Sequence alignment for CL0541

PF14633

SPT6_YEAST/1219-1438SKDPSIWDLKQELEDAEEERKLMMAEARAKRTHRVINHPYYFPFNG-----RQAEDYLRS------KERGEFVIRQSSR-
SPT6H_HUMAN/1296-1515.PKDTYYDFDAEAADHKQEEDMKRKQQRTTYIKRVIAHPSFHNINF-----KQAEKMMET------MDQGDVIIRPSSK-
SPT6_SCHPO/1133-1355SHRTSYWDTEAEKRDTERMQAETQAEQR...VARVIKHPLFKDLNA-----SQAEAYLSK------MQVGDLVIRPSSK-
SPT6H_DANRE/1287-1506.PKDTYYDFDAETDDVKQEEEQKKKQQRTTYIKRVIAHPSFHNINF-----KQAEKMMES------MDQGDVVIRPSSK-

PF00017

ZAP70_MOUSE/10-87------F--------------------------------FYGSISR.....AEAEEHLKL....AGMADGLFLLRQCLR.
BLK_MOUSE/118-199------W--------------------------------FFRTISR.....KDAERQLLA....PMNKAGSFLIRESES.
PLCG2_HUMAN/532-617------W--------------------------------FHKKVEK....RTSAEKLLQEYCMETGGKDGTFLVRESET.
FES_MOUSE/460-530------W--------------------------------YHGAIPR.....AEVAELLTH........SGDFLVRESQG.
SHC1_HUMAN/488-559------W--------------------------------FHGKLSR.....REAEALLQL........NGDFLVRESTT.
BTK_HUMAN/281-362------W--------------------------------YSKHMTR.....SQAEQLLKQ.....EGKEGGFIVRDSS..
SRC_RSVP/148-230------W--------------------------------YFGKITR.....RESERLLLN....PENPRGTFLVRKSET.
YES_XIPHE/159-241------W--------------------------------YFGKLSR.....KDTERLLLL....PGNERGTFLIRESET.
HCK_MOUSE/142-224------W--------------------------------FFKGISR.....KDAERHLLA....PGNMLGSFMIRDSET.
LCK_CHICK/126-208------W--------------------------------FFKNLSR.....KNAEARLLA....SGNTHGSFLIRESET.
LCK_MOUSE/127-209------W--------------------------------FFKNLSR.....KDAERQLLA....PGNTHGSFLIRESES.
LYN_MOUSE/129-211------W--------------------------------FFKDITR.....KDAERQLLA....PGNSAGAFLIRESET.
FPS_DROME/960-1032------W--------------------------------FHGVLPR.....EEVVRLLNN........DGDFLVRETIRN
BTKL_DROME/410-488------W--------------------------------YVGDMSR.....QRAESLLKQ.....GDKEGCFVVRKSS..
ABL1_CAEEL/194-269------W--------------------------------YHGKISR.....SDSEAILGS......GITGSFLVRESET.
ABL2_HUMAN/173-248------W--------------------------------YHGPVSR.....SAAEYLLSS......LINGSFLVRESES.
CRKL_HUMAN/14-88------W--------------------------------YMGPVSR.....QEAQTRLQG......QRHGMFLVRDSST.
CSK_CHICK/82-156------W--------------------------------FHGKITR.....EQAERLLYP......PETGLFLVRESTN.
CSW_DROME/6-81------W--------------------------------FHPTISG.....IEAEKLLQE.....QGFDGSFLARLSSS.
CSW_DROME/111-186------W--------------------------------FHGNLSG.....KEAEKLILE.....RGKNGSFLVRESQS.
MATK_HUMAN/122-196------W--------------------------------FHGKISG.....QEAVQQLQP......PEDGLFLVRESAR.
DRK_DROME/60-134------W--------------------------------YYGRITR.....ADAEKLLSN......KHEGAFLIRISES.
FER_HUMAN/460-531------W--------------------------------YHGAIPR.....IEAQELLK........KQGDFLVRESHG.
FGR_HUMAN/144-226------W--------------------------------YFGKIGR.....KDAERQLLS....PGNPQGAFLIRESET.
FPS_FUJSV/511-581------W--------------------------------YHGAIPR.....SEVQELLKY........SGDFLVRESQG.
FRK_HUMAN/116-193------W--------------------------------FFGAIGR.....SDAEKQLLY....SENKTGSFLIRESES.
GRB2_CHICK/60-135------W--------------------------------FFGKIPR.....AKAEEMLGK.....QRHDGAFLIRESES.
RASA1_HUMAN/181-256------W--------------------------------YHGKLDR.....TIAEERLRQ.....AGKSGSYLIRESDR.
RASA1_HUMAN/351-426------W--------------------------------FHGKISK.....QEAYNLLMT.....VGQVCSFLVRPSDN.
ITK_HUMAN/239-323------W--------------------------------YNKSISR.....DKAEKLLLD.....TGKEGAFMVRDSR..
NCK1_HUMAN/282-356------W--------------------------------YYGKVTR.....HQAEMALNE.....RGHEGDFLIRDSES.
P85A_HUMAN/624-698------W--------------------------------NVGSSNR.....NKAENLLRG......KRDGTFLVRESS..
P85B_BOVIN/326-401------W--------------------------------YWGDISR.....EEVNEKLRD......TPDGTFLVRDASSK
P85B_BOVIN/618-692------W--------------------------------YVGKINR.....TQAEEMLSG......KRDGTFLIRESS..
PLCG1_RAT/550-639------W--------------------------------FHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESET.
PLCG1_RAT/668-741------W--------------------------------YHASLTR.....AQAEHMLMR.....VPRDGAFLVRKRNE.
PLCG2_RAT/646-720------W--------------------------------YYDRLSR.....GEAEDMLMR.....IPRDGAFLIRKREG.
PTN6_MOUSE/4-79------W--------------------------------FHRDLSG.....PDAETLLKG.....RGVPGSFLARPSRK.
PTN6_MOUSE/110-194------W--------------------------------YHGHISG.....GQAESLLQA.....KGEPWTFLVRESLS.
PTN11_MOUSE/6-81------W--------------------------------FHPNITG.....VEAENLLLT.....RGVDGSFLARPSKS.
SEM5_CAEEL/60-136------W--------------------------------YLGKITR.....NDAEVLLKK....PTVRDGHFLVRQCES.
SPK1_DUGTI/100-184------E--------------------------------AWREIQR.....WEAEKSLMK....IGLQKGTYIIRPSR..
SPT6_YEAST/1258-1339------Y--------------------------------YFPFNGR......QAEDYLRS......KERGEFVIRQSSR.
SRC64_DROME/162-244------W--------------------------------FFENVLR.....KEADKLLLA....EENPRGTFLVRPSEH.
SRK1_SPOLA/122-199------W--------------------------------FLGKIKR.....VEAEKMLNQ....SFNQVGSFLIRDSET.
SRK4_SPOLA/122-199------W--------------------------------FFGQVKR.....VDAEKQLMM....PFNNLGSFLIRDSDT.
STAT3_MOUSE/584-674------Y--------------------------------IMGFISK......ERERAILS.....TKPPGTFLLRFSESS
STAT4_MOUSE/570-646------W--------------------------------IDGYIMGF..VSKEKERLLLK.....DKMPGTFLLRFSES.
STA5A_SHEEP/589-670------W--------------------------------NDGAILGFV.NKQQAHDLLIN......KPDGTFLLRFSDS.
STAT6_HUMAN/537-616------L--------------------------------IIGFISK.....QYVTSLLLN......EPDGTFLLRFSDS.
STK_HYDVU/126-203------W--------------------------------YFGDVKR.....AEAEKRLMV....RGLPSGTFLIRKAET.
KSYK_HUMAN/15-92------F--------------------------------FFGNITR.....EEAEDYLVQ....GGMSDGLYLLRQSRN.
KSYK_PIG/163-238------W--------------------------------FHGKISR.....DESEQIVLI....GSKTNGKFLIRARDN.
TEC_MOUSE/246-329------W--------------------------------YCRNTNR.....SKAEQLLRT.....EDKEGGFMVRDSS..
TXK_HUMAN/150-231------W--------------------------------YHRNITR.....NQAEHLLRQ.....ESKEGAFIVRDSR..
VAV_MOUSE/671-745------W--------------------------------YAGPMER.....AGAEGILTN......RSDGTYLVRQRVK.
KIN31_CAEEL/20-101------Y--------------------------------FHGLIQR.....EDVFQLLDN........NGDYVVRLSDP.
ZAP70_HUMAN/163-239------W--------------------------------YHSSLTR.....EEAERKLYS....GAQTDGKFLLRPRKE.

PF14633

SPT6_YEAST/1219-1438GDDH---LVITWKLDK--------DLFQHIDIQELEKENPLALGKVLIVD......NQK--YNDLDQIIVEYLQNKVRLL
SPT6H_HUMAN/1296-1515GENH---LTVTWKVSD--------GIYQHVDVREEGKENAFSLGATLWIN......SEE--FEDLDEIVARYVQPMASFA
SPT6_SCHPO/1133-1355GSDH---IVVTWKVAE--------GSYQHIDVLELEKENEFTIGQKLLVKGRFEKMTYQ--YSDLDELIVLHIKAIAKKI
SPT6H_DANRE/1287-1506GENH---LTVTWKVAD--------GIYQHVDVREEGKENAFSLGHTLWIN......TEE--FEDLDEITARYVQPMAAFA

PF00017

ZAP70_MOUSE/10-87SLGG...YVLSLVHDV.........RFHHFPIERQLNG.......TYAIAG-----GKA..HCGPAELCQFY--------
BLK_MOUSE/118-199NKGA...FSLSVKDITTQ.....GEVVKHYKIRSLDNG.......GYYISP-----RIT..FPTLQALVQHY--------
PLCG2_HUMAN/532-617FPND...YTLSFWRSG.........RVQHCRIRSTMEGG....TLKYYLTD-----NLT..FSSIYALIQHY--------
FES_MOUSE/460-530KQ.E...YVLSVMWDG.........QPRHFIIQSSDN.........LYRLE-----GDG..FPSIPLLITHL--------
SHC1_HUMAN/488-559TPGQ...YVLTGLQSG.........QPKH.LLLVDPEG........VVRTK-----DHR..FESVSHLISYH--------
BTK_HUMAN/281-362KAGK...YTVSVFAKSTGD...PQGVIRHYVVCSTPQS.......QYYLAE-----KHL..FSTIPELINYH--------
SRC_RSVP/148-230AKGA...YCLSVSDFDNA....KGPNVKHYKIYKLYSG.......GFYITS-----RTQ..FGSLQQLVAYY--------
YES_XIPHE/159-241TKGA...YSLSLRDWDET....KGDNCKHYKIRKLDNG.......GYYITT-----RTQ..FMSLQMLVKHY--------
HCK_MOUSE/142-224TKGS...YSLSVRDFDPQ....HGDTVKHYKIRTLDSG.......GFYISP-----RST..FSSLQELVLHY--------
LCK_CHICK/126-208SKGS...YSLSVRDFDQN....QGETVKHYKIRNMDNG.......GYYISP-----RVT..FSSLHELVEYY--------
LCK_MOUSE/127-209TAGS...FSLSVRDFDQN....QGEVVKHYKIRNLDNG.......GFYISP-----RIT..FPGLHDLVRHY--------
LYN_MOUSE/129-211LKGS...FSLSVRDYDPM....HGDVIKHYKIRSLDNG.......GYYISP-----RIT..FPCISDMIKHY--------
FPS_DROME/960-1032EESQ...IVLSVCWNG..........HKHFIVQTTGEG........NFRFE-----GPP..FASIQELIMHQ--------
BTKL_DROME/410-488TKGL...YTLSLHTKVP......QSHVKHYHIKQNARC.......EYYLSE-----KHC..CETIPDLINYH--------
ABL1_CAEEL/194-269SIGQ...YTISVRHDG.........RVFHYRINVDNTE.......KMFITQ-----EVK..FRTLGELVHHH--------
ABL2_HUMAN/173-248SPGQ...LSISLRYEG.........RVYHYRINTTADG.......KVYVTA-----ESR..FSTLAELVHHH--------
CRKL_HUMAN/14-88CPGD...YVLSVSENS.........RVSHYIINSLPNR........RFKIG-----DQE..FDHLPALLEFY--------
CSK_CHICK/82-156YPGD...YTLCVSCEG.........KVEHYRIIYSSSK........LSIDE-----EVY..FENLMQLVEHY--------
CSW_DROME/6-81NPGA...FTLSVRRGN.........EVTHIKIQNNGDF........FDLYG-----GEK..FATLPELVQYY--------
CSW_DROME/111-186KPGD...FVLSVRTDD.........KVTHVMIRWQDKK........YDVGG-----GES..FGTLSELIDHY--------
MATK_HUMAN/122-196HPGD...YVLCVSFGR.........DVIHYRVLHRDG........HLTIDE-----AVF..FCNLMDMVEHY--------
DRK_DROME/60-134SPGD...FSLSVKCPD.........GVQHFKVLRDAQS........KFFLW-----VVK..FNSLNELVEYH--------
FER_HUMAN/460-531KPGE...YVLSVYSDG.........QRRHFIIQYVDNM.........YRFE-----GTG..FSNIPQLIDHH--------
FGR_HUMAN/144-226TKGA...YSLSIRDWDQT....RGDHVKHYKIRKLDMG.......GYYITT-----RVQ..FNSVQELVQHY--------
FPS_FUJSV/511-581KQ.E...YVLSVLWDG.........QPRHFIIQAADN.........LYRLE-----DDG..LPTIPLLIDHL--------
FRK_HUMAN/116-193QKGE...FSLSVLDGA.........VVKHYRIKRLDEG.......GFFLTR-----RRI..FSTLNEFVSHY--------
GRB2_CHICK/60-135APGD...FSLSVKFGN.........DVQQFKVLRDGAG........KYLLW-----VVK..FNSLNELVDYH--------
RASA1_HUMAN/181-256RPGS...FVLSFLSQM........NVVNHFRIIAMCGD........YYIGG-----.RR..FSSLSDLIGYY--------
RASA1_HUMAN/351-426TPGD...YSLYFRTNE.........NIQRFKICPTPN........NQFMMG-----GRY..YNSIGDIIDHY--------
ITK_HUMAN/239-323TAGT...YTVSVFTKAVVS..ENNPCIKHYHIKETNDNP.....KRYYVAE-----KYV..FDSIPLLINYH--------
NCK1_HUMAN/282-356SPND...FSVSLKAQG.........KNKHFKVQLKET.........VYCIG-----QRK..FSTMEELVEHY--------
P85A_HUMAN/624-698KQGC...YACSVVVDG.........EVKHCVINKTATG.........YGFA-----EPYNLYSSLKELVLHY--------
P85B_BOVIN/326-401IQGE...YTLTLRKGG.........NNKL.IKVFHRDG........HYGFS-----EPL.TFCSVVDLITHY--------
P85B_BOVIN/618-692QRGC...YACSVVVDG.........DTKHCVIYRTATG.........FGFA-----EPYNLYGSLKELVLHY--------
PLCG1_RAT/550-639FVGD...YTLSFWRNG.........KVQHCRIHSRQDAG....TPKFFLTD-----NLV..FDSLYDLITHY--------
PLCG1_RAT/668-741.PNS...YAISFRAEG.........KIKHCRVQQEGQT........VMLGN-----SE...FDSLVDLISYY--------
PLCG2_RAT/646-720TD.S...YAITFRARG.........KVKHCRINRDGR........HFVLGT-----SAY..FESLVELVSYY--------
PTN6_MOUSE/4-79NQGD...FSLSVRVDD.........QVTHIRIQNSGDF........YDLYG-----GEK..FATLTELVEYY--------
PTN6_MOUSE/110-194QPGD...FVLSVLNDQPKAGPGSPLRVTHIKVMCEGGR........YTVGG-----SET..FDSLTDLVEHF--------
PTN11_MOUSE/6-81NPGD...FTLSVRRNG.........AVTHIKIQNTGDY........YDLYG-----GEK..FATLAELVQYY--------
SEM5_CAEEL/60-136SPGE...FSISVRFQD.........SVQHFKVLRDQNG........KYYLW-----AVK..FNSLNELVAYH--------
SPK1_DUGTI/100-184KENS...YALSVRDFDEKK...KICIVKHFQIKTLQDE......KGISYSV-----NIR.NFPNILTLIQFY--------
SPT6_YEAST/1258-1339GDDH...LVITWKLDK........DLFQHIDIQELEKENPL.ALGKVLIVD-----NQK..YNDLDQIIVEY--------
SRC64_DROME/162-244NPNG...YSLSVKDWEDG....RGYHVKHYRIKPLDNG.......GYYIAT-----NQT..FPSLQALVMAY--------
SRK1_SPOLA/122-199TPGD...FSLSVKDQD.........RVRHYRVRRLEDG.......SLFVTR-----RST..FQILHELVDHY--------
SRK4_SPOLA/122-199TPGD...FSLSVRDID.........RVRHYRIKKLENG.......TYFVTR-----RLT..FQSIQELVAYY--------
STAT3_MOUSE/584-674KEGG...VTFTWVEKDISGK.TQIQSVEPYTKQQLNNMSFAEIIMGYKIMD-----.AT..NILVSPLVYLY--------
STAT4_MOUSE/570-646HLGG...ITFTWVDQS.........ENGEVRFHSVEP..........YNKG-----RLS..ALAFADILRDY--------
STA5A_SHEEP/589-670EIGG...ITIAWKFDSP.......DRNLWNLKPFTTRE.......GSIRSL-----ADR..LGDLNYLIYVF--------
STAT6_HUMAN/537-616EIGG...ITIAHVIRGQD....GSPQIENIQPFSAKDL........SIRSL-----GDR..IRDLAQLKNLY--------
STK_HYDVU/126-203AVGN...FSLSVRDGD.........SVKHYRVRKLDTG.......GYFITT-----RAP..FNSLYELVQHY--------
KSYK_HUMAN/15-92YLGG...FALSVAHGR.........KAHHYTIERELNG.......TYAIAG-----GRT..HASPADLCHYH--------
KSYK_PIG/163-238..GS...YALGLLHEG.........KVLHYRIDKDKTG.......KLSIPG-----GKN..FDTLWQLVEHY--------
TEC_MOUSE/246-329QPGL...YTVSLYTKFGGE...GSSGFRHYHIKETATSP.....KKYYLAE-----KHA..FGSIPEIIEYH--------
TXK_HUMAN/150-231HLGS...YTISVFMGARRS...TEAAIKHYQIKKNDSG.......QWYVAE-----RHA..FQSIPELIWYH--------
VAV_MOUSE/671-745DTAE...FAISIKYNV.........EVKHIKIMTSEG.........LYRIT-----EKK.AFRGLLELVEFY--------
KIN31_CAEEL/20-101KPGEPRSYILSVMFNNKLD...ENSSVKHFVINSVENK........YFVNN-----NMS..FNTIQQMLSHY--------
ZAP70_HUMAN/163-239.QGT...YALSLIYGK.........TVYHYLISQDKAG.......KYCIPE-----GTK..FDTLWQLVEYL--------

PF14633

SPT6_YEAST/1219-1438NEMTSSEKFKS...GTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNY
SPT6H_HUMAN/1296-1515RDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEY..VTVTPEGFRYRGQIF
SPT6_SCHPO/1133-1355DEMCIHDKFRK...GTQAETEKWLESYSEANPKRSCYAFCFDHQHPGYFILCFKASVNSPVTAWPVKVIPNAFFLQGNVY
SPT6H_DANRE/1287-1506RDLLGHKYFHECNGGDRKKMEELLVRTKKEKPTFIPYYISACRDLPGKFLLGYQPRGKPRIEY..VTITPDGFRYRSQIF

PF00017

ZAP70_MOUSE/10-87--------------------------------------------------------------------------------
BLK_MOUSE/118-199--------------------------------------------------------------------------------
PLCG2_HUMAN/532-617--------------------------------------------------------------------------------
FES_MOUSE/460-530--------------------------------------------------------------------------------
SHC1_HUMAN/488-559--------------------------------------------------------------------------------
BTK_HUMAN/281-362--------------------------------------------------------------------------------
SRC_RSVP/148-230--------------------------------------------------------------------------------
YES_XIPHE/159-241--------------------------------------------------------------------------------
HCK_MOUSE/142-224--------------------------------------------------------------------------------
LCK_CHICK/126-208--------------------------------------------------------------------------------
LCK_MOUSE/127-209--------------------------------------------------------------------------------
LYN_MOUSE/129-211--------------------------------------------------------------------------------
FPS_DROME/960-1032--------------------------------------------------------------------------------
BTKL_DROME/410-488--------------------------------------------------------------------------------
ABL1_CAEEL/194-269--------------------------------------------------------------------------------
ABL2_HUMAN/173-248--------------------------------------------------------------------------------
CRKL_HUMAN/14-88--------------------------------------------------------------------------------
CSK_CHICK/82-156--------------------------------------------------------------------------------
CSW_DROME/6-81--------------------------------------------------------------------------------
CSW_DROME/111-186--------------------------------------------------------------------------------
MATK_HUMAN/122-196--------------------------------------------------------------------------------
DRK_DROME/60-134--------------------------------------------------------------------------------
FER_HUMAN/460-531--------------------------------------------------------------------------------
FGR_HUMAN/144-226--------------------------------------------------------------------------------
FPS_FUJSV/511-581--------------------------------------------------------------------------------
FRK_HUMAN/116-193--------------------------------------------------------------------------------
GRB2_CHICK/60-135--------------------------------------------------------------------------------
RASA1_HUMAN/181-256--------------------------------------------------------------------------------
RASA1_HUMAN/351-426--------------------------------------------------------------------------------
ITK_HUMAN/239-323--------------------------------------------------------------------------------
NCK1_HUMAN/282-356--------------------------------------------------------------------------------
P85A_HUMAN/624-698--------------------------------------------------------------------------------
P85B_BOVIN/326-401--------------------------------------------------------------------------------
P85B_BOVIN/618-692--------------------------------------------------------------------------------
PLCG1_RAT/550-639--------------------------------------------------------------------------------
PLCG1_RAT/668-741--------------------------------------------------------------------------------
PLCG2_RAT/646-720--------------------------------------------------------------------------------
PTN6_MOUSE/4-79--------------------------------------------------------------------------------
PTN6_MOUSE/110-194--------------------------------------------------------------------------------
PTN11_MOUSE/6-81--------------------------------------------------------------------------------
SEM5_CAEEL/60-136--------------------------------------------------------------------------------
SPK1_DUGTI/100-184--------------------------------------------------------------------------------
SPT6_YEAST/1258-1339--------------------------------------------------------------------------------
SRC64_DROME/162-244--------------------------------------------------------------------------------
SRK1_SPOLA/122-199--------------------------------------------------------------------------------
SRK4_SPOLA/122-199--------------------------------------------------------------------------------
STAT3_MOUSE/584-674--------------------------------------------------------------------------------
STAT4_MOUSE/570-646--------------------------------------------------------------------------------
STA5A_SHEEP/589-670--------------------------------------------------------------------------------
STAT6_HUMAN/537-616--------------------------------------------------------------------------------
STK_HYDVU/126-203--------------------------------------------------------------------------------
KSYK_HUMAN/15-92--------------------------------------------------------------------------------
KSYK_PIG/163-238--------------------------------------------------------------------------------
TEC_MOUSE/246-329--------------------------------------------------------------------------------
TXK_HUMAN/150-231--------------------------------------------------------------------------------
VAV_MOUSE/671-745--------------------------------------------------------------------------------
KIN31_CAEEL/20-101--------------------------------------------------------------------------------
ZAP70_HUMAN/163-239--------------------------------------------------------------------------------

PF14633

SPT6_YEAST/1219-1438PSVIQLCNGFKTLL
SPT6H_HUMAN/1296-1515PTVNGLFRWFKDHY
SPT6_SCHPO/1133-1355GDMTALCNGFKLLY
SPT6H_DANRE/1287-1506PTVNGLFRWFKDHY

PF00017

ZAP70_MOUSE/10-87--------------
BLK_MOUSE/118-199--------------
PLCG2_HUMAN/532-617--------------
FES_MOUSE/460-530--------------
SHC1_HUMAN/488-559--------------
BTK_HUMAN/281-362--------------
SRC_RSVP/148-230--------------
YES_XIPHE/159-241--------------
HCK_MOUSE/142-224--------------
LCK_CHICK/126-208--------------
LCK_MOUSE/127-209--------------
LYN_MOUSE/129-211--------------
FPS_DROME/960-1032--------------
BTKL_DROME/410-488--------------
ABL1_CAEEL/194-269--------------
ABL2_HUMAN/173-248--------------
CRKL_HUMAN/14-88--------------
CSK_CHICK/82-156--------------
CSW_DROME/6-81--------------
CSW_DROME/111-186--------------
MATK_HUMAN/122-196--------------
DRK_DROME/60-134--------------
FER_HUMAN/460-531--------------
FGR_HUMAN/144-226--------------
FPS_FUJSV/511-581--------------
FRK_HUMAN/116-193--------------
GRB2_CHICK/60-135--------------
RASA1_HUMAN/181-256--------------
RASA1_HUMAN/351-426--------------
ITK_HUMAN/239-323--------------
NCK1_HUMAN/282-356--------------
P85A_HUMAN/624-698--------------
P85B_BOVIN/326-401--------------
P85B_BOVIN/618-692--------------
PLCG1_RAT/550-639--------------
PLCG1_RAT/668-741--------------
PLCG2_RAT/646-720--------------
PTN6_MOUSE/4-79--------------
PTN6_MOUSE/110-194--------------
PTN11_MOUSE/6-81--------------
SEM5_CAEEL/60-136--------------
SPK1_DUGTI/100-184--------------
SPT6_YEAST/1258-1339--------------
SRC64_DROME/162-244--------------
SRK1_SPOLA/122-199--------------
SRK4_SPOLA/122-199--------------
STAT3_MOUSE/584-674--------------
STAT4_MOUSE/570-646--------------
STA5A_SHEEP/589-670--------------
STAT6_HUMAN/537-616--------------
STK_HYDVU/126-203--------------
KSYK_HUMAN/15-92--------------
KSYK_PIG/163-238--------------
TEC_MOUSE/246-329--------------
TXK_HUMAN/150-231--------------
VAV_MOUSE/671-745--------------
KIN31_CAEEL/20-101--------------
ZAP70_HUMAN/163-239--------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window