Sequence alignment for CL0543

PF01589

POLS_SFV/751-1253PRAHAASVAETMAYLWDQNQALFWLEFAAPVACILIITYCLRNVLCCCKSLSFLVLLSLG.ATARAYEHSTVMPNVVGFP
POLS_CHIKS/744-1247RTAKAATYQEAAVYLWNEQQPLFWLQALIPLAALIVLCNCLRLLPCCCKTLAFLAVMSIGAHTVSAYEHVTVIPNTVGVP

PF00869

POLG_DEN1W/282-576--------------------------------------RCVGI-----GNRDFVEGLSGATWVDVVLEHGSCVTTMAK--
POLG_YEFV1/287-579--------------------------------------HCIGI-----TDRDFIEGVHGGTWVSATLEQDKCVTVMAP--

PF01589

POLS_SFV/751-1253YKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYVKCCGASECS--TKEKPDYQCKVYTGVYPFMWGGA
POLS_CHIKS/744-1247YKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECK--DKNLPDYSCKVFTGVYPFMWGGA

PF00869

POLG_DEN1W/282-576-----DKP-----TLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCR-------------
POLG_YEFV1/287-579-----DKP-----SLDISLETVAIDRPAEVRKVCYNAVLTHVKINDKCPSTGEAHLAEENEGDNACK-------------

PF01589

POLS_SFV/751-1253YCFCDSENTQLSEAYVDRSDVCRHDHASAYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTP
POLS_CHIKS/744-1247YCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYANGDHAVTVKDAKFIVGPMSSAWTP

PF00869

POLG_DEN1W/282-576------------RTFVDRG-------------------------------------WGNGCGLFGKGSLITCAKFKCVTK
POLG_YEFV1/287-579------------RTYSDRG-------------------------------------WGNGCGLFGKGSIVACAKFTCAKS

PF01589

POLS_SFV/751-1253FDNKIVVYKDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGFKYWLKEKGTALN
POLS_CHIKS/744-1247FDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAAGTVHVPYSQAPSGFKYWLKERGASLQ

PF00869

POLG_DEN1W/282-576LEGKIVQYENLKYSVIVTVH-------TGDQHQVGNETTEHGTTATITPQAPTSEIQLTDYG------------------
POLG_YEFV1/287-579MSLFEVDQTKIQYVIRAQLH-------VGAKQENWNTDIK...TLKFDALSGSQEVEFIGYG------------------

PF01589

POLS_SFV/751-1253TKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHS
POLS_CHIKS/744-1247HTAPFGCQIATNPVRAMNCAVGNMPISIDIPDAAFTRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAVSKKGKCAVHS

PF00869

POLG_DEN1W/282-576-ALTLDCSPRT------GLDFNEMVL-LTMEKKSW--LVHKQWFLDLP--LPWTSGASTSQETWN-----------RQDL
POLG_YEFV1/287-579-KATLECQVQT------AVDFGNSYI-AEMETESW--IVDRQWAQDLT--LPWQSG...SGGVWR-----------EMHH

PF01589

POLS_SFV/751-1253HSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQK
POLS_CHIKS/744-1247MTNAVTIREAEIEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQDISATAMSWVQK

PF00869

POLG_DEN1W/282-576LVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEI----------------------------------QTSGTT.....T
POLG_YEFV1/287-579LVEFEPPHAATIRVLALGNQEGSLKTALTGAMRV----------------------------------.TKDTNDNNLYK

PF01589

POLS_SFV/751-1253ISGGLGAFAIGAILVLVVVTCIGLRR
POLS_CHIKS/744-1247ITGGVGLVVAVAALILIVVLCVSFSR

PF00869

POLG_DEN1W/282-576IFAG-------HLKCRLKMDKLTLKG
POLG_YEFV1/287-579LHGG-------HVSCRVKLSALTLKG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window