................
Q16HU4_AEDAE/210-728..KVP.CFLNEY......ADIILRTGKYL--NVIRE............................................
Q7Q703_ANOGA/248-764..KVP.CFLAKH......ADIILRTGKYL--NVVRV............................................
GCP2_MOUSE/220-738..QIP.SFLQKV......AGKILSTGKYL--NVVRE............................................
SPC97_DICDI/430-1044..QIP.KYLQSH......ALKILTTGKYL--NVVRECNQSISQQQQHNK...............................
A0BDB2_PARTE/150-660..QIP.KFLEKY......QDIILRTGKYI--NVIGQ............................................
Q23AE3_TETTS/242-771..QVP.AFLYLW......KEMVFKTGKYL--SVLSE............................................
SPC97_YEAST/62-688.VLLR.DCDSEED..KNLLFKMLRTGILL--KVVRA............................................
Q6FQY5_CANGA/70-712.GLLE.SFHEEL......LSKILVTGKLL--NIVKV............................................
Q756H1_ASHGO/63-723.GLTE.QFQDRQ.....LQYKVLMTGKLL--NLFKR............................................
Q6CXD9_KLULA/57-697.GLLP.QFRDKE.....LQQKILMTGKIW--NLIAI............................................
Q6BGV8_DEBHA/61-751.GVID.QFSSKD.....IQLKILATGKYL--NIFKT............................................
Q59PZ2_CANAL/94-759.GLLN.QFQNST.....IQSKILNTGKYL--NIFKR............................................
Q6C787_YARLI/102-681..ELP.LLLSQS....NLLEKVLLAGKYL--NIVRE............................................
ALP4_SCHPO/74-693..QVP.PQLLDL......QNKVLFAGKYL--NVVLE............................................
Q4X128_ASPFU/183-784..EVP.PQLEGV......KDKVLLAGKYL--NVVRE............................................
Q7S902_NEUCR/140-744..DVP.PQLEAV......KDKVLLAGKYL--NVVRE............................................
Q0V2V1_PHANO/184-787..LVP.PQLEAV......KDKVLLAGKYL--NVVRE............................................
Q5KPG7_CRYNJ/181-812GACIP.QFLQPW......KHKILLAGKYL--NVIRE............................................
Q4Q0X5_LEIMA/136-766..LVP.VFLNTPS...RIAKMAFFAGKYC--CILRE............................................
Q7XUI5_ORYSJ/65-1092HVSAP.CFLKDV......CGPLLRTGQQL--QVLMKLLESCNLSDTGGDAHASRHIIHLEEILPWFDTSIESSMNSFTFS
Q9VS91_DROME/97-627..RLP.GFLLSQ......ADDIFLAGKYL--NILRQ............................................
Q2M118_DROPS/72-608..RLP.DFLNPL......AAEIFHAGKYL--NILRQ............................................
Q29HV5_DROPS/23-546..MQP.KFIGQE.....LADKILRTGKSI--NFLREVCEMNELVKGQGE...............................
GCP3_DROME/235-758..MLP.KFVPMD.....MANKILMTGKSI--NFLREICEEQGMMKERDE...............................
Q16YQ3_AEDAE/217-729..MLP.SFVSDG.....IARRILVIGKSI--NYLREVCQDKTPVKARND...............................
GCP3_MOUSE/251-761..MIP.SFITMD.....QSRKVLLIGKSI--NFLHQVCHDQTPTTKMIAV..............................
Q1K720_NEUCR/225-737..MVP.SIITRN.....FADKVFLIGKSL--NFIRHSCGDHKWVED..................................
ALP6_SCHPO/196-713..LIP.SFLSEE.....LVDKIFLIGKSL--NFARYGCGDFDWAQE..................................
A0A0D1E4X1_USTMA/283-861..MLP.SFLQES.....FGRKIFSTGKSL--NFIRQSCGDGDWVGMR.................................
Q5KL44_CRYNJ/148-724..MVP.GFVGED.....FAKKIFSTGRSL--NFIRYSCHDSDWIETQAKIANAGR.........................
GACP3_ARATH/192-713..MLP.SFISPS.....LAQRILRTGKSI--NFLRVCCDDHGWADAASEA..............................
SPC98_DICDI/112-705..LLP.SFISLP.....LSKRILIIGKSI--NYMKQFCNNFKEDKNDRYYYYNQEDDDDDDEDHDDNDD...........
Q383E4_TRYB2/204-700..MLP.TTVSYS.....LAERIRLVAKNV--SFIRNCCRCKQWHM...................................
Q6FLE0_CANGA/180-724..KIP.SFLTYM.....QARQIFVIGKSY--IFVQKYCKELEYSNEFS................................
SPC98_YEAST/187-740..RVP.AFIPKE.....LAYKIFMIGKSY--IFLEKYCKEVQWTNEFS................................
Q74Z68_ASHGO/190-740..SIP.GFIPPA.....VAQQIYTVGKSY--IYLETYLKEIEWASNFS................................
Q6CIT0_KLULA/175-721..KIP.KFIPSL.....VAKKIYIIGKSL--RYLEHCCSEVEWIGKF.................................
Q6BX70_DEBHA/183-753..RIP.DFFVSMN..ETMAYKIYQIGKML--IFLLKYCKELKWISDYSM...............................
Q4U9K6_THEAN/45-615..YVP.KFLKNV......AVSVLEIGVLL--KLLDN............................................
Q4N294_THEPA/45-610..YVP.KFLKNV......AVCVLEIGVLL--KFLDN............................................
A8BD62_GIAIC/283-863..QVP.LFLNNI......KTHLCDIGRST--VLLKWKKKQYIDKG...................................
Q0UGY4_PHANO/31-649..LLP.KFVTRQ.....TASSILFVGKSL--NQIRS............................................
Q2H2M0_CHAGB/4-638..LLP.RFVTAA.....TAASMLFIGRSL--NQIRA............................................
Q2UDA7_ASPOR/4-644..LQP.KFVSPD.....AASSILFIGKTL--NLIRA............................................
Q0CV34_ASPTN/4-641..LQP.KFVSSH.....TASSILFIGKTL--NLIRA............................................
Q4WZU3_ASPFU/32-668..LLP.KFVSLH.....TASSILFIGKTL--NHITA............................................
A1C7R2_ASPCL/32-668..LLP.QFVSLQ.....TASSILFIGKTL--NHIKA............................................
C8VMB1_EMENI/4-637..LIP.QFVSSH.....TAASILFIGKTL--NLMRA............................................
Q5KH00_CRYNJ/4-686..MLP.TSIGEN.....TRESTLYVGRVV--ATLKR............................................
Q584R6_TRYB2/3-521..LLP.HGIPMEL...GLL..ILSVGKER--RVLLSDA..........................................
Q0IG23_AEDAE/4-557..MLP.YYLPTS.....WAEKVLFVGQTV--LMLNCDPRDHTD.....................................
Q7PWU6_ANOGA/4-573..MLP.YYFPAS.....WAEKVLFVGQTV--LMCHFDPRQQIAD....................................
GCP4_DROME/4-548..QLP.GFFSIV.....LAEKVLFVGQTV--LVFKMGRNVKVK.....................................
GACP4_ARATH/4-645..MLP.DYIPMR.....LGESILFAGKAI--RVLRNPSPAFQFQKDKSFQQTM...........................
Q60F24_ORYSJ/4-649..MLP.EYIHMR.....VAESILFAGKAI--RVLRNPSPGATLQESMNQSQNVKGSY.......................
Q05AR5_XENTR/4-571..MLP.SYIPVR.....VAEKILFVGESV--QMFEN............................................
Q01B37_OSTTA/4-547..RLP.PGIELS.....TAEAVSFIGRGV--RILTR............................................
A0C933_PARTE/4-693..MLPLHFITLQ.....MADKILFIGKAV--KVLKG............................................
Q24CL5_TETTS/4-831..MLPQSIVSHK.....QAEKILFIGKGI--RILRN............................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872EIFCLSLAGLIGHGDHVSRYLWKDETDEWEISPTLASYISGKLVNGTGDLLTYSERMWYKLLVGAVQEKKSIEAKSEL..
Q6H548_ORYSJ/50-922DIIEESTGQFGNNACKMDFLTLSESFLICLSGLLENGDHVDDYLRKLCADNAPVNKTIVHSKSNVQETEEVCGENSSEKT
GCP5_MOUSE/273-942NEDQTTKEN.......................................................................
F1QBQ4_DANRE/270-933TEQQATKKS.......................................................................
C3ZYG0_BRAFL/302-1685VGPVMVSSTMLHRVLDTAVKDSLLDKNFLKAIVVDSSEEEQDETRIKPVTIRCRRIVAPAFESGHKLNQSPPQIRNLTTC
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997IN..............................................................................
Q9VTS3_DROME/266-1244CSMQSIFEDRMATKRVFANLMVKRTQAHLDAWAQKQRELQIKANAQKKLQNDQLNAEQERIQQNHLEKRRQDIVNELAFQ
Q2M0Y2_DROPS/276-1186CSMKSIFEERMASKLRFKNRMVERTESFIAAWEEEQRELLLESNAKKRLLYDKINAEQELQQRNRVQQRRLEVVQELQHQ
Q17IM7_AEDAE/330-1376SLAVRELYERKEREREEFLRQVEANFRRSMEQWRQDQDAEALELRKKKERQMEELLGHLNEIRESKLAAKKQELELEQKY
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843EVLKYNRNGPSEHVMNI...............................................................
Q2UCE2_ASPOR/176-851SEILRYNRGRPSATKNLII.............................................................
Q0D0R6_ASPTN/174-839LKYNRHGSFEKERC..................................................................
A1CPI0_ASPCL/179-855RSEILKYTRGQTTDNALAAS............................................................
Q4WSG8_ASPFU/170-850SEILKYSQGQRVGQVEMDKVLA..........................................................
Q2H076_CHAGB/195-897VRAIKGTLSGTPQAAPYGA.............................................................
A0A0D1BZI3_USTMA/198-1067EDHILQFKREIVRWRRQRRKTIDGSV......................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092KSRVEAVICQRDAMYKSMIEKLHHFFSNVEVIPFDAALNVLHISTSPLDTAVSDVELFYHGTNALPACNVVAELKDNDAS
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922WLKLLRDATSGRDYDGMEK.............................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685LRLQVTRISSTMFNNGSHPWMLPEETYAPEFTSLLGCYRWHLQNNTASIAQADEACSMHEDLVRLGTGTDIVFSLIGLIE
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244RECERMEDKLLEREKQELQKKVVQLAAVLSSSPDRSTVSDLSFASCIEEPDCLAESSSDKDDANTENSEDEATKQLDKTL
Q2M0Y2_DROPS/276-1186RDRERYEDQLLEREKLALINKIQVLRQRDLAAEDASGWEMAESPDNKLNRNRRKMLSSALVQECQSEESS..........
Q17IM7_AEDAE/330-1376QHEGLEFENRRLMAENLEREKAVEGYRELNRMMDEKVEKAEREVERLKVQLAGVGGSGGDSSDFESCVGSVTEDDAGSVY
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092STSQESSDKVDALESSESSSSYSSIDDIEDEIDTACDNMPSSMFSSYRASSGEAKCSSVTTKLLSYETCSVSDGINPASP
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685IIANAVVILGIIGTKELRKPIYFFLANLAMADVFAGIGLLYRTVGHVGHNQMYDFSVTYLNFLIFSQMTSASALSLLSIN
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244NVPLEQPEAEYQADVDVDQPRGKE........................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376EDAQKSPLSDKSEDRTVKEITESDVVNSNDVISESEQNRKRILGSNLGEYLAEDHANAN.....................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092INENKKK.........................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685SYVGVRHPIYFHIHANSAKLRAVVAMIVSWIIFSLIAFSPSMGWNCLHMETLTTGTCTYYFPQAYIIMCLSIMFLMCMVM
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244............................................................................CSLP
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376..........................................IEAIKETAAAGLRQMTEAQRNKMKIMTEEFGLREGVVT
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685LFTNISVYVAIRDREKRRLEQAGVPPGVEGENGPVQNIVGGNQPNNAAQEEALRKYEARVYRSRTVMIYVVVAFVFWLVP
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244NVFQYQRSHSDVINSNEHPTTQAEFNRNRQHGLSSDQFQQCHATVHLQESDLLKTAASTSSGLHAEIPQDINANLNCPDT
Q2M0Y2_DROPS/276-1186..............................STGTELRAFLPPDINMNLNRLEETTEQSDLQRNRQRMLQHDGFNAFNSME
Q17IM7_AEDAE/330-1376AVDINSNQTEERHRNRQRILISDYTSREEEDPVKASGEMTELQKNRIKIMSQEYNVVVDDHDRGSKKDRKPEMYLNLETD
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092..............DDLSYGHVPMHSQSIEHDVVCDALELDNQYSEFWPFDSFLKNSFDISSGKMSLAEEFLYTGDKGAE
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872......................QSPCCVTCVKEEKNVLAAEKVLQGLFCHENLVVSASKMDLERNKNAWHVLNLSENYCL
Q6H548_ORYSJ/50-922..TLAKNAVMRDPTFVPGDHQDVSSTEVESYFNLSCYENPGITACQEMLERNKNSWSDLNISKSFHLPPLNDENIRKSIF
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685LLLMAVCSRYPSTCARWIGPEILFSFYSLNSIINPMATLIRTEELRNAIWQKMTGIHQTLVTAIRGNRVDPQGDQAGTGD
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244KELTELQRNRKRNEHHDGFFSFNSTEDEHTHRLRSLLNSNTERGRNRLRVMETEFGLGYKNTDIETKATPCLPLEIDKLH
Q2M0Y2_DROPS/276-1186DVHTERVKCQLRSDSPLARNRRRVMASEFDIPSICRKITIPLFSIAESGLHLPLELNKLHVEVPLDAATPMSTTSDVDID
Q17IM7_AEDAE/330-1376RAKNRRRILECEYDIVTGAQNFVDTPMSVDSDTISEDIQVPVIVIDDVPQDVNANPIAGDDGQLKLDTTAAQEKFNESRF
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850...............................................................................E
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067..........................................................................GTFSTT
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092QVSHANVVCRHSESGSPRLPNRDNDEKSINIKQPWNTNIPYNFSINPIVKNAVSCHTEHDLHGNRKNQALIGFNFESVTN
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................DVSGDDEHARKSSLTL
Q4WEE6_ASPFU/229-741................................................................NALETMGDSKAITLTL
A1C564_ASPCL/237-752................................................................NALDEVEQHQKTALTF
Q5AUB0_EMENI/232-744................................................................NLADSLEAPRKTALSF
Q0UBK8_PHANO/224-738...............................................................IRGAGAQPFGSEPRLDH
Q2HBB4_CHAGB/228-739................................................................KQHESTKKYRATAEPS
Q1K6Z8_NEUCR/239-749................................................................KRYSPVADRMKAEEPP
F4HUK8_ARATH/48-872PSLNDKSLLSAVFEGSGVAPKFVGTNYKYGFQFGRSEYLSSQDDTKILETLFPFPTLLPSFQSKLHMSEFLPYQKNSTLP
Q6H548_ORYSJ/50-922GDRDSSGTIPGDTLSTTYFPRLDGTDYKFGFQFDDSEYIRQEDDRRTLEALYTFPTLLPCVNENVPLSEILPLQKDSTLA
GCP5_MOUSE/273-942............LIKMQSIAERHLELDDIHDPLLAINFARLYLEQSDFHEKFAGGDICVDRSSESV..............
F1QBQ4_DANRE/270-933............LIKMQSIVARHLELDDIHDPLLAINFARLYLEQNDFHEKFSGGSVILDRSSESV..............
C3ZYG0_BRAFL/302-1685PPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAGTGDPPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAGTGDPPNLQE
Q7PX58_ANOGA/302-918..............................TENPKESGCDSDPQASLAVEVSRKVLCKAYRLTEASEPSQSSAARSDRTL
A0A0D1E2A2_USTMA/319-997..................TEAEAGHEEIVAALCFTPEVATENLRRLLFARGTQLAEQTETKTYVEDVLPQTPISRPDTEP
Q9VTS3_DROME/266-1244VEIPLAVLTPMSTTSDVDFGDPSPRELPEIADTANNNNVSGSIESLSPELPKPVLAIAKPTSLLPKLDFGMKDERETEQD
Q2M0Y2_DROPS/276-1186GLSDHNPFKEEESETDATDYNGHALISNAGHEQDPAPLLPTNPLAVEPAQASVERRVTSMTSRLPAVNWPTNFGKIAEHE
Q17IM7_AEDAE/330-1376GVPDTAVLAKLTPESGLISAGLQAKRGFEFPIVQEGSELEIRSEASYEDDEIYREFVEAMEKRNLNLCELPSMTGDLGNV
Q0UQH9_PHANO/170-704...........................................AFGWQDIEAISNKAKQYEHRLRT..............
Q5BEM5_EMENI/175-843....EKPNTIESKELPDAFSLFDINDAQHMTGLLASDASLEKAKLGQLLNEADHDIEKQSGKLETNF.............
Q2UCE2_ASPOR/176-851.NSQPPAHTEASDTLKDTFDLFDIDDAQNMTGLLANPSSIEKDELSRLIEQGNHKDLEVPEDHRCNF.............
Q0D0R6_ASPTN/174-839......DFTPEHLVLDGDNVVSGAFDLFDMDSAKVTGLLNNQASVESDPLGQLVDAGSIVTGNENAF.............
A1CPI0_ASPCL/179-855.HAQKSDSAVEDRNGPENYEMFDIDDSRNTTGLLTQHSTLNCDELVPLLNTAQPQKSESLESRRSKF.............
Q4WSG8_ASPFU/170-850EQMQKFVSAGDDPAISPAFELFDIDDSKHTTGLLASDSSLENDELGPLFDASTLEVSRPIHPHRKNF.............
Q2H076_CHAGB/195-897.NKRKYDVAELEYFGKDETQVRENILASIRQLDQSLGNPEPRDELTRLLRHRLYQTPETSHSPRGLTPHWTL........
A0A0D1BZI3_USTMA/198-1067SSPLDSSPALPQPAGETDKHMGRVQTNEAPLDPVDDQLARMSQLFASLPGVTNSTLSAAIFTDTEQEPLLSSKADLAKKQ
A8BFK8_GIAIC/197-740......................................................................DCNNITWRFP
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044...................................................SDNNNNNNNNVKLNSQQQLLLLKLNTTQQ
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688.......................................................................SLQIPTIPS
Q6FQY5_CANGA/70-712..........................................................................TMELTS
Q756H1_ASHGO/63-723..............................................................................SC
Q6CXD9_KLULA/57-697...............................................................................C
Q6BGV8_DEBHA/61-751...............................................................................C
Q59PZ2_CANAL/94-759...............................................................................C
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693.............................................................................CRK
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766.................................................................YGAALPAFRPASVPG
Q7XUI5_ORYSJ/65-1092PCEAYCGRSTSSLDEFEVRSAMAVQSNAQASKQFDCSSKLLQSKTTSHAYLTSPGDISAQTNLLENPSGGAFWEKSLEYT
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546...................................................LKNIMESNAGDIFSY..............
GCP3_DROME/235-758...................................................LMKVMESSASQIFSY..............
Q16YQ3_AEDAE/217-729...................................................LKQCLENDMDSIFST..............
GCP3_MOUSE/251-761...................................................TKSAESPRDAADLFT..............
Q1K720_NEUCR/225-737.......................................................YSKNASRELKY..............
ALP6_SCHPO/196-713.......................................................HYQKLVKKLSY..............
A0A0D1E4X1_USTMA/283-861......................................................HTIAGASAELRY..............
Q5KL44_CRYNJ/148-724..............................................GEFMGCKRGSMSDRVVALKY..............
GACP3_ARATH/192-713...................................................AAASGTTTRRGGLGY..............
SPC98_DICDI/112-705...............................DDENENQGEDDEIIERKLLIKESKIIKEKTKELNY..............
Q383E4_TRYB2/204-700........................................................DPSIVAAAQS..............
Q6FLE0_CANGA/180-724.....................................................NRYKQIYDGLRKN..............
SPC98_YEAST/187-740.....................................................KKYHVLYQSNSYR..............
Q74Z68_ASHGO/190-740.....................................................NKYMNKFADLPKS..............
Q6CIT0_KLULA/175-721.....................................................ANKYSLQYRLLGP..............
Q6BX70_DEBHA/183-753...................................................KYSTYIFQNNQGIQS..............
Q4U9K6_THEAN/45-615................................................................KVQHHFLLDTKASGIS
Q4N294_THEPA/45-610................................................................PIQYHFLLDNQNTKTS
A8BD62_GIAIC/283-863.......................................................PNASGQELLLLSAEASGETTQGFRH
Q0UGY4_PHANO/31-649..................................................................VPPSIRADNAPSNI
Q2H2M0_CHAGB/4-638........................................................................KSVGDYTL
Q2UDA7_ASPOR/4-644.................................................................KRSGSRTGPPAGLST
Q0CV34_ASPTN/4-641.................................................................KRNNSITSPLVGLSI
Q4WZU3_ASPFU/32-668.................................................................KRKGATMGFDSG..A
A1C7R2_ASPCL/32-668.................................................................KRTSSIAELSNGFST
C8VMB1_EMENI/4-637.................................................................KRSPTGHTPD.GLLT
Q5KH00_CRYNJ/4-686.........................................................................EGKSLPK
Q584R6_TRYB2/3-521...............................................................ESHGKEYLEQLALGAQD
Q0IG23_AEDAE/4-557.........................................................KRTTGDRKFAAI.....KDSLWG
Q7PWU6_ANOGA/4-573........................................................RAASKGSRKGAALAAAAGKDNLWG
GCP4_DROME/4-548.........................................................NKTDPLAAKLAELDSDDIYQLWS
GACP4_ARATH/4-645...............................................RGSQRIRGFMHSDFPETETELDADLTGGELLPQ
Q60F24_ORYSJ/4-649...........................................RMQSLIGGSGALKELPNFPNISAE........ELLPQ
Q05AR5_XENTR/4-571...................................................................QNANMSRTGSILK
Q01B37_OSTTA/4-547..................................................................SINQRTPSFSFDAE
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831.........................................................................TQKEYEN

PF14609

MOD21_SCHPO/60-677--ETEV....YNATKNCTLFQFFQHV-KKFVDPL--------LCFRFAYEKSATNMWDFVKT---LEFIYSTRNYS....
E4WX70_OIKDI/53-731--ITNVRKVRDFIWQ...LTGSTRHE-NKF....--------..FRPAFLDFGEQVMDLLQS---RVFIFFRRWQNHART
B6K1F8_SCHJY/48-653--ELLVRKHAYNILK...LEHDVTDL-IVFVEL.--------..LTKRLISGCTSVDEFLHC---IFNIHIGRRSN....

PF04130

Q2UAG9_ASPOR/234-750GDVFPEDSASVYM....PFSA..LLD.SAFGRIV........D...ENHSFTSSLLRRELDQ...QCGL..WISLQALEH
Q4WEE6_ASPFU/229-741EHTYGDESSSLLCL...PFAA..ICE.SAIGKLV........E...ANHSFASDLLRKELDQ...QCGL..WRSLQALEH
A1C564_ASPCL/237-752EGMSNDEHASLVYL...PFAA..TFG.SALDKVV........K...ANQSFTSNLLHQELDR...QCGL..WTSLNALEH
Q5AUB0_EMENI/232-744EDIYPSNLSS.TCL...PFYA..LLE.SALNDVI........N...ENHAFTSSLLRKELDE...RCGL..WISLQALEH
Q0UBK8_PHANO/224-738ESVCGLSDDV.PVP...PFAE..LFQ.AAFDRWM........Q...SKYSQASSVLREHLVE...TSGL..MRTSVILET
Q2HBB4_CHAGB/228-739MDFATVCPDGFEFA...PFSE..LFG.AAFQAWI........Q...SKHHSAAATLRELLFS...SYGL..FESLDALQH
Q1K6Z8_NEUCR/239-749MEFAAVCSDGTSFA...PFSE..LFG.NAFNKWI........Q...SKYHSASITLLDILFD...SYGL..SRAFGALRC
F4HUK8_ARATH/48-872SRVLSWILRTEPRN...TLLPVVIMQ.ECFTINI........R...RQVDNISKVIFSKLMN...EWKL..MHELAVLRA
Q6H548_ORYSJ/50-922SRALKFIQSMSLRD...PLQPVGIIQ.ECLSKCI........K...RQVDHIGKQILSKLMG...DWRL..MDELFVLRA
GCP5_MOUSE/273-942...........TCQ...TFEL..TLR.SCLYPHI........D...KQYLHCCGNLMQTLKR...DFRL..VEYLQAMRN
F1QBQ4_DANRE/270-933...........TCQ...TFEL..TLR.SCLYPHI........E...RRYVECCGNLMRTLKK...DYRL..LGYLQAMRN
C3ZYG0_BRAFL/302-1685GSAHGEGQNTPGLAPEGSQPVQLALQ.RCLYPHI........L...QRCSTISRLLVELLKT...EYQL..EDYLQAMQK
Q7PX58_ANOGA/302-918SNAYTLYMKLNSIS...TLQL..PLE.HVLFNAI........KNLMETKRHAANHYVTYIYK..DEFHV..MDHLKNIRK
A0A0D1E2A2_USTMA/319-997LWDVSITRNHRHLS...HRLLEPLLG.RLLQEHL........S...PISALVRKRVTEVLLSPVTEGGYALQSHVQACHG
Q9VTS3_DROME/266-1244RDKVST..LPEACN...PFMARRCLQ.LSVMAPL........N...AYYGLLRNEVLR.IFQ...EQRI..YEHFRKLRN
Q2M0Y2_DROPS/276-1186EPQISAVLVPESCN...PFMARRCLQ.MSVMEPV........S...AHYALLRNEVLR.IFK...EQHI..YEHFRMLRN
Q17IM7_AEDAE/330-1376TELKEIDTELRSLD...VLTVTRFLQ.SSLVIPL........K...AHMEVVNSEILKMCLN...DLDI..LGHFESLRN
Q0UQH9_PHANO/170-704..............................................SLLAYSSGSAVN.................NLPRQ
Q5BEM5_EMENI/175-843.................APEVTSSLY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHNL..KDHLLLQWR
Q2UCE2_ASPOR/176-851.................GPELASALY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHKL..RYHLSLQWR
Q0D0R6_ASPTN/174-839.................GPELAASLY.LSMAPFL........S...SQASLIDFSCLHMLFK...EHQL..RYHLGLQWR
A1CPI0_ASPCL/179-855.................GPEMISAIY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHRL..RYHLTLQWR
Q4WSG8_ASPFU/170-850.................GPEMISAVS.LSLAPLL........S...SQALLVDFSCLHLLFK...EHKL..RYHLTLQWR
Q2H076_CHAGB/195-897.......................VPL.LSFGPVI........E...TQSVLINSECMKLLFS...AHHL..RVHIDLLKQ
A0A0D1BZI3_USTMA/198-1067EESLVLYLSSAACP...PNAQDAISQ.SAFDRVTQASLVAPFE...SWARLINMSLISVFFQ...DLGL..GTYLETCKR
A8BFK8_GIAIC/197-740ESIVALIREANFAK...LLSS..YSS.DASEGTV........KLIRSIHMLSSKAVVAIIKR...QFLL..FDHLNGILY
A2E6U4_TRIVA/44-540.......CNKQQLK...QTNKITISS.IQYEGEL........Q...EIYKSASNILISEMFS...QYRL..MDIFNTIWN
GACP2_ARATH/70-583.....CGHNVQVPISERSKLTIFGSN.HHYLECI........K...AAHEFASIELVNLIKD...KYDL..VGRLRSIKH
Q0JBZ2_ORYSJ/73-597.....CEYTVQVPLSESSKLMGFGSN.HQYLECI........K...SAYDFASGELLTLMKD...KYDL..IGKLRSLKR
GCP2_DROME/204-721.......CGKRVMPTQEMNLEFDPTS.ERHVSVI........N...DAYYFAARMLLDVLLT...ENDL..MGHLQSVKR
Q29G36_DROPS/282-800.......CGKRVMPTQQMELQLDPTD.ERHVYVI........N...DAYYFAARMLLDVLLT...ENDL..MGHLQSVKN
Q16HU4_AEDAE/210-728.....CGSSVDYQQNVCVSLKYTHSDHQTYIKAI........E...DAYNYASSSLLNLIMD...KYNL..MGRLFSVKR
Q7Q703_ANOGA/248-764........ATARTTTAVKRLQYAHFD.QSYLDEI........E...EAYNFASSSLLNLIMN...KYDL..MGRLLSVKR
GCP2_MOUSE/220-738.......CGHDVTCPVAKEIIYTLKE.RAYVEQI........E...KAFNYASKVLLDFLME...EKEL..VAHLRSIKR
SPC97_DICDI/430-1044QQQQQLSSTSASMIPTTIIEYS.KNE.NVYIDKI........E...KAYDYASGILLNLLIN...ERHL..ISRLKAIKH
A0BDB2_PARTE/150-660.......KESPFDNFLIKNQGHIVQN.QDFSHLV............SCFEWANKEIINLLFQ...KENI..HKRLKTIKT
Q23AE3_TETTS/242-771..HEGKVVSSPFELDLVQNYETYLQM.QDFSQPI........Q...KAYEWANAQIMHLVVV...DQDL..QGRLKSIKN
SPC97_YEAST/62-688NSSDITIQEINDFA...DL....MEG.SNLELYV........D...KCYSRANEIFLKLFFQ...GYDL..INVLKHLQQ
Q6FQY5_CANGA/70-712IPVDGKYALRRAGE...FDFVHLLEG.TNLELYV........S...RWYSRANELCIRLFFE...GYNF..GRFLRDIFC
Q756H1_ASHGO/63-723GLATLPHALEHERS...DIATQLPEG.TQLLVYV........D...KWYQRANQMCWDLLQE...GYQL..PRIMYQLHK
Q6CXD9_KLULA/57-697CGNTALKPRSWGTS...VTNIDITNM.TFLKGYV........N...ECYQQANEKCLKMYYE...GYHM..DKFLNLIHD
Q6BGV8_DEBHA/61-751TGLYDFQQLNELIQ...PIDR..LYS.QDLELKI........N...EYYRRANKLLMKLLFE...GYQF..PSLIDGFQT
Q59PZ2_CANAL/94-759TGLHNFESLKEKLT...TITS..LAA.PDLELKI........D...EFYHRANKMLMKLLFD...GYNF..PSVVNIFQR
Q6C787_YARLI/102-681.......CGGGDTSKDAAVNWESIQD.PALVPSI........A...SASDESNRALLSLLLS...SHNL..FDRLASLKH
ALP4_SCHPO/74-693GVNNLASLNAKDDTQNQLLWPSTFDD.DNFTLNI........M...NAYVYANESLLQLLQS...SQSL..YAHLYSLKH
Q4X128_ASPFU/183-784.......CGGVDISQKVTDVPHTLDD.PRFLDNV........N...AAYTYANASLLNLLLT...KNSL..TTRFRSLKH
Q7S902_NEUCR/140-744.......CGGVDVSRKMQDVPNSFDD.NRFLENI........S...SAYAHANGSLMQLLLT...THEL..PARLRSLKH
Q0V2V1_PHANO/184-787.......CGGVDVSKIVQDAPTSFDD.PRFLDNV........S...SSYAYANSSLLNLLLT...THQL..PARLRSLKH
Q5KPG7_CRYNJ/181-812.....CGIEVKKPGEVDEKEMVTMND.PNFYKRI........E...DAYIYANKTLLKLMVE...EQEL..IPHLRSMKH
Q4Q0X5_LEIMA/136-766GAGAAVGSRPDGPG...DALLTWSGA.NQLQRQV........Q...ESFEISSGAVIQLLFS..PSVDL..LGHLKSLKL
Q7XUI5_ORYSJ/65-1092AKSMEIAGDTTSSS...DMPLDIAID.KCIIQEV........L...LQYKYVSSFTMKLLED...GFDL..CGHLQALRR
Q9VS91_DROME/97-627.....CNVSLKLLQ...RPLAYSQGD.LGHEEII........K...TSYELPAHKFLKVLVE...EHNL..PLHIRNLKS
Q2M118_DROPS/72-608.....CNVKLTLMQ...TPLNYNPKE.QGHVEII........R...SSYELPGKKLLDYLKT...EHHL..EWHLGNLHG
Q29HV5_DROPS/23-546.......................TQD.TKWHAAI........E...ICYQNTAKHVLDYMVG...PHKL..LEHLQCMRR
GCP3_DROME/235-758.......................TPD.TSWHAAV........E...TCYQQTSKHVLDIMVG...PHKL..LDHLHGMRR
Q16YQ3_AEDAE/217-729.......................IST.TKLHQLI........D...SAYLNTSKQVLDIVLG...PHRL..LDHLQALRN
GCP3_MOUSE/251-761.......................DLE.NAFQGKI........D...AAYFETSKYLLDVLNK...KYSL..LEHMQAMRR
Q1K720_NEUCR/225-737.......................GDT.ATLEAWI........D...EAHRETMSHLMRLLND...QFRV..FDHLEALKR
ALP6_SCHPO/196-713.......................RDP.HSLETVV........D...KAYTESINHLVYLMEE...VFHL..TDHLKAIKK
A0A0D1E4X1_USTMA/283-861.......................TDL.AGLESTI........E...GAFNSASKRLLDIFLD...EFRL..LEHLRALKD
Q5KL44_CRYNJ/148-724.......................SDL.AGLERSI........D...DAYSIASQRLLEIFFD...KFRL..LDHLRALKS
GACP3_ARATH/192-713.......................GET.DALEHLV........T...EAAKRIDKHLLDVLYK...RYKF..KEHCLAIKR
SPC98_DICDI/112-705.......................INK.EVLQEII........E...LVSRQSSERLLKIVLN...RFKF..MNHVKALKK
Q383E4_TRYB2/204-700.......................ATF.DTLDSVV........R...DAMRFTNTAVLRLIRE...EFHL..DNVLRMVNA
Q6FLE0_CANGA/180-724.......................GIS.IEFIEAV........N...TQFKEIVSYIDTIICT...KFHY..HDVLKTLRN
SPC98_YEAST/187-740.......................GIS.TNFFEII........N...DQYSEIVNHTNQILNQ...KFHY..RDVVFALKN
Q74Z68_ASHGO/190-740.......................AIG.QPFYDLV........N...EQHAEITAFINDILKS...KYYY..DETVTVLKD
Q6CIT0_KLULA/175-721.......................SMD.HKFFELV........N...QQYGEINHYINTTLRS...KFYY..FETLNLLKD
Q6BX70_DEBHA/183-753.......................MPS.NVIIDLI........N...LQYEEILNYFTIVLQE...KHSM..FHHLQNFKR
Q4U9K6_THEAN/45-615NSNDVNFRKYKF...........HSV.DEFALLI........Q...NVHKNVMDEVYFGLKR...NSQL..LTNLKLVFD
Q4N294_THEPA/45-610QSNPNSSSNPKDVR...KYKF..RTV.EELSLLI........K...NAHNEVMHEVYPGSKE...NFPF..SRTLRMIFD
A8BD62_GIAIC/283-863GEETVASLVCGDGS...TGDLELAHI.RLYKQLI............DINARVQTKVLDFFIN...PEYLDFRGHLQNIYA
Q0UGY4_PHANO/31-649SELDLLPSHVEMLS...VVRAP.IIA.AELAEAV........T...KIRLSLSRNLLQYLLP...RNRI..IETLTVLHQ
Q2H2M0_CHAGB/4-638RGNDHLSTQLTRLA...ALRHP.IDS.ATFARTI........A...DIRHFLSRTTLQRLLP...LSRV..LETLQLLRD
Q2UDA7_ASPOR/4-644TPVTLHGEHIEHFA...TLKSP.IST.AKLSNSI........N...SIRLSLSQSTLSKLLP...LPKI..LEILAVLHD
Q0CV34_ASPTN/4-641SPASLHGEHIAQLA...SLKSP.IST.AKLSNAI........S...SIRLSLSQSTLSKLLP...LPKI..LEILSVLHD
Q4WZU3_ASPFU/32-668PPVTLQGEHIAHLA...SLGSP.ISA.SKLSNAV........D...SIRLSLSQSVLSKLLP...LPKI..LEILSVLHD
A1C7R2_ASPCL/32-668SPVTLQGEHIKHLA...SLESP.ISA.SRLSNAI........D...SIRLSLSQSTLSKLLP...LPKI..LEILAVLHD
C8VMB1_EMENI/4-637SPVTLQSEHISHLA...GLKSP.ISA.SELSNTV........D...SIRTSLSQSTLSKLLP...LPKI..LEILSLLHN
Q5KH00_CRYNJ/4-686GLVDSLRGELMAVK...SLEV....G.GGLKEAV........E...KARAEVGEWLWRHILT...GPQV..AESIEMFGS
Q584R6_TRYB2/3-521EAADAVFRAIYHPS...LCVNGFLVV.DELETRV........E...ETHALWSKALWLKVSK...QVDL..RKHIDAMRA
Q0IG23_AEDAE/4-557DQECAFFKKFHQLQ...LDEN..LNI.AKFEHIV........D...EIKLCVTEQMSEIAIK...EADL..IKQLKLIKD
Q7PWU6_ANOGA/4-573DHEQQLFRKFHQLQ...SEEN..LNV.TKFEHLV........D...EIKEQVTKHMSTIVIE...KADL..ERQLRLMKD
GCP4_DROME/4-548GRESEFFKMVVDLS...NEDT..INV.FRLEKVI........I...DIKNYVSARLSEIAVN...EVDL..ERQMGLIKD
GACP4_ARATH/4-645SEADKIEAMLKDLK...ESSE..FHK.RSFECTV........D...SVRAIAASHLWQLVVV...RADL..NGHLKALKD
Q60F24_ORYSJ/4-649AEADKIDAMLKELK...HSSE..FHK.RLFESAV........G...SIRTMAANNLWQLVVV...RADL..NGHLKALKD
Q05AR5_XENTR/4-571NQEDTFAAELHRLK...QQPL..FSL.VDFESVL........D...RIRSTVAEHLWKLMVE...ESDL..LGQLKIIKD
Q01B37_OSTTA/4-547AYAARATARIRKLA...SAES..FDP.REFDAVV........E...SMRSEIAEGLGEVLLH...RSGL..VAHLTAMTE
A0C933_PARTE/4-693..QQELFINEHQQL...IREIEVYDS.FTFNRII........D...QLQKQVGEQLVQVIVD...KQEL..FIHLKNFYL
Q24CL5_TETTS/4-831SFLPPQQMLT.LIE...EIRQ..YDS.FKFQNTI........E...SLRYEIAKQMLELVLK...NQNL..MNHLNTLNN

PF14609

MOD21_SCHPO/60-677.......SQMF.----....KLYKASA.----------------------------------------------------
E4WX70_OIKDI/53-731DDSVCSTSLLVS----AALKQAYGEGMK----------------------------------------------------
B6K1F8_SCHJY/48-653.......SLHFG----EFFSKLYYETL.----------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750IYHC.KDMSVYG....PIDHKIFDLIDR....................................................
Q4WEE6_ASPFU/229-741IYLC.KDLSVSA....IIDNKVFDLMDR....................................................
A1C564_ASPCL/237-752IYLC.KDISVSG....AIDGKIFDLMDR....................................................
Q5AUB0_EMENI/232-744IHLC.KDISLIG....PIDTKIFELIDR....................................................
Q0UBK8_PHANO/224-738LYLG.KNGAVFE....DFANALFERMDG....................................................
Q2HBB4_CHAGB/228-739IYLM.SDGSMSN....SFASSVFRRLDA....................................................
Q1K6Z8_NEUCR/239-749LYLM.SDGATSD....AFASTIFRQLDN....................................................
F4HUK8_ARATH/48-872IYLL.GSGDLLQ....HFLTVIFDRLGK....................................................
Q6H548_ORYSJ/50-922IYLL.GSGDMLQ....QFLVTIFDKLDK....................................................
GCP5_MOUSE/273-942FFLM.EGGDTMY....DFYTSIFDKIRE....................................................
F1QBQ4_DANRE/270-933YFLL.EAGDTMY....DFYTAIFDKVLE....................................................
C3ZYG0_BRAFL/302-1685FFLM.EAGDAMH....NFYMPLFAKLSA....................................................
Q7PX58_ANOGA/302-918VLLL.EASDLMD....YFYSDLFRRIEA....................................................
A0A0D1E2A2_USTMA/319-997LFFM.RRGAEMA....SWLESLFMDLDRRNGMLRATN....................................HHRLHSG
Q9VTS3_DROME/266-1244YFFL.VDGQFGA....TLTNEILGRIRAG...................................................
Q2M0Y2_DROPS/276-1186YFFL.LNGEFGT....QLTGGIFGNIRAG...................................................
Q17IM7_AEDAE/330-1376YFLL.MDGEFSC....YVCDNIFKMLEEV...................................................
Q0UQH9_PHANO/170-704YHLI.GDGVFSS....LLATALFDPERESAERHKGQMRSALRG.......................VLSESYYSSSLYQS
Q5BEM5_EMENI/175-843FQLL.GDGYFMS....RLSQSLFDPEMESGERKIGVVRSGVHTGLRLGSR..........DTWPPASSELRLVLMGILNE
Q2UCE2_ASPOR/176-851FQLL.GDGFFTS....LLSHALFDPEMQSGERKSGVVRSSVHTGLRLGSR..........DTWPPASSELRLVLIGLLSE
Q0D0R6_ASPTN/174-839FQLL.GDGFFAS....RLSHSLFDPEMKSGERKTGVVRSEVHAGLRLGSR..........DTWPPASSELRLVLIGLLDE
A1CPI0_ASPCL/179-855FQLL.GDGHFTS....RLSHSLFDPEMESGERRSGVVRSGVHTGLRLGS...........RDTWPPASSELRLVLMGLLS
Q4WSG8_ASPFU/170-850FQLL.GDGFFAS....RLSHSLFDPEMESGERRSGVVRSGVHTGLRLGN...........RDTWPPASSELRLVLIGLLS
Q2H076_CHAGB/195-897YFLL.DNGLLVS....RLTHALFDPDLSTAERRAGVALGSGTMGLRLGSRQTWPPASSELRLALMGVLSDCYESPTPRLD
A0A0D1BZI3_USTMA/198-1067FLLL.GSLHFER....QVVSSLFDVDQASVLDAASASSGRAVVAMNQRLTAEGAWPPNDSLLSSALNTAVIETVSSMRHA
A8BFK8_GIAIC/197-740ILLG.MQGDFIP....................................................................
A2E6U4_TRIVA/44-540VILF.RRTDLFN....IFYRVAGNKMRR....................................................
GACP2_ARATH/70-583YLLL.DQGDFLV....HFMDIAREELNK....................................................
Q0JBZ2_ORYSJ/73-597YLLL.DQGDFLV....HFMDIAREELTK....................................................
GCP2_DROME/204-721YLLL.NQGDFTM....QFMDACEDELTK....................................................
Q29G36_DROPS/282-800YLLL.NQGDFTM....QFMDACEDELSK....................................................
Q16HU4_AEDAE/210-728YFLL.QQGDFID....QFMDICEEDLNK....................................................
Q7Q703_ANOGA/248-764YFLL.QQGDFIT....EFMDAVEEDLRK....................................................
GCP2_MOUSE/220-738YFLM.DQGDFFV....HFMDLTEEELRK....................................................
SPC97_DICDI/430-1044YFLL.CKGDFFS....HFMDTTYDELKK....................................................
A0BDB2_PARTE/150-660FFLF.DSGDFFI....HFIEAAESELVK....................................................
Q23AE3_TETTS/242-771YFFL.ERGDFFV....YFLDSSEEELIK....................................................
SPC97_YEAST/62-688IFLGYQSGHNVL....KFLTKNMGELTK....................................................
Q6FQY5_CANGA/70-712NYLYVNNGNKFN....KFLLRNHFDLGK....................................................
Q756H1_ASHGO/63-723HFMLYNCGEFQN....KFFMKSMVELTR....................................................
Q6CXD9_KLULA/57-697QSYV..HGVIDQLWNTKFLSKTLFELTR....................................................
Q6BGV8_DEBHA/61-751LFLF.KDSSKID....VFLEKSFNDLRK....................................................
Q59PZ2_CANAL/94-759LFLF.ADSFQID....NFIDSTFSELKR....................................................
Q6C787_YARLI/102-681YFFL.DRADYYI....NFQDIAWTELAR....................................................
ALP4_SCHPO/74-693YFFL.DQSDFFT....TFLDNAQHELRK....................................................
Q4X128_ASPFU/183-784YFFL.DRSDFFS....YFLELGSSELRK....................................................
Q7S902_NEUCR/140-744YFFL.DPSDYFN....YFLELGTSELRK....................................................
Q0V2V1_PHANO/184-787YFFL.DRSDFFT....YFLEMGELELKK....................................................
Q5KPG7_CRYNJ/181-812FFFL.NQSDFLT....NFLDLAASELRK....................................................
Q4Q0X5_LEIMA/136-766YFLQ.ERGDWVV....DFLDSAESLLAE....................................................
Q7XUI5_ORYSJ/65-1092YHFM.ELADWAD....SFIVSIYKKKWS....................................................
Q9VS91_DROME/97-627YFLL.QEEGFSE....TFLHKCHEYLKY....................................................
Q2M118_DROPS/72-608YFLL.QNQEFAE....ALLANYQEHMQR....................................................
Q29HV5_DROPS/23-546YLLL.GQGDFVS....IFIEHMKDELEK....................................................
GCP3_DROME/235-758YLLL.GQGDFIS....ILIENMKNELER....................................................
Q16YQ3_AEDAE/217-729YLLL.GQGNFAD....ILMENLQAELDR....................................................
GCP3_MOUSE/251-761YLLL.GQGDFIR....HLMDLLKPELVR....................................................
Q1K720_NEUCR/225-737YILL.GQGDFIA....LLMESLAPNLDR....................................................
ALP6_SCHPO/196-713YLLL.GQGDFVD....LLMESLGNSLDQ....................................................
A0A0D1E4X1_USTMA/283-861YLML.ARGDFVD....LLMASLGPSLSR....................................................
Q5KL44_CRYNJ/148-724YLML.GAGDFTE....LLMEAMAPRLSK....................................................
GACP3_ARATH/192-713YLLL.GQGDFVQ....YLMDIVGPKLSE....................................................
SPC98_DICDI/112-705YLLL.GQGDFIQ....YLMDLIGEDLLK....................................................
Q383E4_TRYB2/204-700FLLV.GNGDFYE....VLIHKLDPVLGR....................................................
Q6FLE0_CANGA/180-724ILLM.GRGDLIN....TLITKLSSALTS....................................................
SPC98_YEAST/187-740ILLM.GKSDFMD....ALIEKANDILAT....................................................
Q74Z68_ASHGO/190-740ILLM.GRGDFIE....NIIINASDFLME....................................................
Q6CIT0_KLULA/175-721ILLM.GKSDVID....SIIQNSENLFNQ....................................................
Q6BX70_DEBHA/183-753FLLM.NSNDFIE....SIIEKGIVLFNE....................................................
Q4U9K6_THEAN/45-615YFLL..QKSYIQDIVNNFNTGGLSDLNK....................................................
Q4N294_THEPA/45-610YFLL.QKSCYIQDVINNFKSNCYSDLNK....................................................
A8BD62_GIAIC/283-863FYLV.MAGDFLS....CFVESAISELVL....................................................
Q0UGY4_PHANO/31-649FFLL.GRGEFAM....TLITEADARISAR...................................................
Q2H2M0_CHAGB/4-638FFLL.RRGEFAM....ALTQQADEKIRSRWK................................................R
Q2UDA7_ASPOR/4-644FLLL.RRGEFAS....ALVSHADARLLERHRR..............................................PG
Q0CV34_ASPTN/4-641FMLL.RRGEFAS....ALVSHADARLYDRRRR..............................................PE
Q4WZU3_ASPFU/32-668FLLL.GRGEFAT....ALVSHADARLSERHRI..............................................PE
A1C7R2_ASPCL/32-668FLLL.RRGEFAT....ALVKNADSRLLERHRR..............................................PE
C8VMB1_EMENI/4-637FLLL.QRGEFAT....ALVLHADARLRERQRG..............................................PE
Q5KH00_CRYNJ/4-686FFLL.RKTDYCI....AVIRGISQLRL.....................................................
Q584R6_TRYB2/3-521MFLC.HRGDFWH....TFVETAFSTF......................................................
Q0IG23_AEDAE/4-557YYLL.GRGELFL....ELLRQTKSLKTL....................................................
Q7PWU6_ANOGA/4-573FFLL.GRGELFS....EFLTQTQSLKLL....................................................
GCP4_DROME/4-548FFLL.GRGEFYL....EFCSQMVGTMETYRE................................................E
GACP4_ARATH/4-645YFLL.EKGDFFQ....CFLEESRQLMRL....................................................
Q60F24_ORYSJ/4-649YFLL.AKGDFFQ....CFLEESRQLMRL....................................................
Q05AR5_XENTR/4-571FYLL.GRGELFQ....AFIDIAQNMLKT....................................................
Q01B37_OSTTA/4-547FYFL.GKGDFYS....IFVDEAKELLAL....................................................
A0C933_PARTE/4-693FILL.NNGNFIQ....QFLSDCQSILQL....................................................
Q24CL5_TETTS/4-831YFLM.GNGEFFK....AFYEESRSLMQL....................................................

PF14609

MOD21_SCHPO/60-677--IAMLLWMVNQASQITSSMTIAR--------PLYNIL...------------.........ILCKDFPNNFLEKDNI..
E4WX70_OIKDI/53-731--ITEIALEIISVDRSTNPWDISS--------RTLSILFEH------------FPTIYKRFESILPEYS..FLLKKCMWR
B6K1F8_SCHJY/48-653--.....STFLNISKIDAGYALPT--------PLLYIIKTS------------QRVNRQAAKSLLKQTSEKYFAESCS..

PF04130

Q2UAG9_ASPOR/234-750..GRGAWDDR..........YLLT........ELAQSAFST.................LPFIDPSRVIVRSSKDPT....
Q4WEE6_ASPFU/229-741..GRGTWSDR..........YLLT........ELAQSAFSS.................MPFIDHSRIIVRSHQD......
A1C564_ASPCL/237-752..GRGAWSDR..........YLLT........ELAQSAFSR.................LSFVDPSRLIVRSHQD......
Q5AUB0_EMENI/232-744..RKGGWNDR..........FLLT........ELAQDTFGS.................LPIIDSSRLIVRSAKD......
Q0UBK8_PHANO/224-738..GRRGWNDR..........YVLT........EITRTIFGT.................VMPHQDAERIVARSSK......
Q2HBB4_CHAGB/228-739..LNNSWQDR.........FTLTE........VAQEAFSTCLDSYRLSANIDPRGLGRSALVARS...............
Q1K6Z8_NEUCR/239-749..FSTSWNDK.........FTLTE........IAQEAFSQCVAGHRLSADIDQRYIADSPAASRA...............
F4HUK8_ARATH/48-872..GESSNDDF..........ELNI........IIQESIRNS.................ADTMLLSSPDALVVSISSEGCL
Q6H548_ORYSJ/50-922..GNPWDDDF..........ELNT........LLQESIRNS.................ADKMLLTAPDSLVVSLAKHDTR
GCP5_MOUSE/273-942..KETWQNVS..........FLNV........QLQEAVGQR.................YPEDSLRLSISFENVD......
F1QBQ4_DANRE/270-933..KESWQQLA..........FLNV........QLQESVGQR.................HPEDSHRLSIFLETID......
C3ZYG0_BRAFL/302-1685..GEEWQDVS..........VLNS........QLHSAIQQH.......................................
Q7PX58_ANOGA/302-918..GENWANPY..........LLTI........QLNDILASR.................FNDMTSLFTVEVNRTAG.....
A0A0D1E2A2_USTMA/319-997FNDALEIHQQSNGGEAWIDVNLVRFCTVNDDMDRAAAIRQR.......................................
Q9VTS3_DROME/266-1244VGPRSLSQKG..........ILDT........ILTNALAAC.................SA.DETTVSENLTLNCTT....
Q2M0Y2_DROPS/276-1186MDPRSLCQKG..........VLDV........ILNNALGGC.................AASDDTLVAQNLTLDCTK....
Q17IM7_AEDAE/330-1376RSPDELLNYQ..........TLHT........ILDSALCS..................SAAGADKNADRLSFNVEL....
Q0UQH9_PHANO/170-704LLKTGEVAQANTTISGRDNDELPG........QLNFAIRNL.................TEAEQEKVMDP...........
Q5BEM5_EMENI/175-843CYS.GEYADGSGNPEFEKEKELPG........GLSFSIREL.................TEAEIAKCKNP...........
Q2UCE2_ASPOR/176-851CHGFDDRSESSAGNEPRKERELPG........GLSFSIREL.................TAEEVTKCKDP...........
Q0D0R6_ASPTN/174-839CYNADDQRDSTENAEFRREKELPG........GLSFSIREL.................TDEEAVKCKDP...........
A1CPI0_ASPCL/179-855DCNMDERLDNSGNVEFLKERELPG........GLSFAIRDL.................TDEEITKCKDP...........
Q4WSG8_ASPFU/170-850DCNMDERLDNSSNAEFLRERELPG........GLSFSIRDL.................TDEEIVKCKDP...........
Q2H076_CHAGB/195-897TNAGANNSSS..........TLPG........DLSFTVRDL.................SPQEIDRCMDP...........
A0A0D1BZI3_USTMA/198-1067HEEKLHRTGKTEDAISLAFKDLDE........RLSFAVVEP...........................RSTSSSTRSKSK
A8BFK8_GIAIC/197-740..SLCSILSSTSGGDKYKLSMLE.........KIEQAMMSC.................NVSNLPS...............
A2E6U4_TRIVA/44-540..DKSEISPA..........DLED........LMSIVY..........................................
GACP2_ARATH/70-583..KVHEISVE..........KLQS........LLDLALRTT......................AAAAD............
Q0JBZ2_ORYSJ/73-597..KPEEISVE..........KLQS........LVDIALRST......................AAASD............
GCP2_DROME/204-721..NVDHVLPM..........TLEN........LLGLTLRIS......................SARND............
Q29G36_DROPS/282-800..NVDLVLPM..........TLEN........LLGLTLRLS......................SARND............
Q16HU4_AEDAE/210-728..DVDELRPM..........RLEN........LLEVTLNMS......................SARYD............
Q7Q703_ANOGA/248-764..SVDTLHPI..........RLAN........LLDVTLGLS......................SAKYD............
GCP2_MOUSE/220-738..PVEDIILT..........RLEA........LLELALRMS......................TANTD............
SPC97_DICDI/430-1044..PLDQINMV..........KMNS........LLQLSLRTS.....................SISEED............
A0BDB2_PARTE/150-660..DIREISKE..........KLES........LFDLAVR.......................SIASND............
Q23AE3_TETTS/242-771..QARQVSKE..........KLES........LLEMSIRTS......................SLSSD............
SPC97_YEAST/62-688..HYRNDNNA......................NYDKLLQNF.................ELERQSENPNN...........
Q6FQY5_CANGA/70-712..EYSESRSVL........RRLEQ........SWDVEVDDR.......................................
Q756H1_ASHGO/63-723..SRSESIQL..........KLQR........NWQQCQKNT...........................TEH.........
Q6CXD9_KLULA/57-697..SPTESTLH..........KIQR........HFDDILKEI.................SVEDTYRH..............
Q6BGV8_DEBHA/61-751..NKHAISTS..........RLSK........LYDDTLQHKKDDFQVKDINKQNSISDNKMN..................
Q59PZ2_CANAL/94-759..GKLKISVS..........RLQK........QYDDIFKEKI...............ENKVGVRP...............
Q6C787_YARLI/102-681..PASQSSVT..........KLQY........LLDLCLRQP....................GSITSTD............
ALP4_SCHPO/74-693..PAKYISIT..........KLQS........QLDLALRQP....................GTITATD............
Q4X128_ASPFU/183-784..PAKNVNEN..........KLQS........LLDLVLRQP....................GSIAASD............
Q7S902_NEUCR/140-744..PVKVVNTG..........KLQS........LLDLVLRQP....................GSIVCLD............
Q0V2V1_PHANO/184-787..PAKAVNVG..........KLQS........LLDLATRHA....................GSVAVED............
Q5KPG7_CRYNJ/181-812..PAKSASII..........KLQS........LLDLAVRNP....................SSSSSND............
Q4Q0X5_LEIMA/136-766..HPDRIKQH..........SMQV........LLQAAVARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTTAA
Q7XUI5_ORYSJ/65-1092.FVKSEHKRA..........EIQG........LLDLALQRSSCDSDPYKERLFVYMNEQPVVSLKAST............
Q9VS91_DROME/97-627..NVERLIPE..........KLQT........LLAETLHKS................ND.....................
Q2M118_DROPS/72-608..GVDRMIPE..........TLQS........LLMETLQKF................DD.....................
Q29HV5_DROPS/23-546..PGTEIFAH..........DLSA........MLDTALRCT.................NAQYDDP...............
GCP3_DROME/235-758..PGLDIYAN..........DLTS........MLDSALRCT.................NAQYDDP...............
Q16YQ3_AEDAE/217-729..PASEIYQH..........DLFS........ILAAAVRNS.................FSEQEEP...............
GCP3_MOUSE/251-761..PATTLYQH..........NLTG........ILETAVRAT.................NAQFDSP...............
Q1K720_NEUCR/225-737..PAGAQYRH..........TLTA........QLEHAIRGS.................NAQYDDP...............
ALP6_SCHPO/196-713..PANTLFRH..........NLTA........SLESAIRSS.................NASYEPE...............
A0A0D1E4X1_USTMA/283-861..PANSLFRH..........NLTA........SLETAIRGS.................NAQHDDA...............
Q5KL44_CRYNJ/148-724..PAINLYRH..........HLTS........DLESAIRGS.................NAQYDSP...............
GACP3_ARATH/192-713..PANNISSF..........ELAG........FLEAAIRAS.................NAQYDDR...............
SPC98_DICDI/112-705..PTSQIQRH..........KLVG........WMDTAIRNS.................NAQFEEQ...............
Q383E4_TRYB2/204-700..MSHMVQTS..........LVRD........HMQSALLDI.................T.....................
Q6FLE0_CANGA/180-724..SSDLLSDY..........SLTR........ILQESVQQS.................SLRSLINRGDN...........
SPC98_YEAST/187-740..PSDSLPNY..........KLTR........VLQEAVQLS.................SLRHLMNSPRN...........
Q74Z68_ASHGO/190-740..PVHQLQSY..........QLTK........CLQESVQRS.................SLRNYLNKHDN...........
Q6CIT0_KLULA/175-721..PSQLLESH..........HLTK........CLQIAIQQS.................SLRNRLNKSDN...........
Q6BX70_DEBHA/183-753..PANSLTSN..........QLAK........VLIESINNS.................SVKNYRS...............
Q4U9K6_THEAN/45-615....................RLQI........HVDRDWDNSPGSFR.......PKLYLKCDDLYNFAGALEYYSHYGRDV
Q4N294_THEPA/45-610....................SLQS........HVDRDFCNSTDTFK.......PKLYFKCDNLDNFAGALKYFSHYARDL
A8BD62_GIAIC/283-863..SRSVANIL..........RIRS........KFKMVIKTS.................SLANLPYNERMNVIVCPELFKH
Q0UGY4_PHANO/31-649HRGPLPIRSNTTKGVVIREAEISQ........TLARSLAVL.................STLSGNDEHTDDI.........
Q2H2M0_CHAGB/4-638AENLAYQKRDGLSTVTVKEGEVAA........VLARTWAAM.................GSMQGDHAEEDEG.........
Q2UDA7_ASPOR/4-644NLASKGKFAEGLQGLSIKEGDVAN........ALSQALAEL.................YSLQNEEDPVDDE.........
Q0CV34_ASPTN/4-641TLASRGKSREGLELITIKEGDVLS........ALSQAWAEL.................YSLQNDEDPGDDA.........
Q4WZU3_ASPFU/32-668LLAGRVRAQTELEGLVVKDGDVVH........ALAHTWAEL.................YSLQNEEDPVDES.........
A1C7R2_ASPCL/32-668LFSARANTHTGLEGLVVKEGDVLS........TLTQSWTEL.................YSLQNEEDPADEA.........
C8VMB1_EMENI/4-637SSSAR.HVSNSVDGLAIKEGDVAT........TLTKTWAEL.................YSLQNEEDPVDDE.........
Q5KH00_CRYNJ/4-686..DKLITSNPHSSSSIIREQDLDL........ILRRASVGT.................SAELD.................
Q584R6_TRYB2/3-521..VDDTISRS......................TVTEAVVNR.......................................
Q0IG23_AEDAE/4-557..FSKGITDGS........SR...........DMNRAFQLA.................ANSVNITEDVEQFSFALPP...
Q7PWU6_ANOGA/4-573..IGKEINDGT........TR...........DLNRALKLA.................ANSINLGEDIEQFSFELPCGSR
GCP4_DROME/4-548RFK.............................NVTRSFELA.................ATVTGITDDLDKFSLICQR...
GACP4_ARATH/4-645..PPRQSTGE..........S...........DLMVPFQLA.................ATKTIAEEDKYFSRVSLRMPSF
Q60F24_ORYSJ/4-649..PPRQSTAE..........A...........DLMVPFQLA.................ALKTIGDEDKYFARVSLRMSSF
Q05AR5_XENTR/4-571..PPTAVTEH......................DINVAFQLS.................AHKVLLDDDNLLPLLNLTIDYH
Q01B37_OSTTA/4-547..PPKLGNAT..........R...........ELATPFAQS.................AVTAMPSNIAIYSTFKLVYSSA
A0C933_PARTE/4-693..PQTQQALQ......................ELNFNLHKM...........................DYDQTEKMDMF.
Q24CL5_TETTS/4-831..PPKPESEG......................HLNNVIVPH.................TLIRLRNDDEIVNAFKNFQFK.

PF14609

MOD21_SCHPO/60-677........ALQLGS...IVFDQSPTLNNLLVEMEILI-------------------------------------------
E4WX70_OIKDI/53-731YVNCIQLFASQR.NFMKVVPTFPLRFTNTEKDSENFI-------------------------------------------
B6K1F8_SCHJY/48-653........ESQAPSFLVFVLRYQQALYELTTIQETEK-------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................NKAHTHSRSVKLLQ..................................................
Q4WEE6_ASPFU/229-741..................SQGRSRSVKALK..................................................
A1C564_ASPCL/237-752..................PEGLGRSVKMLR..................................................
Q5AUB0_EMENI/232-744..................HDTRSRSVKVLS..................................................
Q0UBK8_PHANO/224-738..................VKATSQSVKDLA..................................................
Q2HBB4_CHAGB/228-739.......................SVRHSLP..................................................
Q1K6Z8_NEUCR/239-749.......................SVRNTLP..................................................
F4HUK8_ARATH/48-872DRDKDDKGDVKSLSSPRESSVNNYAIDCLE..................................................
Q6H548_ORYSJ/50-922ND.......EETTSISRKGRAQGFGIEALD..................................................
GCP5_MOUSE/273-942..................TTKKKLPVHILD..................................................
F1QBQ4_DANRE/270-933..................PARKKQPVNNLD..................................................
C3ZYG0_BRAFL/302-1685..........................HNLR..................................................
Q7PX58_ANOGA/302-918.................YKLDTTTVLLAID..................................................
A0A0D1E2A2_USTMA/319-997.......................SRIHRLA..................................................
Q9VTS3_DROME/266-1244................IPDTLNFLSVEATS..................................................
Q2M0Y2_DROPS/276-1186................IPDGLDFMSLEATG..................................................
Q17IM7_AEDAE/330-1376................IPERFDLYHPNVVS..................................................
Q0UQH9_PHANO/170-704.......................DALSALD..................................................
Q5BEM5_EMENI/175-843.......................NAIEALD..................................................
Q2UCE2_ASPOR/176-851.......................NAIEALD..................................................
Q0D0R6_ASPTN/174-839.......................DAIEALD..................................................
A1CPI0_ASPCL/179-855.......................NAIEALD..................................................
Q4WSG8_ASPFU/170-850.......................HAIEALD..................................................
Q2H076_CHAGB/195-897.......................HGLEALD..................................................
A0A0D1BZI3_USTMA/198-1067...........TKPRSKPTWTDPSSIDALD..................................................
A8BFK8_GIAIC/197-740.......................HVLGCVDVRID..............................................
A2E6U4_TRIVA/44-540.......................KPFEFISVKLEKQQLLSVYTTIQSVT...............................
GACP2_ARATH/70-583.......................PRHEDLTCCVDRASLLTTLGMHK..................................
Q0JBZ2_ORYSJ/73-597.......................PSHEDLTCCVERSSLLKKLSTLKDLDCAY............................
GCP2_DROME/204-721.......................PYKDDLHCELLPYDLVTQMSKIMK.................................
Q29G36_DROPS/282-800.......................PYKDDLHCELLTYDLVTQMSKIMN.................................
Q16HU4_AEDAE/210-728.......................EYNDDLKTMLLPYGIVTQISKIVKK................................
Q7Q703_ANOGA/248-764.......................EYHDDLKTMLLPYGIVTQISKIVNN................................
GCP2_MOUSE/220-738.......................PFKDDLKIELMPHDLITQLLRVLAIET..............................
SPC97_DICDI/430-1044.......................EFKDDLECEFIPYKLVDQLLNIININNFNNPTTTTTTNTSSNNIT............
A0BDB2_PARTE/150-660.......................AYKDDLVCYIDQYTISEQIYAIRNLR...............................
Q23AE3_TETTS/242-771.......................PYVEDLTYEFSQYTLKEQLFAYQNSQMNPN...........................
SPC97_YEAST/62-688.......................LMRQLLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMH.............
Q6FQY5_CANGA/70-712.......................SLVQRLVSLRYSTVSFRESLLQVQRDEIAREDVTMRDESSDDNDALLRAS.......
Q756H1_ASHGO/63-723....................KDSLILQLMTVRLDQMSLAEVIMQFEEDEIPEDQLNSNGNDVDHGDSTNGGSGVAGPTAD
Q6CXD9_KLULA/57-697.......................MILSKLTSVKIDTCPFYETLRQFIDEQETGLLNADNFQQLK................
Q6BGV8_DEBHA/61-751..........................DVLSYCSGLSIDFTNFYDLAEEILNVKSFDAEEAFKNGQNSN............
Q59PZ2_CANAL/94-759.......................SVYDVLKKNQKLSVTSESLYKVVEELMEKNSDYLISDNNLR................
Q6C787_YARLI/102-681.......................QYKDDVVASLAPTTVWDYLLQIVCATDP.............................
ALP4_SCHPO/74-693.......................PHKEYVTVEVNQTSLIDWLMHIVSISGLEEGTSSQGNEVWNESI.............
Q4X128_ASPFU/183-784.......................PFKEDVKVRMNKIGLTKWLMQVVSVSGIDQDN.........................
Q7S902_NEUCR/140-744.......................KFKEDVKVEMNEVTLLKSLQRVVNITGIE............................
Q0V2V1_PHANO/184-787.......................PYKEDIKVHMNDTGLTNWLMKIVNVQGLDQDA.........................
Q5KPG7_CRYNJ/181-812.......................PFKDDLKVVMQSQGLYDWLLKIVSKTGSLTEEG........................
Q4Q0X5_LEIMA/136-766AVGEGATTALPSRRSMGGSGGEVDARRSLE..................................................
Q7XUI5_ORYSJ/65-1092.......................CGLDVLD..................................................
Q9VS91_DROME/97-627.......................FIKDNVRCQLKVCDVATLLGRQHKAQRAVED..........................
Q2M118_DROPS/72-608.......................PFKDLMRCQLKDRDVASQLQKLVNREHGEADK.........................
Q29HV5_DROPS/23-546.......................EILNHLDVVAQPPF...........................................
GCP3_DROME/235-758.......................DILNHLDVIVQRPF...........................................
Q16YQ3_AEDAE/217-729.......................EVLNYLDVHFLTHY...........................................
GCP3_MOUSE/251-761.......................EILKRLDVRLLEVS...........................................
Q1K720_NEUCR/225-737.......................EITNRLDARMLQLS...........................................
ALP6_SCHPO/196-713.......................YVLKRLDARLLELS...........................................
A0A0D1E4X1_USTMA/283-861.......................EILRRLDARILEFS...........................................
Q5KL44_CRYNJ/148-724.......................DILRRLDARILEYS...........................................
GACP3_ARATH/192-713.......................DMLDRLRVKMMPHG...........................................
SPC98_DICDI/112-705.......................DIVNRLDIALLPER...........................................
Q383E4_TRYB2/204-700.......................PHTKNLDTDLFTMLHCE........................................
Q6FLE0_CANGA/180-724......................NYIINKLDARLLDLG...........................................
SPC98_YEAST/187-740......................SSVINGLDARVLDLG...........................................
Q74Z68_ASHGO/190-740......................NVIINKLDARLLESG...........................................
Q6CIT0_KLULA/175-721......................NLLVNRLDARILELA...........................................
Q6BX70_DEBHA/183-753.......................DYKNRLDARILDLS...........................................
Q4U9K6_THEAN/45-615GSMKVETLDGLETTGFEQDNSLGEWNNSLDF.................................................
Q4N294_THEPA/45-610GVSQLENWNSLESGELRHDKSLGEGNNSFDF.................................................
A8BD62_GIAIC/283-863HLNS....VLYPQTYVPDRATDSPDPKVLN..................................................
Q0UGY4_PHANO/31-649.....................LEVAARVLHLTLKESPSNRPGTPGRAKD...............................
Q2H2M0_CHAGB/4-638.....................LELARDLLRLSMAKSRTATPMTPVLPE................................
Q2UDA7_ASPOR/4-644.....................LDLARSLLQLSMNDKRKGHSVAATPSAG...............................
Q0CV34_ASPTN/4-641.....................LDLAKDLFKLSVYDKRHATASGTGSS.................................
Q4WZU3_ASPFU/32-668.....................LDLARDLVRLSITDSKNRHTVATHSDEI...............................
A1C7R2_ASPCL/32-668.....................LDLAKDLIRLSISGKDNGQVASSFSELS...............................
C8VMB1_EMENI/4-637.....................LDLARELVRLSLKPRDHGQNPGFSGAAA...............................
Q5KH00_CRYNJ/4-686.......................SQLDSLHYKMEKGPLRAMLPTVPVKTPKQTD..........................
Q584R6_TRYB2/3-521.......................TAADAFAYALEMSGLGDVRVFERFSTFVRLPI.........................
Q0IG23_AEDAE/4-557..............KEEVDSFCYETKGILS..................................................
Q7PWU6_ANOGA/4-573............DGSGEESSFCYETKSAVG..................................................
GCP4_DROME/4-548...............STSEPDDTSDFNFLQ..................................................
GACP4_ARATH/4-645............GVTVRSSQADMVRS...KVSLTGKANL.........................................
Q60F24_ORYSJ/4-649............GIKASTSQKDLQKSSTPEISSQGKAT..........................................
Q05AR5_XENTR/4-571............GKEHKDMSQPREGPSRDTSPREP.............................................
Q01B37_OSTTA/4-547............LTRSEENAAERPTTPSTAFLPRVHV...........................................
A0C933_PARTE/4-693............IYNNGFEYKTFQSLNNLQIKNNVIQTINILRMGPARGPEDWSGVFRDVKQSIENGFTLQIVFKFKQQL
Q24CL5_TETTS/4-831............IKNNGFEFKDFSQVNELNIFGNVHQQRNNYIRFQPLKNSKLSGSLWYKFKQNIEMGFKLSFTFRFKKE

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723GI..............................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693SKPLGGYSILQVPQDLSTSLVLLFCQDEENGVFIRLKLDQQKVSSLSVESKIK...........................
Q24CL5_TETTS/4-831RNYLPINQFSKLGSPNINLLQSSTKGSVNLLQSEEQSPLKSRFSYFTSSIAQDETNENGLLIVFQNTKEISSYKKAAPYR

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
Q6H548_ORYSJ/50-922................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q2M0Y2_DROPS/276-1186................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q7XUI5_ORYSJ/65-1092................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
Q29HV5_DROPS/23-546................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
Q5KL44_CRYNJ/148-724................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693.............................................FKEEIIYKWKLDKIDFSEGDLHSLKINYQNDELSL
Q24CL5_TETTS/4-831LQDMNEYVAIKFYTKETNKKGAASVAKEINDQKCSIQMVVCNNGKPTYIKNHEFDCDRVNFLDGQLQVIKINYDGENIAL

PF14609

MOD21_SCHPO/60-677----------------------------------------------------RSKI.......LKLGK.SLDLSFDF...
E4WX70_OIKDI/53-731----------------------------------------------------DECVARSNNYPVPPLEPALSLLYEIMRM
B6K1F8_SCHJY/48-653----------------------------------------------------QSDLTVQDTSQLSAGSFSLELSDTL...

PF04130

Q2UAG9_ASPOR/234-750.....................................................................AISFDYVL---
Q4WEE6_ASPFU/229-741.....................................................................TISFDYIL---
A1C564_ASPCL/237-752.....................................................................MISFDYIL---
Q5AUB0_EMENI/232-744.....................................................................SLSFDYIL---
Q0UBK8_PHANO/224-738.....................................................................AVSLDFAL---
Q2HBB4_CHAGB/228-739.....................................................................FIRLNYRL---
Q1K6Z8_NEUCR/239-749.....................................................................AIRLIYHL---
F4HUK8_ARATH/48-872.....................................................................SLKFTYKV---
Q6H548_ORYSJ/50-922.....................................................................VLNFTYKV---
GCP5_MOUSE/273-942.....................................................................GLTLSYKV---
F1QBQ4_DANRE/270-933.....................................................................GLTLSYKV---
C3ZYG0_BRAFL/302-1685.....................................................................SPDVQAET---
Q7PX58_ANOGA/302-918.....................................................................EIRVLYNP---
A0A0D1E2A2_USTMA/319-997.....................................................................DVKVEYEV---
Q9VTS3_DROME/266-1244.....................................................................MLKLNCKI---
Q2M0Y2_DROPS/276-1186.....................................................................MLTLKCKV---
Q17IM7_AEDAE/330-1376.....................................................................MLNLSYRV---
Q0UQH9_PHANO/170-704.....................................................................FLRLQYVP---
Q5BEM5_EMENI/175-843.....................................................................FLCLQYKP---
Q2UCE2_ASPOR/176-851.....................................................................FLRLQYKP---
Q0D0R6_ASPTN/174-839.....................................................................FLRLQYKP---
A1CPI0_ASPCL/179-855.....................................................................FLRLQYKP---
Q4WSG8_ASPFU/170-850.....................................................................FLRLEYTP---
Q2H076_CHAGB/195-897.....................................................................FLRLSYKP---
A0A0D1BZI3_USTMA/198-1067.....................................................................WLTLSFHP---
A8BFK8_GIAIC/197-740.................................................................NSKSNFYVTYSI---
A2E6U4_TRIVA/44-540.................................................IKGATKQKNIRITSGTTQWEFFTLAPKV---
GACP2_ARATH/70-583....................................................DTDSNSIEDPMSITGLETFSLSYKV---
Q0JBZ2_ORYSJ/73-597...............................................PSDKLVAADVDHPMPLSVTGLETFCLSYKV---
GCP2_DROME/204-721....................................................KEENWQAQPRLDLSGLECFAFTYEV---
Q29G36_DROPS/282-800...................................................QKEEYWQSQDRLDLSGLECFAFTYEV---
Q16HU4_AEDAE/210-728...................................................EDVFLDTLGDTSQLKGIECFTFNYNA---
Q7Q703_ANOGA/248-764...................................................EDAFVDTLSDTSQLKGVECFTFTYKA---
GCP2_MOUSE/220-738.................................................KQEKAMTHADPTELTLSGLEAFSFDYMV---
SPC97_DICDI/430-1044..............................ATTNTSSNNTTINTTVNTTLIQSTSAHEVLKTNKLFGIESLAFNYNV---
A0BDB2_PARTE/150-660..................................................GIDINENKPPRNQKLKGIELFTLDIKV---
Q23AE3_TETTS/242-771..............................................LLNDQNQEKFKIHTPALTLKGLDLFSLDYRI---
SPC97_YEAST/62-688...............................ANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHLKFDINI---
Q6FQY5_CANGA/70-712..........................NFENVKRILFEDRHHTDEYDDHGQQGHEQGREQRREPALSNIHYLEFDLVV---
Q756H1_ASHGO/63-723.................DSLRFADTTVNTNRHSILQARNFNNLKDMLLKELDHTVTGSSQRKRKLHSVHHLQFELVM---
Q6CXD9_KLULA/57-697..................................GMLVAEEQNHTSQGSNELDEGRKSKKKKNATPTAMYVQFETSI---
Q6BGV8_DEBHA/61-751...............................IFKALLNNSLERDQINSAGSNISPNSYDPDHSDEYTISGVNLDMDL---
Q59PZ2_CANAL/94-759..................................GIFHRVASLRDDSRLTISSTADSATENVKDEPTITSVDLTIPL---
Q6C787_YARLI/102-681................................................NESGWESDSRKMSMDDMPVSCAFQLDFKV---
ALP4_SCHPO/74-693................................TKQADVGNETRNFESEHNRSTQGTSKVGSDKDINGFETMQLCYKV---
Q4X128_ASPFU/183-784...........................................PEAVLERYQAPQTQGGEDDKDIVGFDALELDYSV---
Q7S902_NEUCR/140-744..............................................QGEALQLTSNQPLEGDKNATGFTSLQLDYTV---
Q0V2V1_PHANO/184-787...........................................AAASISNYTPANTAPITDDSNITGFQALQFDYAM---
Q5KPG7_CRYNJ/181-812..........................................ELDFALGDIHEEEGSKREKERPLIAIDALAFDYSV---
Q4Q0X5_LEIMA/136-766.....................................................................LLQLETDL---
Q7XUI5_ORYSJ/65-1092.....................................................................DILLGYKV---
Q9VS91_DROME/97-627.............................................EEEEEKESCSEQDPPEVLNLYGYEALALGYET---
Q2M118_DROPS/72-608...........................................NEVNTSNTTSDDDGDPFGRFTLYGYEAFALRYEP---
Q29HV5_DROPS/23-546..............................................................LGDTGWDIVSLQYVV---
GCP3_DROME/235-758..............................................................NGDIGWNIISLQYIV---
Q16YQ3_AEDAE/217-729..............................................................EGESGWDVFGLTYKV---
GCP3_MOUSE/251-761..............................................................PGDTGWDVFSLDYHV---
Q1K720_NEUCR/225-737..............................................................HGDIGWDCFTLEYKI---
ALP6_SCHPO/196-713..............................................................HGETGWDVFTLEYKV---
A0A0D1E4X1_USTMA/283-861..............................................................TGDTGWDTFTLEYKL---
Q5KL44_CRYNJ/148-724..............................................................HGETGWDCFALQYKV---
GACP3_ARATH/192-713..............................................................SGDRGWDVFSLEYEA---
SPC98_DICDI/112-705..............................................................PGNIGWDIFSLDYHV---
Q383E4_TRYB2/204-700..........................................................IVKDDKIIGWDAFVVTMSV---
Q6FLE0_CANGA/180-724..............................................................HGAIGWDVFTLDFIV---
SPC98_YEAST/187-740..............................................................HGSVGWDVFTLDYIL---
Q74Z68_ASHGO/190-740..............................................................HGSVGWDVFTLDYLV---
Q6CIT0_KLULA/175-721..............................................................HGSSGWDVFTLDYLV---
Q6BX70_DEBHA/183-753..............................................................HGNIGWEVFTLEYKI---
Q4U9K6_THEAN/45-615....................................................................RGIVLCSDI---
Q4N294_THEPA/45-610....................................................................RGIVLCCDV---
A8BD62_GIAIC/283-863.....................................................................LLGLQYDV---
Q0UGY4_PHANO/31-649.................................................AESVLPQILDLSFNELLLLAPCSLFMDV---
Q2H2M0_CHAGB/4-638...................................................AEMPVIAPTPFRNLLFSVPVVLTLQI---
Q2UDA7_ASPOR/4-644.................................................GSDHLANISDIPFDDLLFPSPTVLSAQV---
Q0CV34_ASPTN/4-641...................................................DTSAVISDVSFEDLLFPAPTVLSVQV---
Q4WZU3_ASPFU/32-668.................................................GSDLVAELSDVSFEDLLFPTRTSISVEV---
A1C7R2_ASPCL/32-668.................................................GADLTAELSDVLFDDLLFPTPTSLSVEV---
C8VMB1_EMENI/4-637..................................................ADPVAETSNTPFDDLLFPTSTSLSVHV---
Q5KH00_CRYNJ/4-686............................................IESKSDTVEHRNSIRALFSSSLLGTPLILTTTV---
Q584R6_TRYB2/3-521...........................................EAEEGEGSGTLRSIEDTARAILSCMRGLGLHYVP---
Q0IG23_AEDAE/4-557.....................................................................YITLKYKV---
Q7PWU6_ANOGA/4-573.....................................................................HIMLKYKV---
GCP4_DROME/4-548.....................................................................GLSLKYEY---
GACP4_ARATH/4-645...........................................................TSDTSVDGWDAIALEYSV---
Q60F24_ORYSJ/4-649............................................................SELALDGWDSIALEYSV---
Q05AR5_XENTR/4-571...............................................................PISGWAALGLSYKV---
Q01B37_OSTTA/4-547..............................................................PEYDAWDGIDLECSI---
A0C933_PARTE/4-693IIDDTQSDTQCKTDILPPSQWKKVAFKFQKYFQLELGRCMVGIKQYGQIVDLYTWKMIGSNFLNDASWSGLTLKYQV---
Q24CL5_TETTS/4-831HLEDIDNMNRGLQSQLFTFPFKFNKFLNLDMGRAYVGFIQDSNNGNCAMDIMSWQMYSSNVFNNQDAWNGLTMDYQV---

PF14609

MOD21_SCHPO/60-677..........QSLMGEFENLIKQQEEAKKSLWSKRFSRFYYGHYVFVNTCHNFFLTLYQSFTEVDENSIFNGVFETLNND
E4WX70_OIKDI/53-731RAVLKNWGVEERFSDRFFSLETAFDENWDELSEKYFGKRIVHDDAYLST.RVWVTREKKKFTK.EQIASF.GVWADDMKE
B6K1F8_SCHJY/48-653..........QSYTLRF.......KEAYLALNQKKANKYVYGHLVFMKTVYDFLLLLSWECSS.GGVSIF..........

PF04130

Q2UAG9_ASPOR/234-750----P.WPVANIIT...KDAILSYQRLSTFLMQIRRAKHTIVKQRLQYS-PEIY...EARK...................
Q4WEE6_ASPFU/229-741----P.WPIANIIP...KDAIHRYRRISTFLMQIRRAKHLIVKQRLKYA-DETD...EFSRDRSSNA.............
A1C564_ASPCL/237-752----P.WPVANIIT...KDAIQSYQRISIFFMQIRRAKQLVVKQRLQYT-TETD...AFSTDRASNA.............
Q5AUB0_EMENI/232-744----P.WPVANIIT...KDGIAAYQRVSNFLMQIRRAKYSIVKQRLQYL-NHDT...NQAKGSKGQT.............
Q0UBK8_PHANO/224-738----S.WPIQNIIQ...RSSLPVYQQVLTFLLQSYRAKYLLQRARPGRG-PQLK...SAR....................
Q2HBB4_CHAGB/228-739----S.WPVQIVVP...EEDIQGYQTLFTFQLQTQRALSLLQYPILPSQ-RGGA...D......................
Q1K6Z8_NEUCR/239-749----P.WPIQMIIS...PAEVKGYQTMFVFLLQTRRAIYLLKHPLLGTT-TTPA...RH.....................
F4HUK8_ARATH/48-872----P.WPLELIAN...SEAIKKYNQ.......VKRAKYVLD.KARRLM-WKGK...GSATKI.................
Q6H548_ORYSJ/50-922----S.WPLDLIVN...TEALKKYNQVMAFLLKVKRAKFILD.ETRKWM-WKGG...GSTMHN.................
GCP5_MOUSE/273-942----P.WPVDIVIS...VECQKIYNQVFLLLLQIKWAKYSLDVLLFGEL-GNAA...ERSQAKEDIPRDQDTPSQF....
F1QBQ4_DANRE/270-933----P.WPVDIVIS...SECQKIYNQVFLLLLQIKWAKYSLDTLRFSDL-TVAA...KRKEGGQP.EENTAK........
C3ZYG0_BRAFL/302-1685----D.QPEE.......SDDIPARQK.......................-..............................
Q7PX58_ANOGA/302-918----S.HDLSNMIN...DDTMASYNSVFRFLLKVKWALGTLEMLRFPEL-LKKR...PPYANFGMLD.............
A0A0D1E2A2_USTMA/319-997----P.WPLTFVFP...TGCMRFYQYIFSTLLQANYAQWKLA.STLKLA-KPET............M.............
Q9VTS3_DROME/266-1244----D.WPLNMVIS...SETISKYGQIFGYLLKLRHVSFVLD.GTYEYL-QQMG...KLLGPELRTC.............
Q2M0Y2_DROPS/276-1186----N.WPLNLVIS...GETITKYGQIFEHLLKLRHVTFVLE.GAFQHL-QHLA...KLHGAALRTA.............
Q17IM7_AEDAE/330-1376----E.WPLNLILN...PETIEQYTNIFKYLVKVRRVSFVLG.KSFQLL-KEAH...KQFGKQMLLS.............
Q0UQH9_PHANO/170-704----P.TPLNLIIT...TEALDKYDLVFKFLLRLLRMLFVIS.HLPHRF-NDLE...SRQ....................
Q5BEM5_EMENI/175-843----S.NVLEVIIT...QRSLRKYDQLFKQLLRLLRMVSVVK.GLIRDS-TARN...SLSGDT.................
Q2UCE2_ASPOR/176-851----S.DVLEAIIT...SRSLNKYDRLFKHLLRLLRMVSVVK.GLIRDS-TGRD...SLSGHP.................
Q0D0R6_ASPTN/174-839----S.DVISTIIT...YRSLAKYDRLFKHLLRLLRMVSVVK.SLIRDS-TARN...SLSGDT.................
A1CPI0_ASPCL/179-855----S.AVLETIIT...QRSLTQYDRLFKHLLRLIRMVSVVK.GLIRDS-TARS...SLSGDT.................
Q4WSG8_ASPFU/170-850----S.PVLETIIT...QRSLDQYDRLFKHLLRLIRMVSVVK.GLIRDS-TARS...SLSGDT.................
Q2H076_CHAGB/195-897----P.ATLRPIMS...PAILLKYDRIFKLLLRVLRMLYVAN.QLSRDQ-RRNS...GEE....................
A0A0D1BZI3_USTMA/198-1067----P.PLISPLLT...QLAQSRYQRLWNMLLRIKRCKVAMR.SAWACT-FKST............SAAFT.........
A8BFK8_GIAIC/197-740----K.DPLTSIIT...PGQIRIYETIFQIQWRLRSADDKLD.QIILLT-NFFY...RRNTQQILTNAGRVGIFRLHYR.
A2E6U4_TRIVA/44-540----S.WPISIVIS...KEFQEKYALFFRFILLWKRIERKFS.NLYSFV-NTFM...RKHSKTSSMT.............
GACP2_ARATH/70-583----Q.WPLSIVIS...KKALSKYQLIFRFLFHCKHVERQLC.GAWQIH-QGIR...SMNSKGTA...............
Q0JBZ2_ORYSJ/73-597----Q.WPLSLVIS...RKSLTKYQLIFRLLFHCKHVSRQLC.TAWQIQ-QGFR...SVKILGTP...............
GCP2_DROME/204-721----K.WPCSLVLN...HISISKYQMLFRQLFYCKHVERQLC.KIWKEN-SIAR...QFEPQAASL..............
Q29G36_DROPS/282-800----K.WPVSLVLN...HIAISKYQMLFRQLFFCKHVERQLC.KIWKEN-SIAK...KFSPQAAEL..............
Q16HU4_AEDAE/210-728----Q.WPVSIVLN...RWTISKYQMIFRQLFYLKYVERILC.RVWIAN-NRTK...QFAPQTAKL..............
Q7Q703_ANOGA/248-764----Q.WPVSIVLN...LWTISKYQMIFRQLFYLKYVERILC.RVWIAN-NETR...QFAPNPAKL..............
GCP2_MOUSE/220-738----K.WPLSLIIN...RKALTRYQMLFRHMFYCKHVERQLC.SVWISN-KTAK...QHALHSAKW..............
SPC97_DICDI/430-1044----G.WPLSLIIS...RKSLIKYQIIFRHLFLCKHVEKVLV.DTWSQH-QFRR...SSYNKPGLST.............
A0BDB2_PARTE/150-660----E.WPANLIFS...RASLLNYQILFRSLMSLNYLLKQLN.EAWVFQ-KQLK...DTGLHQK................
Q23AE3_TETTS/242-771----K.WPLNLIFN...RKTLTKYQLIFRHLFNCKYIERQLS.NAWLVQ-QSMK...ELNVQRI................
SPC97_YEAST/62-688----P.YPLNIIIS...RTCMIKYQIILRYQLVLQYHSRLLD.ETWMDL-NKTP...SWKYRGYSHTVK...........
Q6FQY5_CANGA/70-712----P.YPLNILIN...HSCMIQLRILQRYMNILAHTQLSVD.KRFLDI-TKDT...VWRYRHFQEPIR...........
Q756H1_ASHGO/63-723----P.FPLNALVS...KPFIVEYQIIQRHLLLLMYYNRLLE.DTWFEA-NKAW...PIRARGPSTQ.............
Q6CXD9_KLULA/57-697----P.YPLNIIWT...KPVMVQYQMIQRLLLILSYHERLLE.DTWFEI-SKNK...HWRRNSSQQSEYETHGMIFEDNN
Q6BGV8_DEBHA/61-751----P.FPLNMIVG...QNYVLEYQLIFKLQMIVKFINKLID.NTWKEI-NYST...VWKYTGFHPKI............
Q59PZ2_CANAL/94-759----P.FPLNLVLN...QQLSYQYEIMFKLLINIKFISKYNS.SNWQEM-NYSK...IWTNSHFNSSV............
Q6C787_YARLI/102-681----P.FPLSLVIS...RRALIRYQILFRHLAELKNLERLLS.IVWLEM-AKSR...HWRYPTSDERL............
ALP4_SCHPO/74-693----P.FPLSLILS...RKAIIRYQLLFRYFLLLRHVEMQLE.NSWVQH-SKNS...AWRLNSSNAKI............
Q4X128_ASPFU/183-784----P.FPLSLVIS...RKTVLRYQLIFRHLLSLRHLETLLT.TSWLDQ-NKVV...GWRHKSSDRRL............
Q7S902_NEUCR/140-744----P.FPVSLVIS...RKTIWRYQALFRYLLSLRYLETQLS.VTWYTH-ASGT...AWTHRSSNRML............
Q0V2V1_PHANO/184-787----P.FPLSLVVS...RVTLTRYQLLFRYLLSLKHLETDLA.KCWGEQ-GKNA...AWKHRSRNPRI............
Q5KPG7_CRYNJ/181-812----K.FPLSLIIS...RKTIARYQLIFRFLLHLHHLESALS.AMWLEH-KSP....SWRNNSGNEDI............
Q4Q0X5_LEIMA/136-766----Q.WPLTLVLD...GKVTHRLNIIFRLLMWVKTCERHLF.ELWYTN-EILG...E......................
Q7XUI5_ORYSJ/65-1092----D.WPVNIVIT...EEALKTYAEIFRYLVQVRLAVFSLT.EVWRFL-KELT...QLISRSSHNRPD...........
Q9VS91_DROME/97-627----K.WPLSFIIY...PELLEQLQMLQRVLFFLHYVKHHLT.VLWQSP-CEGTG.LQL.....................
Q2M118_DROPS/72-608----K.WPLSFVLH...SEPLQKMQLLQRVILFLRYVQRQLQ.ALWQAP-PEGTIPISQ.....................
Q29HV5_DROPS/23-546----Q.GPLATML....EPTMSTYKALFKPLWRMKHMEFVLSTKIWKEQ-MTNG...KKLRKMNAEIG............
GCP3_DROME/235-758----H.GPLAAML....ESTMPTYKVLFKPLWRMKHMEFVLSMKIWKEQ-MGNA...KALRTMKSEIG............
Q16YQ3_AEDAE/217-729----S.GPLSTIL....EPSLCRYQTFFKHLWNMKHIQFILS.RTWKCQ-TLAA...KSLKSLQNQIG............
GCP3_MOUSE/251-761----D.GPIATVFT...RECMSHYLRVFNFLWRAKRMEYILT.DIRKGH-MCNA...KLLRNMPEFS.............
Q1K720_NEUCR/225-737----D.APVDVVVT...EWGNRQYLKVFNFLWRIKRVEFALA.STWRKC-MTGA...RGVLQTSDETV............
ALP6_SCHPO/196-713----D.SPINVIIT...PYCSRQYLKIFNFLWRLKRIEFALA.HSWRRV-NLGE...RNVFRNLDYTK............
A0A0D1E4X1_USTMA/283-861----D.SPVNTVLD...NQAMVGYQTIFTHLWKIKRVESSLN.SSWLRL-HETG...TSLCRMKRGTGNALL........
Q5KL44_CRYNJ/148-724----E.APLNAVLD...HRAMGDYDRLFNHLWRLKRVEVVLT.QNWMRV-TSGS...KVYERVPGLN.............
GACP3_ARATH/192-713----R.VPLDTVFT...ESVLSKYLRVFNFLWKLKRVEHALI.GIWKTM-KPNC...ITSNSFVKLQSSVK.........
SPC98_DICDI/112-705----D.TPLNTILS...PNDILRYKKIFHFMWGIKRVEYSLA.SIWRKI-RSST...SLSILSPIGG.............
Q383E4_TRYB2/204-700----P.SPLNNIFD...ASAMKVYRRLFRMMFKVKRAEVALK.NSWRQS-VVLD...RIIGGLHNAKRETT.........
Q6FLE0_CANGA/180-724----D.RPLSFVLNVNRTNGRKEYLRIFNFLWKLKKNQFYFE.KESKRT-KEIL...RTFRKFPEFSPVMG.........
SPC98_YEAST/187-740----Y.PPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQ.KEMLKS-NDII...RSFKKIRGYNPLIR.........
Q74Z68_ASHGO/190-740----D.LPLSIVLNVNRPGRKKEYLRIFNFLWRIKKNAFFFQ.EEWLRN-LSLM...RDFRKTRRNKPLVR.........
Q6CIT0_KLULA/175-721----D.QPLSTVMDINQHGSRRDYLRIFNFLWRIKKNEYNYE.QEWQKN-SSIL...KLFRKLNIRVPFIR.........
Q6BX70_DEBHA/183-753----SDSPIYHILN..YNNGTLEYLKMFNFLWKLRHFSYLLN.LNFIEC-SNVK...KNDLRRISSRYIKLKRQLKSKSS
Q4U9K6_THEAN/45-615----E.LPMRLILT...DKIMYRYKLMFKLLFQLKYAEYCLN.QLTQYH-VRAG...QLAIEPELMPRFN..........
Q4N294_THEPA/45-610----E.FPMRLVLT...NKIMYRYKLMFKLLFQLKYAEHSLN.QLTQYH-VRAG...QLAIEPELMPRFN..........
A8BD62_GIAIC/283-863----T.YPLNLVLT...TPVMERLNLVFRHILRAKVSEIELQ.KAWTTL-QRLR...KLERVPHDKIEVYANALR.....
Q0UGY4_PHANO/31-649----P.FPLDLFIT...RGDVEVYSSIHAYLLAIRRAHLHLA.QLWRQS-SIRR...DHPCPPGYQYSNSAHGKLILD..
Q2H2M0_CHAGB/4-638----P.SPLDLFLS...QSDLQTYTAINSYLLSLRRAHIRLT.DLWKIT-SLRR...HHPAPPGPPYGSTRGGRERVL..
Q2UDA7_ASPOR/4-644----H.PPLDLFLS...ASDVLIYSKIHSYLLGIRRAQLHLG.DLWKHT-FLRK...IHPSPLGPPRSNSQFGQNKLR..
Q0CV34_ASPTN/4-641----R.PPLDLFLS...ASDISIYSKIHSYLLGIRRAQLHLS.DLWKHS-FLRK...SYPSPWGPPRSNSAFGQNKLR..
Q4WZU3_ASPFU/32-668----R.APLDLFLS...TSDIAVYSRIHSYLLGIRRAQIRIN.DLWKHS-FLRK...SYPSPWGPPRSNTPFGQSKLK..
A1C7R2_ASPCL/32-668----R.APLDLFLS...TSDISVYSKIHSYLLGIRRAQIRIG.DLWKHS-FLRK...SHPSPWGPPRSNSAFGQSKLA..
C8VMB1_EMENI/4-637----R.PPLDLFLS...AADISIYSKMHSYLLGIRRAQIRLG.DLWKHS-PLRR...SHPSPWGPPRSNSRFGQSRLQ..
Q5KH00_CRYNJ/4-686----T.WPLDLFIS...PQALSAYSDIQAYLTALRHTHLSVL.SCWTAL-SAAQ...RQRRKWTGVTEGGTDE.......
Q584R6_TRYB2/3-521----P.RGLQLVVS...PKAMEYYQRIFSFHIVRRFSLHALH.SVRGLF-SEALLTNKNPSPE.................
Q0IG23_AEDAE/4-557----K.WPLHLLFS...PKTLDKYNEMFRFLLRIRKIQYDIH.QVWSLQ-RENK...VKK....................
Q7PWU6_ANOGA/4-573----K.WPLHLLFS...PRILERYNEMFRFLLRIKKIQHDLL.QIWSYQ-RERR...MKH....................
GCP4_DROME/4-548----E.WPLNLLFS...PTTIERYNNIFRFLLIIRTYQYEIQ.RVWAKQ-TWRA...KSAKDVPP...............
GACP4_ARATH/4-645----D.WPMQLFFT...QEVLSKYLKVFQYLIRLKRTQMELE.KSWASV-MHQD...HIESAQHRKDGLNGST.......
Q60F24_ORYSJ/4-649----D.WPLQLFFT...PDVVSKYRKVFQYLIRLKRTQMELE.KSWAAV-MHQD...HADFSDYCKDRKNGDA.......
Q05AR5_XENTR/4-571----Q.WPLHILFT...PAVLEKYNVVFKYLLSVRRVQSELQ.HCWALQ-MQRK...HLESNKT................
Q01B37_OSTTA/4-547----P.WPMGIFFT...ADTQERYKTIFKYLFRLKRVQFDLQ.ETWVRL-RRSG..........................
A0C933_PARTE/4-693----D.YPLSLLIT...PSLQEKFQLFFRYLFPIRHAQFELQ.QVWIKL-TKKF...KKKD...................
Q24CL5_TETTS/4-831----K.WPLNLMIS...SHLIEKYKTIFRYLFPLRTIQFELQ.RSWLYF-MKNS...KRGKLNPT...............

PF14609

MOD21_SCHPO/60-677VDDESVIGEKEK.....LILKQKQKCLSEFFVDDIKKLLNEELLNCQKQELPDVME......NTYQISTVSGIKNDPLFT
E4WX70_OIKDI/53-731LNTTKVRHEPEKNTDWGGVL