Sequence alignment for CL0545

PF14807

E7FEH2_DANRE/1016-1117-------------------PLV--VTTDEYGKLWLS.LS-HDVKQN-LKLLT--------DAGDPLQTT..L.NAL-K-D
I7MG35_TETTS/799-898-------------------PIN--INVEQYENYWEQ.FR-FEENQD-IK...--------SNKVKTEYE..F.RNM-L-T
M3ZX44_XIPMA/1022-1123-------------------ALR--LSTEEYGAMWLA.FS-HDTKQN-LTLIH--------DGQDPLAAT..L.DVL-K-R
E1BR26_CHICK/1041-1141-------------------PMK--MTTEDFGKLWLS.LS-NDVKQN-IKM.P--------SSQDSISAA..L.SVL-H-Q
G3NRF7_GASAC/1039-1140-------------------PLT--VSTEEYGTMWLD.FS-HDTKQK-LTPIC--------LGQEPLMDT..L.NVL-K-K
Q583N8_TRYB2/922-1020-------------------..S--MTTDTFGEMWLK.YI-GEYKTT-LH...--------GTAALTLES..ISQLL-M-E
Q4DVU3_TRYCC/908-1005-------------------PAQ--MTTAEFGQTWVG.LR-EECKLQ-MS...--------SAAPLTPQS..LQNLL-L-E
E2RJS0_CANFA/1021-1121-------------------PLK--ISTENFGKLWLS.FA-NDVKQN-VKV.S--------ESQAALSSA..L.KTL-Q-Q
H2LLU4_ORYLA/1029-1130-------------------PLT--VSTEEYGSMWLA.FS-HDTKQN-LTLIK--------EEREPLTAT..L.NAL-N-K
F7E721_XENTR/1013-1111-------------------PLS--ISTEEFGIMWPS.HS-NELKRK-LTV..--------.GQQSFTGT..L.HNL-Q-R
W5N705_LEPOC/934-1035-------------------PLK--VSTEEYGKLWLS.CT-HDVKQN-LKLLS--------DQINSLVTP..L.NAL-K-Q
A2DQQ6_TRIVA/902-1002-------------------PQT--ATTNEFGAAWKS.GG-SELVLS-LQ...--------KKDGMTLDD..ISAAL-N-N
A0BKM3_PARTE/865-963-------------------PAN--INVDQYEQLWER.YQ-NVKEVT-LQ...--------.SRIKSEQD..F.KRM-I-Q
H3D850_TETNG/1027-1125-------------------PLA--VSTEEYGKMWLD.FS-HDTKQN-LKVMG--------DG...LADT..L.QVL-T-N
D3BA10_POLPA/1109-1218-------------------PLD--IGLNQFEQTWSS.YS-QEREII-VD...--------SSLQQKSSQ..LLTCF-I-K
D3ZX21_RAT/1026-1126-------------------PLK--ISTEDFGKLWLS.FA-NDVKQN-IKI.S--------EPRVALASV..L.TEL-Q-Q
H3AE96_LATCH/1032-1133-------------------PLR--ISTEEFGKLWLS.LS-NDVKQN-LRLLS--------DTQDALTKS..L.NIL-K-Q
A7T9X2_NEMVE/77-176-------------------PLV--LTTEEFAVKWGQ.SA-FERRQT-IT...--------.CSVSSSGE..FLRRT-E-S
B5YN72_THAPS/443-550-------------------PLT--ITTPQFGERWGQ.CS-STHPFN-VP..S--------STSAGTLSQ..F.MTL-C-E
A2EQ12_TRIVA/905-1005-------------------PQQ--STTAEFGAAWKS.GG-SEIVYT-IP...--------RSEGLTIDE..VSRLM-N-L
F6U0B3_MONDO/1042-1142-------------------PMK--ICTEDFGKLWLS.SG-NDVKQN-VKM.P--------DSQANLPFA..L.KTL-Q-Q
K3W798_PYTUL/985-1087-------------------PWQ--ITTQDFGARWGT.CP-CEKKTK-VA...--------PSSIRVLDD..F.SSR-M-H
H0V753_CAVPO/1023-1123-------------------PLT--ISTEDFGKLWLS.FA-NDVKQN-VKI.P--------EPQASLLSA..L.KTL-Q-Q
H3GJ53_PHYRM/992-1091-------------------PWQ--ITTQDFGGRWGA.CP-CEQKTK-VN...--------PSGIRTLED..F.MGR-M-H
V4ZCH6_TOXGO/1010-1115-------------------PLH--TSTAEVGARWAS.LP-GEASLS-IPCVS--------ASGVTRSCQEFLTNVL-Q-Q
W5LC92_ASTMX/1065-1166-------------------PLV--LSTEEYGKLWLS.FS-NDVKKN-LPLLT--------NTGDSLLAT..L.NAL-K-D
A9V3X8_MONBE/1246-1346-------------------PLT--ISTDRFGQLWQA.TS-SQRALK-LQ...--------SRQVSSVAA..L.QQV-C-E
F2U7H5_SALR5/1178-1280-------------------PLS--LSTEEFGAMWQSQCT-AERAQM-IT...--------SSPVTTVDD..LSSSA-L-E
K0TDZ6_THAOC/987-1091-------------------PFT--ITTPQFGERWGS.CP-STHSVT-IA..S--------STNVNSLSK..F.VSL-C-V

PF09066

Q8I3I6_PLAF7/813-922-----------------VENFH--MEKDIFKKKWQI-IE.EAKESI-LMAVS...PMV..ITSDMLIKR--MKIFN.I-S
J9K6T5_ACYPI/802-910-----------------IEDGQ--MDKRVFLKTWKD-IP.AENEVQ-FTLKN...VL...CNTEAIVLK--MSQNN.V-F
G1KAG2_ANOCA/624-732-----------------..SVC--LTAEQFERTWIN-LD.VGCQQS-VPWQEMV.......PPDAIQAA--LQVVH.I-Q
T1GYI4_MEGSC/219-327-----------------AEDGQ--LDKRVFLTTWKE-IP.AANEVQ-YSLSG...VV...GNADTIANK--MTSNN.V-F
Q4UI19_THEAN/643-749-----------------VVPET--ISEEDFQTAWLE-CE.HSYSTE-MELYPNDL......NVEDFEGL--FAKLN.I-M
T1L557_TETUR/832-940-----------------VEDGS--MDKRVFLSTWKE-IP.SQNELQ-FPING...VN...LDADAISSK--LQSNN.V-F
Q0DRT9_ORYSJ/783-892-----------------GEDGK--MERTSFLEAWKS-LP.DDNEFS-KEFPS...SVV..SSIDATVEH--LAASN.V-F
U3IVS5_ANAPL/428-538-----------------IPDVY--LTAEQFEKTWLS-LD.ISCQHS-LPWGRTV.......HPDTIQTA--FHVVH.I-H
B9GKF2_POPTR/793-902-----------------TEDGR--MERGSFLESWRS-LP.DSNEVS-RDLPD...ITV..NGVESTLDR--LAASN.M-F
A0BYI5_PARTE/661-768-----------------IVNFA--IDADHFENMWTN-LN.DGATFT-RMLVRNDIA.....NETSIEQL--FKQYR.L-Y
H3GSM2_PHYRM/731-837-----------------.PTPV--MDAPTFQGQWGS-RP.VVAEVV-VQLPNLP.......PQSELEQA--FASRG.I-V
I1G9C8_AMPQE/870-979-----------------VEDGK--MDRKVFLSSWKE-LP.SSNEVQ-KTLSY...PL...ADLDSVKTK--LEANN.V-F
D7M945_ARALL/782-891-----------------SEDGR--MERGTFLETWRS-LP.DSNEVQ-KEFSG...ITI..TSVESTLDL--LAASN.M-F
V8NPR7_OPHHA/525-630-----------------.....--LTAEQFERTWLN-LA.VGCQQS-IPWQESM.......QPETLQAA--LQMVH.I-Q
B9RS58_RICCO/732-842-----------------...AA--LDPATFQQKWRQ-LP.SSVSQE-HSLSPQGAAAL..TTPQPLLRH--MQAHS.I-Q
APBLA_ARATH/725-835-----------------...AA--LDPGAFQQKWRQ-LP.ISLTQE-CSVNPQGIAAL..TVPQSLIKH--MQSHS.I-H
D8TL16_VOLCA/724-839-----------------NPKAR--VAAGAFQEEWKR-LT.PAHCST-LSVSPATVAAIVANNHRDFTQH--MTQAY.I-H
F2UJM8_SALR5/754-862-----------------TEDGK--LERGDYLRLWKD-IE.DSQESI-STVHG...VT...QATDVVLKR--LEASN.V-F
D2A641_TRICA/594-702-----------------IEDGT--LDKRVFLTTWRD-IP.SANEVQ-YTLND...LK...GNSDAISAK--MTHNN.I-F
A0CBT3_PARTE/1031-1136-----------------SSTAS--ITQQKFIELSQA-QNQARKQEV-LQIQI.........DPQRMKEK--LERNY.F-F
G8Z247_SOLLC/724-834-----------------...AA--LEPNAFQQKWRQ-LP.ISLSQE-TSISPEGVATL..ISPQTLIHH--MQGHS.I-H
K3WIX4_PYTUL/809-916-----------------TETGG--LEKTEFITMWKN-IS.EANEHY-FTIPT...GGR...SVDAVSEL--LKHSN.V-F
X6NL64_RETFI/750-853-----------------.....--VPKNDYLEKWKN-IP.QTDGQS-IQLKS...VKS..TDADVIKTT--LSKNN.C-E
F4QCH4_DICFS/828-937-----------------.EGGQ--LDRENYLSMWKS-IP.DQNERS-KDIQI..RLQQ..FDVDSISRR--LQSRN.V-F
A2DLB3_TRIVA/703-806-----------------.EHGK--INREEFNRVWPT-LN.SNDETS-FVIRE...AKV..NNPEKIKSE--LEKER.V-F
A9SX84_PHYPA/711-818-----------------...PS--LDPQAFQRKWGQ-LA.VA.STD-HTLA..NVAAL..STPQPLIRH--MQANL.V-E
B3RYW3_TRIAD/826-934-----------------VEDGK--LESREFLTQWKE-IP.NNSERS-FDINN...VP...ASSDAIENK--LKMSN.V-F
D2VMT9_NAEGR/798-909-----------------IENGS--CDRDTYLTLFQS-IP.DETEST-TDAPN...ASA..GNASALISR--LQAHN.I-F
D7SUE8_VITVI/727-838-----------------..KAV--LDPGTFQQKWRQ-LP.ISLSQD-YSMSPQGVAAL..TRPQAFLRH--MQGHS.I-H
H2ZG85_CIOSA/53-165-----------------LEQGE--MDRKVFLTTWKD-IP.STHEKS-FALENLGSIPN..INTNTIIEK--LKANN.V-F
D8LDW2_ECTSI/826-934-----------------...GP--MGRDQFLAAWKS-VD.DSLEVS-KEAQGLPFSG....DVSAVTRK--LQERN.I-Y
Q4DHL5_TRYCC/662-771-----------------SEDPS--IEPHEFQRRWGA-LG.EKATST-LQLQLQKVP.....DTETFEEG--LEECG.I-I
W4YD47_STRPU/852-960-----------------VEDGQ--MDRKVFLATWKD-IP.PSNEVQ-AQITN...CS...MSSDQATNR--LQQNN.I-F
D8T6G5_SELML/696-805-----------------....V--LDSGTFQKKWSQ-LP.VALSFE-HPISAQ...SL..KTTQPLLRH--MQEKS.V-Q
E0VK25_PEDHC/801-909-----------------MEDGE--MDKRVFLSTWKD-IP.SQNEVQ-FTLSN...IT...LNADAIINK--MKQNN.V-F
T1FPB8_HELRO/834-941-----------------TEDGR--MDKRTYLATWKE-IP.VSDEVH-HEVDG...GML..LTSDKIQEK--LERAN.V-F
A0DI20_PARTE/830-935-----------------SSNGQ--ITQQKFVELSQA-QNYARKNEI-LQLQV.........DYQKMREK--LERNY.L-Y
I1NPU6_ORYGL/778-888-----------------...PV--LDPGTFQKKWGQ-LA.LSLSQE-CSLSPQGAASL..MNPQSLIRH--MQNNY.I-Q
K1QQ16_CRAGI/821-929-----------------VEDGE--MEKRVFLATWKD-IP.AQNEVQ-HEICN...VQ...HNADTISQK--LKNNN.V-F
F1SBR2_PIG/621-728-----------------VPNHQ--LTAECFEKTWLS-LQ.VAHQQV-LPWQGVV.......HPDTLQMA--LQVVN.I-Q
G3PIH2_GASAC/616-726-----------------...PA--LSPEEFERLWTQ-RR.APPAES-VPLHGTS.......SPQSLQAA--MQLVN.I-Q
G0QLQ6_ICHMG/869-980-----------------.STGN--ISKEEFRNTWKS-IP.DDLQKS-HNVNLLN.QSF..FNQDNLINK--LKSNN.I-Y
A0DRP1_PARTE/662-769-----------------VLDYR--IDVEYFESMWTS-LN.NGASIT-RTLARNDIA.....NENAMEQL--FNRFR.L-Y
B0V3P3_MOUSE/545-655-----------------VPNLQ--LTAEYFEKTWLS-LR.VSYQQV-FPWQGEV.......QPDTLQMA--LKVVN.I-Q
A2E742_TRIVA/740-844-----------------ESMGR--MTKAVFAEQIET-LD.PRPKPC-ITVPS...SVL..NSANDAREF--LNGKN.L-C
Q23C04_TETTS/725-835-----------------VLNFS--VDPDDYEPAWNS-LN.EGAVNT-KLVNPGVHL.....TENVVEEL--FKQHR.I-Y
E5RZZ3_TRISP/409-518-----------------ADDGQ--MDKRLFLQAWKD-IP.AENEVQ-YNIEN...VKA..LSPDGICTK--LEQNN.V-Y
B2GUA2_XENTR/836-944-----------------IEDGK--MERQMFLATWKD-IA.NENEAQ-FQIRD...CP...TGSDAVSNK--LQASN.I-F
A2FAG5_TRIVA/724-828-----------------QEGGK--FSREEFVKFWQS-LP.PSTELT-TNVEN...ARV..DSIPVAKNQ--FNSKR.L-Y
D8LNY8_ECTSI/718-824-----------------....T--INSGQFQSLWAA-LG.AGVESS-FEMSKVPA......STQEVEGL--LTARG.V-N
Q22WH8_TETTS/880-989-----------------LPDGE--LTKEDFKKFWMG-QP....ELS-FEVKNNFNKNY..YQENVIKAH--LKRNN.I-F
C3XY98_BRAFL/832-941-----------------TEDGQ--MDRKVFLATWKD-IP.DSNEVQ-KEIAN...PNQ..LDPKGISDK--LQQSF.I-F
H3BCT1_LATCH/841-950-----------------VEDGK--MERQVFLATWKD-IP.NENELQ-FQIKE...CH...LNAVTVHSK--LGKNNKV-L
A2DCQ7_TRIVA/723-827-----------------KDGGK--FTREEFVKFRQS-LP.PSAELT-TSVDN...ARV..DSIPVSKNQ--LNSKR.L-Y
W5MN72_LEPOC/838-946-----------------AEDGK--MDRQVFLATWKD-IP.NDNEAQ-FQVKD...CH...LNSEAATNK--LQSNN.V-F
Q7YZG9_CAEEL/116-225-----------------REDGQ--MEKREFLEEWKS-IP.EQNEQQ-FTLQN...THN..MNADAICTK--LQQNN.I-H
U3JLI9_FICAL/617-727-----------------IPDVS--LTAEQFEKSWLS-LD.TSCQLS-LPWCGSV.......HADTIQTA--LRVVH.I-Q
X6NIB4_RETFI/34-141-----------------TEKPK--ISPSEFMEKWTG-SS.EKEVVQ-HSWPQILR......EWSDIRDQ--LNANN.I-M
B9QK09_TOXGO/810-915-----------------.ENSS--ADKDVFRQRWQN-IG.EARQSS-LMASA...PSS..QSPQAVTKQ--MQAAN.I-S
H3DYD2_PRIPA/21-131-----------------AEDGM--MEKREFLELWKE-IP.EANEQQ-FTIMN...NRG..LTADDICTK--LQANN.V-F
I7MFM9_TETTS/866-970-----------------SLDGR--VTQDDFKTIWKS-IP.DTTHRE-QSVAFIQ.PQY..FQIESLKQK--LNDNR.I-F
D3BF27_POLPA/753-863-----------------...TE--IQPEDFQENWLN-FE.EGHRFD-IQLEKLI.......DTNEMEKL--LTSKG.I-M
D8M378_BLAHO/682-786-----------------.PNPS--TDRGTFQQKWTT-LS.EAHQET-FQIMSTPS......DPKMIEAT--LQNYN.I-A
A0A068XBU3_HYMMI/884-992-----------------TSAGE--MEKMVFLATWKD-IP.PENEQQ-FVLSP...LT...LDADTCSQK--LRSNN.I-F
A0A0D2VQ42_CAPO3/713-819-----------------VPNAT--LDPQNFENLWFA-TT.NSVEAA-MTLSVVP.......TMAELERT--FAANN.I-A
M4B2Y6_HYAAE/809-916-----------------TEGGS--MGSTDFISMWQG-IA.EANEHY-FTLTT...GGR...SVDALSEQ--LGRNN.V-F
D8LJ03_ECTSI/311-418-----------------SEDEV--MMPHAFERLWGA-FE.PQGEFQ-THITQSV.......PQTTVVRH--LNDRG.F-Q
A9VBI8_MONBE/764-872-----------------VEEGR--LPKKDYLTLWRE-ID.DDAESV-AMIGN...VS...GDADACIAK--LEANN.V-F
B7S4C6_PHATC/774-888-----------------SSDGA--MERSSFIENWKS-ID.DRNELY-ATVGD...LPSESVDIDLVQQK--FQASN.V-F
W5MVZ4_LEPOC/612-721-----------------...PA--LSPELFEKRWLE-LE.SAHIQT-LACRQPGS......SPETLQAA--LQLVK.I-Q
A5PMS9_DANRE/837-945-----------------VEDGK--MERQVFLATWKD-IP.NDNEAQ-FQIKD...VH...LNSDAASNK--LQGSN.I-F
I1JAF7_SOYBN/780-889-----------------TEDGR--MERSSFLETWRS-LP.DSNEVS-KDFPA...IVI..GSADATVER--LAASN.M-F
E2BIE2_HARSA/186-294-----------------TEDGQ--LDKRVFLSTWKD-IP.AQNEVQ-YTLNG...VM...LTADQVVQK--MQQNN.V-F
A2DRG8_TRIVA/716-820-----------------TDGAK--LSRNDFVTVWQS-IP.PQNDLT-KTLDK...ARI..DSISVAKNI--LNPNR.I-Y
M0RZM5_MUSAM/724-836-----------------..KAA--LDPGTFQRKWGQ-LA.VSISQD-CSVSPQGIAAL..TTPQALIRH--MQASS.I-Q
M0U680_MUSAM/792-901-----------------GEDGR--MERANFLETWKS-LP.ESNEVG-KDLSN...SII..HSVDATIEH--LTASN.V-F
Q4UE05_THEAN/764-873-----------------KHDAK--VSRSDFESLWQR-LQPKEFNHN-YHHKYTKQRNT..DGGRGIVKA--LQNYG.L-Y
Q38A51_TRYB2/655-766-----------------SVDAS--MELHEFEHRWIS-LG.DSVVTT-ANMQLRLRSVP...DMEMFEDA--LDVCG.V-V
A4RVK7_OSTLU/672-777-----------------...PA--LDSTSFQMKWTS-AAVVATGLQ-ATLRSNALA.....SAAQVTQH--LAPRG.V-A
B7Q6V9_IXOSC/828-936-----------------TEDGL--MDKRVFLATWKD-IP.AQNEVQ-YTLDN...VN...LTADQVSQK--LQNNN.I-F
H3B7P3_LATCH/616-723-----------------...LK--LSPEQFECSWRE-LE.AVCCVT-IEWQGDV.......HPDIMQSA--LQVVN.I-H
W4ZPC2_WHEAT/22-131-----------------....V--LDPRDFQNKWSQ-LA.LSVSQE-CSLTPQGAASL..MNPQSLIRH--MQSNY.I-Q
A2DH87_TRIVA/726-830-----------------KEGGK--LAREDFISVWQS-IP.SSNELT-TVVNN...ARV..DSIPVAKNQ--LAGKR.L-Y
Q4YJB5_PLABA/105-213-----------------....N--ITPEQYQEQWNL-LP.EQNNEK-LFLRKNYYNL....QLESLDEL--ISRYN.I-I
F1KSB8_ASCSU/880-988-----------------DENGQ--MDKREFLQLWKE-IP.EQNELQ-FSINN...TQG..LNADDICTK--LQQNN.V-F
W1NY12_AMBTC/790-899-----------------TEDGR--MERANFLETWKS-LP.DSNEIV-KELTA...SLI..NNVDVTLDK--LAASN.L-F
F1QV11_DANRE/615-719-----------------...AA--VSPEAFEQMWQQ-LE.VLQRQT-VCFSGC........AADTLQSA--LQPVH.I-Q
H0UVW0_CAVPO/622-732-----------------IPNCQ--FTAEYFEKTWLS-LE.VAHQQI-LPWQGEV.......HPDTLQMA--LQVVN.I-Q
F0VDW7_NEOCL/814-917-----------------.....--TDKEAFRQKWQA-IG.EARQSA-LVAAA...PSN..QSPEEVTKQ--MEAAN.I-S
C5LX92_PERM5/807-914-----------------.....--INAEQFLSLWQR-CG.ADRQTS-RMATP...SQP..LNPEMVIAR--LRQGN.L-F
E9HXR5_DAPPU/18-126-----------------AEDGQ--MDKRVFLSTWKD-IP.AANEVQ-YTINN...VN...LSADAVSSK--MQQNN.V-F
X6NHG8_RETFI/234-341-----------------TDNPQ--IGSSEFIEKWTA-VP.EKDSVQ-YIWEGTTH......KWNDIRLR--LQVNN.I-I
K3WB21_PYTUL/741-848-----------------IPNPA--IDAGIFQAKWTN-CP.VVGNVA-VQLPQIP.......SQAEIEQA--FAANR.I-F
L5LZJ8_MYODS/823-931-----------------VEDGK--MDRQIFLATWKD-IP.NENEAQ-FQIRD...CP...LSAEAVSSR--LQSSN.I-F
Q8IBF8_PLAF7/746-854-----------------....S--INPEVYQTQWNA-LP.EQNNEK-IFLRKNYYNL....QLDTIDQL--ISKYN.L-I
E4XT96_OIKDI/515-624-----------------AHDGK--MDRQVFLATWKD-IP.AQNESS-STISG...VGN..LGGDAITAK--LESAN.V-F
G3I8B9_CRIGR/380-488-----------------VEDGK--MERQVFLATWKD-IP.NENELQ-FQIKE...CH...LNADTVSSK--LQNNN.V-Y
D0N2R3_PHYIT/388-490-----------------SPDAN--LAASNFWQLWKR-TE.TTGAFS-CTFANQP.......SRVELEQH--LAAHG.F-R
D7TV41_VITVI/792-901-----------------SEDGK--MERASFLEAWKS-LP.DSNEVS-KEFPG...ITV..NSLEGILDR--LAASK.V-F
A0A0D2UCE9_CAPO3/857-966-----------------GEDGE--MERSAYLSAWKE-IP.DTNERK-FTVTQ...LSS..NNPDTIQAK--LGQNN.I-S
B8C7W7_THAPS/803-917-----------------TPDGA--LERTTFIESWKS-ID.DKKELY-GTVSD...LPPASTDIDQVAAK--FKAHR.I-F
F6WLR5_MONDO/620-730-----------------VPNGQ--LTAEQFEKTWLS-LE.VAHQEV-LPWQGVA.......HPDTIQTA--LQMVN.I-Q
G7YBR2_CLOSI/427-535-----------------VEEGD--MEKRVFLATWKD-IP.SDSERQ-FTLNQ...IN...LNADACSRK--LQQNN.I-F
D8SU50_SELML/758-869-----------------GEDGK--MERQHFLETWKT-IP.DSHEFI-KELPS...VCV..NSVESAIQK--LQATN.L-F
A5KA22_PLAVS/797-905-----------------....N--INPEHYQEQWSI-LP.EQNNEK-LFLRKNYYNL....QLETIDEF--ISKYN.I-V
AP1B_DICDI/828-938-----------------TETGR--LDRESYLSMWKS-IP.ESNERS-VEIQV..RLPH..VDVDSILRR--LNSKN.I-F
F6U640_ORNAN/621-731-----------------VSPGQ--LTAEQFERSWLS-LE.VAYQQV-LPWPGPV.......HPETFQAA--LQVVN.I-Q
A9TVR6_PHYPA/787-898-----------------VEDGR--MERGTFLETWKS-LP.DSHEVA-KDLPN...AVI..TNVDATLEK--LATTN.L-F
W1NSC6_AMBTC/713-827-----------------...AV--LDPANFQRKWGQ-LA.TALSKD-CSLTPHGVASL..TTPQALLHH--MQGHS.I-Q

PF02296

AP2A2_DICDI/872-983----------------FFEPLR--LSSGDFFARWKT-ISGKPLEIQ-EIFK..........STKPIDIQ--SYNRV-IQE
Q2GV39_CHAGB/822-941----------------FMDPAE--LSAEDFFKRWKQ-IGGAPREAQ-HIFGLAATGGGSRAGEREITEG--FVRTV-V.E
A0A0D1CEI5_USTMA/864-977----------------FVEPVQ--LGANDFFERWRQ-IGGAPREAQ-KIFSFK......LSAAGQVDVA--RQRRI-L.E
Q0UJD2_PHANO/843-955----------------YQEGAE--LSAEDFFKRWKQ-IGGAPREAQ-RIFGLV.......NKNRTMNSD--FVKKV-V.A
AP2A_DROME/827-935----------------FFEPTE--MNAESFFARWKN-LSGEQQRSQ-KVFK..........AAQPLDLP--GARNK-L.M
AP2A2_BOVIN/825-933----------------FFQPTE--MASQDFFQRWKQ-LSNPQQEVQ-SIFK..........AKHPMDTE--VTKAK-I.I
Q1EQ22_ENTHI/852-954----------------FLVQEP--LEPNIFMQYWNT-IGNAT.EKK-SIIQMK........QNNPIDLP--TVL..-..G
A6RDP5_AJECN/812-923----------------YMDEST--LSPDDFFKRWRQ-IGGPPLEAQ-STFAVQ.......GKGRMITES--FTRGI-V.Q
AP2A_SCHPO/759-869----------------FMKPTI--FDSYDFFNHWGQ-MG.VEREAQ-LTFGLN.......SKDRKLDAK--RLTKI-V.S
Q5AXG4_EMENI/791-902----------------YLEPST--LTPEDFFKRWRQ-IGGGPLEAQ-NTFGLV.......AKAGGISEG--FTRRL-V.E
AP2A1_MOUSE/864-972----------------FFQPTE--MAAQDFFQRWKQ-LSLPLQEAQ-KIFK..........ANHPMDAE--VTKAK-L.L
Q6CBH9_YARLI/812-920----------------FMTASQ--VSTGDFQNRWNQ-L..ADKESR-RIFKPQ.......DISKSANPA--HNLKV-M.K
A7RH33_NEMVE/829-938----------------FFTSVE--MNSQDFFTRWKG-LSSPQQECQ-KIFQ..........AKYPMESG--TIATK-L.S
A8XNZ9_CAEBR/812-920----------------FFEPTS--MTSEQFFNRWKS-LGAASQEAQ-KIFA..........AQSPMETA--TIETK-L.K
F7DAP0_XENTR/831-939----------------FFQPTE--MNSQDFFQRWKQ-LSSPNQEVQ-KIFK..........AKNPMDTD--ITKAR-L.I
H3CD15_TETNG/739-847----------------FFQPTE--MTSHDFFQRWKQ-LSQTQQEAQ-KIFK..........ANNSMDTE--VLKAK-L.L
Q1K5B2_NEUCR/839-954----------------FMDQAE--LSADDFFKRWKQ-IGGAPREAQ-RIFGLSG....PKDGEREITES--FIRQV-L.E
Q4W9N5_ASPFU/811-921----------------YMEPST--LSAEEFFKRWRQ-IGGPPLEAQ-HTFGVT.......AKAKNVSET--FTRRL-V.E
Q5KEF7_CRYNJ/937-1049----------------FAEGVH--LESGPFFERWKI-IGGPPREAQ-QIFPIK......LTANGMVDIG--RNQRV-I.T

PF14806

Q4QCR1_LEIMA/849-990...SFILNDIHVDIMNYIHPGP..CFSAEFREKWGI----FDWENK.IAVSTT...KRD..LTSLVRFI--VQELN-M-Q
B3RRM9_TRIAD/821-952DRNCVVLNEIHIDIMDYIMPAT..CTDTEFRQMWAE----FEWENKVVTVNSN...ITD..IQEYLDHI--IASTN-M-K
W5FP03_WHEAT/293-419..SEVILKDMSISIMDYMTPAT..CTDVAFRKMWAE----CWCKVK.LKVNTE...HHD..GREFVNFI--IKSVK-M-P
H2ZHQ3_CIOSA/820-948DRNCVVLNDIHIDIMDYIQPAT..CSDAEFRQMWAE----FEWENK.VTVNTN...ICQ..LVPFLQHI--LKSTN-M-K
A2DHS1_TRIVA/770-889ERQLIPLSPITITPDNYMIPLK..VDSIKYREKWEM----FEWEKK.ITISST...LS...IKEIITRY--QEKGK-M-H
K3WIG6_PYTUL/846-973EKTYVNLNDIHLDIMDYIQPAS..CTDSEFRAMWAE----FEWENK.VAVNTE...ITN..VFQFLQHI--VDKTN-M-R
H3FK41_PRIPA/830-961DRNAVYLQDIRIDIMDYIVPGN..ATDAEFRKMWSD----FEWENK.VAVHTS...ITD..LREYIDHL--SKVTN-M-K
R0MKS9_NOSB1/715-832....LNFSEIKTCVSDFLEPKS..ISSEDFREMWRK----MEWENV.YSVKIS....SNSTLSDILNVF--KRKLK-G-N
K5VEM4_PHACS/747-873EQ.CVILNDIHIDIMDYIKPAY..CTEAQFRSMWTE----FEWENR.VNVSTA...MSD..PRDYLKHV--MKATN-M-S
U5H507_USTV1/845-972DSHCVVLNDIHIDILDYINPAS..CNEAQFRSMWTE----FEWENR.VAVDTS...IKG..LNEYLTHI--LATTN-M-A
I3EIY2_NEMP3/741-868.....NLQEIKFNLADMLEKKK..IDGEEFRDRWPS----LVWENL.YTITLN...TSKITPGHVIKTV--SKAIN-G-T
B6ABN2_CRYMR/870-1013D..TVVLNEINIDLIDFISCKT..IPPSLFRQLWAE----FEWENK.IPIHTF...CTS..FVHFLKFI--MSQTK-L-S
D3BC39_POLPA/773-902DKNCVILNEINIDIIDYIQPITHQYTDVLFRNHWLE----FEWENK.IPVYTN...ITD..LVAYVQHI--SKITN-M-G
A8PX79_MALGO/824-951DSSYVVLNEIHIDIMDYISPSY..VSETEFRSMWTG----FEWENK.VNVKTD...ISD..VRQYLEHI--MKATN-M-A
E0VBA2_PEDHC/824-954DRNVVVLNDIHIDIMDYIVPAS..CNDTEFRQMWAE----FEWENK.VSVSTN...LTD..LHEYLQHL--IKSTN-M-K
T0M089_COLGC/819-945DTNVVILNDLHVDIMDYIQPAT..CTETQFRTMWTE----FEWENK.VNINSK...AKS..LRDFLEQL--MAATN-M-N
M2N9I4_BAUCO/826-955ESNVVILNDVHVDIMDYIHPAQ..CTEAQFRTMWTE----FEWENK.INISTKMPDGKG..LRDFLQRL--MKVTN-M-S
A0BYB4_PARTE/776-899EQAYLVTKEINVDLIDFIIPAT..VSIEQFRKFWAK----YEWENR.IVINTN...QND..PFKYVQFL--EKQLK-V-R
Q4GYW5_TRYB2/834-973ERGCVVLNNVRVDIMNYVRPAK..CSASEFRDKWCK----YDWENA.VAIRTE...KTD..MREYVEYV--MQGTN-T-R
A4RW30_OSTLU/802-928DRNVIVLNDVHIDIMDYIIPAT..CSDTVFRSMWAE----FEWENK.VAVSTN...ITD..VRKYLDHI--VTSTN-M-K
Q6CT54_KLULA/827-956DSRYVILNDVHIDTMDYVKPAI..CDDNSFRKMWNA----FEWENK.LRIKSK...LPS..LRGYLEKL--VEVTH-M-K
F2TX28_SALR5/809-936DRNCVILNDIHIDIMDYITPAM..CSEVEFRAMWAE----FEWENK.VSVRTS...ITD..LNAYLNHI--KQTTN-M-Q
Q6C157_YARLI/806-939DNKVVILNDLHVDIMDYIKPST..CSETEFRSMWSE----FEWENK.VNLMAK...GLT..LQKYIRYF--VENTN-M-K
Q23JD9_TETTS/826-950EQAYLITKEIDIDLIDFVYPAE..IDFNSYREMWAK----YEWENR.IVINPQ...KIE..MLQFFLQF--KEQFK-L-Y
D7G7C5_ECTSI/824-953EKTYINLNDIHMDIMDYIKPAS..CSEEAFRSMWAE----FEWENK.VAVNTS...FTD..LNAFLKHL--VAKTN-T-N
U1NUD7_ASCSU/829-960DRNCVYLQDIHIDIMDYIVPGS..CTDTEFRQMWAE----FEWENK.VNVNTP...ITS..LRAFLTHL--SSVTN-M-K
G0R5D3_ICHMG/130-255EQAYLITKEIDIDLIDFIYPSE..IDLNTFRELWAK----YEWENR.ITLNPS...GND..LYQFVNHI--REHFK-L-Y
Q1EQ38_ENTHI/776-900..ANLILNELRIEYLDQMRPCD..VDIEVYQKKWME----YEWENK.IPVDTE...CTD..LKEYADLL--CSIAK-L-Q
Q5KDU2_CRYNJ/817-942..VTIVMSDIHVDIMSFIKPNY..VNEAQFRSMWTE----FEWENK.VAVQTS...ISD..LRAYLDHL--LKSTH-M-A
G0VBM0_NAUCC/829-957DARYVILNDVHIDIMDYIKPSK..TDADNFRSMWNR----FEWENK.ISVKCD...LPS..LPNYLDEL--VKGTN-M-N
H2AVM9_KAZAF/829-958DARYVILNDVHVDIMDYIKPAT..TEDERFRTMWNE----FEWENK.ISVKSQ...LPS..LHAYLEEL--VKGTN-M-G
K0SE22_THAOC/829-956EKGYVNLNDIHMDIMDYIRPAT..CTDEVFRSMWAE----FEWENK.VAISTS...IGD..LVQFLDHI--VSSTN-M-T
W5DHI9_WHEAT/130-257ERSVVVLNDIHIDIMDYISPAT..CADVTFRNMWAE----FEWENK.VAVNTV...IQD..EKEFLNHV--IKSTN-M-K
C5DI95_LACTC/829-958DARYVIMNDIHVDIMDYIKPAK..TDDATFRKMWNA----FEWENK.ITVKSK...LPT..LHAYLDEL--IKGMR-M-G
G3S1L5_GORGO/813-952DRNCVVLSDIHIDIMDYIQPAT..CTDAEFRQMWAE----FEWENK.VTVNTN...MID..LNDYLQHI--LKSTN-M-K
F4NY13_BATDJ/819-946DINCVILNDIHIDIMDYIKPAT..CNETQFRLMWLE----FEWENK.VNVNTN...ITD..LRMYLDHV--MKSTN-L-N
Q4DQP3_TRYCC/831-971ERCCVILNDIHVDIMDYIKPAS..CLTTEFREKWGT----FDWENT.IAVNTD...KTD..LRDYVEFV--MKETN-M-Q
Q75DY5_ASHGO/827-956DARYVILNDVHVATMDYIKPAV..CDEASFRKMWNA----FEWENK.MVVKSK...LPT..LHDYLNKL--IEVTH-M-N
M7PFS6_PNEMU/811-938DSNIVIFNDIHINIADYIRPSY..CSESLFRRMWTE----FEWENK.VNISSI...TKS..LKEFLNEI--MAKTN-M-A
D2VRU3_NAEGR/871-1000ESFCIILNDIHINIMDYIFPAI..CNDIQFRAMWFE----FEWENK.ITIKSF...TTDVSLRDYLTLI--KDVTK-T-N
B6K5M6_SCHJY/800-928ESRVVILNGISINIMDYIKPVY..IPESEFRSMWTE----VEWENK.VDIVRN..EDIT..VHEFLHDL--MKKTN-M-K
G4TAH8_PIRID/789-916ETS.VVLSDIHIDIMDYIKPAT..CTEHQFRSMWTE----FEWENR.VNVTTD...ISD..LRQYLAHI--MKSTN-M-A
A9V7K9_MONBE/810-937DRNCVILNDIHIDILDYIKAAQ..CTDVEFRNMWAE----FEWENK.VAVRTT...IPT..LRGYLEHV--QKTTN-M-R
H2VR32_CAEJA/815-946DRNCVYLQDIKIDIMDYIVPGN..VTDAEFRHMWSE----FEWENK.VNVMTP...IRD..LREFLNHL--STSTN-M-K
S9X6N0_SCHCR/811-939EDRVVNLSSISLNLMDYIKPAS..CPESKFRSMWTE----FEWENK.VDISSN..ENIN..LMEFLHKL--MKKTN-M-N
G8BG98_CANPC/806-933ESTIVILNDVHVDIMDYIKPAV..CSESQFRKMWNE----FEWENK.ITIKSP...IDS..LKNYLDEL--MKGTN-M-E
F0YGU1_AURAN/606-735EKTYINLNNIHLDIMDYIRPAS..CSDQAFRHMWAE----FEWENK.VAISTN...IAS..LNDFLEHI--VTSTN-M-C
E5SGW1_TRISP/822-952DRNCIYLNDIHVDILDYIVPMS..CSDEEFRQMWSE----FEWENK.VTVNTT...ITD..LKEYLDFL--VKSTN-M-R
U9UU60_RHIID/223-350ESNCVVLNDIHIDIMDYINPAY..CNETQFRSMWTE----FEWENK.VNVNTN...ITD..LREYLGHI--MKSTN-M-S
H9JW04_BOMMO/740-864DRGVVVLNDIHIDIVDFIQPAH..CSDADFRQMWAE----FEWENK.VSVNTN...MTD..LHEYLQHL--LASTN-M-K
E4XMI9_OIKDI/820-947DRNCVVLNDIKIDIMDYIQPAF..CSDQEFREMWSA----FEWENK.VTVHTN...IGD..LREYLLHL--VGATN-M-K
D8M9N0_BLAHO/805-930EHAVVNLNEVYVSLMEYIKPAD..CDSKAFRTMWSA----FTWENK.ISVNTN...LNS..LAGLIQRI--ADVTH-M-K
C3Y7L1_BRAFL/790-921DRNCVVLNDIHIDIMDYIVPAQ..CSDNEFRQMWAE----FEWENK.VTVNTS...ITD..LGIYMGHL--LKSTN-M-K
I1G301_AMPQE/818-949DRNCVILNNIHIDIMDYIQPAN..CTDNEFRKMWME----FEWENK.INLNTN...ITD..LNEFLDHI--LAKTN-M-K
Q1EQ39_ENTHI/710-835D.NHMVLNNISVEALDSIKPAD..ISQDVFQKKWMG----YEWENK.IIVETD...ITD..LVQFIEHL--CKETH-M-N
A0A068Y5X9_ECHMU/859-987ESNCIVLSDIRINILEYIQPST..CSDADFRSMWSD----FDWENK.VTVSTQ...LTD..LRAYLDHV--TKITN-F-K

PF14807

E7FEH2_DANRE/1016-1117TLQ----------LH----------IVDIIG..S..EGIVAC---RLLSGA.----.PCLLHCRV....--------.NG
I7MG35_TETTS/799-898NIG----------IG----------VVEVDN..N..ELICAG---KNISSQ.----NIMLLYGSYT...--------.AL
M3ZX44_XIPMA/1022-1123KLQ----------LH----------VVEVIG..V..EAIVAC---CLQQDQ.----.PCLMHCRM....--------.HA
E1BR26_CHICK/1041-1141KLK----------LH----------IVDIIG..N..EGILAC---QLLPSV.----.PCLLHCRT....--------.HS
G3NRF7_GASAC/1039-1140KLK----------LH----------VVEIIG..M..EGIVAC---RVLRDQ.----.PCLMHCRL....--------.HA
Q583N8_TRYB2/922-1020RAS----------LR----------VVEMIG..N..ELIVAA---VLPGTD.----QLLLGHVVLV...--------.DH
Q4DVU3_TRYCC/908-1005RAS----------LR----------VVEVIR..N..ELITAA---KLIGTG.----KPVLCHVDVV...--------.GP
E2RJS0_CANFA/1021-1121KLR----------LH----------VVEIIG..N..EGLLAC---QLLPSI.----.PCLLHFRV....--------.HG
H2LLU4_ORYLA/1029-1130KLS----------LH----------VVEIIG..V..EGLVAC---SLLQDQ.----.PCLMHCRV....--------.HA
F7E721_XENTR/1013-1111EIN----------FH----------IVEIIG..D..EGLAAC---QMLPTV.----.PCLLHCHF....--------.SS
W5N705_LEPOC/934-1035KLQ----------IH----------VVDIIG..E..EGIVAC---QLVPST.----.PCLLHCRV....--------.HA
A2DQQ6_TRIVA/902-1002LAH----------VK----------TVQRIG..Q..EEIFMG---LLVSTP.----FKVLIHVKF....--------.GA
A0BKM3_PARTE/865-963TIN----------IN----------VIEVIE..Q..EIICAG---ANAENK.----SCVLIYGCYN...--------.SN
H3D850_TETNG/1027-1125KLQ----------LH----------VVEIIG..M..EGIVAC---QLLQNQ.----.PCLLHCRL....--------.HA
D3BA10_POLPA/1109-1218GLH----------LH----------TIQPLDSDNHTEFFGAT---QLKVNS.----NIAAGGITLFKLG--------YNG
D3ZX21_RAT/1026-1126KLR----------LC----------VVDVIG..S..EGLLAC---KLLPST.----.PCILHCRV....--------.HA
H3AE96_LATCH/1032-1133KLR----------LH----------IVDIIG..K..EGIVAG---QLLPST.----.PCLLHCRV....--------.HV
A7T9X2_NEMVE/77-176DLR----------LH----------PVSSTG..D..NVIASG---TVLNAS.----.KCLLHAALS...--------.SS
B5YN72_THAPS/443-550RAG----------LH----------KVEEIAATN..EGIAAC---MAGGGS.----AVALVHGKITPLP--------GGA
A2EQ12_TRIVA/905-1005AIG----------VK----------TVQRIG..Q..EEIFMG---ILVSTP.----FKILIHVKF....--------.GN
F6U0B3_MONDO/1042-1142KLR----------LH----------IVDIIG..N..EGILAC---QLLPSI.----.PCLLHLRA....--------.YA
K3W798_PYTUL/985-1087QFS----------VH----------TVEAIPATN..EAIAAC---RLANSE.----HVALVHVKIR...--------.SG
H0V753_CAVPO/1023-1123KLR----------LH----------VVDVRG..S..EGLLAC---RLLPST.----.SGLLHCRV....--------.HA
H3GJ53_PHYRM/992-1091QFN----------VH----------TVEAIPTTN..EAIAAC---RLVNSE.----HVGLLHVKIR...--------.SG
V4ZCH6_TOXGO/1010-1115AIA----------LH----------VVEVIG..D..EAIAAA---QTPLGGD----GVVYVHLKV....--------.KD
W5LC92_ASTMX/1065-1166SLQ----------LH----------IVDIIG..S..EGIVAC---RLLSGA.----.PCLMHCRV....--------.ND
A9V3X8_MONBE/1246-1346ASH----------FH----------CVQVIG..T..EVIFAA---QVLNHEQ----QPCLLHTKL....--------.NA
F2U7H5_SALR5/1178-1280TLH----------LS----------TVAIIG..A..EVIMAG---QLLNNSD----RVCLIHWRV....--------.DA
K0TDZ6_THAOC/987-1091RAG----------LH----------KVEEIAATN..EGIAAC---MAGGGS.----SIALVHGKVSPLS--------GDA

PF09066

Q8I3I6_PLAF7/813-922LIA----------RR----------NV..NN.ME--LYYFAC...ITTNN......LVILSEVTIQ.PE---------.K
J9K6T5_ACYPI/802-910TIA----------KR----------HV..EG.QD--MLYQSL...KLTNG......NWVLNELKIQ.PG---------.N
G1KAG2_ANOCA/624-732TIA----------MS----------KA..GSQLW--KAYLAA...QDDTG......CLFLTELLLEIGG---------IE
T1GYI4_MEGSC/219-327TIA----------KR----------NV..EG.QD--MLYQSL...KLTNN......IWVLLELKVQ.PG---------.N
Q4UI19_THEAN/643-749TLA----------SS----------D...KDSYS--KMYMYT...QDEQG......AKYYIEVIIKGGQ---------..
T1L557_TETUR/832-940TIA----------KR----------TV..EG.ND--MLYQSF...KLTNN......MWILAELKIQ.PG---------.S
Q0DRT9_ORYSJ/783-892FIA----------KR----------KN..SN.KD--VLYMSA...KIPRG......IPFLIELTAA.VG---------.V
U3IVS5_ANAPL/428-538TIA----------MS----------KA..GVQPW--KAYFSA...QDDTG......CLFLTELLLETED---------SE
B9GKF2_POPTR/793-902FIA----------KR----------KH..SN.QD--VFYFST...KIPRG......VAFLIELTTV.VG---------.T
A0BYI5_PARTE/661-768NIA----------.A----------GE..EENVL--KMYFYG.....SHQ......CQVFFEFEINKNL---------ST
H3GSM2_PHYRM/731-837TMA----------.S----------GD..VGTQY--KFFFYA...QDTQG......RYFLSETLVEKAN---------RT
I1G9C8_AMPQE/870-979IIA----------ER----------TVGEDM.QV--LLYVST...KLING......LTVLGELKIL..R---------.N
D7M945_ARALL/782-891FIA----------KR----------KN..GN.QD--VLYLSA...KVPRG......IPFLIELTAM.VG---------.Q
V8NPR7_OPHHA/525-630TIA----------VS----------KP..GSQSW--KVYLGA...QDDTG......CLFLTELLLETGS---------AE
B9RS58_RICCO/732-842CIA----------.S----------GG..QSPNF--KFFFFA...QK.AEES....SIYLVECKINTSS---------SK
APBLA_ARATH/725-835CIA----------.S----------GG..QSPNF--KFFFFA...QK.ESEP....SNYLTECIINTSS---------AK
D8TL16_VOLCA/724-839TIA----------.S----------GG..QAPSF--RYYFYG...QNAGQSA....ALYLVELLLRSDT---------GN
F2UJM8_SALR5/754-862SVA----------RR----------NV..ND.QE--LCYMSL...KFVNN......VVALVELTFT.PG---------.S
D2A641_TRICA/594-702TIA----------KR----------NV..EG.QD--MLYQSL...KLTNN......IWVLLELKLQ.PG---------.V
A0CBT3_PARTE/1031-1136LIG----------VR----------KD..ERGVE--LLSYAA...SLVNG......MPLLVNVIHSPTA---------..
G8Z247_SOLLC/724-834CIA----------.S----------GG..QAPNF--KFFFYA...QK.AEEP....STYLVECVVNSSS---------CK
K3WIX4_PYTUL/809-916YVA----------KR----------GI..DG.KE--IAYFSI...KTMTN......VVALFEFTFDGSG---------..
X6NL64_RETFI/750-853FIA----------RR----------EI..QDKGV--SLYFAA...KLRNE......L.MLIEIAIATMG---------..
F4QCH4_DICFS/828-937EIV----------RR----------KA..QN.QE--MCCYSV...KTDNS......IYFLVQLTFV.AQ---------.S
A2DLB3_TRIVA/703-806FFA----------KK----------.......DA--SLFFSG...RTVND......DLFFLIVLMSAEN---------..
A9SX84_PHYPA/711-818VMA----------.S----------GG..KAPTF--KFFFYA...QAADSPP..TSGFFLVELIVNTST---------AS
B3RYW3_TRIAD/826-934TVA----------KR----------NV..DG.QN--MHYMSL...KFTNN......ILVLAELKIQ.SG---------.N
D2VMT9_NAEGR/798-909FVA----------DH----------QD..AG.LT--NYYFSAKFNYGTEE......VIALLEIVVS.AN---------.S
D7SUE8_VITVI/727-838CIA----------.S----------GG..QAPNF--KFFFFA...QK.AEEP....STFLVECIINTSS---------AK
H2ZG85_CIOSA/53-165MIA----------KR----------TV..EG.KD--MVYLSL...QLPRD......IWVLMELKVT.PG---------VT
D8LDW2_ECTSI/826-934FVA----------GR----------EA..PG.QQ--IVYYSF...KLVQ.......LHMLAEVTFPVGG---------SA
Q4DHL5_TRYCC/662-771TLA----------.S----------GA..QGDAQ--KYYLYA...QEEGDDT....TYFMLELFLHKSG---------S.
W4YD47_STRPU/852-960TVA----------KR----------TV..DG.QD--MLYQSL...KLTNG......IWVLAELKVV.PG---------.N
D8T6G5_SELML/696-805CMA----------.S----------GG..QSPTF--KFFFFA...QKADGMP..GTGFFLVECLVHTSA---------GK
E0VK25_PEDHC/801-909TIA----------KR----------NV..EG.QD--MLYQSL...KLVNQ......IWVLNELKMQ.PG---------.N
T1FPB8_HELRO/834-941TVA----------RR----------NV..DQ.QE--MLYQSI...KLTNQ......VWVLIEVKVV...---------.A
A0DI20_PARTE/830-935LVG----------IR----------KD..DKGVE--LLSYSV...VLANG......MSILINVIHTTNA---------..
I1NPU6_ORYGL/778-888CIA----------.S----------GG..QPPNY--KFFFYA...QK.DGAT....AFFLVECIVNTAS---------AK
K1QQ16_CRAGI/821-929TIA----------KR----------NV..EG.QD--MLYQSL...KLTNG......IWVLAELKIQ.PN---------.N
F1SBR2_PIG/621-728TIA----------MS----------RA..GAQPW--KAYLSA...RDDRG......CLFLTELLWEPET---------..
G3PIH2_GASAC/616-726TLA----------FT----------AA..HASPW--RVYLYTHAQQAARS......ALILGQLLYAGRE---------EE
G0QLQ6_ICHMG/869-980FLA----------SK----------NS..GN.QI--QSYYAS...RF.NN......TTILFEVNIPNNN---------DQ
A0DRP1_PARTE/662-769NIA----------.A----------GE..EDNVL--QMYFYG.....AHK......CQVFFEFEINKNL---------ST
B0V3P3_MOUSE/545-655TIA----------MS----------RA..GAQPW--KAYLSA...QDDTG......GLFLAELLLKPEN---------SE
A2E742_TRIVA/740-844FLG----------KQ----------.......GE--CTFFTA...MAVSQ......DKIIVRITLQPNG---------..
Q23C04_TETTS/725-835SAA----------.Q----------GE..EDDTL--KFYLYA..KHQSTG......NVVYMEFDLNTAS---------RV
E5RZZ3_TRISP/409-518TVA----------RR----------NV..ES.QE--LLYHSM...KLTNG......IWVLSELKLQ.PN---------.N
B2GUA2_XENTR/836-944TVA----------RR----------TV..EG.QD--MLYQSM...KLTNG......IWVLAEVRMQ.PG---------.S
A2FAG5_TRIVA/724-828FNA----------KK----------.......DN--TAYFSG...KTSKG......VELVVFLSFNDGG---------..
D8LNY8_ECTSI/718-824TMA----------.S----------GN..KPAAM--KFFFYA...KDVLG......STYLMQCSVLKPE---------RL
Q22WH8_TETTS/880-989HVA----------TR----------PS..PSGQG--TFFFSC...KTGED......FIFCIEISYVSDT---------..
C3XY98_BRAFL/832-941TIA----------QR----------NV..DG.RD--MLYQSL...KLTNG......IWVLAELKIQ.PR---------.S
H3BCT1_LATCH/841-950TCG----------KK----------AV..PR.YP--QVFKSM...YLTNP......LFVLQFFSSS.RY---------.N
A2DCQ7_TRIVA/723-827FNA----------KK----------.......DT--TAYFSG...KTIKG......ENLVVFLSFSEGG---------..
W5MN72_LEPOC/838-946TIA----------KR----------NV..EG.QD--MLYQSM...KLTNG......IWVLAELRIQ.PG---------.N
Q7YZG9_CAEEL/116-225TVA----------RR----------QV..DN.QQ--LLYHSV...KYTNN......LNVLSELKVN.SQ---------.T
U3JLI9_FICAL/617-727TIA----------MS----------KA..GAQPW--KAYLSA...QDDSG......CLFLTELLLQAAD---------SE
X6NIB4_RETFI/34-141CIY----------ER----------NV..EHKGI--ISYCLC...VFLD.......TSVFIEVSLALTG---------..
B9QK09_TOXGO/810-915LVA----------QR----------SA..DT.FD--ALYFSA...TTTNN......LVVLAEVSLQ.RN---------.G
H3DYD2_PRIPA/21-131TVA----------RR----------SV..DG.QE--LLYHSI...KYTNK......IVVLSELKMEITG---------.A
I7MFM9_TETTS/866-970YIA----------AK----------NK.......--NSYYSA...KI.NN......TVVLLEVIVPSNT---------NP
D3BF27_POLPA/753-863CLA----------FG----------SV..AGVTK--LYYYAQ...EIENG......PLFLLEILINEKT---------LL
D8M378_BLAHO/682-786FVA----------.N----------GY..MGQVM--KIFLSA....YHSG......AAFETELLIAQNN---------..
A0A068XBU3_HYMMI/884-992TIA----------QR----------NV..DG.QD--MLYQSM...KLCNG......IWVLAELKIQ.PG---------.N
A0A0D2VQ42_CAPO3/713-819TMA----------.S----------SE..ELEAM--RFYFYA...QLVTG......DYVLIEAVFDIPS---------QE
M4B2Y6_HYAAE/809-916YVA----------KR----------PI..DD.KE--IAYFSV...KTMTN......VVALFELTFDKSG---------..
D8LJ03_ECTSI/311-418VVA----------AG----------TV..DGLMR--VLFCAKEATSNGTG......AWFLAELLQDESA---------LT
A9VBI8_MONBE/764-872LVA----------RR----------SV..TD.QE--LLYMSV...KFINN......ITALIEVTIK.NG---------.S
B7S4C6_PHATC/774-888FIA----------RR----------PVPNAEGQE--VVYFSM...RTVTD......MEFLAELTFK.QG---------.V
W5MVZ4_LEPOC/612-721TLA----------FS----------RP..GARPW--KAYLYT....YSSD......TLVLAELTWDADP---------GA
A5PMS9_DANRE/837-945TIA----------KR----------TV..DA.QD--MLYQSI...KLTNG......IWVLAEMRVQ.TG---------.N
I1JAF7_SOYBN/780-889FIA----------KR----------KN..AN.QD--VFYFSA...KLPRG......IPFLIELTTL.TG---------.N
E2BIE2_HARSA/186-294TIA----------KR----------NV..EG.QD--MLYQSL...KLTNN......VWVLNELKIQ.PG---------.N
A2DRG8_TRIVA/716-820FNA----------KK----------.......ET--TAYFSG...KTILG......DIFFIYIEFHNSG---------..
M0RZM5_MUSAM/724-836CIA----------.S----------GG..QSPNF--KFFFFA...QKLDGPP....LFFLVECIVNTSS---------AK
M0U680_MUSAM/792-901FVA----------KR----------RN..AD.KE--LLYLSA...KIPRD......IPFLIELTAV.LG---------.V
Q4UE05_THEAN/764-873HVG----------TG----------LCGDRSSES--EFFYTL....TTNS......LAILAKFTRD...---------..
Q38A51_TRYB2/655-766MLT----------.A----------GP..HNDGD--RCFLYA...QEEGAMG....AYFLLEVCLSRNG---------M.
A4RVK7_OSTLU/672-777TMA----------.S----------GG..PSNAM--KFYFYA..IDNGNR......EIFLVEALIDATA---------RA
B7Q6V9_IXOSC/828-936TIA----------KR----------NV..DG.QD--MLYQSL...KLTNG......IWVLAELKIQ.PG---------.N
H3B7P3_LATCH/616-723TIA----------IT----------KA..ETHPW--KAYLCA...QEKNG......CLFLTELLLSVDK---------TA
W4ZPC2_WHEAT/22-131CVA----------.S----------GS..QPPNC--KFFFYG...QK.PGAA....DFYLVECTVNTAS---------PK
A2DH87_TRIVA/726-830FVA----------KK----------.......DN--TAYFSG...KAINN......EMCIVFLTFSDSG---------..
Q4YJB5_PLABA/105-213ILA----------.S----------GE..IDQCL--KFYMYS...QFYTK......HYVFIEFIFNKIE---------YS
F1KSB8_ASCSU/880-988TVA----------RR----------NV..DG.QE--LLYHSI...KYTNQ......IHVLSELKMQ.QS---------.S
W1NY12_AMBTC/790-899FIA----------KR----------RH..AN.QE--VLYLST...KIPGN......IPFLIELTTT.AG---------.I
F1QV11_DANRE/615-719TLA----------FS----------PA..RALPW--RAYIYS....RGSG......TLVLAELLQDDPE---------M.
H0UVW0_CAVPO/622-732TIA----------MS----------RV..GAQPW--KAYLSA...QDATG......CLFLTELLLEPGN---------SK
F0VDW7_NEOCL/814-917LVA----------QR----------SA..DT.FD--ALYFAA...TTTNN......LGVLAEVSLQ.RN---------.G
C5LX92_PERM5/807-914HVN----------TR----------LSKDGA.SA--ALYFGA...CLTNR......LVVLLELVIT.RT---------LP
E9HXR5_DAPPU/18-126TIA----------KR----------NV..EG.QD--MLYQSL...KLVNG......IWILSELKMQ.PG---------.N
X6NHG8_RETFI/234-341CVH----------QR----------NV..DRKGT--IVYCVC...SVFD.......AQVLSEVSLATNG---------..
K3WB21_PYTUL/741-848TMA----------.S----------GD..VGPQY--KFFFYA...QDAQG......NFYLSETLVEKAE---------RV
L5LZJ8_MYODS/823-931TVA----------KR----------NV..EG.QD--MLYQSL...KLTNG......IWVLAELRIQ.PG---------.N
Q8IBF8_PLAF7/746-854TLA----------.S----------GE..IDQCL--KFYMYS...QLYTK......HYIFIELIFNKRD---------NS
E4XT96_OIKDI/515-624NVA----------KR----------NV..EG.VD--MLYNSF...KLTNG......IWCLLELRIQ.PA---------.S
G3I8B9_CRIGR/380-488TIA----------KR----------NV..EG.QD--MLYQSL...KLTNG......IWILAELRIQ.PG---------.N
D0N2R3_PHYIT/388-490VVA----------AE----------QK..DSVLQ--VYFYAS...QYGTD......TFFLCEFVLLFAR---------RF
D7TV41_VITVI/792-901FIA----------KR----------KH..AN.QE--VLYLSA...QVPGG......ITFLIELTMV.AG---------.A
A0A0D2UCE9_CAPO3/857-966TIA----------KR----------TV..EG.QD--LLYLSA...KLTNG......LWVLFELCLR.PQ---------.A
B8C7W7_THAPS/803-917LIA----------RR----------PVPNAEGQE--VAYFSM...KTSTG......MVFMAELTFK.KG---------.V
F6WLR5_MONDO/620-730TIA----------LS----------KA..GVQPW--KAYLSA...QDGSG......CVFLTELLLDPEH---------LQ
G7YBR2_CLOSI/427-535TVA----------KR----------NV..DG.QD--MLYLTM...KTTNN......IWVLAELKIQ.PG---------.N
D8SU50_SELML/758-869FIA----------RR----------SQKESR.QE--LLYLSA...KVPPN......IVFLVELATV.VG---------.T
A5KA22_PLAVS/797-905TLA----------.S----------GE..IDQCL--KFYMYS...QFYTK......QYIFIELIFNKAE---------NS
AP1B_DICDI/828-938EIV----------RK----------KA..PN.QE--ISFLSC...KTESS......VYILIELAFN.IS---------.T
F6U640_ORNAN/621-731AIA----------VS----------KP..GAQPW--KAYLGA...SDDTG......CLFLTELLLETEN---------SQ
A9TVR6_PHYPA/787-898YIA----------RR----------VLKDTN.QE--VLYLSG...KVPPS......IAFLVELTCK.VG---------.Y
W1NSC6_AMBTC/713-827CIA----------.S----------GG..QPPNL--RFFFFA...QI.ADEPQSTSSFFLVKCDINTSS---------AK

PF02296

AP2A2_DICDI/872-983GLN----------IT----------VLKQVDPNP--NNIVAS---CLFPFGSNGQ..PINSYIRIETNP---------QA
Q2GV39_CHAGB/822-941GFR----------WG----------VLNGVDPNG--KNLVGA---SVVHTSEGGK...YGCLLRLEPNY---------QT
A0A0D1CEI5_USTMA/864-977GAR----------MQ----------VLEGVDANA--TNSVAA---GVLHMADAGK...VGCLLRLEPNK---------DA
Q0UJD2_PHANO/843-955GFK----------WG----------IVDGVDPNG--KNIVGA---TVLHTSEGGK...FGCLMRLEPNF---------DT
AP2A_DROME/827-935GFG----------MQ----------LLDQVDPNP--DNMVCA---GIIHTQ.SQQ...VGCLMRLEPNK---------QA
AP2A2_BOVIN/825-933GFG----------SA----------LLEEVDPNP--ANFVGA---GIIHTR.TAQ...IGCLLRLEPNL---------QA
Q1EQ22_ENTHI/852-954GMR----------FI----------C...LDVKP--EQIVAC---SSFPSFQN.....IYVLLRIEINV---------TS
A6RDP5_AJECN/812-923GFR----------FR----------ILGGVDPNS--KNVVGC---AVYQMD.GGK...TGCLLRLEPNY---------EK
AP2A_SCHPO/759-869GFH----------WG----------ICQNVDSIA--LNIVGA---GIIRFG.TQN...VGCLLRIEPNY---------EQ
Q5AXG4_EMENI/791-902QFG----------WK----------LLSGVDPIS--TNIVGC---AVYHSA.QGK...TGCLLRLEPNY---------ER
AP2A1_MOUSE/864-972GFG----------SA----------LLDNVDPNP--ENFVGA---GIIQTK.ALQ...VGCLLRLEPNA---------QA
Q6CBH9_YARLI/812-920GFG----------WS----------I.DAQQSTR--DAIYGA---GVLYTSVSGNFGLLGCLQKLQGN.---------Q.
A7RH33_NEMVE/829-938GFG----------LA----------IQNGVDPNP--ENFVCA---GIIKMKVAGQ...VGCLLRLEPNR---------QA
A8XNZ9_CAEBR/812-920GFG----------AN----------LLTEVDPNP--DNYVCA---GIIHTQ.TQQ...IGTLIRLEPNK---------QA
F7DAP0_XENTR/831-939GFG----------PA----------VMDNVDPNP--SNYVAA---GIIQAK.TRQ...VGCLLRLEPNE---------QA
H3CD15_TETNG/739-847GLG----------TA----------LLENIDPNP--ENYVCA---GVIQTK.SQQ...IGCLLRLEPNA---------QA
Q1K5B2_NEUCR/839-954GFR----------WG----------LLYNVDPNS--KNFVGA---SVVHTSEGGK...FGCLMRLEPNY---------GT
Q4W9N5_ASPFU/811-921GFH----------WR----------ILENVDPNP--NNIVGC---AVYQSH.GGK...TGCLLRLEPNY---------ER
Q5KEF7_CRYNJ/937-1049GNK----------LS----------VLPDIDHKP--ENIVFA---GVLHMSSAGK...VGILGRVEPNK---------DA

PF14806

Q4QCR1_LEIMA/849-990LLE...PYEVEQQEEQDPELELLPTSEENEKCAYVSCNLYAQ---TA.FG------EDALANVSVESDG...K....GLV
B3RRM9_TRIAD/821-952CLT...S......DT..........ALKGD.CGFLAANLYAK---SI.FG------EDALANVSIERTA...DQSE.TPV
W5FP03_WHEAT/293-419CVT...P......LS..........ALDGD.CGLVAANLYGK---SV.FG------EDALANISVEKQA...DS...SKL
H2ZHQ3_CIOSA/820-948CLT...P......EK..........ALGDE.SGFLAANLFAK---SI.FG------ENALANVSIEKPV...GN...GPV
A2DHS1_TRIVA/770-889LMN......................EFDDN.ASWATVNLCAT---SM.FD------EDVLLNISLEKTD...N....GTT
K3WIG6_PYTUL/846-973CLT...P......TA..........SLGGD.TNFLAANLYAK---SV.FG------EDALVNLSVEKQD...K....GRI
H3FK41_PRIPA/830-961ILT...P......ES..........ALDGS.CGFMAANLCAH---SI.FG------EDAIANVSIEKAN...PLEETSPI
R0MKS9_NOSB1/715-832IVD........................CKDNEDFLVGNISAT---TK.QN------NDILFNVCMTKDG........QFI
K5VEM4_PHACS/747-873CLT...P......EG..........AISGE.CDFLSANMYAR---SL.FG------EDALANLSVEQTE....Q...GTI
U5H507_USTV1/845-972CLT...P......MR..........EASSE.CGYLSANLYAR---SI.FG------EDALANLSLECSD...E....GVI
I3EIY2_NEMP3/741-868VVETRAKIGDTISDK..........DEIER.PDILVKNMYTR---TA.QG------TGIYVNAAITTEG........QEL
B6ABN2_CRYMR/870-1013LIG.VNPNDINDTDS.......YINKMSEN.SSFFAANLYSK---SI.FG------EDALVNISLEKQHTSNNSNENKTI
D3BC39_POLPA/773-902ILT...P......DI..........HLSNE.TGILSANLCAK---SV.FG------EDALANICIEKQE...D....GKI
A8PX79_MALGO/824-951CLT...P......EA..........SLAGE.CGFLSANLSAT---SL.FG------EDALANVSIERLD...N....GTI
E0VBA2_PEDHC/824-954CLT...P......EK..........ALSGQ.CGFMAANMYAK---SI.FG------EDALANLSIEKPF...NKPE.AAV
T0M089_COLGC/819-945CLT...P......EA..........SMKGD.CQFLSANLYAR---SV.FG------EDALANLSIEKEG...ED...GPI
M2N9I4_BAUCO/826-955CLT...P......EA..........SLSGD.CQFLSANLYAR---SV.FG------EDALANLSVEKDG...ES...SLV
A0BYB4_PARTE/776-899PI............E..........ENHPK.GNIICVNMYAQ---TK.FD------DDFVLNVSAEVVN........DKL
Q4GYW5_TRYB2/834-973LLE...PYPEEDDEV.....VSAFDGKGDNGHRYVSCNMYAR---TL.FG------DDALLNVSIERDA...E....GKL
A4RW30_OSTLU/802-928CLT...P......PS..........ALDGE.CGFLAANLYAK---SV.FG------EDALVNVSIESND........GEI
Q6CT54_KLULA/827-956VLT...P......EE..........ALGDNDSRFLSCNLYSR---ST.FG------EDALANLCIEKDP...IT...QEI
F2TX28_SALR5/809-936CLT...P......DS..........ALTGD.CNFLAANLYAK---SV.FG------EDALANLSIEKGP....D...GQI
Q6C157_YARLI/806-939CLT...PGAIKEDAT..........DLEDD.CGFLSANLYSI---SS.FG------EEALANISIEIND...N....LEI
Q23JD9_TETTS/826-950MLN..........DE..........EEIKN.ATVICVNFYAK---TK.LG------DDFLINISAESQN........GSV
D7G7C5_ECTSI/824-953CLT...P......LS..........SLDGS.SSFLAANLYAM---SV.FG------EDALVNVSVEKKS...DAD..GKL
U1NUD7_ASCSU/829-960LLT...T......EE..........ALQGE.CGFLAANFCAH---SI.FG------EDALANVSIEKTN...PLDPNSSI
G0R5D3_ICHMG/130-255LLN..........DE..........EEIKN.ANCICANFYAK---TK.LD------DDFLINLSAEIIN........NKI
Q1EQ38_ENTHI/776-900CIT...P......AI..........MFCDS.IGFLSANFYAK---NL.FD------EDALINLSAEKIG........NKI
Q5KDU2_CRYNJ/817-942LLT...P......EA..........ALSGD.CDFLSANLAAK---SL.FG------EDALANASIERTE...D....GHI
G0VBM0_NAUCC/829-957VLT...N......LE..........SLNDN.SRFLSCNLYAK---SS.FG------EEALANVCVERDV...ET...KSI
H2AVM9_KAZAF/829-958ILT...P......SE..........ALGEEDCRFLSCNLYAK---SS.FG------EDALANLCIEKDP...AT...NQV
K0SE22_THAOC/829-956CLT...P......HG..........NEKG...SFLAANLYAK---SV.FG------EDALVNVSVEKKD...DND..GKL
W5DHI9_WHEAT/130-257CLT...P......PS..........ALDGE.CGFLAANLYAK---SV.FG------EDALVNISIEKQV....D...GKL
C5DI95_LACTC/829-958ILT...P......EE..........ALGEEGCRFLSCNLYSK---ST.FG------EDALANLCIEKDP...TS...HEI
G3S1L5_GORGO/813-952CLT...P......EK.........ILVYSAYTDYLTSDLYVQ---SVEFF------ESQGVNLKILENPFHKHPIGINLV
F4NY13_BATDJ/819-946CLT...P......EH..........ALAGE.CGFLAANLYAR---SI.FG------EDALANICLEKIS....G...DKI
Q4DQP3_TRYCC/831-971LLE...PYRDVDEEE....LQGLSPTDEDGGYGYVSCSLYAR---TV.FG------EDALANVSIERDA...Q....GKI
Q75DY5_ASHGO/827-956VLT...P......EE..........SFADPECRFLSCNLYSK---ST.FG------EDALANLCIERDP...TS...GSI
M7PFS6_PNEMU/811-938CLS...P......DT..........LFKED.CGFLSANLYAK---SV.FG------EDALMNVSIEKQD...N....GCI
D2VRU3_NAEGR/871-1000CLT...P......ES..........ALDGD.CEFLSANLYAK---SS.FG------EDALANVSLEKLP...E....GNI
B6K5M6_SCHJY/800-928CLT...P......ES..........SLRGD.CQFLSANLYAR---SI.FG------EDALMSLSIEKTT...D....GKI
G4TAH8_PIRID/789-916CLT...P......DA..........ALSGE.CDFLSANLYAR---SV.FG------EDALANLSIEKVE...GT...GHI
A9V7K9_MONBE/810-937CLT...P......AS..........ALAGE.CDFLAANLYAR---SV.FG------EDALANLSIEKLP....D...GTV
H2VR32_CAEJA/815-946VLT...G......DA..........AIEGE.CGFLAANLCAH---SI.FG------EDALANVSVEKAL...PMDDSSPI
S9X6N0_SCHCR/811-939CLT...P......DA..........SLRGD.CGFLSANLYAR---SI.FG------EDALMSLSVEKST...D....GPI
G8BG98_CANPC/806-933CLT...P......GA..........VIGEE.CQFLSANLYSR---ST.FG------EDALANLCIEKQS...D....GPI
F0YGU1_AURAN/606-735CLT...P......SS..........SLGGT.SSFLAANLYAK---SI.FG------EDALVNVSVEKKD...DAD..GKL
E5SGW1_TRISP/822-952CLT...P......EP..........ALSGD.SGFLAANLYAR---SI.FG------EDALANLSIEKSS...SNSE.AVV
U9UU60_RHIID/223-350CLT...P......EV..........ALSGD.CGFLSANMYAR---SI.FG------EDALANISIEKQT....D...GAI
H9JW04_BOMMO/740-864CLT...P......EK..........ALSGQ.CGFMAANLYAR---SI.FG------EDALANLSIERPL...HKPG.APV
E4XMI9_OIKDI/820-947CLT...P......EQ..........TMSGN.CEFLAANLYAK---SM.FG------ESALANLSIEVGK...N....GFV
D8M9N0_BLAHO/805-930IVSDFDP......ET..............D.ADFMAANLYAR---SL.FG------EDILLNVSVEKTP........MGV
C3Y7L1_BRAFL/790-921SLT...P......EK..........ALSGE.CGFMAANLYAR---SI.FG------EDVLANLSIEKMI...HLGEDAPV
I1G301_AMPQE/818-949SLT...P......RQ..........ALLGD.CCFLAANLYAR---SI.FG------EDALANVSIEKPF...GSGPETPV
Q1EQ39_ENTHI/710-835CVT...P......KS..........LFCSE.IGFLSANLYAT---TV.FG------DDALANISIEINN........GKI
A0A068Y5X9_ECHMU/859-987CLT...P......PE..........ALRGE.CNYLCATLYAR---SI.FG------EHVLGNLCLEKSA...DG...APV

PF14807

E7FEH2_DANRE/1016-1117SALAMWLRS-P---LPALPDCILYHCQRA-
I7MG35_TETTS/799-898GNLSITMKS-N---SKQEIDQIFNTIKT.-
M3ZX44_XIPMA/1022-1123GMLAVWLRS-P---VPDLPDCLLYCCQRA-
E1BR26_CHICK/1041-1141GMLALWFRS-P---CSALPDGLLYQCQKV-
G3NRF7_GASAC/1039-1140GALSVWLRS-P---VPDLPDCLMYHCQRA-
Q583N8_TRYB2/922-1020HCANATFRA-Q---DKRLAEFVVRSLDS.-
Q4DVU3_TRYCC/908-1005NAANVKVRA-D---DKGFAAYVAHA....-
E2RJS0_CANFA/1021-1121DVLALWFRS-S---CSSLPDYLLYQCQKV-
H2LLU4_ORYLA/1029-1130GRLAVWLRS-P---VADLPDCLLYHCQRA-
F7E721_XENTR/1013-1111GLLTLWIRS-H---SSTLLDCLLRQCQKA-
W5N705_LEPOC/934-1035GMLVVWLRS-P---SPYLPDCMIYQCQKA-
A2DQQ6_TRIVA/902-1002QKVDVKILS-K---AQPLTASVLNDLKNI-
A0BKM3_PARTE/865-963GSLDLKING-T---DPKDAEYILAIIKR.-
H3D850_TETNG/1027-1125GALAVWLRS-P---VPELPDCLLYHCQRA-
D3BA10_POLPA/1109-1218GRLTISLKT-N---DKNFSDVISRHCYKI-
D3ZX21_RAT/1026-1126DVVALWFRS-S---SSVLSDCLSCHCQKV-
H3AE96_LATCH/1032-1133GTLAVWLRS-P---SSALPDCLLYQCQKA-
A7T9X2_NEMVE/77-176GSLEIWIKT-N---SQLLSEVVMKQCIAI-
B5YN72_THAPS/443-550SRVDVTVKS-S---DAQLGGSLAMYLQNM-
A2EQ12_TRIVA/905-1005QKVDFKVLT-K---AQPLTASIVNDLKTV-
F6U0B3_MONDO/1042-1142GIVALWFRS-S---CSTLPDYLLYQCQKV-
K3W798_PYTUL/985-1087GFVDLTVRT-A---DMNLTDQLLDAVANR-
H0V753_CAVPO/1023-1123DGLSLWFRS-S---CSALPDCLLYQCQKA-
H3GJ53_PHYRM/992-1091GFVDLTVRT-A---DMEFTSQLLAAT...-
V4ZCH6_TOXGO/1010-1115QVASFIIKA-S---TAQLAEAVAAACQR.-
W5LC92_ASTMX/1065-1166ASLAVWMRS-P---LSSLSDCVLYHCQRV-
A9V3X8_MONBE/1246-1346PVIEVQVHA-H---ATPYAESVLKLLEDN-
F2U7H5_SALR5/1178-1280PTLHAAVRT-K---SMPFTEAVLQVVVSS-
K0TDZ6_THAOC/987-1091SRLDITVKS-S---DANLGSQLAMYM...-

PF09066

Q8I3I6_PLAF7/813-922KNVKLCIRT-D...SSSVIPLYKLLFVKAF
J9K6T5_ACYPI/802-910PNITLSLKL-L...AMEVAQGVFQAYDAIL
G1KAG2_ANOCA/624-732..IQMLVKQ-SDN.KPEVLQAFVSVLKTVL
T1GYI4_MEGSC/219-327PDATLSLKS-R...SVEVAPMIFTAYEAII
Q4UI19_THEAN/643-749..IKVTIKV-K...ETNSSESALQSLSEIL
T1L557_TETUR/832-940PDIQLSVKS-R...VTEIASCVHKMYEILL
Q0DRT9_ORYSJ/783-892PGVKCAVKT-P...NKEMVALFFEAMESLL
U3IVS5_ANAPL/428-538..MQVSVKQ-SEA.KPEALQAFMSVFRTAM
B9GKF2_POPTR/793-902PGVKCAIKT-P...NPEMAPLFFEAIETLL
A0BYI5_PARTE/661-768..VILNTRS-E...IEDQAYLASKYVEDFL
H3GSM2_PHYRM/731-837..LHATIKG-E...DEASGSQFADLMRRIL
I1G9C8_AMPQE/870-979GQTTLSLKT-N...AMNVVPLVQSSLDAIL
D7M945_ARALL/782-891PGLKCAVKT-P...TPEIAPLFFEAVEILF
V8NPR7_OPHHA/525-630..MQMLVKQ-TEN.KLEALQAFVSLLKTVL
B9RS58_RICCO/732-842..AQINIKA-D...DQSTSQEFSSLFQSAL
APBLA_ARATH/725-835..AQIKVKA-D...EQSTCQAFTTVFETAL
D8TL16_VOLCA/724-839..MQVTVKT-A...DTASLPAFLELWNAC.
F2UJM8_SALR5/754-862SSVKVAIRS-K...ITDVIRGLQDTLETLL
D2A641_TRICA/594-702NHATLSLKS-R...SVEVAPFVFQAYDAII
A0CBT3_PARTE/1031-1136..INLQLQV-P...HPTLMPLLYQAIGFIL
G8Z247_SOLLC/724-834..VQLKVKA-D...DQSTSQAFSELFQSAL
K3WIX4_PYTUL/809-916.STKVCLKT-E...QKAFCGVLQKTIETLF
X6NL64_RETFI/750-853.AARIQVRA-D...NKYLAFITTNAIQTLI
F4QCH4_DICFS/828-937RVVRCEYKS-P...AVDFMPLFEHTIDLLI
A2DLB3_TRIVA/703-806.ACKISLRM-K...HQEMRSLILGLITGLF
A9SX84_PHYPA/711-818..SQVKIKA-D...DASLAPHFQELFL...
B3RYW3_TRIAD/826-934PTLKLALKS-S...IAEVLPGVYQAFELIL
D2VMT9_NAEGR/798-909PQCKINTRC-A...ETQFIPFIEQDVARI.
D7SUE8_VITVI/727-838..GQIKIKA-D...DQSMSQAFSTSFQSAL
H2ZG85_CIOSA/53-165AMYNMAYKC-R...QVQVSPIIHSSIDTI.
D8LDW2_ECTSI/826-934AAPRLCIRS-E...APPYAPLALQLLEAAL
Q4DHL5_TRYCC/662-771..VNITVKS-....DNPHMPQFLLLVKKIM
W4YD47_STRPU/852-960PTIQLSLKT-R...AMDVVQDIQKAYTEIM
D8T6G5_SELML/696-805..ASVKVKS-E...DSTFTAAFSDLFKSAL
E0VK25_PEDHC/801-909PNVTLSLKS-K...AVEVASVIYQAYDAIL
T1FPB8_HELRO/834-941GVINVSIKS-R...ATEVYPYIQQSFDIIL
A0DI20_PARTE/830-935..INLQLQA-P...HPTLIPLIFQALGFIL
I1NPU6_ORYGL/778-888..AQIKVKA-D...DGTAAEAFSTLFQSAL
K1QQ16_CRAGI/821-929PNFMLSLKA-R...AMDVYQGIQQAFDNIL
F1SBR2_PIG/621-728..LQISVKQ-NEP.RTEALNSFVSVLATV.
G3PIH2_GASAC/616-726..VKVTLKQ-RPR.DEKALQGFLSILTAVL
G0QLQ6_ICHMG/869-980SGASVGCRS-T...DNNLGQIFAQYVCELL
A0DRP1_PARTE/662-769..VILNTRS-E...LEDYAYLGQKYVEDFL
B0V3P3_MOUSE/545-655..MQISVKQ-SKA.RTESLHGFVSVLETVI
A2E742_TRIVA/740-844.SCMVETLC-I...NGEIAKLIAKLIVSIL
Q23C04_TETTS/725-835..LSLCTRC-A...NEEIAAFFSKFVLGFL
E5RZZ3_TRISP/409-518SSMTLSLKS-R...NTVVVDSINQAFVTIL
B2GUA2_XENTR/836-944PNCTLSLKC-C...APEVSQFVFQAYETVV
A2FAG5_TRIVA/724-828.RVQAGIRM-Q...DNVLAPLILELVKNVI
D8LNY8_ECTSI/718-824..LELVVKS-DAPDPAESARAISGVVKEA.
Q22WH8_TETTS/880-989.SCKVICKS-K...HQNFIPLVLQLFNFLL
C3XY98_BRAFL/832-941PTMTLSLKT-R...ALDVIPQVQQAYELII
H3BCT1_LATCH/841-950CSYTLSLKC-R...APEVSQYVYQVYDAIL
A2DCQ7_TRIVA/723-827.KVQVGIKM-S...DSTVASVILELVKSII
W5MN72_LEPOC/838-946PSCTLSLKC-R...APEVSQFVFQSYEAML
Q7YZG9_CAEEL/116-225TSITLSLKS-K...NLMAIANINEVFQALL
U3JLI9_FICAL/617-727..LQVSVKQ-NEA.KPEALQSFISALRTVL
X6NIB4_RETFI/34-141.KIIVLVKS-N...DSAVSKLVLLAIQHLL
B9QK09_TOXGO/810-915NAVKLVTRS-E...AAALLPLFTSTVC...
H3DYD2_PRIPA/21-131ASLTLSLKS-R...HLTALANLNEMYQQIF
I7MFM9_TETTS/866-970QGATVGARS-Q...DQNVLQPLINGV....
D3BF27_POLPA/753-863MTLCFKSNN-QKRLHNKLVPLFLSTLSKLI
D8M378_BLAHO/682-786..CKITVKT-E...DPSHVTDFVDILKSAL
A0A068XBU3_HYMMI/884-992MSYTLSLKS-R...AMDVHPYVREAFHGIL
A0A0D2VQ42_CAPO3/713-819..LAVTLKA-D...QAPLLGEMVRIFKSC.
M4B2Y6_HYAAE/809-916.TTKVCLKV-E...QRAFLALLQQTMERLL
D8LJ03_ECTSI/311-418..LEATFKS-K...RPAVVPGFVRAF....
A9VBI8_MONBE/764-872SDVKVAVRT-S...LTDIVAGLHETVQSIL
B7S4C6_PHATC/774-888NACKICLKT-E...NATYGLLAKKALEDLL
W5MVZ4_LEPOC/612-721ADLSVTLKQ-DPK.DEEALNGVVLVLQTVL
A5PMS9_DANRE/837-945PNYTLSIKC-R...APEVSQFVYQCYELVL
I1JAF7_SOYBN/780-889PGVKCAIKT-P...SPEMSALFFEAIETLL
E2BIE2_HARSA/186-294PDVTLSLKS-R...SVEVAPGVFQAYNAIL
A2DRG8_TRIVA/716-820.KVSIGLRM-K...NMVYANIILQLVEKLL
M0RZM5_MUSAM/724-836..AQVKIKA-D...DATASEAFFGLFQSAL
M0U680_MUSAM/792-901PGVKCAVKT-Q...SPEMAPLLFEAMETLL
Q4UE05_THEAN/764-873...TFTVKC-E...SSTVLMLFAKAVEKML
Q38A51_TRYB2/655-766..VNVKVKS-....DSAHMQQFLQHFHKIM
A4RVK7_OSTLU/672-777..ATFTAKC-DGRGTNFVA......FQRLF
B7Q6V9_IXOSC/828-936PRITLSLKT-R...ALEVAAGVQQTYELIL
H3B7P3_LATCH/616-723..MQITVKQ-NDE.HKELLESFVSVIQAVI
W4ZPC2_WHEAT/22-131..AKLKIKA-D...DGATAEAFCTLFQSVL
A2DH87_TRIVA/726-830.DAQAGIRM-A...NQVIAPLILELVKNVI
Q4YJB5_PLABA/105-213..INWILKS-QSD.NADMVDQFADCFRDIF
F1KSB8_ASCSU/880-988QVLTLSLKS-R...HLAAIASLNDEYQLI.
W1NY12_AMBTC/790-899PGVKCAIKT-P...NPEMAPLFFEAMEALL
F1QV11_DANRE/615-719..LTVTVKQ-QPE.HQQTVTAFISVLQSVL
H0UVW0_CAVPO/622-732..MQISVKQ-SET.RTEILSRFISVLETVI
F0VDW7_NEOCL/814-917NAVKLVTRS-E...AAALIPLFNTTICTA.
C5LX92_PERM5/807-914QKVMVNVRT-E...TPPLVNHMHYLIESLL
E9HXR5_DAPPU/18-126PTLILAVKT-R...APDVSTGVNTAFDAIL
X6NHG8_RETFI/234-341.KLNVVVKS-K...DMWKSKLVLQALRNLL
K3WB21_PYTUL/741-848..LRATVKG-E...NDAGGAQFSELLKRVL
L5LZJ8_MYODS/823-931PNFMLSLKC-R...APEVSQHVYQAYETIL
Q8IBF8_PLAF7/746-854..INWIFKS-ECN.DENLIEQFTDCFRDIF
E4XT96_OIKDI/515-624SDVVLSLKA-R...QTEIFKFAQKAIEAIF
G3I8B9_CRIGR/380-488PNYTLSLKC-R...APEVSQYIYQVYDSIL
D0N2R3_PHYIT/388-490..FQATFKC-S...EREAASDFVT......
D7TV41_VITVI/792-901PGVKCAIKT-P...SPEMAPLFFEAIETLL
A0A0D2UCE9_CAPO3/857-966NSVDISVRT-R...SVELVPLVEAALSGIL
B8C7W7_THAPS/803-917NAAKVCLKT-E...NIAYGVQAKVALESLL
F6WLR5_MONDO/620-730..VRLSVKQ-SHV.KAEALNSFISVLKTVI
G7YBR2_CLOSI/427-535PTFTLSLKS-R...IVDVYPHVHAAFDSVL
D8SU50_SELML/758-869AGVKCAVKT-V...SPEMAPLLFDALEALL
A5KA22_PLAVS/797-905..INWILKS-QSD.DPNMLDRFTDYFRDIF
AP1B_DICDI/828-938NTCRCSSKT-T...SPDIMALFEHNLNLLI
F6U640_ORNAN/621-731..MQISVKQ-SEA.RAEALGGFVSMLKTVL
A9TVR6_PHYPA/787-898PSVKCAVKT-P...TPEMAPLFFEAIESLL
W1NSC6_AMBTC/713-827..AQIVVRA-D...DQSKSDAFSSLFESAL

PF02296

AP2A2_DICDI/872-983NMCRLTIRS-Q---SATLTNTIKNL-----
Q2GV39_CHAGB/822-941QMVRLTIRA-T---EDALPPLLLKM-----
A0A0D1CEI5_USTMA/864-977KLARLTVRT-T---NDLASAEMLRI-----
Q0UJD2_PHANO/843-955QMYRITIRA-T---DEAVPPVLIKA-----
AP2A_DROME/827-935QMFRLTVRA-S---KETVTREICDL-----
AP2A2_BOVIN/825-933QMYRLTLRT-S---RETVSQRLCEL-----
Q1EQ22_ENTHI/852-954NKACIYVRA-Q---DPSLAKVIHNL-----
A6RDP5_AJECN/812-923KMYRITIRA-T---QDAVPQALVKL-----
AP2A_SCHPO/759-869NLIRLSIRS-T---NTSIANTLAKE-----
Q5AXG4_EMENI/791-902KMYRVTIRA-T---QEEIPQALARQ-----
AP2A1_MOUSE/864-972QMYRLTLRT-S---KEPVSRHLCEL-----
Q6CBH9_YARLI/812-920..FSITIRG-T---NAVLPAIVGKC-----
A7RH33_NEMVE/829-938KMYRLTLRS-S---RPEVATHLCEL-----
A8XNZ9_CAEBR/812-920KMYRLTIRS-S---KDTVVQTLVDL-----
F7DAP0_XENTR/831-939QMYRLTIRT-S---KEEVSQTLCDL-----
H3CD15_TETNG/739-847QMYRLTLRC-S---KDSVSKRLCEL-----
Q1K5B2_NEUCR/839-954QMVRLTIRA-T---DETVPPVLLKM-----
Q4W9N5_ASPFU/811-921KMFRVTIRA-T---QEAVPQALAK.-----
Q5KEF7_CRYNJ/937-1049KLCRLTVRS-T---NEHVSAEILS.-----

PF14806

Q4QCR1_LEIMA/849-990SG.VIRIRS.N---TQTIAYGIGEKL----
B3RRM9_TRIAD/821-952TG.HIRIRA.K---SQGMALSLGDKI----
W5FP03_WHEAT/293-419SG.YITIRG.N---VQGLVLNLAHAI----
H2ZHQ3_CIOSA/820-948TG.HIRIRA.K---SQGMALSLGDKM----
A2DHS1_TRIVA/770-889EG.YMRLRC.A---SQPMAIAF....----
K3WIG6_PYTUL/846-973AG.YIRIRS.K---TQGIALSLGDRI----
H3FK41_PRIPA/830-961HG.HIRIRA.K---SQGMALTLGDKI----
R0MKS9_NOSB1/715-832NL.ECRVRS.S---KEEVVKSLND..----
K5VEM4_PHACS/747-873TG.HVRIRS.K---TQGIALSLGDRI----
U5H507_USTV1/845-972TG.HVRIRS.K---QQGIALSLGDKI----
I3EIY2_NEMP3/741-868AA.TFRIRG.S---NARVVKS.....----
B6ABN2_CRYMR/870-1013IG.TVRIRS.R---TQGIALSLGDRI----
D3BC39_POLPA/773-902VG.YIRIRS.K---VQGIAVSLGARI----
A8PX79_MALGO/824-951QG.HVRIRS.K---TQGIALSLGDKL----
E0VBA2_PEDHC/824-954IG.HIRIRA.K---SQGMALSLGDKI----
T0M089_COLGC/819-945TG.FVRIRS.R---SQGLALSLGS..----
M2N9I4_BAUCO/826-955TG.FMRIRS.R---SQGLALSLGS..----
A0BYB4_PARTE/776-899QG.FVRIRS.K---VREIVINLGDKI----
Q4GYW5_TRYB2/834-973SG.MVRVRA.N---KRPVAYGFGEKL----
A4RW30_OSTLU/802-928SG.FIRIRS.K---TQGIALSLGDKI----
Q6CT54_KLULA/827-956VG.EIRIRS.K---TQGLALTNGDNI----
F2TX28_SALR5/809-936TG.HIRIRS.K---TQGIALSLGDKI----
Q6C157_YARLI/806-939SG.HVRIRS.K---GQGLALSLGDRV----
Q23JD9_TETTS/826-950TG.TIRIRS.K---VKGVVVSIGQK.----
D7G7C5_ECTSI/824-953SG.HVRIRS.K---TQGIALSLGDRI----
U1NUD7_ASCSU/829-960IG.HIRIRA.K---SQGMALSLGDKI----
G0R5D3_ICHMG/130-255NG.YARIRS.K---AKGIVVNLGSKF----
Q1EQ38_ENTHI/776-900SG.WVRIRS.K---TQSLAINLGDRI----
Q5KDU2_CRYNJ/817-942TG.HVRIRS.K---TQGIALSLGDKI----
G0VBM0_NAUCC/829-957VG.TVRIRS.K---GQGLALSLGDRV----
H2AVM9_KAZAF/829-958VG.YVRIRS.K---GQGLALSLGDRI----
K0SE22_THAOC/829-956AG.YIRIRS.K---TQGIALSLGDRI----
W5DHI9_WHEAT/130-257SG.YIRIRS.K---TQGIALSLGDKI----
C5DI95_LACTC/829-958TG.HVRIRS.K---GQGLALSLGDRV----
G3S1L5_GORGO/813-952LGKYPRMRGPK---VQGMALSLGDKI----
F4NY13_BATDJ/819-946TG.HIRIRS.K---TQGIALSLGDKF----
Q4DQP3_TRYCC/831-971SG.VVRIRS.N---TQSIAYGIGEKL----
Q75DY5_ASHGO/827-956IG.EVRIRS.K---TQGLALTHGDSI----
M7PFS6_PNEMU/811-938VG.HIRIRS.K---TQGIALSIGELI----
D2VRU3_NAEGR/871-1000EG.VVRIRS.K---TQGIALSLGNII----
B6K5M6_SCHJY/800-928LG.HVRIRS.K---TQGVALSLGSVV----
G4TAH8_PIRID/789-916QG.HVRIRS.K---TQGIALSLGDKI----
A9V7K9_MONBE/810-937TG.HIRIRS.K---TQGIALSLGDKI----
H2VR32_CAEJA/815-946VG.HIRIRA.K---SQGMCLTLGDKL----
S9X6N0_SCHCR/811-939SG.HVRIRS.K---TQGIALTLGSLV----
G8BG98_CANPC/806-933IG.HVRIRS.K---GQGLALSLGDRV----
F0YGU1_AURAN/606-735SG.YIRIRS.K---TQGIALSLGDRI----
E5SGW1_TRISP/822-952IG.HIRIRA.K---SQGMALSLGDRM----
U9UU60_RHIID/223-350TG.HVRIRS.K---TQGIALSLGDKI----
H9JW04_BOMMO/740-864LG.HVRIRA.K---TQGPSV......----
E4XMI9_OIKDI/820-947LG.HIRIRA.K---SQGMAISLGDKI----
D8M9N0_BLAHO/805-930SG.YYRIRS.K---TQGVAISLGDVI----
C3Y7L1_BRAFL/790-921QG.HIRIRA.K---SQGMALSMGDKV----
I1G301_AMPQE/818-949QG.HVRIRA.K---TQGMALSLGDKI----
Q1EQ39_ENTHI/710-835SG.CIRIRA.K---SQGVALSLGDKI----
A0A068Y5X9_ECHMU/859-987SG.HVRIRA.K---TQGMAVTMGDKI----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window