Sequence alignment for CL0540

PF14609

MOD21_SCHPO/60-677M...........GIQGREDLEMPLRNACEV.LNR..QTVSVKQ-------------------------------------
E4WX70_OIKDI/53-731VKDQIESVVDKFRMHNFTAQANDFDDHMDDFVDRALVENGTGN-------------------------------------
B6K1F8_SCHJY/48-653VISSVEGIAEKQSILGREDVANCLHARLAE.LDQ..VSSNWRV-------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264--------HLKKAAAG.LQSET.FECPAGGGDQ..LQIKRNTT..............................VRTVL..
Q29HV5_DROPS/223-746--------NVLFSFTG.IQGKF.LRKNVVTGRF..KLDTAN.................................TNLL..
Q5KL44_CRYNJ/218-790--------DTLYLLQG.IDGRY.VHFAVSPPKE..QNPYLTERGREGEGTGFPLG.....KEGPIIEEGYDDEVVGIEIV
Q2UAG9_ASPOR/234-750--------ETIFMLQG.LPTSL.FWR.............HHES.............................VEVDRKYS
Q4WEE6_ASPFU/229-741--------ETLFMLQG.LPTSL.FWR.............LDDN.............................IEVDRRYT
A1C564_ASPCL/237-752--------ETIFMLQG.LPTSL.FWR.............LDDN.............................IEVDRRYT
Q5AUB0_EMENI/232-744--------EAIFMLQG.LPTSL.LRR.............IDGN.............................VEIDRRYT
Q0UBK8_PHANO/224-738--------ETLFMLAG.LRTSL.YKL.............DPQQS...........................SIRINPKYV
Q2HBB4_CHAGB/228-739--------EALFMLAG.LETSL.FDFECNPIT.............................................RYQ
Q1K6Z8_NEUCR/239-749--------.VVFMLRG.LPTSL.FDLACKPVP.............................................DYV
F4HUK8_ARATH/48-872--------.LLQALQG.FSSPF.IFWDRKEQTF..RAKS......................................EIR
GCP5_MOUSE/273-942--------ETLWLLSG.VKKMF.IFQ.............LIDGK............................VTVRNNII
F1QBQ4_DANRE/270-933--------ETLWLFSG.VKKLF.IFQ.............HNDGK............................VTVRNDVV
C3ZYG0_BRAFL/302-1685--------ESLWVLGG.CQQSF.LYRSREQKLL..LMN.......................................NIK
Q7PX58_ANOGA/302-918--------EILWMFTNPVDCKL.FRI.............DDDQ.............................IWINTNVS
A0A0D1E2A2_USTMA/319-997--------ESLSSLMG.SSSML.YSRHSSGQFT..IDNSRK..................................DPL..
Q9VTS3_DROME/266-1244--------HLKKAACG.IESLT.F..PISSADK..LELRVRPNT............................TLPTML..
Q17IM7_AEDAE/330-1376--------DVKFLITG.FSSRC.FEYDDDNRFR..MVG.......................................NFT
Q0UQH9_PHANO/170-704--------QSLWNLGLGRSSIL.FDFNTKLKSF..EPTVP.....................................QGR
Q5BEM5_EMENI/175-843--------QSLFRVGLGWSSML.FRFNKQRQKF..EKVVK.....................................DIR
Q2UCE2_ASPOR/176-851--------RSLFRLGLGWSSLF.FRYNRERQMF..ERVFD.....................................DIR
Q0D0R6_ASPTN/174-839--------RSLFRLGLGWSSMF.FRYNQQQAQF..ERVFK.....................................DVR
A1CPI0_ASPCL/179-855--------HAMFRLGLGWSSIF.FRYNRQQRKF..ERVSG.....................................GIR
Q4WSG8_ASPFU/170-850--------HALFRLGLGWNSVL.FRYNKQRKAF..ERVSD.....................................NIR
Q2H076_CHAGB/195-897--------ACLSNLALGRSSVL.FSWESEKNSF..VKTSP.....................................CLG
A0A0D1BZI3_USTMA/198-1067--------SLVNTATTGTSSDH.FQWDSDSASFVWAATLQHCKNVRQLRRRYKEQATLRASLAAAGDDVDPPPLLPTAMM
A8BFK8_GIAIC/197-740--------DLIYAMQG.LPGQY.FELIKDPTSG..ISHFVLQRQ............................YQSLSV..
A2E6U4_TRIVA/44-540--------DLFSCLLG.GDGTY.IRRTKQNKYL..VQAIL........................................
GACP2_ARATH/70-583--------DLLSALVG.IEGRY.ISIKRFHGKE..DSIAFQV................................DPSM..
Q0JBZ2_ORYSJ/73-597--------DLLSALVG.IEGRY.ISIKRVRGKE..GYVVFQI................................DSSM..
GCP2_DROME/204-721--------ELLHCLTG.IRESLLVPQKPIISAV..GLAKYDTDF............................DIHTHL..
Q29G36_DROPS/282-800--------ELIHCLCG.TRGNFIVPLPPDANST..GIAKYETYF............................TIHAHL..
Q16HU4_AEDAE/210-728--------ELLDCLVG.VKGSL.IGPKKTVRAT..VGLFPVEF.............................EVSDQI..
Q7Q703_ANOGA/248-764--------EVLNCLIG.IKGTL.ITPRKGATTLDPDGALAVEF.............................QLSNQL..
GCP2_MOUSE/220-738--------DLLYVLVG.VDGRY.ITAQPLAGRQ..NRTFLVD.................................PNL..
SPC97_DICDI/430-1044--------DLLSTMIG.IEGEC.IHIGVVQENE..DDSLQSNLVS..........................FVVEGEV..
A0BDB2_PARTE/150-660--------DLLYAMMS.IEGQY.IKK....KNG..SFEYQIEGH............................LEQSTC..
Q23AE3_TETTS/242-771--------DLLFVMTG.IEGNY.IKKKADQYRK..PYIYCIEPY............................LETSTC..
SPC97_YEAST/62-688--------DLLNVLIG.LEGTY.IRYFNDYEPS......DPETPI..........................EFKIAKKM.
Q6FQY5_CANGA/70-712--------DLLDTMMG.LEGKY.IRYNNSYDPH..VDMMPAFR...............................ISKNM.
Q756H1_ASHGO/63-723--------DLLHVLVG.LEGIY.IRYNNSYEPE......QRRSGALPYD..................IVGPDFKIAKNM.
Q6CXD9_KLULA/57-697--------DLLLVLQG.YEGVY.IRYNSSYRRD......SMTGPE..........................YKVVKMM..
Q6BGV8_DEBHA/61-751--------DLLFSLIG.YEGCY.IRYSEKYDPS..EINSKIRGPD..........................FKIAKHL..
Q59PZ2_CANAL/94-759--------ELLFTLLG.HEGHY.IQYSKRYDPT..SQISRIEGPD..........................YKIAKNL..
Q6C787_YARLI/102-681--------DLLNVLMG.HEGVY.INYSDSYNPR..LELDRLKGPD..........................YRTARGL..
ALP4_SCHPO/74-693--------ELLNAFMG.MEGVF.VHLQDMKASS..EFETIIMPPS..........................FYILPGF..
Q4X128_ASPFU/183-784--------DLLFVFMG.FEGRY.IHYHHTFDPT..AEKDRLAGPA..........................FQLPSGL..
Q7S902_NEUCR/140-744--------DLLFVFMG.FEGQY.IRFAKGYNPY..EERDRLSGPQ..........................WRILSGL..
Q0V2V1_PHANO/184-787--------DLLFVFMG.FEGQY.IRFSETYNPH..EEKERLVGPQ..........................FRILPGL..
Q5KPG7_CRYNJ/181-812--------DLLFVLQG.VEGVL.IRYDEGYDPF..DEEQRVKGAK..........................WRVNPLL..
Q4Q0X5_LEIMA/136-766--------EVLAAAVG.LGGLF.LQYTPAAPGT..SSGISPKEG...........................FQVSPLV..
Q9VS91_DROME/97-627--------DLIYAFSG.VPSAY.VKPDIQIDQI..SEMSAVDIAKI........................RFRLKKTF..
Q2M118_DROPS/72-608--------NLIYAFSG.VPSSH.IKPEATIKQI..ATMQQSGLPNV........................RFKIDEGF..
GCP3_DROME/235-758--------SAIYSFTG.VQGKY.LKKDVVTGRF..KLDQQNI.................................KFL..
Q16YQ3_AEDAE/217-729--------DVIYACTG.IQGKY.LRKHVVTGEF..KLDHIKG.................................RTL..
GCP3_MOUSE/251-761--------DILYVFQG.IDGKN.IKMSSTENCY..KVEAKA...................................NL..
Q1K720_NEUCR/225-737--------DLPFTLQG.LSSAT.LPFLNDTTLK..LPPTL........................................
ALP6_SCHPO/196-713--------SISYVLQG.ISTEY.VQFKNELALL..SKRI.........................................
A0A0D1E4X1_USTMA/283-861--------DVIFLMQG.INGRH.VRFQEEFQYN..TAAAAAAAAASEAGESGP.........AKVVRIVFSEGEAGYI..
GACP3_ARATH/192-713--------DVLYASQG.IDGKY.VKFNSEIDGY..AVQESV...................................KV..
SPC98_DICDI/112-705--------DIIYVFQG.IDGTY.IKYNKQSDSF..KIDENTSNTL.........................VNGEPAYI..
Q383E4_TRYB2/204-700--------DMLFMWMGVDKTKY.FAYDNACCRY..EMNSG....................................YG..
Q6FLE0_CANGA/180-724--------SIPFVLLG.TTSEL.FDI.............EYDK.............................IIIPSNI.
SPC98_YEAST/187-740--------YVSYTLLA.TTSAL.FPF.............DHEQ.............................IQIPSKI.
Q74Z68_ASHGO/190-740--------YISYTLLA.TTSSL.FPI.............SNQV.............................IEIPPNV.
Q6CIT0_KLULA/175-721--------SIPYLVLG.TPSTL.FEL.............KDKK.............................FTIPSNI.
Q6BX70_DEBHA/183-753--------YLSYSLLG.LDSKL.LSF.............SRDGN...........................SIELPPNI.
Q4U9K6_THEAN/45-615--------DLLNVFSG.LGSSF.FIWSKNSE..............................................NSS
Q4N294_THEPA/45-610--------DLLNVFSG.LGSFF.FIWTKNSE..............................................NSS
A8BD62_GIAIC/283-863--------DCIAVLQGCMQTTY.LQVSEQNKEY..VVTIRKEV...............................ATEL..
Q0UGY4_PHANO/31-649--------EILLSLSG.HPSAL.FDTGATSGHV..NSTTSH...................................LL..
Q2H2M0_CHAGB/4-638--------EILLSLSG.HPSPL.LRSASASSST..PPNSDNPNNN..........................NTPTSPL..
Q2UDA7_ASPOR/4-644--------EILLSLSG.QPSPL.FEAHAEEDTV..SEDAFP...................................LL..
Q0CV34_ASPTN/4-641--------EILLSLSG.QPSPL.FNLRTDEDAI..SEDAFP...................................LL..
Q4WZU3_ASPFU/32-668--------EILLSLSG.QPSPL.FAFNTEEDIV..PEDAF....................................PL..
A1C7R2_ASPCL/32-668--------EILLSLSG.QPSPL.FNVHSEEDII..SENAF....................................PL..
C8VMB1_EMENI/4-637--------EILLSLSG.QQSSL.FSFQTEEDAV..SEESFP...................................LL..
Q5KH00_CRYNJ/4-686--------EILLILSG.HPSSFFIPYPSPPAVP..FTCKASPS..............................LTEYL..
Q584R6_TRYB2/3-521--------ELQCALLGFHSASLPFEILKDSPCD..AGVTGTF.................................SQL..
Q0IG23_AEDAE/4-557--------DILFTLFS..............................................................SN
Q7PWU6_ANOGA/4-573--------DILFTLFS..............................................................SN
GCP4_DROME/4-548--------DLLLACRS..............................................................HN
GACP4_ARATH/4-645--------ELLLALLG.FTGDL.I.VDEREQRK..TLGLAFNSDSPLS....................DECTFKLAPDIS
Q60F24_ORYSJ/4-649--------ELLLALLG.FTGDF.V.LDAASSPS......ATRRRRPVPPEAA...........AGGDVGPASFRLAPDLT
Q05AR5_XENTR/4-571--------ELLLALSG.YPGSI.FTWNKRTGLQ..VVQ.......................................DVP
Q01B37_OSTTA/4-547--------DLLLALLG.VPGDV.FIATDAPERA..PSLAVAEE..............................LNFFI..
A0C933_PARTE/4-693--------DLLFSLLG.KPGSF.VKQFDNSPFY..IDESLN...................................LF..
Q24CL5_TETTS/4-831--------EILFGLLG.KSGNI.IIE.............QNDS.............................FVLDPKIT

PF14609

MOD21_SCHPO/60-677-------------------------SILHAQILKLFLELSKPPSDIHVPQIPVY--------------------------
E4WX70_OIKDI/53-731-------------------------SDLHWEILHFLLEMSNSPTRAAEIKNPA.--------------------------
B6K1F8_SCHJY/48-653-------------------------KLGIANVLHLLLTLSAHPRDVVWPKEEQE--------------------------

PF04130

Q2M0Y2_DROPS/276-1264.........................PEVLSDFVQPFLESGTAFRRLSARIKSRG..........................
Q29HV5_DROPS/223-746.........................TTGDAGLMLRLSELGYYHDRVAEFADPSK..........................
Q5KL44_CRYNJ/218-790ADEE................KDGVISQPTRTLLMQLSEMGMLYRRVTNFVNSRQ..........................
Q2UAG9_ASPOR/234-750LA....................HLSSETLSSLLRSFCSIGSKIDILRRYNQVPR..........................
Q4WEE6_ASPFU/229-741LA....................HTSSEALSSLLRSFSMIGARLDVVRRFVKITQ..........................
A1C564_ASPCL/237-752LA....................HASNESLTSLLQSLGVIGARIDVLRQFTKTKQ..........................
Q5AUB0_EMENI/232-744LP....................HLSHEALSSVLRSICACGTKIDILRRFTRTPQ..........................
Q0UBK8_PHANO/224-738LA....................SAMSNTVQHLLSELVNIGRNVYRLRQWTKRSQ..........................
Q2HBB4_CHAGB/228-739LR....................GVSWDSYKALVTSFSECGRKLAPLRVYVENRE..........................
Q1K6Z8_NEUCR/239-749LE....................GVTWQTYDALVNTFSECGRKLAPLRIYASKKE..........................
F4HUK8_ARATH/48-872VS....................HLSQSSLHVLLAGFLYAATCLKLVESIVSGIN..........................
GCP5_MOUSE/273-942VT....................HLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESLP..............PGNG
F1QBQ4_DANRE/270-933VT....................HLTNNCLHSVLEHIAAYGQAVSRLQKFIDEVTGHSAEPCPPG...........LNSSS
C3ZYG0_BRAFL/302-1685VS....................HITPDALQSILQKLAWYGDITHKLHHMIDSVITRSF......................
Q7PX58_ANOGA/302-918LS....................STTEHGIQTFLLNFTEYMTIAYRLRNFCRSILEH........................
A0A0D1E2A2_USTMA/319-997.........................TNSLTEQMEAVAYLASTLSILRSFVKATVFQS.......................
Q9VTS3_DROME/266-1244.........................PEVLADFANHFIRAGCAFLRLSSRTKWNNI.........................
Q17IM7_AEDAE/330-1376VD....................GVSPVTIKAVVDQFLELGTCFRRLHKMTKKNPY.........................
Q0UQH9_PHANO/170-704TS....................GLSPVAAQSLVTRFIHTGNTFLYLRSFAAKTF..........................
Q5BEM5_EMENI/175-843IS....................GVSTLALSGIIDEMLQCGNNMQRVRTFIGRVP..........................
Q2UCE2_ASPOR/176-851LS....................GVSVAALNSLTDEMIQCGTDMQRVRNFVGKAP..........................
Q0D0R6_ASPTN/174-839VS....................GISLTALSGLVDEMIRCGTDMQRVRNFVIKTP..........................
A1CPI0_ASPCL/179-855IS....................GVSLTAINSVVEQLLQCGTDMQRIREFARRTR..........................
Q4WSG8_ASPFU/170-850VS....................GVSLAVVNGLTEEVLRCGTAMYNLRDFARRTR..........................
Q2H076_CHAGB/195-897IS....................GLSLETVKAVDKLCLDCGNSARHLQAFAEGAY..........................
A0A0D1BZI3_USTMA/198-1067QPWIGS............ERILGWSQAASDSVIRPLLDIGALLRRIDDRTLAIH..........................
A8BFK8_GIAIC/197-740.........................SQTAATFCERIASCGFFYTRCTELLNAVT..........................
A2E6U4_TRIVA/44-540.........................RDSTQSFIDQLIPICDKFYYCQKFSETHY..........................
GACP2_ARATH/70-583.........................DLALQELAKRIFPLCEYYLLIDQFVESSS..........................
Q0JBZ2_ORYSJ/73-597.........................DLALQELTRRIFPLCEDFVLVYHFVESRS..........................
GCP2_DROME/204-721.........................DRSLTHQVREILPLASYFMGVQKIIAATD..........................
Q29G36_DROPS/282-800.........................DKSLTELLQDILPLASYFIGIQKMMAATD..........................
Q16HU4_AEDAE/210-728.........................EESLRDIVREILPLASHYSQVQDFIAASS..........................
Q7Q703_ANOGA/248-764.........................TESCRDMVVEVLPLAANYSAVQSFIEGAS..........................
GCP2_MOUSE/220-738.........................DLSIRELVNRILPVAASYSTVTRFIEEKS..........................
SPC97_DICDI/430-1044.........................DPSNNDLVQRILPLCSYYSFVNDFIQIRY..........................
A0BDB2_PARTE/150-660.........................DLSLQQMVSKILPMCSQHDFIENYIQQKI..........................
Q23AE3_TETTS/242-771.........................ESSLKQLVNKILEICLQYDKIQNYIAQHQ..........................
SPC97_YEAST/62-688.........................DPSFKTFSRRIVRYGKQYMILTRAYEKWS..........................
Q6FQY5_CANGA/70-712.........................DKSLKQCCIKILKLSKSYIFINNCIQEWS..........................
Q756H1_ASHGO/63-723.........................DPSLKSVAKRISKVGRLYVILSEFINRFE..........................
Q6CXD9_KLULA/57-697.........................NVTFKSFSKKLIKIGSIFVKLDKFQQWCC..........................
Q6BGV8_DEBHA/61-751.........................DISLKCITKKLVKFGKYYSGLNGFLELYD..........................
Q59PZ2_CANAL/94-759.........................DISLKVITKKLVKFGKFYSGLKSFIQVFD..........................
Q6C787_YARLI/102-681.........................DPSFKDFTRACIKIASTYVSLSAFVDKMT..........................
ALP4_SCHPO/74-693.........................DLGIKDIASEMLEMGSHYLSITAFIESRS..........................
Q4X128_ASPFU/183-784.........................DPTLRDLTSSMLKMATHYSALESFVEVQS..........................
Q7S902_NEUCR/140-744.........................DPSLLDLTQSMLRMASHYTALETFVDVQS..........................
Q0V2V1_PHANO/184-787.........................DPSLRDLTKSMLKTATHYIAVETCIEVLS..........................
Q5KPG7_CRYNJ/181-812.........................DASLLSLVKRLLPLASFFTAVEASMELRT..........................
Q4Q0X5_LEIMA/136-766.........................PASMRSLCETVLPVADAFMALRCIEKAEY..........................
Q9VS91_DROME/97-627.........................TGAFRALANETLPLIGYYISVQSYIEETN..........................
Q2M118_DROPS/72-608.........................NSTIRTLGNYLLPLVGHFISVQNFIETTN..........................
GCP3_DROME/235-758.........................TTGQAGMLLRLSELGYYHDRVVKFSDVST..........................
Q16YQ3_AEDAE/217-729.........................SIGDAGMILQLAEVGHFHDRVVKFTDPKS..........................
GCP3_MOUSE/251-761.........................NKSLRDTAVRLAELGWLHNKIRKYADQRS..........................
Q1K720_NEUCR/225-737.........................PIPIISLLNTLAEPSLLYRGLNEFTKTPA..........................
ALP6_SCHPO/196-713.........................PVQYLLQMRALSETGLLYQELKVFSNYDPSVSQSID.................GD
A0A0D1E4X1_USTMA/283-861.........................NAPTKRIVHRLAELGQLYKRVSEFSQQRS..........................
GACP3_ARATH/192-713.........................PRATRIMVRMLSELGWLFRKVKTFITESMD.........................
SPC98_DICDI/112-705.........................SKPKRDLVYRLCEFGWLFKKVRLFITNND..........................
Q383E4_TRYB2/204-700.........................TVRQRQAFSAFQECGCLAHQIDDALRGGT..........................
Q6FLE0_CANGA/180-724.........................PNSESGILHLIFEAGLLYKELGNLCDKYR..........................
SPC98_YEAST/187-740.........................PNFESGLLHLIFEAGLLYQSLGYKVEKFR..........................
Q74Z68_ASHGO/190-740.........................PNGESGVFHSIFEAALLYQYLSNQVEKFK..........................
Q6CIT0_KLULA/175-721.........................PNGESQQLHDIVEAGLLYLHLQIRVEYLK..........................
Q6BX70_DEBHA/183-753.........................NSSYSGLLHSILEPGLVYKKLKLFVDSNK..........................
Q4U9K6_THEAN/45-615FDIENNPLINGNTIYNLFIIYLIYVGNEMIEVCHEILRIHFDQLTLLEFVASSY..........................
Q4N294_THEPA/45-610YYIEN.............NPLIQDVGDDMIEMCHEILRIHFDQLTLLEFVASSY..........................
A8BD62_GIAIC/283-863.........................PATLVAMTQRVLVHAHARFQIVNTIYTHQ..........................
Q0UGY4_PHANO/31-649.........................SPPEAELLSSIGHLSRLHRKVRDHAARIA..........................
Q2H2M0_CHAGB/4-638.........................TPPERALLASLAHLSELHIQLLTSTAHIA..........................
Q2UDA7_ASPOR/4-644.........................SPPEKALLASLARLSRLHAKLRAHTALIS..........................
Q0CV34_ASPTN/4-641.........................SPPEKALLTSLARLSRLHAKLRAHTASIS..........................
Q4WZU3_ASPFU/32-668.........................SPPEKALLTSLARLSRLHAKLREQTSLIS..........................
A1C7R2_ASPCL/32-668.........................APPEKALLASLSRLSKLHAGLRKHTALIS..........................
C8VMB1_EMENI/4-637.........................SPPEKALLASLARLSRLHARLQAHTALIC..........................
Q5KH00_CRYNJ/4-686.........................HPGEVASLNSLADLAFQYRKVKTWANDTIDCGRKAILAESLPP..SRKGKEREVF
Q584R6_TRYB2/3-521.........................HPSERSLVGEVLPLGEMCQTLRALATDFA..........................
Q0IG23_AEDAE/4-557SDLPIENFT......IPEVAANFLHPG.EIKILEDLIRIANQYKELKKFVHQYGTQSAGLVK...............PKQ
Q7PWU6_ANOGA/4-573AELPIENFT......IPEVASTFLHPG.EIHILEELIRIANQYKEIKKFVQQYGTLNAGLLK...............PKQ
GCP4_DROME/4-548PEQLGIKAF.....NETTVIDQFIHPC.EREIFMDIIKIIKVYQEVEQFTHSSGRKSD......................
GACP4_ARATH/4-645F.....................IEPS..ERDLIERLIKLGFYYRELDRFAKKSRNLSWIRSVTSVH.......PLERADE
Q60F24_ORYSJ/4-649F.....................LQPS..ERSAIERLISLGFYYRELNRFATESRDLSWINSPIDV.........SPTHGE
Q05AR5_XENTR/4-571F.....................LHPG..ETNVLNRLCKLGTDYIRFTEFIEQYTGHVQQQD.................HH
Q01B37_OSTTA/4-547.........................KPHERERLNNLIRIGASYGALERVTRSERESVI......................
A0C933_PARTE/4-693.........................SKPEIVQLNQIVNLGYHYQQIDNFLQNQE..........................
Q24CL5_TETTS/4-831F.....................LTPA..EKEIINSLCCLGYYYKNLEQFLDENYNNFAKITYFMNKNNNFNENCDDQNDG

PF14609

MOD21_SCHPO/60-677-KDCNKN.EQEAIIQ.....LLTSCEGDHWL..MPDWSSMPDDET-----------------------------------
E4WX70_OIKDI/53-731-KRLNASIEEEAEKSEDSENMEEFDNGDRWDDKLSEWSE......-----------------------------------
B6K1F8_SCHJY/48-653-EDISDELASEKLINQDDTYLSAPFEGEHWD..IPNWESSDSDTS-----------------------------------

PF04130

Q2M0Y2_DROPS/276-1264......PRLEGPLNRAMRDTIIDFLA.TNRQ.FFLSLPA.........................................
Q29HV5_DROPS/223-746.....GYSALGCMGQALTCFLRKELG.AYHG.EVALLHDQVNDFKKAQLKRGFADR.......................E
Q5KL44_CRYNJ/218-790....AGDSKGGMIEQSLCHFLHHELS.EYHR.LLAVLESQMNTASSSGE...............................
Q2UAG9_ASPOR/234-750.........VIPYLQTFHRGIEDRLR.EFDR.FLSNVQAQY....LSQS...............................
Q4WEE6_ASPFU/229-741.........VVPYMQTFHRCVEDCLS.QFDA.FLSEVQTQC....ISQG...............................
A1C564_ASPCL/237-752.........AVPFMQTFHRCIEGHLH.KFDA.FLSKIQSGF....LPQR...............................
Q5AUB0_EMENI/232-744.........SAAYMQTLHRSTEDCLH.KFDK.FLSEMQNKF....LSRD...............................
Q0UBK8_PHANO/224-738.........TLPLIQTFESTVRMRLV.AFDR.ALADVQQRY....LTPN...............................
Q2HBB4_CHAGB/228-739.........QSPLLQVFRACLQKALH.HLDL.ELSLIQTSLVAIKED.................................
Q1K6Z8_NEUCR/239-749........KEEPLLQVFQDSLQKALQ.SFDQ.ELTAIQGRFVAIHKD.................................
F4HUK8_ARATH/48-872.....ASLKSPPTLMAFSNSASGWLE...AN.IALNEEVKINDSNVA.................................
GCP5_MOUSE/273-942PIPKKQPDAPFRTYQAFMWALYKYFI.NFKE.ELTDIEKCVISSDT..................................
F1QBQ4_DANRE/270-933SSSKKSSEPPFRTYQAFVWALYKYFT.SFKE.ELNAIEKDIIAKDE..................................
C3ZYG0_BRAFL/302-1685GCHDNGEPSVSRTQQAFTSALLRCLQ.DFNK.KLAALEKRLVLQEE..................................
Q7PX58_ANOGA/302-918...TARSLPAPHSFECYAAGVKSFL..DHMESVMIRHEKELIKQEPG.................................
A0A0D1E2A2_USTMA/319-997.IHTVDALTRTPAVEAFAEQLQALLE.NLCS.QFSELDADIAAGSTLAHPA.............................
Q9VTS3_DROME/266-1244....AEMRLERPLNRAMRETIMDYLS.TTRQ.FLLSLQA.........................................
Q17IM7_AEDAE/330-1376...NYAMILEGFVFKAFCDCVERILS.CFRV.VVTCYDG.........................................
Q0UQH9_PHANO/170-704.....ASATSIPARVALATTVSSVLY.TLEE.QLGKYSSKI.......................................
Q5BEM5_EMENI/175-843.....TAAAEPSALSAFSTAASVIVY.TLEK.QLLHSFKQI.......................................
Q2UCE2_ASPOR/176-851.....SKSTKLSALSTLSSAVAVVIY.IVEK.RLLRDADNI.......................................
Q0D0R6_ASPTN/174-839.....SGSGIPSALSTLSSAAAVIVY.TLEA.QLVRNYKQA.......................................
A1CPI0_ASPCL/179-855.....VKSREFSARSAFSSTIAAIVY.TLEK.RLSGYSRGI.......................................
Q4WSG8_ASPFU/170-850.....IKPEGFSARSAFASAVAMIIY.TLEK.QIINYFKEV.......................................
Q2H076_CHAGB/195-897......SIASTPTRVALAGVVDRLVT.AVRS.ELKNNSHGV.......................................
A0A0D1BZI3_USTMA/198-1067....RSSATLCSEATALAAALDTVVT.WFKA.ELATQSSTLVSNSSAS................................
A8BFK8_GIAIC/197-740......KTNMGKTRASLCEALHTGLS.EYRQ.RISLLDSQLTEEQ...................................
A2E6U4_TRIVA/44-540......YLKYGKIVHTVCNAIRKYLL.QFME.QVSEIEALPV......................................
GACP2_ARATH/70-583......QFKNGLVNHAFAAALRALLL.DYQA.MVAQLEHQFRLGR...................................
Q0JBZ2_ORYSJ/73-597......HFKSGLVNHALAAALRAFLL.DYQA.MVAQLEHQFRLGR...................................
GCP2_DROME/204-721........GLGQVMNSLNEALQELTH.DFYL.IIVQAEQELRHNR...................................
Q29G36_DROPS/282-800........GHGQVVNSLNAALQDLTN.DFYV.LVVQSEQELQQQQ...................................
Q16HU4_AEDAE/210-728......SLESGQVLQALRAALQAIIK.DYYL.SITQLEDLFLKQQ...................................
Q7Q703_ANOGA/248-764......VTEGGVVLQALRSVLKTIMT.DYYL.SIAQLDDLRCRRG...................................
GCP2_MOUSE/220-738......SFEYGQVNHALAAAMRTLVK.EYLI.LVTQLEQLHRQGL...................................
SPC97_DICDI/430-1044......AYEWGIINHSLCFSIDQLLK.EYLV.LVSQLEGQLKSER...................................
A0BDB2_PARTE/150-660......KFENGYISQAFCSAIKELMQ.KYLL.MVNQLDYEFNQGE...................................
Q23AE3_TETTS/242-771......QFSFGTVSQALCAALGLLLR.EYVV.MINQLDQEFQKAE...................................
SPC97_YEAST/62-688......DTSFGMVLQRFAYEIRRFLEDVYLKTLVERLERDFNKVPN..................................
Q6FQY5_CANGA/70-712......RPSYGCILHRLTYEIRKFLKDGYLRFIVERLEKEYSSNVS..................................
Q756H1_ASHGO/63-723......QTRYGTVLHRMCFVVRRFLTDDYLPFVVGKLERWFQEDAR..................................
Q6CXD9_KLULA/57-697......DERYGRVMHRLGHEVRIFLYENYLS.CIKELEIRFQQDVK..................................
Q6BGV8_DEBHA/61-751......RPEFGKVVQRLCFAISEFLI.VYQQ.VIKHIEDEFKFNST..................................
Q59PZ2_CANAL/94-759......NNKFGKIVQKFCSEVRKFLS.SYQQ.VLINVEHEFKFNKN..................................
Q6C787_YARLI/102-681......RDRRGLVNGALAASIRKLLK.EYVK.LAQGLEYSLRFESG..................................
ALP4_SCHPO/74-693......HFEYGFVNHALCAALRKFVM.DYVV.LIMQCENQSRIDPN..................................
Q4X128_ASPFU/183-784......RAEYGAVNHALCATIRRILK.DYLI.LVAQLETQLLNHSN..................................
Q7S902_NEUCR/140-744......REEFGAVNHALCASIRRYLH.EYLV.MVVQLETQFLNDEN..................................
Q0V2V1_PHANO/184-787......REEYGAVNHALCAAIRRLMK.DYLT.LIAQLEHQLLTNDS..................................
Q5KPG7_CRYNJ/181-812......APEYGMVSHALCSGIRAMLK.EFRV.LTAQLESLFLTSPT..................................
Q4Q0X5_LEIMA/136-766.......SSCSLVLMALGEVVSEINT.SYAH.QVSKLQLWSEGRP...................................
Q9VS91_DROME/97-627.....MSPNCGRTRLTLATALSDQLQ.DYYD.LQSKLETDLQDKK...................................
Q2M118_DROPS/72-608.....MTPRSGRTSLALAAALNDKMQ.QYYD.LQATMETEMQQRK...................................
GCP3_DROME/235-758.....GFNAIGSMGQALISKLKEELA.NFHG.QVAMLHDEMQRFRQASVNGIANKG.......................K
Q16YQ3_AEDAE/217-729.....DCYMKGNFGQGYIAALQRELT.QYYG.MLAILQEDLNRQRKERTGL.............................
GCP3_MOUSE/251-761.....LDRSFGLVGQSFCAALHQELK.EYYR.LLSVLHSQLQLEDDQGVN..............................
Q1K720_NEUCR/225-737.........NGLLGQSLRAAISKELR.SYLT.LVATLETQIRRALSELDESAP...........................
ALP6_SCHPO/196-713NVSKAFINDQSLALQSLKSVISKELT.NFLA.LIASLDSQIRADASLE................................
A0A0D1E4X1_USTMA/283-861.....AMPASGLIMQSLCHFISKELT.GFYR.LVASLEAQMSNGSKNSPGLAQDANV.....................AA
GACP3_ARATH/192-713...RFPAEDVGTVGQAFCAALQDELS.DYYK.LLAVLEAQAMNPIPLVSES.............................
SPC98_DICDI/112-705......FKKTGLTNQSFCSAINDELI.ELYR.IIAILETQVYKKFDMVNYGGGGGGSGGSGSGSGLESPSSVSSGGTTTS
Q383E4_TRYB2/204-700.......SERSFLQQSLRGAVRRHLS.QYHT.LVASFRGRQTPP....................................
Q6FLE0_CANGA/180-724......RMPISPMKKAFIIAVGSELN.TYNG.LINQLASNDKI.....................................
SPC98_YEAST/187-740......MLNISPMKKALIIEISEELQ.NYTA.FVNNLVSSGTV.....................................
Q74Z68_ASHGO/190-740.....VASSLSPLKVNFLTVVSERLR.EYSR.VVNQLSSSIAS.....................................
Q6CIT0_KLULA/175-721.....KHVTTSTLKVAFLTLIQSKLR.DYSN.FVNNFSSHLHPL....................................
Q6BX70_DEBHA/183-753......GKIVSPIKTAFLRSLESELN.YYVNHINEYFNTEP.......................................
Q4U9K6_THEAN/45-615.........TGVICESITAEFVEILE.DLQE.CVTRFHDIHITSF...................................
Q4N294_THEPA/45-610.........TGVICETITAEFVDVLE.DLQE.CVSRFHDIHITTF...................................
A8BD62_GIAIC/283-863......VPEYGRIANAFSQALRCIIK.EYDF.YLADLSKKHYGKMQSSA...............................
Q0UGY4_PHANO/31-649......TTHPSTVCRAVAAAVTSHHLESFQR.KILDVESRILKQDASTV...............................
Q2H2M0_CHAGB/4-638......AAHPSVICRAVASAVDALHLAAFRR.KVRAVEETLLRRDAALV...............................
Q2UDA7_ASPOR/4-644......SSHSSVICRAASTAISTQHLGDFQR.KVLEVEKSILVEDSGYV...............................
Q0CV34_ASPTN/4-641......ASHPSVVCRAVSTAISKHHLGNFQK.KILEVEEAILTEDSGYV...............................
Q4WZU3_ASPFU/32-668......SSHPSIICRAVSSAINAHHLGGFQR.KILEVEKAILAEDSAYV...............................
A1C7R2_ASPCL/32-668......SSHPSVICRAVATNISAQHLGNFQK.KILDVEKAVLAEDSAYV...............................
C8VMB1_EMENI/4-637......STHASVICRAVSTAIRSHHLGAFQK.KILEVEKAILVEDSGYV...............................
Q5KH00_CRYNJ/4-686MNDKGDSIKLNQYLVTLAASIIEVLN.GYEL.LIVETEAKVLSFDPAVVQ..............................
Q584R6_TRYB2/3-521.....VGRTDGLYISAIASAVVQILR.SYEE.SVRAA...........................................
Q0IG23_AEDAE/4-557QKPSEEPLPQGLYLQAFADGLDLAVK.PYRD.LIVHLEAYY....LK.................................
Q7PWU6_ANOGA/4-573QKPTEEPLPQGLYLQAFVDGLELVVK.PYRD.LVVELEAKY....LK.................................
GCP4_DROME/4-548THGELPDSLHGYYLLNLAKGIEMALE.EYYA.EIGRLEKYC....LG.................................
GACP4_ARATH/4-645LSKQSREKKPSVYRRAIANGIGEILS.VYRS.AVLHIEQKL....LA.................................
Q60F24_ORYSJ/4-649KTVKAKVRKGSAYRRAIANGIAEILS.VYRS.AVLQVEQNL....LS.................................
Q05AR5_XENTR/4-571PSQQGQVGLHGIYLRAFCRGLDSILQ.PYRQ.ALLDLEQEF....LA.................................
Q01B37_OSTTA/4-547DHDGLDVKSGSLYRRALASGVDEILD.AYEA.KILKLEQDA....LRR................................
A0C933_PARTE/4-693........EKSSYIKALVFGIDNSLN.DYRQ.TILTLEQEYLNEKM..................................
Q24CL5_TETTS/4-831PIAEVNVIGNSAYLKGFCLGLEQIIN.SYRE.KIIEIERDF....LE.................................

PF14609

MOD21_SCHPO/60-677----------ITEDSEEETFNG--NANEITIPANI.HIPIIEESDNASNNKLC---------------------------
E4WX70_OIKDI/53-731----------VTKSEESEEETD--ENERKNEASGFPEIPT..KFKNFEKIDRI---------------------------
B6K1F8_SCHJY/48-653----------VTFYEETPPVIP--DNENIQDPQYYPHAKVSEHTEDYAYQQYE---------------------------

PF04130

Q2M0Y2_DROPS/276-1264..........ESFSQLLMSAQP..AMRLLQHLERMFETE......PSLNLHSG...........................
Q29HV5_DROPS/223-746QEWLDSQREQVTLFKLLVWYTK..PLHRMQWLTKIA............HSCMM...........................
Q5KL44_CRYNJ/218-790.....QPDSGLTLLRLRLWTED..MKLKLKQMSTIV............DEAKN...........................
Q2UAG9_ASPOR/234-750......RTIAVSLLQLYESVLR..ESKLLLLLAEIV............SNLRHDAS........................
Q4WEE6_ASPFU/229-741......APFSVSLLQLAEDVRT..ASAMLVLLADLI............SNLEYDSP........................
A1C564_ASPCL/237-752......TSVSISLLQLAEDVRN..ESRMLVILSDLI............SNLQCNAS........................
Q5AUB0_EMENI/232-744......SSVAVSLLQLLDDVQR..ESKLLTLLADLV............SNLDRTA.........................
Q0UBK8_PHANO/224-738......SPAAVSLLQLHTEVRS..MSAPLLRLAHLT............SDVEV...........................
Q2HBB4_CHAGB/228-739........VVVSLIGVLGELGP..KLAPLYGLADIV............RQVQQERN........................
Q1K6Z8_NEUCR/239-749........VIVSLVAMLAELGP..SLAPLYVLSGIV............QQVHRERN........................
F4HUK8_ARATH/48-872........VTPTLLGLTSSLSS..LCSDAEYLFQVVRGAIPHAYFESSSAIST...........................
GCP5_MOUSE/273-942.........TITLAIVVNKLAP..RLAQLKVLDKVF................STGVAE......................
F1QBQ4_DANRE/270-933.........TVTLSSVLERLSP..HLAQITMLHRVF................CTGVAE......................
C3ZYG0_BRAFL/302-1685.........LITLSTMMGTLQE..QFGDLEMLYTVYQLGVVSPSTDKTNDVLKASRLLSVLYQNILQYNTLGDAANTKYN
Q7PX58_ANOGA/302-918........KTHTIIKLFHELEP..ELFVLKKLYDIH................KFSVL.......................
A0A0D1E2A2_USTMA/319-997...VIRTNRYTTLTQLINFSYS..KAASVLLLARLLKDMGFISGHGGDTDVSLIPRGS......................
Q9VTS3_DROME/266-1244..........DSLFQLLNNTST..AIQLLCQLDRMF................ENEPR.......................
Q17IM7_AEDAE/330-1376..........KSLLQLQRNTDP..MRKQILALAKFC................GIHPN.......................
Q0UQH9_PHANO/170-704..........RSLIQLQHQFSK..PREVLLHVARMV............DATQH...........................
Q5BEM5_EMENI/175-843..........SSVLQIRALFQR..CAELIGVLVNMM............DAVET...........................
Q2UCE2_ASPOR/176-851..........LSLIQVRALFQR..CGELAGVLADLV............EAVEG...........................
Q0D0R6_ASPTN/174-839..........VSVLRIKSLFEP..CREIVAALANII............ESIEG...........................
A1CPI0_ASPCL/179-855..........SSLLQITSLFER..CGELVHALATIV............EAVEK...........................
Q4WSG8_ASPFU/170-850..........SSLIQIMTLFQR..CGDLVGALSNIV............EAVQK...........................
Q2H076_CHAGB/195-897..........RSILQLQSVVQP..ARSILLYFKGLV............KKLAQ...........................
A0A0D1BZI3_USTMA/198-1067.......VKCSAVLNAHAELET..CFAVLKNLGNLL................SCGQPRT.....................
A8BFK8_GIAIC/197-740..........MTLVELTAVANL..IREEISTLAVIADNCLYDKSLTSPQ...............................
A2E6U4_TRIVA/44-540..........KSLPVICINISK..SAEFLDVLSEIV............TKIEN...........................
GACP2_ARATH/70-583..........LSIQGLWFYCQP..MMGSMRALAAVIQQA......STKQ...............................
Q0JBZ2_ORYSJ/73-597..........LSVQGLWFFCQR..MMSSLNALAVLVEKA......ISNN...............................
GCP2_DROME/204-721..........LTLQKLLYYLQP..TMWVMHEVWSSLVII......QLSD...............................
Q29G36_DROPS/282-800..........LTVQKLLYYLQP..TIWVMEELWTTLVNV......QLNE...............................
Q16HU4_AEDAE/210-728..........LTFHKLLYFLRP..VFHTMEVLAETVTAI......RQTN...............................
Q7Q703_ANOGA/248-764..........LSLQRLIQFLKP..VYPTMEELAATVSEI......RRSN...............................
GCP2_MOUSE/220-738..........LSLQKLWFYIQP..AMRTIDILASLATSV......DKGE...............................
SPC97_DICDI/430-1044..........LSLQRMWFYLQP..TIKTFEILYRVTSEI......MRCN...............................
A0BDB2_PARTE/150-660..........ITLQKFWYYTQP..SIRIINSIYVLIQS........LSK...............................
Q23AE3_TETTS/242-771..........LTLQKLWFYIQP..SLKVMEALYKLVSE........TEN...............................
SPC97_YEAST/62-688..........FSIRELEQIINETEVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNES.............
Q6FQY5_CANGA/70-712..........FSIRDMEHMINDYELSKKMEILYNLCLRLNEEMNRRLNMNLDQEDFNNFKRELEDV..............
Q756H1_ASHGO/63-723..........FGIRIMEQLLNE.EIIYKARLLYELVMCVVNEMERRDKVDLAEADFENFIQDLKMGSDAG..........
Q6CXD9_KLULA/57-697..........FSIRDLEMVLED.GFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDT.............
Q6BGV8_DEBHA/61-751..........FNLSIFETILNQ.ELSLKLSHFYDIVIAVHTETIERSKYKHQTSESYFNNFIKSIQND............
Q59PZ2_CANAL/94-759..........FNLNMLDSLLHQ.EISNEMTHLYQIGIEISRITEERQKMSQ.AEIMGNFEPTTLANTS............
Q6C787_YARLI/102-681..........LTLHKFHLKLMT..IGGILHETHELAKDILREDEVRFHNATLEPSNDLDALLAKFREN............
ALP4_SCHPO/74-693..........FSLQTLRLYTLP..TSRSLRQVYLILRDLLLSMEKNASSSDDLGLSNIDDLLEQLNE.............
Q4X128_ASPFU/183-784..........FTLHMLHLHTMP..TSQCLSQLYSLGQELLRRNGLLDQDIDESIDDFDDVDNILEQL.............
Q7S902_NEUCR/140-744..........FTLQQLNVHILP..SSHLMAHMYGLALELLKRNALLDDDSDESSDSSDDDFDHIIEQ.............
Q0V2V1_PHANO/184-787..........FTLHVLNLHTKQ..TSHMLFQLYTTGIELLKANDILEDDKDEDSADDDSNDFENI...............
Q5KPG7_CRYNJ/181-812..........FTLQTLYLHLHP..TLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLGGMAEELGLGGAG.........
Q4Q0X5_LEIMA/136-766..........MPLMGVVSEILR..VGHHVVRLRQVLPMDLICSALAEAAAAAADPTSS......................
Q9VS91_DROME/97-627..........LDLKDLVRQVRP..WLPILKTFSNMA...........SS...............................
Q2M118_DROPS/72-608..........LFLKDLVRQLRP..WVGILKVFSSMV...........TS...............................
GCP3_DROME/235-758KDSGPDAGDEMTLFKLLAWYIK..PLHRMQWLTKIA............DACQV...........................
Q16YQ3_AEDAE/217-729....TGGGDRLTLKKLRLWLTS..PMERLQWLAQIS............ESCKE...........................
GCP3_MOUSE/251-761....LGLESSLTLRRLLVWTYD..PKIRLKTLAALV............DHCQG...........................
Q1K720_NEUCR/225-737..RGGIGKTGVTLKRCVVWTRE..ATMGLRLMSLIA............EESKN...........................
ALP6_SCHPO/196-713.......KPMVTIRRCIAWTQV..AKLKLRILSSVV............NDNMN...........................
A0A0D1E4X1_USTMA/283-861GVGSDASTAYVTLKRLSLWTDE..MTLRFRLMSTIV............ESCQD...........................
GACP3_ARATH/192-713....ASSNNYLSLRRLSVWFAE..PMVKMRLMAVLV............DKCKV...........................
SPC98_DICDI/112-705TEIPFIDGDSLTLIRLFVWIQS..PLKRLKVLGTCV............DSITV...........................
Q383E4_TRYB2/204-700..........MAFGDLVVAFKR..VQPKLRVLHTML............KETEN...........................
Q6FLE0_CANGA/180-724..........STNNGVYVSIYD..SINKLRVFYSIM............LKFEG...........................
SPC98_YEAST/187-740..........VSLKSLYREIYE..NIIRLRIYCRFT............EHLEE...........................
Q74Z68_ASHGO/190-740..........ESVKSIYIQIYT..QILVFRFYHGYL............ERFEQ...........................
Q6CIT0_KLULA/175-721..........DPLCFTYQHLYP..EVLKLRTYMEYI............ENFEK...........................
Q6BX70_DEBHA/183-753..........TSLIAVYNALFP..FILKLRLLYSLT............NELNL...........................
Q4U9K6_THEAN/45-615..........LGLQKLLNYLRP..SMQTLSTLASLVTEFDSKRLIDNNSNIGV...........................
Q4N294_THEPA/45-610..........LGLQKLLNYLRP..STQTLSTLASLVTDFDTKRLTDDNSNIGV...........................
A8BD62_GIAIC/283-863......ERGSLSLQTLEVKTKQ..IHIILENVADLC............SRLGV...........................
Q0UGY4_PHANO/31-649.....GAYNIVPLAGIVGEFSE..WIRLLEWLWELSTFMLSPHVQPNAEKGLV...........................
Q2H2M0_CHAGB/4-638.....GAYDIVPLTAVVAEFAG..WARRLEWLAGVVAVMVGGGGSGSGSGSGSGSGSGG.....................
Q2UDA7_ASPOR/4-644.....GGYGIVPLSTIVGEFSP..WTRRLEWLWEVARFILPNHKKANNQS..............................
Q0CV34_ASPTN/4-641.....GGYGIVPLSTIVGEFSP..WTRRLEWLWEVARVIKPEQPQSKSHG..............................
Q4WZU3_ASPFU/32-668.....GGYGIVPLSTIVGEFSP..WTRRLEWLWDVTRFVLPENRTSSAHG..............................
A1C7R2_ASPCL/32-668.....GGYGIVPLSTIVGEFSP..WTRRLEWLWEVVHFIIPEQGTGSAQG..............................
C8VMB1_EMENI/4-637.....GGYGIVPLATVVGEFAP..WTRRLEWLWEVVRFILPTEKKKHTQS..............................
Q5KH00_CRYNJ/4-686.....DQQGYVPLASIVATFDR..WRAPLTALSQIVDQLSSFDEREDSWSPGR...........................
Q584R6_TRYB2/3-521..........VTPSSVVSLRPT..YFLAFSLIMEMV................Q...........................
Q0IG23_AEDAE/4-557.......RPNLSLIFIYHQVNQ..YQSLFGFLLRLV............SGVVT...........................
Q7PWU6_ANOGA/4-573.......RPNLSLMFIFHQVSQ..YRSLFGFLLQLI............SGVVT...........................
GCP4_DROME/4-548.......NERNSLSYVYNALYA..KFPLLVFMRNLI............TEIHV...........................
GACP4_ARATH/4-645.......ETTPILATVTEGLNK..FFVLFPPLYEVI............LEIER...........................
Q60F24_ORYSJ/4-649.......DPLPILATVTHGLNK..FEVLLPPLHELV............MEIEQ...........................
Q05AR5_XENTR/4-571.......DPHLSISHINYSLDQ..FHLLFPSVMVVV............EQIKS...........................
Q01B37_OSTTA/4-547......RGDAGTLSSIESELSE..ERAVIPALMELF............GEVLD...........................
A0C933_PARTE/4-693..........FIVSQLNVRLQA..YYQILLNLHTSI............NIIQQ...........................
Q24CL5_TETTS/4-831.......NRVFTIASLKIKLTS..HFDILPDLHKIV............IKIVE...........................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264................................................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685TLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLG
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264................................................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685DAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKVCTILKASRLLS
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264................................................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685VLYQNILQYNTLGDAANTKVCTILKASRLLSVLYQNILQYNTLGDAANTKYNTLGDAANTKVCILKASRLLSVLYQNILQ
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688..............................................................................SL
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723...........................................................................ATGDS
Q6CXD9_KLULA/57-697..............................................................................ND
Q6BGV8_DEBHA/61-751.............................................................................LKE
Q59PZ2_CANAL/94-759..............................................................................MN
Q6C787_YARLI/102-681.............................................................................SVE
ALP4_SCHPO/74-693..............................................................................GN
Q4X128_ASPFU/183-784...............................................................................K
Q7S902_NEUCR/140-744..............................................................................LR
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812...........................................................................LKGLM
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677------------TLFKKSKQPNLDFLQIKPFMFWDSSLNETVRISERSIIRD.SIYMLIGYPSFFFLKNGSKIETRLSLL
E4WX70_OIKDI/53-731------------YIFEEEAQKIADKYPEKK..........VYRIGEQPWKGEKTIGKLYG..............EILDHV
B6K1F8_SCHJY/48-653------------DPVSHASETLLQRILEKE....SSGTPQLLQLSQQSMLYE.IIYMLMGYQGHIF....TCVEGVFRPA

PF04130

Q2M0Y2_DROPS/276-1264...............VSGTF.ILASIGSAIDTC.....SN.TDF.LQ..LLMYLLKCMCQ--------------------
Q29HV5_DROPS/223-746...............KKGGE.LTSVVWDFLDN......GH.PAV.DK..LVIDLLTAMCR--------------------
Q5KL44_CRYNJ/218-790...............THGGA.LVSKLHSHTSN......GD.PLI.RN..FTTQILEEVSK--------------------
Q2UAG9_ASPOR/234-750..........DSPVR......CLDLLYDSVCMT..QATGD.ENE.FK..FLAQLFFSCFE--------------------
Q4WEE6_ASPFU/229-741..........DDGVR......CLDLLYDVVCMK..QATGD.DVE.FT..FLAKLFFSCLE--------------------
A1C564_ASPCL/237-752..........GNCVR......CLDLLYDSVCLN..QATGD.DSE.FK..VLAGLFLSCLE--------------------
Q5AUB0_EMENI/232-744..........VDSVQ......CLDQLFDLVCIT..QAAGD.DEN.FA..RLAEIFFASLE--------------------
Q0UBK8_PHANO/224-738............ALLVNPFS.HLEALFDQINLA..QMTLE.IRS.FQ..YLSSVFFDCLQ--------------------
Q2HBB4_CHAGB/228-739..........PHAFR......YLELLYDAAGIA..QLQGS.TAT.YR..LLGTIFFDCFQ--------------------
Q1K6Z8_NEUCR/239-749..........TKAFH......YLELLYDAVGMA..QMEGS.LDT.YR..LLGTIFLDCFQ--------------------
F4HUK8_ARATH/48-872...............AEIAVHVLDYLYKRLDEVCLVQGGELVAV.EGFHMLLQIFAGSLL--------------------
GCP5_MOUSE/273-942.......VPPDTRNVVRASH.LLNTLYKAILEY..DNVGE.ASE.QTVSLLFSLWVETVR--------------------
F1QBQ4_DANRE/270-933.......VPPGTPNVLRASH.LLNTLYKAIIEY..DSVGE.ASE.QSVALLFSLWVETVR--------------------
C3ZYG0_BRAFL/302-1685YNTLGDAANTKVCTILKASR.LLSVLYQNILQY..NTLGDAANTKLP..LLLPLWIQTLR--------------------
Q7PX58_ANOGA/302-918........DWTKFPAHIAVAHLLSGLFRSVKLSANLEKGN.........LAFALLLAALK--------------------
A0A0D1E2A2_USTMA/319-997........SDRALID......GLQALLAFVHQQDELAHGDMILT.....DLSTCLLAACR--------------------
Q9VTS3_DROME/266-1244.........LNLNTGITGSF.LLSSIWLAIDTCGNKDFLH.........LLIYFLRCISR--------------------
Q17IM7_AEDAE/330-1376.........YESDKEFPTGSVFLDHLYKEIIHITSSDVST.........FLLHILKHCCN--------------------
Q0UQH9_PHANO/170-704...............AKTNEQLASILHHRLLEL.....EDGDTDIRQ..LSSRIMCEVAK--------------------
Q5BEM5_EMENI/175-843...............AGSEARIISSVFKLAAHYAQIYGQM.....ES..LFREIVFKVAQ--------------------
Q2UCE2_ASPOR/176-851...............VVSDAQIFSIVLEKAAHYSQTFGHM.....ED..LFREIVIRTVY--------------------
Q0D0R6_ASPTN/174-839...............PTTESQIISIVLARAAHFSQTFAHM.....EN..LFREIATRVAR--------------------
A1CPI0_ASPCL/179-855...............AVSDAQVISVIIKKAAHFAQTLSSM.....EN..LFREIVARAIT--------------------
Q4WSG8_ASPFU/170-850...............AASDAQVISAVIEKAAHYSEAFGSM.....EN..LFRELVARVIA--------------------
Q2H076_CHAGB/195-897...............ETSDEGMLSCLFQEAQAS.....EYRDGLIED..VTREVLRVLSQ--------------------
A0A0D1BZI3_USTMA/198-1067.......PPFRPLTWLESTHATLSHLHAHLAASLASGASSLPSA.....VLAYLLDRTSV--------------------
A8BFK8_GIAIC/197-740.....................ILNIIFGYSLH......GD.RKM.HH..IGQSLLIKASE--------------------
A2E6U4_TRIVA/44-540...............LKGPK.ICTIIHQAISTN....RGL.PYI.RE..PLTALFNQSVQ--------------------
GACP2_ARATH/70-583...............FVGSG.VLNLLQSQAKA....MAGD.NSV.RS..LLEKMTECASN--------------------
Q0JBZ2_ORYSJ/73-597...............TSGSA.TLNLLQSQAKA....MAGD.SAV.RS..LLEKMTECASA--------------------
GCP2_DROME/204-721...............SRDAE.VLTYLHERIKR....LEGN.KDA.QQ..LIIGLVRKAAK--------------------
Q29G36_DROPS/282-800...............FQGAA.VLTHLHGRIKR....LEGD.RAA.QQ..IMIKLTHQAAE--------------------
Q16HU4_AEDAE/210-728...............CRGGT.VLTLLYDKIIA....TTGD.EKS.RK..VLIHLIEMAAV--------------------
Q7Q703_ANOGA/248-764...............ARGGQ.VLSLLHDRITA....KSGT.NHA.QK..VLVHLVESAAA--------------------
GCP2_MOUSE/220-738...............CVGGS.TLSLLHDRSFN....YTGD.SQA.QE..LCLYLTKAASA--------------------
SPC97_DICDI/430-1044...............SHGVQ.VINLLLKLQSK....YSSD.KKT.DD..LFHYLIKATTL--------------------
A0BDB2_PARTE/150-660...............QIGGT.LLSTITHFINT.....STD.PQI.VE..VYSFLLQKSFL--------------------
Q23AE3_TETTS/242-771...............YKGGE.LLSKLYDLLKNTSDKQIVD.........IYYYVLQKSFA--------------------
SPC97_YEAST/62-688HLRLMVAFDTTVYPVPKGGA.ILKIFQQKILEN....LGD.RSS.VM..FLKKLLNNISQ--------------------
Q6FQY5_CANGA/70-712GQAILLPTDSSLSLTPKGGN.IIKVVQEMIAET....LGD.RNG.VQ..FLKDILNKIGE--------------------
Q756H1_ASHGO/63-723STNGILITDTRVSPVAKGGV.VLQMVLEKMKQN....WGD.QRN.LQ..FLHQVWQDISA--------------------
Q6CXD9_KLULA/57-697ELDLRVLYDTRVSLFVKGGS.LIIIVQQIMEQE....QGD.IRH.VE..FLSLICDSLNR--------------------
Q6BGV8_DEBHA/61-751TGSIDLATDNVNFEFCKGGI.LLKIIQDRINAY....QGD.VIS.LE..FLTKIFDVVSI--------------------
Q59PZ2_CANAL/94-759GINSEPNLYYGKFDCCKGGL.LLQVIQERMVYY....KGD.PTS.LD..FLTQLFDIVSS--------------------
Q6C787_YARLI/102-681IDTRGYGISLNGSSMCRGGI.TLKVIAERLNA....HSGD.PTA.NQ..LLTRLLNDASK--------------------
ALP4_SCHPO/74-693DISHVVNATRSKKKVCKGGQ.VISFLTESLTK....YAGD.PVA.RK..ILTYLLREASR--------------------
Q4X128_ASPFU/183-784EGGDLIPGAMSSKKICKGGN.VLRLLTERLAT....FSGD.PTT.KT..LLEKLLRDASR--------------------
Q7S902_NEUCR/140-744DGGDLVPGNMTGKKICKGGV.VLGLITKRLES....LSGD.PSA.RV..LLTTLLRDASR--------------------
Q0V2V1_PHANO/184-787.LESLREGGNATKKLCKGGS.VLGLITKRLSS....MSGD.PAA.RT..LLTTLLREASR--------------------
Q5KPG7_CRYNJ/181-812KNLKAREGLIGDGGDVLGGE.VLGIICEREAT....MSGD.PTA.ST..LHSSLLLHASQ--------------------
Q4Q0X5_LEIMA/136-766.......TFASPSTGLVGPR.ILNHLCDQVNKY........SGSCEDHELLTLLLRRSLV--------------------
Q9VS91_DROME/97-627...............ARGNLTSAQVLTLLDQFYRDLKDTD.IDL.KE..RVNKILTSTSR--------------------
Q2M118_DROPS/72-608...............ARGKKTSAQILSDINEIYEKLKPSD.LEL.KE..LLEKILNSVSS--------------------
GCP3_DROME/235-758...............KKGGD.LASTVYDFLDN......GN.DMV.NK..LVEDLLTAICG--------------------
Q16YQ3_AEDAE/217-729...............LKGGA.LATIVYDYTAN......GD.PEN.RR..LAMELLRSACI--------------------
GCP3_MOUSE/251-761...............RKGGE.LASAVHAYTKT......GD.PYM.KS..LVQHILSLVSH--------------------
Q1K720_NEUCR/225-737...............KHGGQ.LVTLIHNFSSS.....HGD.PVV.AA..FAERLLVDVTR--------------------
ALP6_SCHPO/196-713...............QENKKRLIQVVSKYNVH......GD.PLI.QE..LSDKILTEITG--------------------
A0A0D1E4X1_USTMA/283-861...............AHGGL.LVSLIHSYTFN......GD.PFI.RK..FTSGLLDEVSK--------------------
GACP3_ARATH/192-713...............LRGGA.MAGAIHLHAQH......GD.PLV.HD..FMMSLLRCVCS--------------------
SPC98_DICDI/112-705..............DMKGGE.ILSKIDTLSKH......GD.QDI.RI..LIHNIMFKICQ--------------------
Q383E4_TRYB2/204-700...............VKGGE.LASKLQRLVQQ......GS.RRL.CA..LLSDVYMEAVS--------------------
Q6FLE0_CANGA/180-724...............LTGDQ.LLSLLEQL...R...HHGD.LTI.EN..IADKLFSTLLT--------------------
SPC98_YEAST/187-740...............LSGDT.FLIELNIF...K...SHGD.LTI.RK..IATNLFNSMIS--------------------
Q74Z68_ASHGO/190-740...............LRGDQ.LISEFDSL...R...QHGD.PLV.KN..LAEEIFSTLID--------------------
Q6CIT0_KLULA/175-721................SSAEGLLSVCQLQ...K...SNGD.PVL.EK..FASDALERLLQ--------------------
Q6BX70_DEBHA/183-753................SGYE.FLSKVYHL...S...KFGD.IRI.KD..LTHNIFSQISA--------------------
Q4U9K6_THEAN/45-615........................LILDSLDFRCRSEVGS.KKL.....LLQHILNSVLD--------------------
Q4N294_THEPA/45-610........................LILDSLDFRCRSEIGP.KKL.....LLQHILNSVLD--------------------
A8BD62_GIAIC/283-863...............VRGCA.LLQQLETAVLQSSGLSVKE.........VFQYLLSESLK--------------------
Q0UGY4_PHANO/31-649.............GASSGAQ.VIDKLRMEAQT......GH.PTI.EE..AANQLGDVAET--------------------
Q2H2M0_CHAGB/4-638......GGSGGGEAGCTGAR.VMDFLRGELQT......GY.RDV.EE..AAGSLVGVAEA--------------------
Q2UDA7_ASPOR/4-644...............CTGAA.LIDYLRAESQT......GY.IDI.GE..MALHLISAAET--------------------
Q0CV34_ASPTN/4-641...............CTGAA.LIDFLRAESQT......GY.QDL.EE..MALHMIGVAEV--------------------
Q4WZU3_ASPFU/32-668...............CTGSA.LIDYLRTESQT......GY.LDL.EE..IALHLITVAES--------------------
A1C7R2_ASPCL/32-668...............CTGAA.LINYLRTESQT......GY.VDL.EE..MALHMIATAET--------------------
C8VMB1_EMENI/4-637...............CTGAG.LIDHLRRESHT......GY.IDI.EE..IVLDLIGAAET--------------------
Q5KH00_CRYNJ/4-686.....................LIDLILLKSQT......GN.PFL.QN..IFSNLAKSLQD--------------------
Q584R6_TRYB2/3-521..............QQKNADLLLVTIQSFLSN.........REIPQK..FRLWMGEAVWM--------------------
Q0IG23_AEDAE/4-557.............QRIHGCA.LLQYLQQNCLH......GN.EKH.YQ..AVKLIQNAVYA--------------------
Q7PWU6_ANOGA/4-573.............QRIHGCA.LLPYLQQHCLH......GN.DAN.YQ..AVKTIQKSVYV--------------------
GCP4_DROME/4-548.............LNLRGCV.LLHNLHQQCEH......GD.IQL.EK..AIKIIMKPVKN--------------------
GACP4_ARATH/4-645.............DDIRGGQ.LLNVLNKRCHC......GV.PEL.RT..CLQRLLWNGHQ--------------------
Q60F24_ORYSJ/4-649.............KDIKGGQ.LLNLLHKRCHC......GV.PEL.QS..CIQRLLWHGHQ--------------------
Q05AR5_XENTR/4-571.............QKIHGCQ.ILETVYKHSCG......GL.PPV.RS..ALEKILAVCHG--------------------
Q01B37_OSTTA/4-547..............GARGVS.GAEVLRRARDAW..LRAGH.PAT.RA..ACERLYWRATQ--------------------
A0C933_PARTE/4-693.............HNMRGGQ.ILDYLYERTLT......GN.DKL.QL..IYQNILSACYE--------------------
Q24CL5_TETTS/4-831.............ENLKGGQ.LLDLMHSKSQT......GN.TAL.RE..VYQILTDQCYS--------------------

PF14609

MOD21_SCHPO/60-677P....KLHHMSEEILR--------S--IMTE---------LADYGSN---------------------------------
E4WX70_OIKDI/53-731P....VNDTLEYWIEQ--------T--NLLH---------KKGFGKG---------------------------------
B6K1F8_SCHJY/48-653PFDYFQIQGLSTSMQE--------H--ILSN---------FCNWGRE---------------------------------

PF04130

Q2M0Y2_DROPS/276-1264T----YFAQLQRWVYK........G..ELDE.A.......VNEIFIRRR...............................
Q29HV5_DROPS/223-746P----LTRMISQWMLD........G..DITD.L.......HNEFFVE.................................
Q5KL44_CRYNJ/218-790P----FFLTLQRWIFS........G..ELHD.P.......FKEFFVQLNPENVSFREGQ..................ISP
Q2UAG9_ASPOR/234-750T----YARPIRLWMEK........G..ELEETV.......QGSFFIR.................................
Q4WEE6_ASPFU/229-741T----YIRPIRRWMEE........G..RLDP.R.......EGVSFII.................................
A1C564_ASPCL/237-752T----YMRPIHRWMEE........G..QLDS.R.......QGTFFII.................................
Q5AUB0_EMENI/232-744T----YARPLYRWMET........G..QLED.S........SLFFVS.................................
Q0UBK8_PHANO/224-738T----YLKPIRKWMEA........G..ELGA.N.......DETFFVF.................................
Q2HBB4_CHAGB/228-739V----YLKPIRLWMEE........G..KLLP.G.......DRTFFIS.................................
Q1K6Z8_NEUCR/239-749V----YLKPIRFWMEE........G..ELLA.G.......DRTFFIG.................................
F4HUK8_ARATH/48-872P----YVESLDSWLFE........G..TLDD.P.......FEELFFT.................................
GCP5_MOUSE/273-942P----YLQTVDEWIVH........G..HLWD.G.......AREFIIQ.................................
F1QBQ4_DANRE/270-933P----YLEIVDEWIVH........G..HLFD.P.......AKEFIIQ.................................
C3ZYG0_BRAFL/302-1685P----YLEIIDGWVNK........G..NLID.P.......AMEFIIQ.................................
Q7PX58_ANOGA/302-918C----YMNMIDTWWTE........G..RLDD.W.......REEFLVEKTY..............................
A0A0D1E2A2_USTMA/319-997P----AWRSVCHLLQRGLSFAIHRDHDLLFDDR.......LVQHMIR.................................
Q9VTS3_DROME/266-1244N----YFIQLQRWIYH........G..ELDE.S.......VNEIFISRCL..............................
Q17IM7_AEDAE/330-1376A----YFLLFQQWLFG........G..QLGD.P.......SGELFIY.................................
Q0UQH9_PHANO/170-704P----SLELLAEWI..........G..TMKEQETI..PVTSRDSFVT.................................
Q5BEM5_EMENI/175-843P----WLTYVETWI..........G..FRPETSASIELLTNGRSFVS.................................
Q2UCE2_ASPOR/176-851P----FLKHAETWI..........G..LRLEASTLKELAANGRSFVV.................................
Q0D0R6_ASPTN/174-839P----FLDHIESWV..........G..FRSETPTSKEFARSGRSFVS.................................
A1CPI0_ASPCL/179-855P----WLHYVEAWV..........G..LRAETPGLFEATGNSAGFVV.................................
Q4WSG8_ASPFU/170-850P----WLQYVEAWV..........G..LRTETPALVDLAAKSEGFVA.................................
Q2H076_CHAGB/195-897P----WIEFVEEWV..........G..LRAENGIAMTKTGPSKGFVN.................................
A0A0D1BZI3_USTMA/198-1067T----WRQQVARWVGFPGFESDRTG..ELDDRP.............SVL...............................
A8BFK8_GIAIC/197-740P----FFDYLKHWIIE........G..SLL..........STEYFIQPTTSNSTD.........................
A2E6U4_TRIVA/44-540P----ILEYIEKWIYE........G..KIDD.P.......YNEFFIQT................................
GACP2_ARATH/70-583A----YLSILERWVYE........G..IIDD.P.......YGEFFIAENR..............................
Q0JBZ2_ORYSJ/73-597A----YLRMLERWVYE........G..VIDD.P.......YGEFFIAENK..............................
GCP2_DROME/204-721P----YMRMLQMWIQK........G..VIVD.R.......HREFLVVDNE..............................
Q29G36_DROPS/282-800P----YMRMLQLWIQK........G..VIVD.R.......NREFLVEDNE..............................
Q16HU4_AEDAE/210-728P----YMEMLQLWIFN........G..VIHD.T.......RKEFLVEH................................
Q7Q703_ANOGA/248-764P----FMEMLELWIYR........G..VIND.P.......QQEFFIDH................................
GCP2_MOUSE/220-738P----YFEILEKWIYR........G..IIHD.P.......YSEFMVEEH...............................
SPC97_DICDI/430-1044P----FLEMLDLWIHQ........G..IIRD.T.......YFEFMIEENT..............................
A0BDB2_PARTE/150-660P----YMKQLSNWIYY........G..RIDD.P.......FEEFLVAEK...............................
Q23AE3_TETTS/242-771P----YVQMLSQWIYY........G..QIDD.L.......FQEFFIQENV..............................
SPC97_YEAST/62-688D----YCTMLYEWLTQ........G..ILND.P.......YQEFMTYDD...............................
Q6FQY5_CANGA/70-712G----YLKMFDDWLIN........G..DIND.P.......HEEFMIRDMMK.............................
Q756H1_ASHGO/63-723P----YCEMLNEWLIK........G..DLKD.P.......YEEFLISDTS..............................
Q6CXD9_KLULA/57-697V----YGQMFVEWMQE........G..KLND.Y.......HEEFLISDTVA.............................
Q6BGV8_DEBHA/61-751D----YVSMLNKWLIN........G..EIDD.S.......AEEFIIKMNR..............................
Q59PZ2_CANAL/94-759D----YIGMLNQWLLE........G..VIND.P.......FDEFMIREKR..............................
Q6C787_YARLI/102-681P----YLQMLSRWIYQ........G..VILD.P.......YGEFCIQEN...............................
ALP4_SCHPO/74-693P----YTKMLNEWIHL........G..LVND.P.......YDEFMIKIHK..............................
Q4X128_ASPFU/183-784P----YMAMLNEWLHH........G..DIKD.P.......HAEFLIKEQK..............................
Q7S902_NEUCR/140-744P----YMAMLNEWLHH........G..SIND.P.......HSEFLIKEQK..............................
Q0V2V1_PHANO/184-787P----YMAMLNEWLHH........G..GIKD.P.......HSEFLIKEQR..............................
Q5KPG7_CRYNJ/181-812P----YCKMLIQWIAT........G..HLSD.P.......FDEFMVKESG..............................
Q4Q0X5_LEIMA/136-766P----YLRMLQRWMHS........G..VLDD.P.......YGEFFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPSA
Q9VS91_DROME/97-627A----YMKIVQLWMQK........G..VLFD.T.......QHEFFVEDTEPS............................
Q2M118_DROPS/72-608V----YMKIVQLWTQK........G..IIYD.L.......QHEFFVEDSERS............................
GCP3_DROME/235-758P----LVRMISKWILE........G..GISD.M.......HREFFVK.................................
Q16YQ3_AEDAE/217-729P----LQQALIRWLID........G..EIID.P.......NGEFFIE.................................
GCP3_MOUSE/251-761P----VLSFLYRWIYD........G..ELED.T.......YHEFFVA.................................
Q1K720_NEUCR/225-737P----FYDILRRWIYD........G..ELLD.P.......HMEFFVREQNP.............................
ALP6_SCHPO/196-713P----LYEMIENWIYK........G..ELVD.P.......YQEFFVKEK...............................
A0A0D1E4X1_USTMA/283-861P----FFNSLSLWIYQ........G..ELQD.P.......FREFFVELNDDPRKVNQS....................RT
GACP3_ARATH/192-713P----LFEMVRSWVLE........G..ELED.T.......FGEFFVV.................................
SPC98_DICDI/112-705P----LFSMIRLWMFK........G..EIND.P.......YQEFFIR.................................
Q383E4_TRYB2/204-700P----LLHMTVSSIIK........G..DVSD.P.......FNEFFVK.................................
Q6FLE0_CANGA/180-724L----YYDYLSQWLTL........G..SIDN.T.......NNELFIE.................................
SPC98_YEAST/187-740L----YYEYLMNWLTK........G..LLRA.T.......YGEFFIA.................................
Q74Z68_ASHGO/190-740L----YMEYLLYWLVR........G..QLKS.T.......HDEFFVS.................................
Q6CIT0_KLULA/175-721P----YMKNICDWLID........G..KLDSNV.......SSDFFVQ.................................
Q6BX70_DEBHA/183-753P----YYEVLEHWVIK........G..ELID.N.......SDEFFIA.................................
Q4U9K6_THEAN/45-615S----YSLLINHYINFFNFSQVDFT..DF...........VTDFFIKTCE..............................
Q4N294_THEPA/45-610S----YSLLINHYINFFNFSQVDFT..EF...........VSDFFIKINQ..............................
A8BD62_GIAIC/283-863P----LGRIMDRYINE........A..VIPDSD.......AADFFIRKSH..............................
Q0UGY4_PHANO/31-649S----WLRQLSTWLLY........G..RLPSFG.......AIDFFVH.................................
Q2H2M0_CHAGB/4-638A----WVKQVSAWVLY........G..RLPGFG.......EGDFFVR.................................
Q2UDA7_ASPOR/4-644A----WMRQLSTWLLY........G..NLPVLG.......KDDFFIQ.................................
Q0CV34_ASPTN/4-641A----WMRQLSTWLLY........G..NLPVLG.......REDFFIQ.................................
Q4WZU3_ASPFU/32-668A----WIRQLSTWLLY........G..NLPIFG.......KDDFFIQ.................................
A1C7R2_ASPCL/32-668A----WMRQLSTWLLY........G..TLPVFG.......KEDFFIQ.................................
C8VMB1_EMENI/4-637A----WMRQLSTWLLY........G..NLPILG.......KGDFFIQ.................................
Q5KH00_CRYNJ/4-686L----FLTHLVSFILH........G..IAPSEPLMTSPSIGRTVGVD.................................
Q584R6_TRYB2/3-521S----LLYTIGHYVAH........G.VVLHG.........RRDFFIS.................................
Q0IG23_AEDAE/4-557I----FIKQLFGWLLH........G..KFVD.Q.......FGEFFIQHVDNTKTAGIGSL................QGTT
Q7PWU6_ANOGA/4-573I----FLKQLYGWLMH........G..KFVD.H.......YGEFFIQQVESSAKASIAAGG...............AAIA
GCP4_DROME/4-548A----FFSSLAHWLLF........G..VIDD.V.......HSEFFIKFTPTDAVDG........................
GACP4_ARATH/4-645V----MYNQLAAWMVY........G..ILQD.P.......HGEFFIKRQDDGDLDHR.......................
Q60F24_ORYSJ/4-649V----MFNQLTSWMVY........G..ILQD.Q.......YNEFFIRRQEDRDKEND.......................
Q05AR5_XENTR/4-571V----MYKQLSAWMLH........G..LLLD.Q.......YEEFFVRQGPSSNLAA........................
Q01B37_OSTTA/4-547V----MMQQLLGWCAH........G..TIVD.P.......CDEFFVRTID..............................
A0C933_PARTE/4-693V----LFQQLSSWLQY........G..QILD.T.......SDEFFIQR................................
Q24CL5_TETTS/4-831V----LYQQLSGWILY........G..NLQD.Y.......YDEFFIYRIEQTKS..........................

PF14609

MOD21_SCHPO/60-677------LEFFR.QKLTSPSDSFFKSDD............--------------------------------------QST
E4WX70_OIKDI/53-731------FDVMNYQVANERQCQIWLCDSCMGITENPLINW--------------------------------------DEE
B6K1F8_SCHJY/48-653------LHILN.RVASTKHCRFLPSSPS...........--------------------------------------DIE

PF04130

Q2M0Y2_DROPS/276-1264........APLDRQIDECSKEFFDK...............GYQV.................................HEE
Q29HV5_DROPS/223-746............SLTDIGPDRLWHD...............KFRV.................................RTA
Q5KL44_CRYNJ/218-790TGDVGFEMGMDADGGEEEAYKLWEK...............KYVF.................................VKK
Q2UAG9_ASPOR/234-750..........DNRNNDLDLRTLWHG...............WYTL..................................DE
Q4WEE6_ASPFU/229-741..........DQR.DDKDLRSLWRD...............WYAV..................................DD
A1C564_ASPCL/237-752..........DNH.NDNDLRSLWRE...............WYTL..................................DE
Q5AUB0_EMENI/232-744..........ANH.EKNDLRTLWHD...............WYLL..................................ET
Q0UBK8_PHANO/224-738...........ESDSGSDAASLWHD...............RYVL.................................RRD
Q2HBB4_CHAGB/228-739...........ESPAKLPLSQIWKG...............QFNL.................................LRS
Q1K6Z8_NEUCR/239-749...........KSSARPQLHQIWEQ...............QFHQ.................................LVS
F4HUK8_ARATH/48-872..........ANQSVSVSDAEFWEK...............SYLLTRVLGPKSNVTSLNQKKGMSGNDSNSVSDKDKEQNN
GCP5_MOUSE/273-942..........RNKNVPVNHRDFWYA...............TYTLYSVSEKTENEDKVS....DSASASSGSDQGPSSRQH
F1QBQ4_DANRE/270-933..........RNKDVPVNHRDFWYA...............TYTLYSVSEMVESEERLS....DAASGSSGGEQTSSSRQH
C3ZYG0_BRAFL/302-1685..........RNGKVDVFHEDFWES...............AFLVSCSPMHQDDTTESSMK.EDGQEENLDDGKTDKDTRE
Q7PX58_ANOGA/302-918......GEHSPTGLQTGYQARMFSKCK...........IRSFYV..................................SS
A0A0D1E2A2_USTMA/319-997..........HDASISTSDSAFWTS...............GYVVNQPS.........................IDEVDNM
Q9VTS3_DROME/266-1244.......NTSP.SFTNQCSKEFFDK...............SYQV.................................DNE
Q17IM7_AEDAE/330-1376..........FVDHYRPKTKHFFDK...............AFLI.................................RRQ
Q0UQH9_PHANO/170-704........................LEPNPL.....NEDQPEYVY.................................RSE
Q5BEM5_EMENI/175-843.....................LEKSESNGKI...SSQERHEYAY.................................LPE
Q2UCE2_ASPOR/176-851.....................LEPSEENPKT..TSQSTRLEYRY.................................NPA
Q0D0R6_ASPTN/174-839.....................LRHPEESDKQ..ISKAEMDHYIY.................................CPE
A1CPI0_ASPCL/179-855.....................TERRDGRSTSK.RSRTTTVDYRY.................................HPD
Q4WSG8_ASPFU/170-850.....................VERYEGRAGSR.SMKASSLQYRY.................................HPE
Q2H076_CHAGB/195-897.................IVDKMWIDDQGF......ELEEADYFL.................................DED
A0A0D1BZI3_USTMA/198-1067........KSGSSSNTAHISTPWSGAVVDWSLDERGEEDVGYTL.................................KPS
A8BFK8_GIAIC/197-740..ILILQTNNLLVSRSIFINSNWYN...............KFHI.................................SSS
A2E6U4_TRIVA/44-540........NDISPDIPDPHRTYWND...............HFTC.................................NEE
GACP2_ARATH/70-583.......SLKKESLSQDSTAKYWSQ...............RYSL..................................KD
Q0JBZ2_ORYSJ/73-597.......SLQKESLTQDYDAKYWQQ...............RYSL..................................KD
GCP2_DROME/204-721.......VIHRDELPEHYSDDYWER...............RYTL.................................RDE
Q29G36_DROPS/282-800.......VVHQGELPEHYSDDYWEK...............RYTV.................................RRD
Q16HU4_AEDAE/210-728.........HAMDLNENDMMDYWEK...............QYII.................................RTD
Q7Q703_ANOGA/248-764.........SSMELTENELVDYWEK...............QYTI.................................RNE
GCP2_MOUSE/220-738.......ELRKEKIQEDYNDKYWDQ...............RYTV.................................LPQ
SPC97_DICDI/430-1044.......DLKRDNINRDFNDLYWEQ...............RYQI.................................RQD
A0BDB2_PARTE/150-660.......KIQKSSLETDYKNDFWDQ...............RFAL.................................RNS
Q23AE3_TETTS/242-771.......FVKRDNISKDFKENYWDQ...............RFIL.................................REK
SPC97_YEAST/62-688.......LEGKTDNIFDTRDRAWDT...............QYFI.................................RKD
Q6FQY5_CANGA/70-712......DVNVTDTNAMMTTDRLWET...............RYLI.................................RKD
Q756H1_ASHGO/63-723.......QDNNIVLNSLNSERLWDT...............QYVI.................................RKD
Q6CXD9_KLULA/57-697......DVDEEKLANTIDNERLWDT...............RFVI.................................RKD
Q6BGV8_DEBHA/61-751......FPDNPDSPIRRNVEKYWDE...............LYVT.................................RTD
Q59PZ2_CANAL/94-759......VPDSFMEIFQSKSEYYWNE...............LFLI.................................KID
Q6C787_YARLI/102-681........GDLATGNEGAYDEYWEQ...............RYSV.................................RKD
ALP4_SCHPO/74-693.......GITSMQLDEDYTDEYWEK...............RYVI.................................RED
Q4X128_ASPFU/183-784.......WIKREKLEEDYTDEYWEK...............RYTI.................................RDN
Q7S902_NEUCR/140-744.......SIRRERLEQDYTDEYWER...............RYTI.................................RDH
Q0V2V1_PHANO/184-787.......SIKRERLDQDYTDEYWEK...............RYTM.................................RDA
Q5KPG7_CRYNJ/181-812.......HITKGVLESDYTDEYWER...............RYTLRDGAIPGSSKVSARN...NTPSISAGVPPPRQGTNR
Q4Q0X5_LEIMA/136-766TSAGRDGELGASGASTASQGRFGLKRRAAAQQ.DVVAFDRRFSL.................................NKS
Q9VS91_DROME/97-627.....STMSSTLLAPEKCCHAYWAE...............RYRL.................................LPD
Q2M118_DROPS/72-608.....NSMSSTLLAPEQCCHAYWEN...............RYTL.................................LPE
GCP3_DROME/235-758............SIKDVGVDRLWHD...............KFRL.................................RLP
Q16YQ3_AEDAE/217-729............EICEVGFDQLWHQ...............KYRI.................................RKS
GCP3_MOUSE/251-761............SDPTVKTDRLWHD...............KYTL.................................RKS
Q1K720_NEUCR/225-737......LDEERKDAKAKGQMSVWNS...............KYEL.................................VED
ALP6_SCHPO/196-713.......NGSESHDHQGQGDVVWKG...............KYFL.................................DKE
A0A0D1E4X1_USTMA/283-861HSNLADGDMPSFGDLDGDAASLWQN...............KFVF.................................RKE
GACP3_ARATH/192-713.............GQPVKVDLLWRE...............GYKL.................................HPA
SPC98_DICDI/112-705............QYESVQLEKTWKE...............KFAI.................................VAR
Q383E4_TRYB2/204-700..........SDPRVEDTSDTFWSS...............KFSL.................................LPD
Q6FLE0_CANGA/180-724...........VEQENTDGEVIFKL....................................................NTD
SPC98_YEAST/187-740.........ENTDTNGTDDDFIYHI...............PIEF.................................NQE
Q74Z68_ASHGO/190-740..............VNKSADPKLGM...............NFAI.................................LKE
Q6CIT0_KLULA/175-721...............NDEKEPL..................GLVF.................................LPQ
Q6BX70_DEBHA/183-753...........FNTEAQHINDIIEY....................................................LPQ
Q4U9K6_THEAN/45-615.......NYEFSPSNERDDGTGWNLCSFCR.....EVGWPRVWV.................................DER
Q4N294_THEPA/45-610......DDEYSPSDAYGDEGTEWNLSSLCR.....EIGLPRVSI.................................DER
A8BD62_GIAIC/283-863.......STELAEEQGKTTINTWMQ...............MFKV.................................DDA
Q0UGY4_PHANO/31-649........................RDEED.......SGELLFVI.................................NHQ
Q2H2M0_CHAGB/4-638........................RVVGE.......EGREEYGC.................................EMA
Q2UDA7_ASPOR/4-644........................EDSIAES..NRTPAVAQFVL.................................RTD
Q0CV34_ASPTN/4-641........................EEPMDGN...TPSVAPSFAL.................................HVD
Q4WZU3_ASPFU/32-668........................KDNSSQM..DDSSSITNFVM.................................QTS
A1C7R2_ASPCL/32-668........................EDKSSDP..DSSSAVTQFVM.................................QTN
C8VMB1_EMENI/4-637........................EADTKEN..EGPVSTVQFTI.................................HTQ
Q5KH00_CRYNJ/4-686........................PLSP.........QHRVYAL.................................NVD
Q584R6_TRYB2/3-521........................VKSK........GGKEDHTL.................................HSD
Q0IG23_AEDAE/4-557GGTGTHLSVNSFSDNTSINTELW.................RYEI.................................RHE
Q7PWU6_ANOGA/4-573NPPAGHTSVNT.SDSASINTELW.................RYEI.................................RRE
GCP4_DROME/4-548SSFSKSATCSLLSAEKNPEDYIW.................QYEV.................................NMS
GACP4_ARATH/4-645SSQEEVSEKLARTSVHETSLTDWHS...............GFHI.................................SLD
Q60F24_ORYSJ/4-649SSQVDVADKFTQKSAKETSLTSWHT...............GFHV.................................SLD
Q05AR5_XENTR/4-571SSEEDDDDLGIGGLTGKQLRELQDLRLIEEEN.MLAPSLKQFSL.................................RAE
Q01B37_OSTTA/4-547.......RCEGLRTKEDDGGGIWHE...............SHRV.................................ALE
A0C933_PARTE/4-693.........IDEKKKTDQHEYNWDT...............SFTL.................................NIQ
Q24CL5_TETTS/4-831..QQSNAYDKNVVEQPNELEIDWDS...............IFSL.................................RYA

PF14609

MOD21_SCHPO/60-677-----KNE-PFLSVVFIYPQIKPHLLSCLKNTHQELIKL-----------------------------------------
E4WX70_OIKDI/53-731-----KQE-AFVNEFTLVQHATPNWHGYIK....RLLPL-----------------------------------------
B6K1F8_SCHJY/48-653-----RLP-PF.....IFQIMTVWMNETVQN...ELLRM-----------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264.....EVP.DFLSGC......ETVILHCGKYN--RLLKAFNAQHPAFDVSYPDIVVCLSEQQLTAMRRNLNDKYNRIRQT
Q29HV5_DROPS/223-746.....MQP.KFIGQE.....LADKILRTGKSI--NFLREVCEMNELVKGQ..............................
Q5KL44_CRYNJ/218-790.....MVP.GFVGED.....FAKKIFSTGRSL--NFIRYSCHDSDWIETQ..............................
Q2UAG9_ASPOR/234-750SAWISSAP.KFVQPV......ARKIFVAGKSM--VFLRHL........................................
Q4WEE6_ASPFU/229-741S..CGL.P.QFMRPV......AQKIFTTGKSM--VFLQHL........................................
A1C564_ASPCL/237-752TSGLEHIP.QFMKPF......ARQIFTAGKSM--VFLQHL........................................
Q5AUB0_EMENI/232-744KPELAKIP.KFIRPF......AHKIFITGKSR--VFLNRL........................................
Q0UBK8_PHANO/224-738AQNSLQCP.SFLQPA......VKKIFNTGKSI--IFLKELG.......................................
Q2HBB4_CHAGB/228-739PEGKLHAP.RFLDPS......IHQIFEAGKSI--VVLKHM........................................
Q1K6Z8_NEUCR/239-749SEGVLNAP.RFLSPA......VDRIVRAGKSI--VVLKHL........................................
F4HUK8_ARATH/48-872R...VLCP.LFIKDI......CKSIVSAGKSL--QLMQHIPSTSSENCEKIQYHGRNGFGNSGCGILLAGKNSFRSIADL
GCP5_MOUSE/273-942.....TMV.SFLKPV......LKQIIMAGKSM--QLLKNLNCAEGPACQAAARDAERKSLYTLFLESIQLRLQHGEDSAP
F1QBQ4_DANRE/270-933.....TMV.SFLKPV......LKQIIMAGKSM--QLLKNLDCKETEQSDGSSRDAERKSLYTLFLESVQTRLRRGEESPT
C3ZYG0_BRAFL/302-1685NQEEEFIP.VFLKSV......FKEIILAGKSM--ELLKALGKMGGRVEFPVPLYEEFVQSLQTFLEVTDDLDQTGSSLCP
Q7PX58_ANOGA/302-918.....AIS.EVIENDPIIKLLLHHSLEAGYTL--NILNGLDRISDMRKEQGTDENLIYTSFLKTIVDELERFR.......
A0A0D1E2A2_USTMA/319-997VNPGYSSP.AFLQSI......MQDVLTTAKGV--GLLRSLGVDALGGVQPDPNLGHVLGLRTTIAQTSLNPLQSLVERGA
Q9VTS3_DROME/266-1244.....AIP.EFLVGC......EEEILQCGKYN--LVLRAYNAQHPVFDVQYPDIVVCLTEQQLKNMRRNLADKYAIIYKR
Q17IM7_AEDAE/330-1376.....AVP.GFLKGF......EEDILLCGKYT--MLLKAFKKSHPIFSLKIPKLEVCLSYRAVDRLKARWLQYVAKARDV
Q0UQH9_PHANO/170-704.....MMP.RFILPE.....DGNMAFETGQSL--RFLKTQHPGHPLVRLHDAEISPPKFQW...................
Q5BEM5_EMENI/175-843.....QMP.SFVPPD.....QAYLIYESGRSL--RLLKRYHPHHPLAGEQVRIDSPKLACAGTWAELERIQMKARDYEAR
Q2UCE2_ASPOR/176-851.....EMP.SFIPTD.....QAELIFESGRSL--RLLKRFHPQHPIASDEICNGDVPRLSCASTWTDIERIQEKAKIYEN
Q0D0R6_ASPTN/174-839.....QMP.SFVPSD.....QAKLIFESGRSL--RLLKRFHPRHPIANGKFRNSTLDCARSWAEIERIQSKAQTYERELR
A1CPI0_ASPCL/179-855.....QMP.SFIPED.....QAQLIFESGRGL--RLLRRYHPQHPVASGTPLRKDRRPALSCAGTWSDIERIQKKAQFYE
Q4WSG8_ASPFU/170-850.....QMP.TFIPAE.....QADLIFETGRSL--RLLRRYHPQHPIANDAILTKDSPNLRCAGSWSDIERIQKKAQQYET
Q2H076_CHAGB/195-897.....RVP.TFIPED.....MARSIFETGQNL--RFLREHHPEHPLARPDLVSLAMPPKLEWEFNWDAVSQLEARVNQYQ
A0A0D1BZI3_USTMA/198-1067.....AVP.SFLPFR.....HARAFLEAGRAL--RLLKKAAPQDHPLVHQWSLNAQERASAKRVSLPTWRWSLLESKLQV
A8BFK8_GIAIC/197-740.......P.DLKTHPLLSPYVTKLCFEIGRAS--AFLRE.........................................
A2E6U4_TRIVA/44-540.....NAP.MFIPSA.....IINLIIATGKVQ--SIIAD.........................................
GACP2_ARATH/70-583.....TIP.GFLANI......AATILTTGKYL--NVMRE.........................................
Q0JBZ2_ORYSJ/73-597.....GIP.SFLTNV......AATILTTGKYL--NVMRE.........................................
GCP2_DROME/204-721.....QIP.SFLAKY......SDKILRTGKYL--NVIRQ.........................................
Q29G36_DROPS/282-800.....RIP.SFLEKY......SDKILRTGKYL--NVIRQ.........................................
Q16HU4_AEDAE/210-728.....KVP.CFLNEY......ADIILRTGKYL--NVIRE.........................................
Q7Q703_ANOGA/248-764.....KVP.CFLAKH......ADIILRTGKYL--NVVRV.........................................
GCP2_MOUSE/220-738.....QIP.SFLQKV......AGKILSTGKYL--NVVRE.........................................
SPC97_DICDI/430-1044.....QIP.KYLQSH......ALKILTTGKYL--NVVRECNQSISQQQQHNK............................
A0BDB2_PARTE/150-660.....QIP.KFLEKY......QDIILRTGKYI--NVIGQ.........................................
Q23AE3_TETTS/242-771.....QVP.AFLYLW......KEMVFKTGKYL--SVLSE.........................................
SPC97_YEAST/62-688....VLLR.DCDSEED..KNLLFKMLRTGILL--KVVRA.........................................
Q6FQY5_CANGA/70-712....GLLE.SFHEEL......LSKILVTGKLL--NIVKV.........................................
Q756H1_ASHGO/63-723....GLTE.QFQDRQ.....LQYKVLMTGKLL--NLFKR.........................................
Q6CXD9_KLULA/57-697....GLLP.QFRDKE.....LQQKILMTGKIW--NLIAI.........................................
Q6BGV8_DEBHA/61-751....GVID.QFSSKD.....IQLKILATGKYL--NIFKT.........................................
Q59PZ2_CANAL/94-759....GLLN.QFQNST.....IQSKILNTGKYL--NIFKR.........................................
Q6C787_YARLI/102-681.....ELP.LLLSQS....NLLEKVLLAGKYL--NIVRE.........................................
ALP4_SCHPO/74-693.....QVP.PQLLDL......QNKVLFAGKYL--NVVLE.........................................
Q4X128_ASPFU/183-784.....EVP.PQLEGV......KDKVLLAGKYL--NVVRE.........................................
Q7S902_NEUCR/140-744.....DVP.PQLEAV......KDKVLLAGKYL--NVVRE.........................................
Q0V2V1_PHANO/184-787.....LVP.PQLEAV......KDKVLLAGKYL--NVVRE.........................................
Q5KPG7_CRYNJ/181-812LPGGACIP.QFLQPW......KHKILLAGKYL--NVIRE.........................................
Q4Q0X5_LEIMA/136-766.....LVP.VFLNTPS...RIAKMAFFAGKYC--CILRE.........................................
Q9VS91_DROME/97-627.....RLP.GFLLSQ......ADDIFLAGKYL--NILRQ.........................................
Q2M118_DROPS/72-608.....RLP.DFLNPL......AAEIFHAGKYL--NILRQ.........................................
GCP3_DROME/235-758.....MLP.KFVPMD.....MANKILMTGKSI--NFLREICEEQGMMKERDE............................
Q16YQ3_AEDAE/217-729.....MLP.SFVSDG.....IARRILVIGKSI--NYLREVCQDKTPVKARND............................
GCP3_MOUSE/251-761.....MIP.SFITMD.....QSRKVLLIGKSI--NFLHQVCHDQTPTTKMIAV...........................
Q1K720_NEUCR/225-737.....MVP.SIITRN.....FADKVFLIGKSL--NFIRHSCGDHKWVED...............................
ALP6_SCHPO/196-713.....LIP.SFLSEE.....LVDKIFLIGKSL--NFARYGCGDFDWAQE...............................
A0A0D1E4X1_USTMA/283-861.....MLP.SFLQES.....FGRKIFSTGKSL--NFIRQSCGDGDWVGMR..............................
GACP3_ARATH/192-713.....MLP.SFISPS.....LAQRILRTGKSI--NFLRVCCDDHGWADAASEA...........................
SPC98_DICDI/112-705.....LLP.SFISLP.....LSKRILIIGKSI--NYMKQFCNNFKEDKNDRYYYYNQEDDDDDDEDHDDNDD........
Q383E4_TRYB2/204-700.....MLP.TTVSYS.....LAERIRLVAKNV--SFIRNCCRCKQWHM................................
Q6FLE0_CANGA/180-724.....KIP.SFLTYM.....QARQIFVIGKSY--IFVQKYCKELEYSNEFS.............................
SPC98_YEAST/187-740.....RVP.AFIPKE.....LAYKIFMIGKSY--IFLEKYCKEVQWTNEFS.............................
Q74Z68_ASHGO/190-740.....SIP.GFIPPA.....VAQQIYTVGKSY--IYLETYLKEIEWASNFS.............................
Q6CIT0_KLULA/175-721.....KIP.KFIPSL.....VAKKIYIIGKSL--RYLEHCCSEVEWIGKF..............................
Q6BX70_DEBHA/183-753.....RIP.DFFVSMN..ETMAYKIYQIGKML--IFLLKYCKELKWISDYSM............................
Q4U9K6_THEAN/45-615.....YVP.KFLKNV......AVSVLEIGVLL--KLLDN.........................................
Q4N294_THEPA/45-610.....YVP.KFLKNV......AVCVLEIGVLL--KFLDN.........................................
A8BD62_GIAIC/283-863.....QVP.LFLNNI......KTHLCDIGRST--VLLKWKKKQYIDKG................................
Q0UGY4_PHANO/31-649.....LLP.KFVTRQ.....TASSILFVGKSL--NQIRS.........................................
Q2H2M0_CHAGB/4-638.....LLP.RFVTAA.....TAASMLFIGRSL--NQIRA.........................................
Q2UDA7_ASPOR/4-644.....LQP.KFVSPD.....AASSILFIGKTL--NLIRA.........................................
Q0CV34_ASPTN/4-641.....LQP.KFVSSH.....TASSILFIGKTL--NLIRA.........................................
Q4WZU3_ASPFU/32-668.....LLP.KFVSLH.....TASSILFIGKTL--NHITA.........................................
A1C7R2_ASPCL/32-668.....LLP.QFVSLQ.....TASSILFIGKTL--NHIKA.........................................
C8VMB1_EMENI/4-637.....LIP.QFVSSH.....TAASILFIGKTL--NLMRA.........................................
Q5KH00_CRYNJ/4-686.....MLP.TSIGEN.....TRESTLYVGRVV--ATLKR.........................................
Q584R6_TRYB2/3-521.....LLP.HGIPMEL...GLL..ILSVGKER--RVLLSDA.......................................
Q0IG23_AEDAE/4-557.....MLP.YYLPTS.....WAEKVLFVGQTV--LMLNCDPRDHTD..................................
Q7PWU6_ANOGA/4-573.....MLP.YYFPAS.....WAEKVLFVGQTV--LMCHFDPRQQIAD.................................
GCP4_DROME/4-548.....QLP.GFFSIV.....LAEKVLFVGQTV--LVFKMGRNVKVK..................................
GACP4_ARATH/4-645.....MLP.DYIPMR.....LGESILFAGKAI--RVLRNPSPAFQFQKDKSFQQTM........................
Q60F24_ORYSJ/4-649.....MLP.EYIHMR.....VAESILFAGKAI--RVLRNPSPGATLQESMNQSQNVKGSY....................
Q05AR5_XENTR/4-571.....MLP.SYIPVR.....VAEKILFVGESV--QMFEN.........................................
Q01B37_OSTTA/4-547.....RLP.PGIELS.....TAEAVSFIGRGV--RILTR.........................................
A0C933_PARTE/4-693.....MLPLHFITLQ.....MADKILFIGKAV--KVLKG.........................................
Q24CL5_TETTS/4-831.....MLPQSIVSHK.....QAEKILFIGKGI--RILRN.........................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264FEKCSMKSIFEERMASKLRFKNRMVERTESFIAAWEEEQRELLLESNAKKRLLYDKINAEQELQQRNRVQQRRLEVVQEL
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872SLSEIFCLSLAGLIGHGDHVSRYLWKDETDEWEISPTLASYISGKLVNGTGDLLTYSERMWYKLLVGAVQEKKSIEAKSE
GCP5_MOUSE/273-942HIVNEDQTTKEN....................................................................
F1QBQ4_DANRE/270-933NTVTEQQATKKS....................................................................
C3ZYG0_BRAFL/302-1685PDHVGPVMVSSTMLHRVLDTAVKDSLLDKNFLKAIVVDSSEEEQDETRIKPVTIRCRRIVAPAFESGHKLNQSPPQIRNL
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997DDPIN...........................................................................
Q9VTS3_DROME/266-1244FGWCSMQSIFEDRMATKRVFANLMVKRTQAHLDAWAQKQRELQIKANAQKKLQNDQLNAEQERIQQNHLEKRRQDIVNEL
Q17IM7_AEDAE/330-1376CGPSLAVRELYERKEREREEFLRQVEANFRRSMEQWRQDQDAEALELRKKKERQMEELLGHLNEIRESKLAAKKQELELE
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843LRAEVLKYNRNGPSEHVMNI............................................................
Q2UCE2_ASPOR/176-851RLRSEILRYNRGRPSATKNLII..........................................................
Q0D0R6_ASPTN/174-839AEILKYNRHGSFEKERC...............................................................
A1CPI0_ASPCL/179-855AELRSEILKYTRGQTTDNALAAS.........................................................
Q4WSG8_ASPFU/170-850QLRSEILKYSQGQRVGQVEMDKVLA.......................................................
Q2H076_CHAGB/195-897NAVVRAIKGTLSGTPQAAPYGA..........................................................
A0A0D1BZI3_USTMA/198-1067DAIEDHILQFKREIVRWRRQRRKTIDGSV...................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264QHQRDRERYEDQLLEREKLALINKIQVLRQRDLAAEDASGWEMAESPDNSSNTSFKSCLEGTDADLQTDADPSSSVDEEQ
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872L...............................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685TTCLRLQVTRISSTMFNNGSHPWMLPEETYAPEFTSLLGCYRWHLQNNTASIAQADEACSMHEDLVRLGTGTDIVFSLIG
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244AFQRECERMEDKLLEREKQELQKKVVQLAAVLSSSPDRSTVSDLSFASCIEEPDCLAESSSDKDDANTENSEDEATKQLD
Q17IM7_AEDAE/330-1376QKYQHEGLEFENRRLMAENLEREKAVEGYRELNRMMDEKVEKAEREVERLKVQLAGVGGSGGDSSDFESCVGSVTEDDAG
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264KATDPPKSVDEEQNAVDPEPAPASVVPYQRTH................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685LIEIIANAVVILGIIGTKELRKPIYFFLANLAMADVFAGIGLLYRTVGHVGHNQMYDFSVTYLNFLIFSQMTSASALSLL
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244KTLNVPLEQPEAEYQADVDVDQPRGKE.....................................................
Q17IM7_AEDAE/330-1376SVYEDAQKSPLSDKSEDRTVKEITESDVVNSNDVISESEQNRKRILGSNLGEYLAEDHANAN..................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264..........................................................................SDVLNS
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685SINSYVGVRHPIYFHIHANSAKLRAVVAMIVSWIIFSLIAFSPSMGWNCLHMETLTTGTCTYYFPQAYIIMCLSIMFLMC
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244...............................................................................C
Q17IM7_AEDAE/330-1376.............................................IEAIKETAAAGLRQMTEAQRNKMKIMTEEFGLREG
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264NEEEPSLPSELNRNRRKMLSSALVQECQSEESSSTGTELRAFLPPDINMNLNRLEETTEQSDLQRNRQRMLQHDGFNAFN
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685MVMLFTNISVYVAIRDREKRRLEQAGVPPGVEGENGPVQNIVGGNQPNNAAQEEALRKYEARVYRSRTVMIYVVVAFVFW
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244SLPNVFQYQRSHSDVINSNEHPTTQAEFNRNRQHGLSSDQFQQCHATVHLQESDLLKTAASTSSGLHAEIPQDINANLNC
Q17IM7_AEDAE/330-1376VVTAVDINSNQTEERHRNRQRILISDYTSREEEDPVKASGEMTELQKNRIKIMSQEYNVVVDDHDRGSKKDRKPEMYLNL
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264SMEDVHTERVKCQLRSDSPLARNRRRVMASEFDIPSICRKITIPLFSIAESGLHLPLELNKLHVEVPLDAATPMSTTSDV
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872.........................QSPCCVTCVKEEKNVLAAEKVLQGLFCHENLVVSASKMDLERNKNAWHVLNLSEN
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685LVPLLLMAVCSRYPSTCARWIGPEILFSFYSLNSIINPMATLIRTEELRNAIWQKMTGIHQTLVTAIRGNRVDPQGDQAG
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244PDTKELTELQRNRKRNEHHDGFFSFNSTEDEHTHRLRSLLNSNTERGRNRLRVMETEFGLGYKNTDIETKATPCLPLEID
Q17IM7_AEDAE/330-1376ETDRAKNRRRILECEYDIVTGAQNFVDTPMSVDSDTISEDIQVPVIVIDDVPQDVNANPIAGDDGQLKLDTTAAQEKFNE
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067.............................................................................GTF
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831................................................................................

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264DIDGLSDHNPFKEEESETDATDYNGHALISNAGHEQDPAPLLPTNPLAVEPAQASVERRVTSMTSRLPAVNWPTNFGKIA
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790.........................................................AKIANAGRALKY...........
Q2UAG9_ASPOR/234-750...................................................................DVSGDDEHARKSS
Q4WEE6_ASPFU/229-741...................................................................NALETMGDSKAIT
A1C564_ASPCL/237-752...................................................................NALDEVEQHQKTA
Q5AUB0_EMENI/232-744...................................................................NLADSLEAPRKTA
Q0UBK8_PHANO/224-738..................................................................IRGAGAQPFGSEPR
Q2HBB4_CHAGB/228-739...................................................................KQHESTKKYRATA
Q1K6Z8_NEUCR/239-749...................................................................KRYSPVADRMKAE
F4HUK8_ARATH/48-872YCLPSLNDKSLLSAVFEGSGVAPKFVGTNYKYGFQFGRSEYLSSQDDTKILETLFPFPTLLPSFQSKLHMSEFLPYQKNS
GCP5_MOUSE/273-942...............LIKMQSIAERHLELDDIHDPLLAINFARLYLEQSDFHEKFAGGDICVDRSSESV...........
F1QBQ4_DANRE/270-933...............LIKMQSIVARHLELDDIHDPLLAINFARLYLEQNDFHEKFSGGSVILDRSSESV...........
C3ZYG0_BRAFL/302-1685TGDPPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAGTGDPPNLQEGSAHGEGQNTPGLAPDDQPQVGNQNQAGTGDPPN
Q7PX58_ANOGA/302-918.................................TENPKESGCDSDPQASLAVEVSRKVLCKAYRLTEASEPSQSSAARSD
A0A0D1E2A2_USTMA/319-997.....................TEAEAGHEEIVAALCFTPEVATENLRRLLFARGTQLAEQTETKTYVEDVLPQTPISRPD
Q9VTS3_DROME/266-1244KLHVEIPLAVLTPMSTTSDVDFGDPSPRELPEIADTANNNNVSGSIESLSPELPKPVLAIAKPTSLLPKLDFGMKDERET
Q17IM7_AEDAE/330-1376SRFGVPDTAVLAKLTPESGLISAGLQAKRGFEFPIVQEGSELEIRSEASYEDDEIYREFVEAMEKRNLNLCELPSMTGDL
Q0UQH9_PHANO/170-704..............................................AFGWQDIEAISNKAKQYEHRLRT...........
Q5BEM5_EMENI/175-843.......EKPNTIESKELPDAFSLFDINDAQHMTGLLASDASLEKAKLGQLLNEADHDIEKQSGKLETNF..........
Q2UCE2_ASPOR/176-851....NSQPPAHTEASDTLKDTFDLFDIDDAQNMTGLLANPSSIEKDELSRLIEQGNHKDLEVPEDHRCNF..........
Q0D0R6_ASPTN/174-839.........DFTPEHLVLDGDNVVSGAFDLFDMDSAKVTGLLNNQASVESDPLGQLVDAGSIVTGNENAF..........
A1CPI0_ASPCL/179-855....HAQKSDSAVEDRNGPENYEMFDIDDSRNTTGLLTQHSTLNCDELVPLLNTAQPQKSESLESRRSKF..........
Q4WSG8_ASPFU/170-850..EEQMQKFVSAGDDPAISPAFELFDIDDSKHTTGLLASDSSLENDELGPLFDASTLEVSRPIHPHRKNF..........
Q2H076_CHAGB/195-897....NKRKYDVAELEYFGKDETQVRENILASIRQLDQSLGNPEPRDELTRLLRHRLYQTPETSHSPRGLTPHWTL.....
A0A0D1BZI3_USTMA/198-1067STTSSPLDSSPALPQPAGETDKHMGRVQTNEAPLDPVDDQLARMSQLFASLPGVTNSTLSAAIFTDTEQEPLLSSKADLA
A8BFK8_GIAIC/197-740.........................................................................DCNNITW
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044......................................................SDNNNNNNNNVKLNSQQQLLLLKLNT
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688..........................................................................SLQIPT
Q6FQY5_CANGA/70-712.............................................................................TME
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766....................................................................YGAALPAFRPAS
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758......................................................LMKVMESSASQIFSY...........
Q16YQ3_AEDAE/217-729......................................................LKQCLENDMDSIFST...........
GCP3_MOUSE/251-761......................................................TKSAESPRDAADLFT...........
Q1K720_NEUCR/225-737..........................................................YSKNASRELKY...........
ALP6_SCHPO/196-713..........................................................HYQKLVKKLSY...........
A0A0D1E4X1_USTMA/283-861.........................................................HTIAGASAELRY...........
GACP3_ARATH/192-713......................................................AAASGTTTRRGGLGY...........
SPC98_DICDI/112-705..................................DDENENQGEDDEIIERKLLIKESKIIKEKTKELNY...........
Q383E4_TRYB2/204-700...........................................................DPSIVAAAQS...........
Q6FLE0_CANGA/180-724........................................................NRYKQIYDGLRKN...........
SPC98_YEAST/187-740........................................................KKYHVLYQSNSYR...........
Q74Z68_ASHGO/190-740........................................................NKYMNKFADLPKS...........
Q6CIT0_KLULA/175-721........................................................ANKYSLQYRLLGP...........
Q6BX70_DEBHA/183-753......................................................KYSTYIFQNNQGIQS...........
Q4U9K6_THEAN/45-615...................................................................KVQHHFLLDTKAS
Q4N294_THEPA/45-610...................................................................PIQYHFLLDNQNT
A8BD62_GIAIC/283-863..........................................................PNASGQELLLLSAEASGETTQG
Q0UGY4_PHANO/31-649.....................................................................VPPSIRADNAP
Q2H2M0_CHAGB/4-638...........................................................................KSVGD
Q2UDA7_ASPOR/4-644....................................................................KRSGSRTGPPAG
Q0CV34_ASPTN/4-641....................................................................KRNNSITSPLVG
Q4WZU3_ASPFU/32-668....................................................................KRKGATMGFDSG
A1C7R2_ASPCL/32-668....................................................................KRTSSIAELSNG
C8VMB1_EMENI/4-637....................................................................KRSPTGHTPD.G
Q5KH00_CRYNJ/4-686............................................................................EGKS
Q584R6_TRYB2/3-521..................................................................ESHGKEYLEQLALG
Q0IG23_AEDAE/4-557............................................................KRTTGDRKFAAI.....KDS
Q7PWU6_ANOGA/4-573...........................................................RAASKGSRKGAALAAAAGKDN
GCP4_DROME/4-548............................................................NKTDPLAAKLAELDSDDIYQ
GACP4_ARATH/4-645..................................................RGSQRIRGFMHSDFPETETELDADLTGGEL
Q60F24_ORYSJ/4-649..............................................RMQSLIGGSGALKELPNFPNISAE........EL
Q05AR5_XENTR/4-571......................................................................QNANMSRTGS
Q01B37_OSTTA/4-547.....................................................................SINQRTPSFSF
A0C933_PARTE/4-693................................................................................
Q24CL5_TETTS/4-831............................................................................TQKE

PF14609

MOD21_SCHPO/60-677-----ETEV....YNATKNCTLFQFFQHV-KKFVDPL--------LCFRFAYEKSATNMWDFVKT---LEFIYSTRNYS.
E4WX70_OIKDI/53-731-----ITNVRKVRDFIWQ...LTGSTRHE-NKF....--------..FRPAFLDFGEQVMDLLQS---RVFIFFRRWQNH
B6K1F8_SCHJY/48-653-----ELLVRKHAYNILK...LEHDVTDL-IVFVEL.--------..LTKRLISGCTSVDEFLHC---IFNIHIGRRSN.

PF04130

Q2M0Y2_DROPS/276-1264EHEEPQISAVLVPESCN...PFMARRCLQ.MSVMEPV........S...AHYALLRNEVLR.IFK...EQHI..YEHFRM
Q29HV5_DROPS/223-746....GELKNIMESNAGD...IFSY..TQD.TKWHAAI........E...ICYQNTAKHVLDYMVG...PHKL..LEHLQC
Q5KL44_CRYNJ/218-790..........................SDL.AGLERSI........D...DAYSIASQRLLEIFFD...KFRL..LDHLRA
Q2UAG9_ASPOR/234-750LTLGDVFPEDSASVYM....PFSA..LLD.SAFGRIV........D...ENHSFTSSLLRRELDQ...QCGL..WISLQA
Q4WEE6_ASPFU/229-741LTLEHTYGDESSSLLCL...PFAA..ICE.SAIGKLV........E...ANHSFASDLLRKELDQ...QCGL..WRSLQA
A1C564_ASPCL/237-752LTFEGMSNDEHASLVYL...PFAA..TFG.SALDKVV........K...ANQSFTSNLLHQELDR...QCGL..WTSLNA
Q5AUB0_EMENI/232-744LSFEDIYPSNLSS.TCL...PFYA..LLE.SALNDVI........N...ENHAFTSSLLRKELDE...RCGL..WISLQA
Q0UBK8_PHANO/224-738LDHESVCGLSDDV.PVP...PFAE..LFQ.AAFDRWM........Q...SKYSQASSVLREHLVE...TSGL..MRTSVI
Q2HBB4_CHAGB/228-739EPSMDFATVCPDGFEFA...PFSE..LFG.AAFQAWI........Q...SKHHSAAATLRELLFS...SYGL..FESLDA
Q1K6Z8_NEUCR/239-749EPPMEFAAVCSDGTSFA...PFSE..LFG.NAFNKWI........Q...SKYHSASITLLDILFD...SYGL..SRAFGA
F4HUK8_ARATH/48-872TLPSRVLSWILRTEPRN...TLLPVVIMQ.ECFTINI........R...RQVDNISKVIFSKLMN...EWKL..MHELAV
GCP5_MOUSE/273-942..............TCQ...TFEL..TLR.SCLYPHI........D...KQYLHCCGNLMQTLKR...DFRL..VEYLQA
F1QBQ4_DANRE/270-933..............TCQ...TFEL..TLR.SCLYPHI........E...RRYVECCGNLMRTLKK...DYRL..LGYLQA
C3ZYG0_BRAFL/302-1685LQEGSAHGEGQNTPGLAPEGSQPVQLALQ.RCLYPHI........L...QRCSTISRLLVELLKT...EYQL..EDYLQA
Q7PX58_ANOGA/302-918RTLSNAYTLYMKLNSIS...TLQL..PLE.HVLFNAI........KNLMETKRHAANHYVTYIYK..DEFHV..MDHLKN
A0A0D1E2A2_USTMA/319-997TEPLWDVSITRNHRHLS...HRLLEPLLG.RLLQEHL........S...PISALVRKRVTEVLLSPVTEGGYALQSHVQA
Q9VTS3_DROME/266-1244EQDRDKVST..LPEACN...PFMARRCLQ.LSVMAPL........N...AYYGLLRNEVLR.IFQ...EQRI..YEHFRK
Q17IM7_AEDAE/330-1376GNVTELKEIDTELRSLD...VLTVTRFLQ.SSLVIPL........K...AHMEVVNSEILKMCLN...DLDI..LGHFES
Q0UQH9_PHANO/170-704.................................................SLLAYSSGSAVN.................NL
Q5BEM5_EMENI/175-843....................APEVTSSLY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHNL..KDHLLL
Q2UCE2_ASPOR/176-851....................GPELASALY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHKL..RYHLSL
Q0D0R6_ASPTN/174-839....................GPELAASLY.LSMAPFL........S...SQASLIDFSCLHMLFK...EHQL..RYHLGL
A1CPI0_ASPCL/179-855....................GPEMISAIY.LSLAPLL........S...SQALLIDFSCLHLLFK...EHRL..RYHLTL
Q4WSG8_ASPFU/170-850....................GPEMISAVS.LSLAPLL........S...SQALLVDFSCLHLLFK...EHKL..RYHLTL
Q2H076_CHAGB/195-897..........................VPL.LSFGPVI........E...TQSVLINSECMKLLFS...AHHL..RVHIDL
A0A0D1BZI3_USTMA/198-1067KKQEESLVLYLSSAACP...PNAQDAISQ.SAFDRVTQASLVAPFE...SWARLINMSLISVFFQ...DLGL..GTYLET
A8BFK8_GIAIC/197-740RFPESIVALIREANFAK...LLSS..YSS.DASEGTV........KLIRSIHMLSSKAVVAIIKR...QFLL..FDHLNG
A2E6U4_TRIVA/44-540..........CNKQQLK...QTNKITISS.IQYEGEL........Q...EIYKSASNILISEMFS...QYRL..MDIFNT
GACP2_ARATH/70-583........CGHNVQVPISERSKLTIFGSN.HHYLECI........K...AAHEFASIELVNLIKD...KYDL..VGRLRS
Q0JBZ2_ORYSJ/73-597........CEYTVQVPLSESSKLMGFGSN.HQYLECI........K...SAYDFASGELLTLMKD...KYDL..IGKLRS
GCP2_DROME/204-721..........CGKRVMPTQEMNLEFDPTS.ERHVSVI........N...DAYYFAARMLLDVLLT...ENDL..MGHLQS
Q29G36_DROPS/282-800..........CGKRVMPTQQMELQLDPTD.ERHVYVI........N...DAYYFAARMLLDVLLT...ENDL..MGHLQS
Q16HU4_AEDAE/210-728........CGSSVDYQQNVCVSLKYTHSDHQTYIKAI........E...DAYNYASSSLLNLIMD...KYNL..MGRLFS
Q7Q703_ANOGA/248-764...........ATARTTTAVKRLQYAHFD.QSYLDEI........E...EAYNFASSSLLNLIMN...KYDL..MGRLLS
GCP2_MOUSE/220-738..........CGHDVTCPVAKEIIYTLKE.RAYVEQI........E...KAFNYASKVLLDFLME...EKEL..VAHLRS
SPC97_DICDI/430-1044TQQQQQQQLSSTSASMIPTTIIEYS.KNE.NVYIDKI........E...KAYDYASGILLNLLIN...ERHL..ISRLKA
A0BDB2_PARTE/150-660..........KESPFDNFLIKNQGHIVQN.QDFSHLV............SCFEWANKEIINLLFQ...KENI..HKRLKT
Q23AE3_TETTS/242-771.....HEGKVVSSPFELDLVQNYETYLQM.QDFSQPI........Q...KAYEWANAQIMHLVVV...DQDL..QGRLKS
SPC97_YEAST/62-688IPSNSSDITIQEINDFA...DL....MEG.SNLELYV........D...KCYSRANEIFLKLFFQ...GYDL..INVLKH
Q6FQY5_CANGA/70-712LTSIPVDGKYALRRAGE...FDFVHLLEG.TNLELYV........S...RWYSRANELCIRLFFE...GYNF..GRFLRD
Q756H1_ASHGO/63-723.SCGLATLPHALEHERS...DIATQLPEG.TQLLVYV........D...KWYQRANQMCWDLLQE...GYQL..PRIMYQ
Q6CXD9_KLULA/57-697..CCGNTALKPRSWGTS...VTNIDITNM.TFLKGYV........N...ECYQQANEKCLKMYYE...GYHM..DKFLNL
Q6BGV8_DEBHA/61-751..CTGLYDFQQLNELIQ...PIDR..LYS.QDLELKI........N...EYYRRANKLLMKLLFE...GYQF..PSLIDG
Q59PZ2_CANAL/94-759..CTGLHNFESLKEKLT...TITS..LAA.PDLELKI........D...EFYHRANKMLMKLLFD...GYNF..PSVVNI
Q6C787_YARLI/102-681..........CGGGDTSKDAAVNWESIQD.PALVPSI........A...SASDESNRALLSLLLS...SHNL..FDRLAS
ALP4_SCHPO/74-693CRKGVNNLASLNAKDDTQNQLLWPSTFDD.DNFTLNI........M...NAYVYANESLLQLLQS...SQSL..YAHLYS
Q4X128_ASPFU/183-784..........CGGVDISQKVTDVPHTLDD.PRFLDNV........N...AAYTYANASLLNLLLT...KNSL..TTRFRS
Q7S902_NEUCR/140-744..........CGGVDVSRKMQDVPNSFDD.NRFLENI........S...SAYAHANGSLMQLLLT...THEL..PARLRS
Q0V2V1_PHANO/184-787..........CGGVDVSKIVQDAPTSFDD.PRFLDNV........S...SSYAYANSSLLNLLLT...THQL..PARLRS
Q5KPG7_CRYNJ/181-812........CGIEVKKPGEVDEKEMVTMND.PNFYKRI........E...DAYIYANKTLLKLMVE...EQEL..IPHLRS
Q4Q0X5_LEIMA/136-766VPGGAGAAVGSRPDGPG...DALLTWSGA.NQLQRQV........Q...ESFEISSGAVIQLLFS..PSVDL..LGHLKS
Q9VS91_DROME/97-627........CNVSLKLLQ...RPLAYSQGD.LGHEEII........K...TSYELPAHKFLKVLVE...EHNL..PLHIRN
Q2M118_DROPS/72-608........CNVKLTLMQ...TPLNYNPKE.QGHVEII........R...SSYELPGKKLLDYLKT...EHHL..EWHLGN
GCP3_DROME/235-758..........................TPD.TSWHAAV........E...TCYQQTSKHVLDIMVG...PHKL..LDHLHG
Q16YQ3_AEDAE/217-729..........................IST.TKLHQLI........D...SAYLNTSKQVLDIVLG...PHRL..LDHLQA
GCP3_MOUSE/251-761..........................DLE.NAFQGKI........D...AAYFETSKYLLDVLNK...KYSL..LEHMQA
Q1K720_NEUCR/225-737..........................GDT.ATLEAWI........D...EAHRETMSHLMRLLND...QFRV..FDHLEA
ALP6_SCHPO/196-713..........................RDP.HSLETVV........D...KAYTESINHLVYLMEE...VFHL..TDHLKA
A0A0D1E4X1_USTMA/283-861..........................TDL.AGLESTI........E...GAFNSASKRLLDIFLD...EFRL..LEHLRA
GACP3_ARATH/192-713..........................GET.DALEHLV........T...EAAKRIDKHLLDVLYK...RYKF..KEHCLA
SPC98_DICDI/112-705..........................INK.EVLQEII........E...LVSRQSSERLLKIVLN...RFKF..MNHVKA
Q383E4_TRYB2/204-700..........................ATF.DTLDSVV........R...DAMRFTNTAVLRLIRE...EFHL..DNVLRM
Q6FLE0_CANGA/180-724..........................GIS.IEFIEAV........N...TQFKEIVSYIDTIICT...KFHY..HDVLKT
SPC98_YEAST/187-740..........................GIS.TNFFEII........N...DQYSEIVNHTNQILNQ...KFHY..RDVVFA
Q74Z68_ASHGO/190-740..........................AIG.QPFYDLV........N...EQHAEITAFINDILKS...KYYY..DETVTV
Q6CIT0_KLULA/175-721..........................SMD.HKFFELV........N...QQYGEINHYINTTLRS...KFYY..FETLNL
Q6BX70_DEBHA/183-753..........................MPS.NVIIDLI........N...LQYEEILNYFTIVLQE...KHSM..FHHLQN
Q4U9K6_THEAN/45-615GISNSNDVNFRKYKF...........HSV.DEFALLI........Q...NVHKNVMDEVYFGLKR...NSQL..LTNLKL
Q4N294_THEPA/45-610KTSQSNPNSSSNPKDVR...KYKF..RTV.EELSLLI........K...NAHNEVMHEVYPGSKE...NFPF..SRTLRM
A8BD62_GIAIC/283-863FRHGEETVASLVCGDGS...TGDLELAHI.RLYKQLI............DINARVQTKVLDFFIN...PEYLDFRGHLQN
Q0UGY4_PHANO/31-649SNISELDLLPSHVEMLS...VVRAP.IIA.AELAEAV........T...KIRLSLSRNLLQYLLP...RNRI..IETLTV
Q2H2M0_CHAGB/4-638YTLRGNDHLSTQLTRLA...ALRHP.IDS.ATFARTI........A...DIRHFLSRTTLQRLLP...LSRV..LETLQL
Q2UDA7_ASPOR/4-644LSTTPVTLHGEHIEHFA...TLKSP.IST.AKLSNSI........N...SIRLSLSQSTLSKLLP...LPKI..LEILAV
Q0CV34_ASPTN/4-641LSISPASLHGEHIAQLA...SLKSP.IST.AKLSNAI........S...SIRLSLSQSTLSKLLP...LPKI..LEILSV
Q4WZU3_ASPFU/32-668..APPVTLQGEHIAHLA...SLGSP.ISA.SKLSNAV........D...SIRLSLSQSVLSKLLP...LPKI..LEILSV
A1C7R2_ASPCL/32-668FSTSPVTLQGEHIKHLA...SLESP.ISA.SRLSNAI........D...SIRLSLSQSTLSKLLP...LPKI..LEILAV
C8VMB1_EMENI/4-637LLTSPVTLQSEHISHLA...GLKSP.ISA.SELSNTV........D...SIRTSLSQSTLSKLLP...LPKI..LEILSL
Q5KH00_CRYNJ/4-686LPKGLVDSLRGELMAVK...SLEV....G.GGLKEAV........E...KARAEVGEWLWRHILT...GPQV..AESIEM
Q584R6_TRYB2/3-521AQDEAADAVFRAIYHPS...LCVNGFLVV.DELETRV........E...ETHALWSKALWLKVSK...QVDL..RKHIDA
Q0IG23_AEDAE/4-557LWGDQECAFFKKFHQLQ...LDEN..LNI.AKFEHIV........D...EIKLCVTEQMSEIAIK...EADL..IKQLKL
Q7PWU6_ANOGA/4-573LWGDHEQQLFRKFHQLQ...SEEN..LNV.TKFEHLV........D...EIKEQVTKHMSTIVIE...KADL..ERQLRL
GCP4_DROME/4-548LWSGRESEFFKMVVDLS...NEDT..INV.FRLEKVI........I...DIKNYVSARLSEIAVN...EVDL..ERQMGL
GACP4_ARATH/4-645LPQSEADKIEAMLKDLK...ESSE..FHK.RSFECTV........D...SVRAIAASHLWQLVVV...RADL..NGHLKA
Q60F24_ORYSJ/4-649LPQAEADKIDAMLKELK...HSSE..FHK.RLFESAV........G...SIRTMAANNLWQLVVV...RADL..NGHLKA
Q05AR5_XENTR/4-571ILKNQEDTFAAELHRLK...QQPL..FSL.VDFESVL........D...RIRSTVAEHLWKLMVE...ESDL..LGQLKI
Q01B37_OSTTA/4-547DAEAYAARATARIRKLA...SAES..FDP.REFDAVV........E...SMRSEIAEGLGEVLLH...RSGL..VAHLTA
A0C933_PARTE/4-693.....QQELFINEHQQL...IREIEVYDS.FTFNRII........D...QLQKQVGEQLVQVIVD...KQEL..FIHLKN
Q24CL5_TETTS/4-831YENSFLPPQQMLT.LIE...EIRQ..YDS.FKFQNTI........E...SLRYEIAKQMLELVLK...NQNL..MNHLNT

PF14609

MOD21_SCHPO/60-677..........SQMF.----....KLYKASA.-------------------------------------------------
E4WX70_OIKDI/53-731ARTDDSVCSTSLLVS----AALKQAYGEGMK-------------------------------------------------
B6K1F8_SCHJY/48-653..........SLHFG----EFFSKLYYETL.-------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264LRNYFFL.LNGEFGT....QLTGGIFGNIRAG................................................
Q29HV5_DROPS/223-746MRRYLLL.GQGDFVS....IFIEHMKDELEK.................................................
Q5KL44_CRYNJ/218-790LKSYLML.GAGDFTE....LLMEAMAPRLSK.................................................
Q2UAG9_ASPOR/234-750LEHIYHC.KDMSVYG....PIDHKIFDLIDR.................................................
Q4WEE6_ASPFU/229-741LEHIYLC.KDLSVSA....IIDNKVFDLMDR.................................................
A1C564_ASPCL/237-752LEHIYLC.KDISVSG....AIDGKIFDLMDR.................................................
Q5AUB0_EMENI/232-744LEHIHLC.KDISLIG....PIDTKIFELIDR.................................................
Q0UBK8_PHANO/224-738LETLYLG.KNGAVFE....DFANALFERMDG.................................................
Q2HBB4_CHAGB/228-739LQHIYLM.SDGSMSN....SFASSVFRRLDA.................................................
Q1K6Z8_NEUCR/239-749LRCLYLM.SDGATSD....AFASTIFRQLDN.................................................
F4HUK8_ARATH/48-872LRAIYLL.GSGDLLQ....HFLTVIFDRLGK.................................................
GCP5_MOUSE/273-942MRNFFLM.EGGDTMY....DFYTSIFDKIRE.................................................
F1QBQ4_DANRE/270-933MRNYFLL.EAGDTMY....DFYTAIFDKVLE.................................................
C3ZYG0_BRAFL/302-1685MQKFFLM.EAGDAMH....NFYMPLFAKLSA.................................................
Q7PX58_ANOGA/302-918IRKVLLL.EASDLMD....YFYSDLFRRIEA.................................................
A0A0D1E2A2_USTMA/319-997CHGLFFM.RRGAEMA....SWLESLFMDLDRRNGMLRATN....................................HHRL
Q9VTS3_DROME/266-1244LRNYFFL.VDGQFGA....TLTNEILGRIRAG................................................
Q17IM7_AEDAE/330-1376LRNYFLL.MDGEFSC....YVCDNIFKMLEEV................................................
Q0UQH9_PHANO/170-704PRQYHLI.GDGVFSS....LLATALFDPERESAERHKGQMRSALRG.......................VLSESYYSSSL
Q5BEM5_EMENI/175-843QWRFQLL.GDGYFMS....RLSQSLFDPEMESGERKIGVVRSGVHTGLRLGSR..........DTWPPASSELRLVLMGI
Q2UCE2_ASPOR/176-851QWRFQLL.GDGFFTS....LLSHALFDPEMQSGERKSGVVRSSVHTGLRLGSR..........DTWPPASSELRLVLIGL
Q0D0R6_ASPTN/174-839QWRFQLL.GDGFFAS....RLSHSLFDPEMKSGERKTGVVRSEVHAGLRLGSR..........DTWPPASSELRLVLIGL
A1CPI0_ASPCL/179-855QWRFQLL.GDGHFTS....RLSHSLFDPEMESGERRSGVVRSGVHTGLRLGS...........RDTWPPASSELRLVLMG
Q4WSG8_ASPFU/170-850QWRFQLL.GDGFFAS....RLSHSLFDPEMESGERRSGVVRSGVHTGLRLGN...........RDTWPPASSELRLVLIG
Q2H076_CHAGB/195-897LKQYFLL.DNGLLVS....RLTHALFDPDLSTAERRAGVALGSGTMGLRLGSRQTWPPASSELRLALMGVLSDCYESPTP
A0A0D1BZI3_USTMA/198-1067CKRFLLL.GSLHFER....QVVSSLFDVDQASVLDAASASSGRAVVAMNQRLTAEGAWPPNDSLLSSALNTAVIETVSSM
A8BFK8_GIAIC/197-740ILYILLG.MQGDFIP.................................................................
A2E6U4_TRIVA/44-540IWNVILF.RRTDLFN....IFYRVAGNKMRR.................................................
GACP2_ARATH/70-583IKHYLLL.DQGDFLV....HFMDIAREELNK.................................................
Q0JBZ2_ORYSJ/73-597LKRYLLL.DQGDFLV....HFMDIAREELTK.................................................
GCP2_DROME/204-721VKRYLLL.NQGDFTM....QFMDACEDELTK.................................................
Q29G36_DROPS/282-800VKNYLLL.NQGDFTM....QFMDACEDELSK.................................................
Q16HU4_AEDAE/210-728VKRYFLL.QQGDFID....QFMDICEEDLNK.................................................
Q7Q703_ANOGA/248-764VKRYFLL.QQGDFIT....EFMDAVEEDLRK.................................................
GCP2_MOUSE/220-738IKRYFLM.DQGDFFV....HFMDLTEEELRK.................................................
SPC97_DICDI/430-1044IKHYFLL.CKGDFFS....HFMDTTYDELKK.................................................
A0BDB2_PARTE/150-660IKTFFLF.DSGDFFI....HFIEAAESELVK.................................................
Q23AE3_TETTS/242-771IKNYFFL.ERGDFFV....YFLDSSEEELIK.................................................
SPC97_YEAST/62-688LQQIFLGYQSGHNVL....KFLTKNMGELTK.................................................
Q6FQY5_CANGA/70-712IFCNYLYVNNGNKFN....KFLLRNHFDLGK.................................................
Q756H1_ASHGO/63-723LHKHFMLYNCGEFQN....KFFMKSMVELTR.................................................
Q6CXD9_KLULA/57-697IHDQSYV..HGVIDQLWNTKFLSKTLFELTR.................................................
Q6BGV8_DEBHA/61-751FQTLFLF.KDSSKID....VFLEKSFNDLRK.................................................
Q59PZ2_CANAL/94-759FQRLFLF.ADSFQID....NFIDSTFSELKR.................................................
Q6C787_YARLI/102-681LKHYFFL.DRADYYI....NFQDIAWTELAR.................................................
ALP4_SCHPO/74-693LKHYFFL.DQSDFFT....TFLDNAQHELRK.................................................
Q4X128_ASPFU/183-784LKHYFFL.DRSDFFS....YFLELGSSELRK.................................................
Q7S902_NEUCR/140-744LKHYFFL.DPSDYFN....YFLELGTSELRK.................................................
Q0V2V1_PHANO/184-787LKHYFFL.DRSDFFT....YFLEMGELELKK.................................................
Q5KPG7_CRYNJ/181-812MKHFFFL.NQSDFLT....NFLDLAASELRK.................................................
Q4Q0X5_LEIMA/136-766LKLYFLQ.ERGDWVV....DFLDSAESLLAE.................................................
Q9VS91_DROME/97-627LKSYFLL.QEEGFSE....TFLHKCHEYLKY.................................................
Q2M118_DROPS/72-608LHGYFLL.QNQEFAE....ALLANYQEHMQR.................................................
GCP3_DROME/235-758MRRYLLL.GQGDFIS....ILIENMKNELER.................................................
Q16YQ3_AEDAE/217-729LRNYLLL.GQGNFAD....ILMENLQAELDR.................................................
GCP3_MOUSE/251-761MRRYLLL.GQGDFIR....HLMDLLKPELVR.................................................
Q1K720_NEUCR/225-737LKRYILL.GQGDFIA....LLMESLAPNLDR.................................................
ALP6_SCHPO/196-713IKKYLLL.GQGDFVD....LLMESLGNSLDQ.................................................
A0A0D1E4X1_USTMA/283-861LKDYLML.ARGDFVD....LLMASLGPSLSR.................................................
GACP3_ARATH/192-713IKRYLLL.GQGDFVQ....YLMDIVGPKLSE.................................................
SPC98_DICDI/112-705LKKYLLL.GQGDFIQ....YLMDLIGEDLLK.................................................
Q383E4_TRYB2/204-700VNAFLLV.GNGDFYE....VLIHKLDPVLGR.................................................
Q6FLE0_CANGA/180-724LRNILLM.GRGDLIN....TLITKLSSALTS.................................................
SPC98_YEAST/187-740LKNILLM.GKSDFMD....ALIEKANDILAT.................................................
Q74Z68_ASHGO/190-740LKDILLM.GRGDFIE....NIIINASDFLME.................................................
Q6CIT0_KLULA/175-721LKDILLM.GKSDVID....SIIQNSENLFNQ.................................................
Q6BX70_DEBHA/183-753FKRFLLM.NSNDFIE....SIIEKGIVLFNE.................................................
Q4U9K6_THEAN/45-615VFDYFLL..QKSYIQDIVNNFNTGGLSDLNK.................................................
Q4N294_THEPA/45-610IFDYFLL.QKSCYIQDVINNFKSNCYSDLNK.................................................
A8BD62_GIAIC/283-863IYAFYLV.MAGDFLS....CFVESAISELVL.................................................
Q0UGY4_PHANO/31-649LHQFFLL.GRGEFAM....TLITEADARISAR................................................
Q2H2M0_CHAGB/4-638LRDFFLL.RRGEFAM....ALTQQADEKIRSRWK..............................................
Q2UDA7_ASPOR/4-644LHDFLLL.RRGEFAS....ALVSHADARLLERHRR.............................................
Q0CV34_ASPTN/4-641LHDFMLL.RRGEFAS....ALVSHADARLYDRRRR.............................................
Q4WZU3_ASPFU/32-668LHDFLLL.GRGEFAT....ALVSHADARLSERHRI.............................................
A1C7R2_ASPCL/32-668LHDFLLL.RRGEFAT....ALVKNADSRLLERHRR.............................................
C8VMB1_EMENI/4-637LHNFLLL.QRGEFAT....ALVLHADARLRERQRG.............................................
Q5KH00_CRYNJ/4-686FGSFFLL.RKTDYCI....AVIRGISQLRL..................................................
Q584R6_TRYB2/3-521MRAMFLC.HRGDFWH....TFVETAFSTF...................................................
Q0IG23_AEDAE/4-557IKDYYLL.GRGELFL....ELLRQTKSLKTL.................................................
Q7PWU6_ANOGA/4-573MKDFFLL.GRGELFS....EFLTQTQSLKLL.................................................
GCP4_DROME/4-548IKDFFLL.GRGEFYL....EFCSQMVGTMETYRE..............................................
GACP4_ARATH/4-645LKDYFLL.EKGDFFQ....CFLEESRQLMRL.................................................
Q60F24_ORYSJ/4-649LKDYFLL.AKGDFFQ....CFLEESRQLMRL.................................................
Q05AR5_XENTR/4-571IKDFYLL.GRGELFQ....AFIDIAQNMLKT.................................................
Q01B37_OSTTA/4-547MTEFYFL.GKGDFYS....IFVDEAKELLAL.................................................
A0C933_PARTE/4-693FYLFILL.NNGNFIQ....QFLSDCQSILQL.................................................
Q24CL5_TETTS/4-831LNNYFLM.GNGEFFK....AFYEESRSLMQL.................................................

PF14609

MOD21_SCHPO/60-677-----IAMLLWMVNQASQITSSMTIAR--------PLYNIL...------------.........ILCKDFPNNFLEKDN
E4WX70_OIKDI/53-731-----ITEIALEIISVDRSTNPWDISS--------RTLSILFEH------------FPTIYKRFESILPEYS..FLLKKC
B6K1F8_SCHJY/48-653-----.....STFLNISKIDAGYALPT--------PLLYIIKTS------------QRVNRQAAKSLLKQTSEKYFAESC

PF04130

Q2M0Y2_DROPS/276-1264...MDPRSLCQKG..........VLDV........ILNNALGGC.................AASDDTLVAQNLTLDCT..
Q29HV5_DROPS/223-746.....PGTEIFAH..........DLSA........MLDTALRCT.................NAQYDDP............
Q5KL44_CRYNJ/218-790.....PAINLYRH..........HLTS........DLESAIRGS.................NAQYDSP............
Q2UAG9_ASPOR/234-750.....GRGAWDDR..........YLLT........ELAQSAFST.................LPFIDPSRVIVRSSKDP..
Q4WEE6_ASPFU/229-741.....GRGTWSDR..........YLLT........ELAQSAFSS.................MPFIDHSRIIVRSHQ....
A1C564_ASPCL/237-752.....GRGAWSDR..........YLLT........ELAQSAFSR.................LSFVDPSRLIVRSHQ....
Q5AUB0_EMENI/232-744.....RKGGWNDR..........FLLT........ELAQDTFGS.................LPIIDSSRLIVRSAK....
Q0UBK8_PHANO/224-738.....GRRGWNDR..........YVLT........EITRTIFGT.................VMPHQDAERIVARSS....
Q2HBB4_CHAGB/228-739.....LNNSWQDR.........FTLTE........VAQEAFSTCLDSYRLSANIDPRGLGRSALVARS............
Q1K6Z8_NEUCR/239-749.....FSTSWNDK.........FTLTE........IAQEAFSQCVAGHRLSADIDQRYIADSPAASRA............
F4HUK8_ARATH/48-872.....GESSNDDF..........ELNI........IIQESIRNS.................ADTMLLSSPDALVVSISSE
GCP5_MOUSE/273-942.....KETWQNVS..........FLNV........QLQEAVGQR.................YPEDSLRLSISFENV....
F1QBQ4_DANRE/270-933.....KESWQQLA..........FLNV........QLQESVGQR.................HPEDSHRLSIFLETI....
C3ZYG0_BRAFL/302-1685.....GEEWQDVS..........VLNS........QLHSAIQQH....................................
Q7PX58_ANOGA/302-918.....GENWANPY..........LLTI........QLNDILASR.................FNDMTSLFTVEVNRTA...
A0A0D1E2A2_USTMA/319-997HSGFNDALEIHQQSNGGEAWIDVNLVRFCTVNDDMDRAAAIRQR....................................
Q9VTS3_DROME/266-1244...VGPRSLSQKG..........ILDT........ILTNALAAC.................SA.DETTVSENLTLNCT..
Q17IM7_AEDAE/330-1376...RSPDELLNYQ..........TLHT........ILDSALCS..................SAAGADKNADRLSFNVE..
Q0UQH9_PHANO/170-704YQSLLKTGEVAQANTTISGRDNDELPG........QLNFAIRNL.................TEAEQEKVMDP........
Q5BEM5_EMENI/175-843LNECYS.GEYADGSGNPEFEKEKELPG........GLSFSIREL.................TEAEIAKCKNP........
Q2UCE2_ASPOR/176-851LSECHGFDDRSESSAGNEPRKERELPG........GLSFSIREL.................TAEEVTKCKDP........
Q0D0R6_ASPTN/174-839LDECYNADDQRDSTENAEFRREKELPG........GLSFSIREL.................TDEEAVKCKDP........
A1CPI0_ASPCL/179-855LLSDCNMDERLDNSGNVEFLKERELPG........GLSFAIRDL.................TDEEITKCKDP........
Q4WSG8_ASPFU/170-850LLSDCNMDERLDNSSNAEFLRERELPG........GLSFSIRDL.................TDEEIVKCKDP........
Q2H076_CHAGB/195-897RLDTNAGANNSSS..........TLPG........DLSFTVRDL.................SPQEIDRCMDP........
A0A0D1BZI3_USTMA/198-1067RHAHEEKLHRTGKTEDAISLAFKDLDE........RLSFAVVEP...........................RSTSSSTRS
A8BFK8_GIAIC/197-740.....SLCSILSSTSGGDKYKLSMLE.........KIEQAMMSC.................NVSNLPS............
A2E6U4_TRIVA/44-540.....DKSEISPA..........DLED........LMSIVY.......................................
GACP2_ARATH/70-583.....KVHEISVE..........KLQS........LLDLALRTT......................AAAAD.........
Q0JBZ2_ORYSJ/73-597.....KPEEISVE..........KLQS........LVDIALRST......................AAASD.........
GCP2_DROME/204-721.....NVDHVLPM..........TLEN........LLGLTLRIS......................SARND.........
Q29G36_DROPS/282-800.....NVDLVLPM..........TLEN........LLGLTLRLS......................SARND.........
Q16HU4_AEDAE/210-728.....DVDELRPM..........RLEN........LLEVTLNMS......................SARYD.........
Q7Q703_ANOGA/248-764.....SVDTLHPI..........RLAN........LLDVTLGLS......................SAKYD.........
GCP2_MOUSE/220-738.....PVEDIILT..........RLEA........LLELALRMS......................TANTD.........
SPC97_DICDI/430-1044.....PLDQINMV..........KMNS........LLQLSLRTS.....................SISEED.........
A0BDB2_PARTE/150-660.....DIREISKE..........KLES........LFDLAVR.......................SIASND.........
Q23AE3_TETTS/242-771.....QARQVSKE..........KLES........LLEMSIRTS......................SLSSD.........
SPC97_YEAST/62-688.....HYRNDNNA......................NYDKLLQNF.................ELERQSENPNN........
Q6FQY5_CANGA/70-712.....EYSESRSVL........RRLEQ........SWDVEVDDR....................................
Q756H1_ASHGO/63-723.....SRSESIQL..........KLQR........NWQQCQKNT...........................TEH......
Q6CXD9_KLULA/57-697.....SPTESTLH..........KIQR........HFDDILKEI.................SVEDTYRH...........
Q6BGV8_DEBHA/61-751.....NKHAISTS..........RLSK........LYDDTLQHKKDDFQVKDINKQNSISDNKMN...............
Q59PZ2_CANAL/94-759.....GKLKISVS..........RLQK........QYDDIFKEKI...............ENKVGVRP............
Q6C787_YARLI/102-681.....PASQSSVT..........KLQY........LLDLCLRQP....................GSITSTD.........
ALP4_SCHPO/74-693.....PAKYISIT..........KLQS........QLDLALRQP....................GTITATD.........
Q4X128_ASPFU/183-784.....PAKNVNEN..........KLQS........LLDLVLRQP....................GSIAASD.........
Q7S902_NEUCR/140-744.....PVKVVNTG..........KLQS........LLDLVLRQP....................GSIVCLD.........
Q0V2V1_PHANO/184-787.....PAKAVNVG..........KLQS........LLDLATRHA....................GSVAVED.........
Q5KPG7_CRYNJ/181-812.....PAKSASII..........KLQS........LLDLAVRNP....................SSSSSND.........
Q4Q0X5_LEIMA/136-766.....HPDRIKQH..........SMQV........LLQAAVARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDT
Q9VS91_DROME/97-627.....NVERLIPE..........KLQT........LLAETLHKS................ND..................
Q2M118_DROPS/72-608.....GVDRMIPE..........TLQS........LLMETLQKF................DD..................
GCP3_DROME/235-758.....PGLDIYAN..........DLTS........MLDSALRCT.................NAQYDDP............
Q16YQ3_AEDAE/217-729.....PASEIYQH..........DLFS........ILAAAVRNS.................FSEQEEP............
GCP3_MOUSE/251-761.....PATTLYQH..........NLTG........ILETAVRAT.................NAQFDSP............
Q1K720_NEUCR/225-737.....PAGAQYRH..........TLTA........QLEHAIRGS.................NAQYDDP............
ALP6_SCHPO/196-713.....PANTLFRH..........NLTA........SLESAIRSS.................NASYEPE............
A0A0D1E4X1_USTMA/283-861.....PANSLFRH..........NLTA........SLETAIRGS.................NAQHDDA............
GACP3_ARATH/192-713.....PANNISSF..........ELAG........FLEAAIRAS.................NAQYDDR............
SPC98_DICDI/112-705.....PTSQIQRH..........KLVG........WMDTAIRNS.................NAQFEEQ............
Q383E4_TRYB2/204-700.....MSHMVQTS..........LVRD........HMQSALLDI.................T..................
Q6FLE0_CANGA/180-724.....SSDLLSDY..........SLTR........ILQESVQQS.................SLRSLINRGDN........
SPC98_YEAST/187-740.....PSDSLPNY..........KLTR........VLQEAVQLS.................SLRHLMNSPRN........
Q74Z68_ASHGO/190-740.....PVHQLQSY..........QLTK........CLQESVQRS.................SLRNYLNKHDN........
Q6CIT0_KLULA/175-721.....PSQLLESH..........HLTK........CLQIAIQQS.................SLRNRLNKSDN........
Q6BX70_DEBHA/183-753.....PANSLTSN..........QLAK........VLIESINNS.................SVKNYRS............
Q4U9K6_THEAN/45-615.......................RLQI........HVDRDWDNSPGSFR.......PKLYLKCDDLYNFAGALEYYSHYG
Q4N294_THEPA/45-610.......................SLQS........HVDRDFCNSTDTFK.......PKLYFKCDNLDNFAGALKYFSHYA
A8BD62_GIAIC/283-863.....SRSVANIL..........RIRS........KFKMVIKTS.................SLANLPYNERMNVIVCPEL
Q0UGY4_PHANO/31-649...HRGPLPIRSNTTKGVVIREAEISQ........TLARSLAVL.................STLSGNDEHTDD.......
Q2H2M0_CHAGB/4-638..RAENLAYQKRDGLSTVTVKEGEVAA........VLARTWAAM.................GSMQGDHAEEDE.......
Q2UDA7_ASPOR/4-644.PGNLASKGKFAEGLQGLSIKEGDVAN........ALSQALAEL.................YSLQNEEDPVDD.......
Q0CV34_ASPTN/4-641.PETLASRGKSREGLELITIKEGDVLS........ALSQAWAEL.................YSLQNDEDPGDD.......
Q4WZU3_ASPFU/32-668.PELLAGRVRAQTELEGLVVKDGDVVH........ALAHTWAEL.................YSLQNEEDPVDE.......
A1C7R2_ASPCL/32-668.PELFSARANTHTGLEGLVVKEGDVLS........TLTQSWTEL.................YSLQNEEDPADE.......
C8VMB1_EMENI/4-637.PESSSAR.HVSNSVDGLAIKEGDVAT........TLTKTWAEL.................YSLQNEEDPVDD.......
Q5KH00_CRYNJ/4-686.....DKLITSNPHSSSSIIREQDLDL........ILRRASVGT.................SAELD..............
Q584R6_TRYB2/3-521.....VDDTISRS......................TVTEAVVNR....................................
Q0IG23_AEDAE/4-557.....FSKGITDGS........SR...........DMNRAFQLA.................ANSVNITEDVEQFSFALPP
Q7PWU6_ANOGA/4-573.....IGKEINDGT........TR...........DLNRALKLA.................ANSINLGEDIEQFSFELPC
GCP4_DROME/4-548..ERFK.............................NVTRSFELA.................ATVTGITDDLDKFSLICQ.
GACP4_ARATH/4-645.....PPRQSTGE..........S...........DLMVPFQLA.................ATKTIAEEDKYFSRVSLRM
Q60F24_ORYSJ/4-649.....PPRQSTAE..........A...........DLMVPFQLA.................ALKTIGDEDKYFARVSLRM
Q05AR5_XENTR/4-571.....PPTAVTEH......................DINVAFQLS.................AHKVLLDDDNLLPLLNLTI
Q01B37_OSTTA/4-547.....PPKLGNAT..........R...........ELATPFAQS.................AVTAMPSNIAIYSTFKLVY
A0C933_PARTE/4-693.....PQTQQALQ......................ELNFNLHKM...........................DYDQTEKMD
Q24CL5_TETTS/4-831.....PPKPESEG......................HLNNVIVPH.................TLIRLRNDDEIVNAFKNFQ

PF14609

MOD21_SCHPO/60-677I..........ALQLGS...IVFDQSPTLNNLLVEMEILI----------------------------------------
E4WX70_OIKDI/53-731MWRYVNCIQLFASQR.NFMKVVPTFPLRFTNTEKDSENFI----------------------------------------
B6K1F8_SCHJY/48-653S..........ESQAPSFLVFVLRYQQALYELTTIQETEK----------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264..................KIPDGLDFMSLEATG...............................................
Q29HV5_DROPS/223-746..........................EILNHLDVVAQPPF........................................
Q5KL44_CRYNJ/218-790..........................DILRRLDARILEYS........................................
Q2UAG9_ASPOR/234-750..................TNKAHTHSRSVKLLQ...............................................
Q4WEE6_ASPFU/229-741....................DSQGRSRSVKALK...............................................
A1C564_ASPCL/237-752....................DPEGLGRSVKMLR...............................................
Q5AUB0_EMENI/232-744....................DHDTRSRSVKVLS...............................................
Q0UBK8_PHANO/224-738....................KVKATSQSVKDLA...............................................
Q2HBB4_CHAGB/228-739..........................SVRHSLP...............................................
Q1K6Z8_NEUCR/239-749..........................SVRNTLP...............................................
F4HUK8_ARATH/48-872GCLDRDKDDKGDVKSLSSPRESSVNNYAIDCLE...............................................
GCP5_MOUSE/273-942....................DTTKKKLPVHILD...............................................
F1QBQ4_DANRE/270-933....................DPARKKQPVNNLD...............................................
C3ZYG0_BRAFL/302-1685.............................HNLR...............................................
Q7PX58_ANOGA/302-918...................GYKLDTTTVLLAID...............................................
A0A0D1E2A2_USTMA/319-997..........................SRIHRLA...............................................
Q9VTS3_DROME/266-1244..................TIPDTLNFLSVEATS...............................................
Q17IM7_AEDAE/330-1376..................LIPERFDLYHPNVVS...............................................
Q0UQH9_PHANO/170-704..........................DALSALD...............................................
Q5BEM5_EMENI/175-843..........................NAIEALD...............................................
Q2UCE2_ASPOR/176-851..........................NAIEALD...............................................
Q0D0R6_ASPTN/174-839..........................DAIEALD...............................................
A1CPI0_ASPCL/179-855..........................NAIEALD...............................................
Q4WSG8_ASPFU/170-850..........................HAIEALD...............................................
Q2H076_CHAGB/195-897..........................HGLEALD...............................................
A0A0D1BZI3_USTMA/198-1067KSK...........TKPRSKPTWTDPSSIDALD...............................................
A8BFK8_GIAIC/197-740..........................HVLGCVDVRID...........................................
A2E6U4_TRIVA/44-540..........................KPFEFISVKLEKQQLLSVYTTIQSVT............................
GACP2_ARATH/70-583..........................PRHEDLTCCVDRASLLTTLGMHK...............................
Q0JBZ2_ORYSJ/73-597..........................PSHEDLTCCVERSSLLKKLSTLKDLDCAY.........................
GCP2_DROME/204-721..........................PYKDDLHCELLPYDLVTQMSKIMK..............................
Q29G36_DROPS/282-800..........................PYKDDLHCELLTYDLVTQMSKIMN..............................
Q16HU4_AEDAE/210-728..........................EYNDDLKTMLLPYGIVTQISKIVKK.............................
Q7Q703_ANOGA/248-764..........................EYHDDLKTMLLPYGIVTQISKIVNN.............................
GCP2_MOUSE/220-738..........................PFKDDLKIELMPHDLITQLLRVLAIET...........................
SPC97_DICDI/430-1044..........................EFKDDLECEFIPYKLVDQLLNIININNFNNPTTTTTTNTSSNNIT.........
A0BDB2_PARTE/150-660..........................AYKDDLVCYIDQYTISEQIYAIRNLR............................
Q23AE3_TETTS/242-771..........................PYVEDLTYEFSQYTLKEQLFAYQNSQMNPN........................
SPC97_YEAST/62-688..........................LMRQLLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMH..........
Q6FQY5_CANGA/70-712..........................SLVQRLVSLRYSTVSFRESLLQVQRDEIAREDVTMRDESSDDNDALLRAS....
Q756H1_ASHGO/63-723.......................KDSLILQLMTVRLDQMSLAEVIMQFEEDEIPEDQLNSNGNDVDHGDSTNGGSGVAGP
Q6CXD9_KLULA/57-697..........................MILSKLTSVKIDTCPFYETLRQFIDEQETGLLNADNFQQLK.............
Q6BGV8_DEBHA/61-751.............................DVLSYCSGLSIDFTNFYDLAEEILNVKSFDAEEAFKNGQNSN.........
Q59PZ2_CANAL/94-759..........................SVYDVLKKNQKLSVTSESLYKVVEELMEKNSDYLISDNNLR.............
Q6C787_YARLI/102-681..........................QYKDDVVASLAPTTVWDYLLQIVCATDP..........................
ALP4_SCHPO/74-693..........................PHKEYVTVEVNQTSLIDWLMHIVSISGLEEGTSSQGNEVWNESI..........
Q4X128_ASPFU/183-784..........................PFKEDVKVRMNKIGLTKWLMQVVSVSGIDQDN......................
Q7S902_NEUCR/140-744..........................KFKEDVKVEMNEVTLLKSLQRVVNITGIE.........................
Q0V2V1_PHANO/184-787..........................PYKEDIKVHMNDTGLTNWLMKIVNVQGLDQDA......................
Q5KPG7_CRYNJ/181-812..........................PFKDDLKVVMQSQGLYDWLLKIVSKTGSLTEEG.....................
Q4Q0X5_LEIMA/136-766TAAAVGEGATTALPSRRSMGGSGGEVDARRSLE...............................................
Q9VS91_DROME/97-627..........................FIKDNVRCQLKVCDVATLLGRQHKAQRAVED.......................
Q2M118_DROPS/72-608..........................PFKDLMRCQLKDRDVASQLQKLVNREHGEADK......................
GCP3_DROME/235-758..........................DILNHLDVIVQRPF........................................
Q16YQ3_AEDAE/217-729..........................EVLNYLDVHFLTHY........................................
GCP3_MOUSE/251-761..........................EILKRLDVRLLEVS........................................
Q1K720_NEUCR/225-737..........................EITNRLDARMLQLS........................................
ALP6_SCHPO/196-713..........................YVLKRLDARLLELS........................................
A0A0D1E4X1_USTMA/283-861..........................EILRRLDARILEFS........................................
GACP3_ARATH/192-713..........................DMLDRLRVKMMPHG........................................
SPC98_DICDI/112-705..........................DIVNRLDIALLPER........................................
Q383E4_TRYB2/204-700..........................PHTKNLDTDLFTMLHCE.....................................
Q6FLE0_CANGA/180-724.........................NYIINKLDARLLDLG........................................
SPC98_YEAST/187-740.........................SSVINGLDARVLDLG........................................
Q74Z68_ASHGO/190-740.........................NVIINKLDARLLESG........................................
Q6CIT0_KLULA/175-721.........................NLLVNRLDARILELA........................................
Q6BX70_DEBHA/183-753..........................DYKNRLDARILDLS........................................
Q4U9K6_THEAN/45-615RDVGSMKVETLDGLETTGFEQDNSLGEWNNSLDF..............................................
Q4N294_THEPA/45-610RDLGVSQLENWNSLESGELRHDKSLGEGNNSFDF..............................................
A8BD62_GIAIC/283-863FKHHLN....SVLYPQTYVPDRATDSPDPKVLN...............................................
Q0UGY4_PHANO/31-649.......................ILEVAARVLHLTLKESPSNRPGTPGRAKD............................
Q2H2M0_CHAGB/4-638.......................GLELARDLLRLSMAKSRTATPMTPVLPE.............................
Q2UDA7_ASPOR/4-644.......................ELDLARSLLQLSMNDKRKGHSVAATPSAG............................
Q0CV34_ASPTN/4-641.......................ALDLAKDLFKLSVYDKRHATASGTGSS..............................
Q4WZU3_ASPFU/32-668.......................SLDLARDLVRLSITDSKNRHTVATHSDEI............................
A1C7R2_ASPCL/32-668.......................ALDLAKDLIRLSISGKDNGQVASSFSELS............................
C8VMB1_EMENI/4-637.......................ELDLARELVRLSLKPRDHGQNPGFSGAAA............................
Q5KH00_CRYNJ/4-686..........................SQLDSLHYKMEKGPLRAMLPTVPVKTPKQTD.......................
Q584R6_TRYB2/3-521..........................TAADAFAYALEMSGLGDVRVFERFSTFVRLPI......................
Q0IG23_AEDAE/4-557.................KEEVDSFCYETKGILS...............................................
Q7PWU6_ANOGA/4-573GS............RDGSGEESSFCYETKSAVG...............................................
GCP4_DROME/4-548.................RSTSEPDDTSDFNFLQ...............................................
GACP4_ARATH/4-645PS............FGVTVRSSQADMVRS...KVSLTGKANL......................................
Q60F24_ORYSJ/4-649SS............FGIKASTSQKDLQKSSTPEISSQGKAT.......................................
Q05AR5_XENTR/4-571DY............HGKEHKDMSQPREGPSRDTSPREP..........................................
Q01B37_OSTTA/4-547SS............ALTRSEENAAERPTTPSTAFLPRVHV........................................
A0C933_PARTE/4-693MF.............IYNNGFEYKTFQSLNNLQIKNNVIQTINILRMGPARGPEDWSGVFRDVKQSIENGFTLQIVFKFK
Q24CL5_TETTS/4-831FK.............IKNNGFEFKDFSQVNELNIFGNVHQQRNNYIRFQPLKNSKLSGSLWYKFKQNIEMGFKLSFTFRF

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264................................................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723TADGI...........................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693QQLSKPLGGYSILQVPQDLSTSLVLLFCQDEENGVFIRLKLDQQKVSSLSVESKIK........................
Q24CL5_TETTS/4-831KKERNYLPINQFSKLGSPNINLLQSSTKGSVNLLQSEEQSPLKSRFSYFTSSIAQDETNENGLLIVFQNTKEISSYKKAA

PF14609

MOD21_SCHPO/60-677--------------------------------------------------------------------------------
E4WX70_OIKDI/53-731--------------------------------------------------------------------------------
B6K1F8_SCHJY/48-653--------------------------------------------------------------------------------

PF04130

Q2M0Y2_DROPS/276-1264................................................................................
Q29HV5_DROPS/223-746................................................................................
Q5KL44_CRYNJ/218-790................................................................................
Q2UAG9_ASPOR/234-750................................................................................
Q4WEE6_ASPFU/229-741................................................................................
A1C564_ASPCL/237-752................................................................................
Q5AUB0_EMENI/232-744................................................................................
Q0UBK8_PHANO/224-738................................................................................
Q2HBB4_CHAGB/228-739................................................................................
Q1K6Z8_NEUCR/239-749................................................................................
F4HUK8_ARATH/48-872................................................................................
GCP5_MOUSE/273-942................................................................................
F1QBQ4_DANRE/270-933................................................................................
C3ZYG0_BRAFL/302-1685................................................................................
Q7PX58_ANOGA/302-918................................................................................
A0A0D1E2A2_USTMA/319-997................................................................................
Q9VTS3_DROME/266-1244................................................................................
Q17IM7_AEDAE/330-1376................................................................................
Q0UQH9_PHANO/170-704................................................................................
Q5BEM5_EMENI/175-843................................................................................
Q2UCE2_ASPOR/176-851................................................................................
Q0D0R6_ASPTN/174-839................................................................................
A1CPI0_ASPCL/179-855................................................................................
Q4WSG8_ASPFU/170-850................................................................................
Q2H076_CHAGB/195-897................................................................................
A0A0D1BZI3_USTMA/198-1067................................................................................
A8BFK8_GIAIC/197-740................................................................................
A2E6U4_TRIVA/44-540................................................................................
GACP2_ARATH/70-583................................................................................
Q0JBZ2_ORYSJ/73-597................................................................................
GCP2_DROME/204-721................................................................................
Q29G36_DROPS/282-800................................................................................
Q16HU4_AEDAE/210-728................................................................................
Q7Q703_ANOGA/248-764................................................................................
GCP2_MOUSE/220-738................................................................................
SPC97_DICDI/430-1044................................................................................
A0BDB2_PARTE/150-660................................................................................
Q23AE3_TETTS/242-771................................................................................
SPC97_YEAST/62-688................................................................................
Q6FQY5_CANGA/70-712................................................................................
Q756H1_ASHGO/63-723................................................................................
Q6CXD9_KLULA/57-697................................................................................
Q6BGV8_DEBHA/61-751................................................................................
Q59PZ2_CANAL/94-759................................................................................
Q6C787_YARLI/102-681................................................................................
ALP4_SCHPO/74-693................................................................................
Q4X128_ASPFU/183-784................................................................................
Q7S902_NEUCR/140-744................................................................................
Q0V2V1_PHANO/184-787................................................................................
Q5KPG7_CRYNJ/181-812................................................................................
Q4Q0X5_LEIMA/136-766................................................................................
Q9VS91_DROME/97-627................................................................................
Q2M118_DROPS/72-608................................................................................
GCP3_DROME/235-758................................................................................
Q16YQ3_AEDAE/217-729................................................................................
GCP3_MOUSE/251-761................................................................................
Q1K720_NEUCR/225-737................................................................................
ALP6_SCHPO/196-713................................................................................
A0A0D1E4X1_USTMA/283-861................................................................................
GACP3_ARATH/192-713................................................................................
SPC98_DICDI/112-705................................................................................
Q383E4_TRYB2/204-700................................................................................
Q6FLE0_CANGA/180-724................................................................................
SPC98_YEAST/187-740................................................................................
Q74Z68_ASHGO/190-740................................................................................
Q6CIT0_KLULA/175-721................................................................................
Q6BX70_DEBHA/183-753................................................................................
Q4U9K6_THEAN/45-615................................................................................
Q4N294_THEPA/45-610................................................................................
A8BD62_GIAIC/283-863................................................................................
Q0UGY4_PHANO/31-649................................................................................
Q2H2M0_CHAGB/4-638................................................................................
Q2UDA7_ASPOR/4-644................................................................................
Q0CV34_ASPTN/4-641................................................................................
Q4WZU3_ASPFU/32-668................................................................................
A1C7R2_ASPCL/32-668................................................................................
C8VMB1_EMENI/4-637................................................................................
Q5KH00_CRYNJ/4-686................................................................................
Q584R6_TRYB2/3-521................................................................................
Q0IG23_AEDAE/4-557................................................................................
Q7PWU6_ANOGA/4-573................................................................................
GCP4_DROME/4-548................................................................................
GACP4_ARATH/4-645................................................................................
Q60F24_ORYSJ/4-649................................................................................
Q05AR5_XENTR/4-571................................................................................
Q01B37_OSTTA/4-547................................................................................
A0C933_PARTE/4-693................................................FKEEIIYKWKLDKIDFSEGDLHSLKINYQNDE
Q24CL5_TETTS/4-831PYRLQDMNEYVAIKFYTKETNKKGAASVAKEINDQKCSIQMVVCNNGKPTYIKNHEFDCDRVNFLDGQLQVIKINYDGEN

PF14609

MOD21_SCHPO/60-677-------------------------------------------------------RSKI.......LKLGK.SLDLSFDF
E4WX70_OIKDI/53-731-------------------------------------------------------DECVARSNNYPVPPLEPALSLLYEI
B6K1F8_SCHJY/48-653-------------------------------------------------------QSDLTVQDTSQLSAGSFSLELSDTL

PF04130

Q2M0Y2_DROPS/276-1264........................................................................MLTLKCKV
Q29HV5_DROPS/223-746.................................................................LGDTGWDIVSLQYVV
Q5KL44_CRYNJ/218-790.................................................................HGETGWDCFALQYKV
Q2UAG9_ASPOR/234-750........................................................................AISFDYVL
Q4WEE6_ASPFU/229-741........................................................................TISFDYIL
A1C564_ASPCL/237-752........................................................................MISFDYIL
Q5AUB0_EMENI/232-744........................................................................SLSFDYIL
Q0UBK8_PHANO/224-738........................................................................AVSLDFAL
Q2HBB4_CHAGB/228-739........................................................................FIRLNYRL
Q1K6Z8_NEUCR/239-749........................................................................AIRLIYHL
F4HUK8_ARATH/48-872........................................................................SLKFTYKV
GCP5_MOUSE/273-942........................................................................GLTLSYKV
F1QBQ4_DANRE/270-933........................................................................GLTLSYKV
C3ZYG0_BRAFL/302-1685........................................................................SPDVQAET
Q7PX58_ANOGA/302-918........................................................................EIRVLYNP
A0A0D1E2A2_USTMA/319-997........................................................................DVKVEYEV
Q9VTS3_DROME/266-1244........................................................................MLKLNCKI
Q17IM7_AEDAE/330-1376........................................................................MLNLSYRV
Q0UQH9_PHANO/170-704........................................................................FLRLQYVP
Q5BEM5_EMENI/175-843........................................................................FLCLQYKP
Q2UCE2_ASPOR/176-851........................................................................FLRLQYKP
Q0D0R6_ASPTN/174-839........................................................................FLRLQYKP
A1CPI0_ASPCL/179-855........................................................................FLRLQYKP
Q4WSG8_ASPFU/170-850........................................................................FLRLEYTP
Q2H076_CHAGB/195-897........................................................................FLRLSYKP
A0A0D1BZI3_USTMA/198-1067........................................................................WLTLSFHP
A8BFK8_GIAIC/197-740....................................................................NSKSNFYVTYSI
A2E6U4_TRIVA/44-540....................................................IKGATKQKNIRITSGTTQWEFFTLAPKV
GACP2_ARATH/70-583.......................................................DTDSNSIEDPMSITGLETFSLSYKV
Q0JBZ2_ORYSJ/73-597..................................................PSDKLVAADVDHPMPLSVTGLETFCLSYKV
GCP2_DROME/204-721.......................................................KEENWQAQPRLDLSGLECFAFTYEV
Q29G36_DROPS/282-800......................................................QKEEYWQSQDRLDLSGLECFAFTYEV
Q16HU4_AEDAE/210-728......................................................EDVFLDTLGDTSQLKGIECFTFNYNA
Q7Q703_ANOGA/248-764......................................................EDAFVDTLSDTSQLKGVECFTFTYKA
GCP2_MOUSE/220-738....................................................KQEKAMTHADPTELTLSGLEAFSFDYMV
SPC97_DICDI/430-1044.................................ATTNTSSNNTTINTTVNTTLIQSTSAHEVLKTNKLFGIESLAFNYNV
A0BDB2_PARTE/150-660.....................................................GIDINENKPPRNQKLKGIELFTLDIKV
Q23AE3_TETTS/242-771.................................................LLNDQNQEKFKIHTPALTLKGLDLFSLDYRI
SPC97_YEAST/62-688..................................ANNFKNMNAILFDELSKERTGAYHGSNLELYTPKSAIYHLKFDINI
Q6FQY5_CANGA/70-712.............................NFENVKRILFEDRHHTDEYDDHGQQGHEQGREQRREPALSNIHYLEFDLVV
Q756H1_ASHGO/63-723....................DSLRFADTTVNTNRHSILQARNFNNLKDMLLKELDHTVTGSSQRKRKLHSVHHLQFELVM
Q6CXD9_KLULA/57-697.....................................GMLVAEEQNHTSQGSNELDEGRKSKKKKNATPTAMYVQFETSI
Q6BGV8_DEBHA/61-751..................................IFKALLNNSLERDQINSAGSNISPNSYDPDHSDEYTISGVNLDMDL
Q59PZ2_CANAL/94-759.....................................GIFHRVASLRDDSRLTISSTADSATENVKDEPTITSVDLTIPL
Q6C787_YARLI/102-681...................................................NESGWESDSRKMSMDDMPVSCAFQLDFKV
ALP4_SCHPO/74-693...................................TKQADVGNETRNFESEHNRSTQGTSKVGSDKDINGFETMQLCYKV
Q4X128_ASPFU/183-784..............................................PEAVLERYQAPQTQGGEDDKDIVGFDALELDYSV
Q7S902_NEUCR/140-744.................................................QGEALQLTSNQPLEGDKNATGFTSLQLDYTV
Q0V2V1_PHANO/184-787..............................................AAASISNYTPANTAPITDDSNITGFQALQFDYAM
Q5KPG7_CRYNJ/181-812.............................................ELDFALGDIHEEEGSKREKERPLIAIDALAFDYSV
Q4Q0X5_LEIMA/136-766........................................................................LLQLETDL
Q9VS91_DROME/97-627................................................EEEEEKESCSEQDPPEVLNLYGYEALALGYET
Q2M118_DROPS/72-608..............................................NEVNTSNTTSDDDGDPFGRFTLYGYEAFALRYEP
GCP3_DROME/235-758.................................................................NGDIGWNIISLQYIV
Q16YQ3_AEDAE/217-729.................................................................EGESGWDVFGLTYKV
GCP3_MOUSE/251-761.................................................................PGDTGWDVFSLDYHV
Q1K720_NEUCR/225-737.................................................................HGDIGWDCFTLEYKI
ALP6_SCHPO/196-713.................................................................HGETGWDVFTLEYKV
A0A0D1E4X1_USTMA/283-861.................................................................TGDTGWDTFTLEYKL
GACP3_ARATH/192-713.................................................................SGDRGWDVFSLEYEA
SPC98_DICDI/112-705.................................................................PGNIGWDIFSLDYHV
Q383E4_TRYB2/204-700.............................................................IVKDDKIIGWDAFVVTMSV
Q6FLE0_CANGA/180-724.................................................................HGAIGWDVFTLDFIV
SPC98_YEAST/187-740.................................................................HGSVGWDVFTLDYIL
Q74Z68_ASHGO/190-740.................................................................HGSVGWDVFTLDYLV
Q6CIT0_KLULA/175-721.................................................................HGSSGWDVFTLDYLV
Q6BX70_DEBHA/183-753.................................................................HGNIGWEVFTLEYKI
Q4U9K6_THEAN/45-615.......................................................................RGIVLCSDI
Q4N294_THEPA/45-610.......................................................................RGIVLCCDV
A8BD62_GIAIC/283-863........................................................................LLGLQYDV
Q0UGY4_PHANO/31-649....................................................AESVLPQILDLSFNELLLLAPCSLFMDV
Q2H2M0_CHAGB/4-638......................................................AEMPVIAPTPFRNLLFSVPVVLTLQI
Q2UDA7_ASPOR/4-644....................................................GSDHLANISDIPFDDLLFPSPTVLSAQV
Q0CV34_ASPTN/4-641......................................................DTSAVISDVSFEDLLFPAPTVLSVQV
Q4WZU3_ASPFU/32-668....................................................GSDLVAELSDVSFEDLLFPTRTSISVEV
A1C7R2_ASPCL/32-668....................................................GADLTAELSDVLFDDLLFPTPTSLSVEV
C8VMB1_EMENI/4-637.....................................................ADPVAETSNTPFDDLLFPTSTSLSVHV
Q5KH00_CRYNJ/4-686...............................................IESKSDTVEHRNSIRALFSSSLLGTPLILTTTV
Q584R6_TRYB2/3-521..............................................EAEEGEGSGTLRSIEDTARAILSCMRGLGLHYVP
Q0IG23_AEDAE/4-557........................................................................YITLKYKV
Q7PWU6_ANOGA/4-573........................................................................HIMLKYKV
GCP4_DROME/4-548........................................................................GLSLKYEY
GACP4_ARATH/4-645..............................................................TSDTSVDGWDAIALEYSV
Q60F24_ORYSJ/4-649...............................................................SELALDGWDSIALEYSV
Q05AR5_XENTR/4-571..................................................................PISGWAALGLSYKV
Q01B37_OSTTA/4-547.................................................................PEYDAWDGIDLECSI
A0C933_PARTE/4-693LSLIIDDTQSDTQCKTDILPPSQWKKVAFKFQKYFQLELGRCMVGIKQYGQIVDLYTWKMIGSNFLNDASWSGLTLKYQV
Q24CL5_TETTS/4-831IALHLEDIDNMNRGLQSQLFTFPFKFNKFLNLDMGRAYVGFIQDSNNGNCAMDIMSWQMYSSNVFNNQDAWNGLTMDYQV

PF14609

MOD21_SCHPO/60-677.............QSLMGEFENLIKQQEEAKKSLWSKRFSRFYYGHYVFVNTCHNFFLTLYQSFTEVDENSIFNGVFETL
E4WX70_OIKDI/53-731MRMRAVLKNWGVEERFSDRFFSLETAFDENWDELSEKYFGKRIVHDDAYLST.RVWVTREKKKFTK.EQIASF.GVWADD
B6K1F8_SCHJY/48-653.............QSYTLRF.......KEAYLALNQKKANKYVYGHLVFMKTVYDFLLLLSWECSS.GGVSIF.......

PF04130

Q2M0Y2_DROPS/276-1264-------N.WPLNLVIS...GETITKYGQIFEHLLKLRHVTFVLE.GAFQHL-QHLA...KLHGAALRTA..........
Q29HV5_DROPS/223-746-------Q.GPLATML....EPTMSTYKALFKPLWRMKHMEFVLSTKIWKEQ-MTNG...KKLRKMNAEIG.........
Q5KL44_CRYNJ/218-790-------E.APLNAVLD...HRAMGDYDRLFNHLWRLKRVEVVLT.QNWMRV-TSGS...KVYERVPGLN..........
Q2UAG9_ASPOR/234-750-------P.WPVANIIT...KDAILSYQRLSTFLMQIRRAKHTIVKQRLQYS-PEIY...EARK................
Q4WEE6_ASPFU/229-741-------P.WPIANIIP...KDAIHRYRRISTFLMQIRRAKHLIVKQRLKYA-DETD...EFSRDRSSNA..........
A1C564_ASPCL/237-752-------P.WPVANIIT...KDAIQSYQRISIFFMQIRRAKQLVVKQRLQYT-TETD...AFSTDRASNA..........
Q5AUB0_EMENI/232-744-------P.WPVANIIT...KDGIAAYQRVSNFLMQIRRAKYSIVKQRLQYL-NHDT...NQAKGSKGQT..........
Q0UBK8_PHANO/224-738-------S.WPIQNIIQ...RSSLPVYQQVLTFLLQSYRAKYLLQRARPGRG-PQLK...SAR.................
Q2HBB4_CHAGB/228-739-------S.WPVQIVVP...EEDIQGYQTLFTFQLQTQRALSLLQYPILPSQ-RGGA...D...................
Q1K6Z8_NEUCR/239-749-------P.WPIQMIIS...PAEVKGYQTMFVFLLQTRRAIYLLKHPLLGTT-TTPA...RH..................
F4HUK8_ARATH/48-872-------P.WPLELIAN...SEAIKKYNQ.......VKRAKYVLD.KARRLM-WKGK...GSATKI..............
GCP5_MOUSE/273-942-------P.WPVDIVIS...VECQKIYNQVFLLLLQIKWAKYSLDVLLFGEL-GNAA...ERSQAKEDIPRDQDTPSQF.
F1QBQ4_DANRE/270-933-------P.WPVDIVIS...SECQKIYNQVFLLLLQIKWAKYSLDTLRFSDL-TVAA...KRKEGGQP.EENTAK.....
C3ZYG0_BRAFL/302-1685-------D.QPEE.......SDDIPARQK.......................-...........................
Q7PX58_ANOGA/302-918-------S.HDLSNMIN...DDTMASYNSVFRFLLKVKWALGTLEMLRFPEL-LKKR...PPYANFGMLD..........
A0A0D1E2A2_USTMA/319-997-------P.WPLTFVFP...TGCMRFYQYIFSTLLQANYAQWKLA.STLKLA-KPET............M..........
Q9VTS3_DROME/266-1244-------D.WPLNMVIS...SETISKYGQIFGYLLKLRHVSFVLD.GTYEYL-QQMG...KLLGPELRTC..........
Q17IM7_AEDAE/330-1376-------E.WPLNLILN...PETIEQYTNIFKYLVKVRRVSFVLG.KSFQLL-KEAH...KQFGKQMLLS..........
Q0UQH9_PHANO/170-704-------P.TPLNLIIT...TEALDKYDLVFKFLLRLLRMLFVIS.HLPHRF-NDLE...SRQ.................
Q5BEM5_EMENI/175-843-------S.NVLEVIIT...QRSLRKYDQLFKQLLRLLRMVSVVK.GLIRDS-TARN...SLSGDT..............
Q2UCE2_ASPOR/176-851-------S.DVLEAIIT...SRSLNKYDRLFKHLLRLLRMVSVVK.GLIRDS-TGRD...SLSGHP..............
Q0D0R6_ASPTN/174-839-------S.DVISTIIT...YRSLAKYDRLFKHLLRLLRMVSVVK.SLIRDS-TARN...SLSGDT..............
A1CPI0_ASPCL/179-855-------S.AVLETIIT...QRSLTQYDRLFKHLLRLIRMVSVVK.GLIRDS-TARS...SLSGDT..............
Q4WSG8_ASPFU/170-850-------S.PVLETIIT...QRSLDQYDRLFKHLLRLIRMVSVVK.GLIRDS-TARS...SLSGDT..............
Q2H076_CHAGB/195-897-------P.ATLRPIMS...PAILLKYDRIFKLLLRVLRMLYVAN.QLSRDQ-RRNS...GEE.................
A0A0D1BZI3_USTMA/198-1067-------P.PLISPLLT...QLAQSRYQRLWNMLLRIKRCKVAMR.SAWACT-FKST............SAAFT......
A8BFK8_GIAIC/197-740-------K.DPLTSIIT...PGQIRIYETIFQIQWRLRSADDKLD.QIILLT-NFFY...RRNTQQILTNAGRVGIFRLH
A2E6U4_TRIVA/44-540-------S.WPISIVIS...KEFQEKYALFFRFILLWKRIERKFS.NLYSFV-NTFM...RKHSKTSSMT..........
GACP2_ARATH/70-583-------Q.WPLSIVIS...KKALSKYQLIFRFLFHCKHVERQLC.GAWQIH-QGIR...SMNSKGTA............
Q0JBZ2_ORYSJ/73-597-------Q.WPLSLVIS...RKSLTKYQLIFRLLFHCKHVSRQLC.TAWQIQ-QGFR...SVKILGTP............
GCP2_DROME/204-721-------K.WPCSLVLN...HISISKYQMLFRQLFYCKHVERQLC.KIWKEN-SIAR...QFEPQAASL...........
Q29G36_DROPS/282-800-------K.WPVSLVLN...HIAISKYQMLFRQLFFCKHVERQLC.KIWKEN-SIAK...KFSPQAAEL...........
Q16HU4_AEDAE/210-728-------Q.WPVSIVLN...RWTISKYQMIFRQLFYLKYVERILC.RVWIAN-NRTK...QFAPQTAKL...........
Q7Q703_ANOGA/248-764-------Q.WPVSIVLN...LWTISKYQMIFRQLFYLKYVERILC.RVWIAN-NETR...QFAPNPAKL...........
GCP2_MOUSE/220-738-------K.WPLSLIIN...RKALTRYQMLFRHMFYCKHVERQLC.SVWISN-KTAK...QHALHSAKW...........
SPC97_DICDI/430-1044-------G.WPLSLIIS...RKSLIKYQIIFRHLFLCKHVEKVLV.DTWSQH-QFRR...SSYNKPGLST..........
A0BDB2_PARTE/150-660-------E.WPANLIFS...RASLLNYQILFRSLMSLNYLLKQLN.EAWVFQ-KQLK...DTGLHQK.............
Q23AE3_TETTS/242-771-------K.WPLNLIFN...RKTLTKYQLIFRHLFNCKYIERQLS.NAWLVQ-QSMK...ELNVQRI.............
SPC97_YEAST/62-688-------P.YPLNIIIS...RTCMIKYQIILRYQLVLQYHSRLLD.ETWMDL-NKTP...SWKYRGYSHTVK........
Q6FQY5_CANGA/70-712-------P.YPLNILIN...HSCMIQLRILQRYMNILAHTQLSVD.KRFLDI-TKDT...VWRYRHFQEPIR........
Q756H1_ASHGO/63-723-------P.FPLNALVS...KPFIVEYQIIQRHLLLLMYYNRLLE.DTWFEA-NKAW...PIRARGPSTQ..........
Q6CXD9_KLULA/57-697-------P.YPLNIIWT...KPVMVQYQMIQRLLLILSYHERLLE.DTWFEI-SKNK...HWRRNSSQQSEYETHGMIFE
Q6BGV8_DEBHA/61-751-------P.FPLNMIVG...QNYVLEYQLIFKLQMIVKFINKLID.NTWKEI-NYST...VWKYTGFHPKI.........
Q59PZ2_CANAL/94-759-------P.FPLNLVLN...QQLSYQYEIMFKLLINIKFISKYNS.SNWQEM-NYSK...IWTNSHFNSSV.........
Q6C787_YARLI/102-681-------P.FPLSLVIS...RRALIRYQILFRHLAELKNLERLLS.IVWLEM-AKSR...HWRYPTSDERL.........
ALP4_SCHPO/74-693-------P.FPLSLILS...RKAIIRYQLLFRYFLLLRHVEMQLE.NSWVQH-SKNS...AWRLNSSNAKI.........
Q4X128_ASPFU/183-784-------P.FPLSLVIS...RKTVLRYQLIFRHLLSLRHLETLLT.TSWLDQ-NKVV...GWRHKSSDRRL.........
Q7S902_NEUCR/140-744-------P.FPVSLVIS...RKTIWRYQALFRYLLSLRYLETQLS.VTWYTH-ASGT...AWTHRSSNRML.........
Q0V2V1_PHANO/184-787-------P.FPLSLVVS...RVTLTRYQLLFRYLLSLKHLETDLA.KCWGEQ-GKNA...AWKHRSRNPRI.........
Q5KPG7_CRYNJ/181-812-------K.FPLSLIIS...RKTIARYQLIFRFLLHLHHLESALS.AMWLEH-KSP....SWRNNSGNEDI.........
Q4Q0X5_LEIMA/136-766-------Q.WPLTLVLD...GKVTHRLNIIFRLLMWVKTCERHLF.ELWYTN-EILG...E...................
Q9VS91_DROME/97-627-------K.WPLSFIIY...PELLEQLQMLQRVLFFLHYVKHHLT.VLWQSP-CEGTG.LQL..................
Q2M118_DROPS/72-608-------K.WPLSFVLH...SEPLQKMQLLQRVILFLRYVQRQLQ.ALWQAP-PEGTIPISQ..................
GCP3_DROME/235-758-------H.GPLAAML....ESTMPTYKVLFKPLWRMKHMEFVLSMKIWKEQ-MGNA...KALRTMKSEIG.........
Q16YQ3_AEDAE/217-729-------S.GPLSTIL....EPSLCRYQTFFKHLWNMKHIQFILS.RTWKCQ-TLAA...KSLKSLQNQIG.........
GCP3_MOUSE/251-761-------D.GPIATVFT...RECMSHYLRVFNFLWRAKRMEYILT.DIRKGH-MCNA...KLLRNMPEFS..........
Q1K720_NEUCR/225-737-------D.APVDVVVT...EWGNRQYLKVFNFLWRIKRVEFALA.STWRKC-MTGA...RGVLQTSDETV.........
ALP6_SCHPO/196-713-------D.SPINVIIT...PYCSRQYLKIFNFLWRLKRIEFALA.HSWRRV-NLGE...RNVFRNLDYTK.........
A0A0D1E4X1_USTMA/283-861-------D.SPVNTVLD...NQAMVGYQTIFTHLWKIKRVESSLN.SSWLRL-HETG...TSLCRMKRGTGNALL.....
GACP3_ARATH/192-713-------R.VPLDTVFT...ESVLSKYLRVFNFLWKLKRVEHALI.GIWKTM-KPNC...ITSNSFVKLQSSVK......
SPC98_DICDI/112-705-------D.TPLNTILS...PNDILRYKKIFHFMWGIKRVEYSLA.SIWRKI-RSST...SLSILSPIGG..........
Q383E4_TRYB2/204-700-------P.SPLNNIFD...ASAMKVYRRLFRMMFKVKRAEVALK.NSWRQS-VVLD...RIIGGLHNAKRETT......
Q6FLE0_CANGA/180-724-------D.RPLSFVLNVNRTNGRKEYLRIFNFLWKLKKNQFYFE.KESKRT-KEIL...RTFRKFPEFSPVMG......
SPC98_YEAST/187-740-------Y.PPLSLVLNVNRPFGRKEYLRIFNFLWRFKKNNYFYQ.KEMLKS-NDII...RSFKKIRGYNPLIR......
Q74Z68_ASHGO/190-740-------D.LPLSIVLNVNRPGRKKEYLRIFNFLWRIKKNAFFFQ.EEWLRN-LSLM...RDFRKTRRNKPLVR......
Q6CIT0_KLULA/175-721-------D.QPLSTVMDINQHGSRRDYLRIFNFLWRIKKNEYNYE.QEWQKN-SSIL...KLFRKLNIRVPFIR......
Q6BX70_DEBHA/183-753-------SDSPIYHILN..YNNGTLEYLKMFNFLWKLRHFSYLLN.LNFIEC-SNVK...KNDLRRISSRYIKLKRQLKS
Q4U9K6_THEAN/45-615-------E.LPMRLILT...DKIMYRYKLMFKLLFQLKYAEYCLN.QLTQYH-VRAG...QLAIEPELMPRFN.......
Q4N294_THEPA/45-610-------E.FPMRLVLT...NKIMYRYKLMFKLLFQLKYAEHSLN.QLTQYH-VRAG...QLAIEPELMPRFN.......
A8BD62_GIAIC/283-863-------T.YPLNLVLT...TPVMERLNLVFRHILRAKVSEIELQ.KAWTTL-QRLR...KLERVPHDKIEVYANALR..
Q0UGY4_PHANO/31-649-------P.FPLDLFIT...RGDVEVYSSIHAYLLAIRRAHLHLA.QLWRQS-SIRR...DHPCPPGYQYSNSAHGKLIL
Q2H2M0_CHAGB/4-638-------P.SPLDLFLS...QSDLQTYTAINSYLLSLRRAHIRLT.DLWKIT-SLRR...HHPAPPGPPYGSTRGGRERV
Q2UDA7_ASPOR/4-644-------H.PPLDLFLS...ASDVLIYSKIHSYLLGIRRAQLHLG.DLWKHT-FLRK...IHPSPLGPPRSNSQFGQNKL
Q0CV34_ASPTN/4-641-------R.PPLDLFLS...ASDISIYSKIHSYLLGIRRAQLHLS.DLWKHS-FLRK...SYPSPWGPPRSNSAFGQNKL
Q4WZU3_ASPFU/32-668-------R.APLDLFLS...TSDIAVYSRIHSYLLGIRRAQIRIN.DLWKHS-FLRK...SYPSPWGPPRSNTPFGQSKL
A1C7R2_ASPCL/32-668-------R.APLDLFLS...TSDISVYSKIHSYLLGIRRAQIRIG.DLWKHS-FLRK...SHPSPWGPPRSNSAFGQSKL
C8VMB1_EMENI/4-637-------R.PPLDLFLS...AADISIYSKMHSYLLGIRRAQIRLG.DLWKHS-PLRR...SHPSPWGPPRSNSRFGQSRL
Q5KH00_CRYNJ/4-686-------T.WPLDLFIS...PQALSAYSDIQAYLTALRHTHLSVL.SCWTAL-SAAQ...RQRRKWTGVTEGGTDE....
Q584R6_TRYB2/3-521-------P.RGLQLVVS...PKAMEYYQRIFSFHIVRRFSLHALH.SVRGLF-SEALLTNKNPSPE..............
Q0IG23_AEDAE/4-557-------K.WPLHLLFS...PKTLDKYNEMFRFLLRIRKIQYDIH.QVWSLQ-RENK...VKK.................
Q7PWU6_ANOGA/4-573-------K.WPLHLLFS...PRILERYNEMFRFLLRIKKIQHDLL.QIWSYQ-RERR...MKH.................
GCP4_DROME/4-548-------E.WPLNLLFS...PTTIERYNNIFRFLLIIRTYQYEIQ.RVWAKQ-TWRA...KSAKDVPP............
GACP4_ARATH/4-645-------D.WPMQLFFT...QEVLSKYLKVFQYLIRLKRTQMELE.KSWASV-MHQD...HIESAQHRKDGLNGST....
Q60F24_ORYSJ/4-649-------D.WPLQLFFT...PDVVSKYRKVFQYLIRLKRTQMELE.KSWAAV-MHQD...HADFSDYCKDRKNGDA....
Q05AR5_XENTR/4-571-------Q.WPLHILFT...PAVLEKYNVVFKYLLSVRRVQSELQ.HCWALQ-MQRK...HLESNKT.............
Q01B37_OSTTA/4-547-------P.WPMGIFFT...ADTQERYKTIFKYLFRLKRVQFDLQ.ETWVRL-RRSG.......................
A0C933_PARTE/4-693-------D.YPLSLLIT...PSLQEKFQLFFRYLFPIRHAQFELQ.QVWIKL-TKKF...KKKD................
Q24CL5_TETTS/4-831-------K.WPLNLMIS...SHLIEKYKTIFRYLFPLRTIQFELQ.RSWLYF-MKNS...KRGKLNPT............

PF14609

MOD21_SCHPO/60-677NNDVDDESVIGEKEK.....LILKQKQKCLSEFFVDDIKKLLNEELLNCQKQELPDVME......NTYQISTVSGIKNDP
E4WX70_OIKDI/53-731MKELNTTKVRHEPEKNTDWGGVLKKHTKEIYGFKMSRPAALNCGDTNPWHKEFLKPIMDHLQVQKNCYKTQLAE.IDLQR
B6K1F8_SCHJY/48-653.............................LKDILTKRVLDLFNAALSCVHTDSLADVL..........KTSVSNANDNDR

PF04130

Q2M0Y2_DROPS/276-1264.................HQFRHLQAVRHKLSHFMTTLQTHLVANALQATWNAFKKDLCGC....................
Q29HV5_DROPS/223-746.................KASYKLHLFTSEIMHFIHQMQYYVLFEVIECNWVELQKQMQQA....................
Q5KL44_CRYNJ/218-790.................NDWHHCRIVQAEMVHFLRQLQAFCQLEVIECSWADLIEFTTKR....................
Q2UAG9_ASPOR/234-750...................NAQAYALRHNMLWFLNTLYSHMTDFVISTTTDSLRKDL.SA....................
Q4WEE6_ASPFU/229-741.....................LSYSLRHHMLWFLNTLYSHITDFVISTATESLRKSL.SA....................
A1C564_ASPCL/237-752.....................LSYALRHNMLWFLNTLYSHMTDFVISTTTNSFHQSL.AA....................
Q5AUB0_EMENI/232-744.....................LSYAIRHNLLFFLNVLYSHLTGFVISSTTQSLRKSL.ST....................
Q0UBK8_PHANO/224-738...................IQLTYKLQHRVTWFADILRSYLTETVIFFTTRAMDAQM.EK....................
Q2HBB4_CHAGB/228-739...................MARYYLLRSKLLWFSNTIKTYLTTLVLAPNTARLRADLGDA....................
Q1K6Z8_NEUCR/239-749...................QSTYYLLRTKLLWFCNTMMSYLTTLVFAPNINKMDEAL.QH....................
F4HUK8_ARATH/48-872...................RKHHCLLEQKLLNFVDAFHQYVMDRVYHTAWRELCEAM.VK....................
GCP5_MOUSE/273-942.........GPPKESLRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQV.EE....................
F1QBQ4_DANRE/270-933.............ESINQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQV.QE....................
C3ZYG0_BRAFL/302-1685...................EHRMHLLRLRLLHFINALHSYFMTRILYTTALEFRKEFSEA....................
Q7PX58_ANOGA/302-918.................LILKRLAMLKFWMIFSVQCIHSHLMTHVLQSFGEQLDEKL.DL....................
A0A0D1E2A2_USTMA/319-997..................HMRKFWSLRRQAQWLVRTLIGFIQSDILFDGSQRILSALEGT....................
Q9VTS3_DROME/266-1244.................THFRHMQMMRHKMSHFMTSFQTHLVAKALLSTWKSFKEELCTA....................
Q17IM7_AEDAE/330-1376.................PQYSRVQLISHKLSHLVNALKNYITSSALQASWETFRKDLESA....................
Q0UQH9_PHANO/170-704.........................LKLEAHHFVTMFAGYVFQSGIAGHWQEFDSFV..STLETRINEE...........
Q5BEM5_EMENI/175-843...................HNLLQKFRIDSQHFILALSDYFFHLAVGSTWQRFRDTLSQIEACLDRG.............
Q2UCE2_ASPOR/176-851...................RNVYQKFRIDCQHFVLSLSDYCFHVGIGSTWQRFQDSLAKIERCLDRG.............
Q0D0R6_ASPTN/174-839...................RNVFQKFRIDCQHFVLSLSDYCFHIGIGSTWRKFQDSLTEIETCLDKG.............
A1CPI0_ASPCL/179-855...................RNLFQRFRIDCQHFILTLSDYSFHIGVGATWRRFQETLSRTEECLEHS.............
Q4WSG8_ASPFU/170-850...................RSLFQRFRIDCQHFVLAVSDYCFHVGVGSSWQSFQATLSRIEYCLEQG.............
Q2H076_CHAGB/195-897...................SNASRRFRIEATRFIHHIAAYFFDIGIKQPWARFEAWL..DGVQAETEAEVEADECRDGVS
A0A0D1BZI3_USTMA/198-1067..............FDFRTRSVMQQFRWELNHFLDCFGGFVEEVGIESHWSGFMHR</