Sequence alignment for CL0548

PF14848

E4T5P8_PALPW/4-122ILKILLTKNENY.KYSNVYNTEVLDNRNITITD--IVDEMQ-----KE.G------LDV---DRETALRIISQFNRKVTQ
D6D350_9BACE/4-125TLKGWLVDNAVTVDNKEDKILMLESAGSLTLED--ILSEMK-----KE.D------TGL---REETIEHAVKLYHRVLSD
F2NY32_TRES6/1-126MLKISLRENK.TANAKSPYHFYSENSGVLTFDE--LIDEMA-----KN.N------TTI---TKADIAGAMNVYKEVVIR
F2NW27_TRES6/6-129VWSIVLRPNPFTQDNDRDQLADVVPAAAKRDED--IADAIV-----AE.G------SEI---KKETILNILSLRNKKVFE
Q73KF9_TREDE/1-123MLKYCLRENLLT.PDENDYMAQTADVRSFSLDE--IIDLMM-----QK.G------STL---TKADTKAALQVYGEVVSA
Q73Q73_TREDE/1-124MLKYCLRENLLT.PAPDDYMAQVTDSQVFTLED--VIDRMV-----KR.G------TTV---TRTDLVAIMQLYTQECSF
F0SCQ0_PEDSD/6-130KIKAYLYDNLLTKDKPSDFIARTASERSLNVKQ--ICEEAA-----GRGG------ADV---SAAAMEHATELFLKEMAY
A6L2B2_BACV8/5-125VLKAWLVDNTVTTDDKTDKIFQLETTRSIDKEI--ILDRMV-----AK.N------PGV---RRETMALGIELMEEVVAE
A6LBW1_PARD8/4-124VLKGWLIDNAVTTDNKTDKILLLASAGSLTLDD--VLEEMY-----KQ.D------TGL---RPETMRHSVTLYHRIVMD
A6LDD4_PARD8/15-135.RKLSLRVSKSHLPGNASYKGSVVWQRTLSIDD--IAARVV-----DK.R------SEY---RKETLITTFNLLKREIYD
A6LGM9_PARD8/7-127ILTVDLYDNVLT.EKTGDFTGKIRITGTTRTSD--ISNRIV-----KK.R------TEY---RPETITNILDLSYDEMIE
D6D4G8_9BACE/8-129TLNVDLYDNIMT.EQKGDYTGRARITGSLHNKE--IAARII-----KE.R------TEY---RQETIENILDLADQKKVE
D6D8K9_9BACE/4-124VLKIWLVDNTVTVDNKDDKIGQLESSGNLSLQD--ILDEMH-----KE.D------TGL---RPETIEHVVKLYNRVVSD
J9QY98_RIEAN/3-123TLKAWLRPNLLTKDDPNDFVAVPLLGGSLGITE--IIDALK-----KE.G------MEI---KTETAVDIITRFNRKASE
Q5L7Z0_BACFN/5-125.LKGWLADNTVTTDNKEDKILVLESAGNLTLSD--VLDEMK-----KE.D------TGL---RAETLKHAVDLFQRTVSE
R6WTD6_9PORP/9-130TLNIDLYDNIMT.EKEGDYTGRPRITGTLYNKQ--IAARIV-----KA.G------TEY---KQESIEYILDRADKAKVE
R6X4U5_9PORP/16-136..KSYIRVSKSNLPGYKGYKASVIFRSTIGIET--IAERIV-----KK.R------NVY---GKETLVTAFNIIKNEIYE

PF00216

B9LTH2_HALLT/1-88----------------------------MNKAE--LIESMA.....SE-S......G.L...SKSDAKRALDTFTDATTK
B3EBV2_GEOLS/3-92----------------------------LTKNK--LIQLVA.....EQ-Q......H.I...TLKDAALLVEELITLIKA
B2JWH4_BURP8/1-93----------------------------MNKQE--LIDAVA.....AS-T......G.E...SKASTGEALDAILEAVTS
B4U8N4_HYDS0/1-90----------------------------MKKSD--IIKQID.....KY-T......N.Y...SQKDIKLVIEYFLDAIME
B4U6N1_HYDS0/1-97----------------------------MRKKD--LLDQVMIKLQKQN-T......K.L...KKRDVSRIINMFLNALED
B0SZ60_CAUSK/2-91----------------------------TTKAE--LVTAIA.....EK-A......G.I...NKNQAKDALEAFIDAVTT
Q2LU73_SYNAS/3-92----------------------------LTKNE--MMTMLY.....NQ-L......N.I...SRKECVDIVESFFEIIKS
A6W9K1_KINRD/1-89----------------------------MNKTE--MVDALE.....TR-L......G.....GRKEATAAVEAVIELIQL
Q6MI01_BDEBA/1-90----------------------------MNKAQ--LIEKIA.....TE-T......K.V...SKAQAEAILDCAVENIKK
Q73IU0_WOLPM/11-100----------------------------VTKAT--IAGDIN.....QE-I......G.L...SKEDSVSIIDDILDEIKT
A6LAJ8_PARD8/5-94----------------------------LNIQD--LAGLLS.....ER-T......G.K...DRGEVERFLRDFISVVSE
A6QBH0_SULNB/1-91----------------------------MTKAE--FVELVQ.....KN-G......E.F..ESKAAAERAVKAFITSVTE
Q88P78_PSEPK/3-92----------------------------LTKDQ--LIADIA.....ES-I......A.A...PKATAKNALEQLGQIVAD
Q310Q0_DESAG/1-90----------------------------MNKSE--LIKVLS.....EE-N......N.I...SIEEATLVVTTFVDSMKD
Q2LSR6_SYNAS/1-90----------------------------MNKSE--LIEALS.....KK-E......G.L...TEKKAIEVINLLFKGFTE
DBHA_PSEAE/1-90----------------------------MRKPE--LAAAIA.....EK-A......D.L...TKEQANRVLNALLDEITG
A7AMR9_BABBO/79-168----------------------------VTKKQ--LISEIA.....QT-T......N.M...TQKDVGIVVDEFLKSIVK
Q3J8B8_NITOC/20-109----------------------------VGDKE--LAGRIA.....KQ-T......G.M...APDQIEEVLVAFKKQIIA
Q7NFI0_GLOVI/7-97----------------------------LNRQQ--LLQQMA.....SR-V......DGL...TQKTAGAALDAALEVIAD
Q2S2T0_SALRD/3-92----------------------------MTKAD--LIDQIA.....DG-T......G.L...TKIETRAVVEGFMTAVRG
DBH_BUCBP/1-90----------------------------MNKSE--LINIIS.....KK-S......N.L...SKIQIKNILEITLTAIIQ
Q2S3N6_SALRD/8-101----------------------------ATKED--VARRVAN..IQEC-P........LY.EAKEQVRSVLTALGDLMIE
A6Q378_NITSB/1-90----------------------------MKKAE--FVQIVA.....EK-A......G.L...SKKDTQKVIDAALEVITD
Q6F136_MESFL/157-247----------------------------VSKKY--LVERLT.....EM-Y......PDY...KKKTIDEIVKNLFQNVEN
A0L9H9_MAGSM/1-90----------------------------MDAKG--LIQQIA.....RK-R......N.L...SIAQVTEIVQDLLDGVED
Q1ATP8_RUBXD/1-90----------------------------MNKSE--LIQEIA.....EK-T......N.G...SKSEAQRFFDAFAEVVRD
Q3J6Y8_NITOC/1-90----------------------------MNKTE--LVNFVV.....LK-A......N.L...SQATAQRAVNALFQTITG
Q72CZ7_DESVH/1-95----------------------------MNRKE--LVSAVQN..TLER-T......G.CK.ITRRDVERTLDVFGDVAAA
Q2GDC8_NEOSM/1-90----------------------------MKNVD--LINVVA.....EG-A......S.I...SKGHAKRAINALYEYIYE
A1A0V0_BIFAA/3-92----------------------------YNKSD--LVSKIA.....QK-S......N.L...TKAQAEAAVNAFQDVFVE
Q1J206_DEIGD/28-115----------------------------IAKTQ--IVDQIA.....ER-T......S.L...SRKQASEAVATILDTIAQ
Q0BZC9_HYPNA/2-91----------------------------LTLKH--LAAEL......SE-A......HEM...PKKQAEAVVSDFIDRMGG
Q8RES0_FUSNN/1-90----------------------------MTKKE--FVNAFA.....EK-G......E.L...KIKDSERLVNAFLETVEN
Q30VZ6_DESAG/1-95----------------------------MTKAE--LEMAVVE..VLAL-N......G.IK.ATHKAVADVISATLDVITG
DBH_UREPA/8-97----------------------------KTRSQ--MIDEL......SK-M........LN.IEKKQTKAFMDTYEAFLIL
Q01W44_SOLUE/20-108----------------------------LIKLD--IINEVV.....NR-T......G.I...TKTKAEMAVETVFESMKK
Q6F109_MESFL/281-373----------------------------VTKND--LVNSIFS..NNEN-K........L...TKVKIKKIVDSLFELMEN
Q0BSK0_GRABC/1-90----------------------------MNKME--LITAVA.....DE-L......E.L...PRSRAAQAVDAVLGSIES
Q6ANC3_DESPS/13-102----------------------------LTRKE--IAEELT.....GQ-L......G.Y...SQNICSEIVDSFLGKMKD
A6LAJ7_PARD8/1-90----------------------------MKNKE--LITELA.....NR-.........MD.WTSKEVSDMLSALSSVVSS
Q5NQY6_ZYMMO/1-90----------------------------MNSND--LVDRIA.....SG-Q......G.L...TKTDAKKLVDAVFSTIVD
Q2LSX6_SYNAS/1-90----------------------------MTKAE--LISVIA.....EE-A......G.I...TKASASKALESYVNTVAK
Q7NFV0_GLOVI/1-90----------------------------MNKGE--LVDAVA.....KK-A......K.L...AKKDVDAIVGAAFDVIVE
Q3ASB2_CHLCH/5-94----------------------------TTKID--LVTTIA.....RN-T......G.L...TKYETEAVVNCLFESIIE
A5WFT6_PSYWF/5-95----------------------------INKSD--LIQDVA.....AR-C......DYM...ADSDVDNAVREILELLSE
O67923_AQUAE/1-90----------------------------MTKSD--IAKELA.....RR-H......G.I...SYKKALLIVNMTFEILKA
Q602W2_METCA/1-92----------------------------MNQSQ--LINAIH.....ED-A.....NGSL...TKTVIQRVLIALANVAQE
A0L712_MAGSM/1-90----------------------------MTKSE--LILTIA.....AQ-K......G.L...TKQYAAMVVDLVFSELGK
A0L640_MAGSM/1-90----------------------------MNLGE--LKKIVA.....DK-T......G.M...SQADAGRAVAATLEAISE
Q7NBW7_MYCGA/2-91----------------------------LTKSE--ICKIIA.....EC-T......G.V...SPKLVKACFQVYSDLVKK
A6LB49_PARD8/1-90----------------------------MNKAE--LIEALA.....DK-T......G.L...QKQEAKKVLDAYIEIVTE
Q2INU3_ANADE/1-90----------------------------MLKSD--LINILV.....VK-R......G.V...TQKQAEATIETIFDSMKD
Q6KHG3_MYCMO/18-107----------------------------ITKKD--LIATIA.....EN-Q......N.K...SKKEVEEIVNAFLEEISS
Q4FMF5_PELUB/1-90----------------------------MNKKQ--LIAQLS.....GS-L......N.L...SKADAERTFDTITNTILD
Q5HMK7_STAEQ/4-104----------------------------LAKKD--LINEL......QE-SARVRGLE.I...TKKDAATLFSAFEDTVIE
Q0C311_HYPNA/6-95----------------------------LTRAE--VTDAIV.....RE-V......G.V...TRQESADLLDRTLDLIGA
Q83GW5_TROWT/4-93----------------------------LNRTE--LVAKVA.....ET-S......G.V...SRATVNSVIEETFAVFAE
DBH_AQUAE/1-93----------------------------MTKKE--IAEEIY.....DR-LIRDYNVK.I...QKKEVYNLVSEVFTIIQE
A1WXD6_HALHL/1-90----------------------------MNKAD--LAEKVA.....AE-T......G.V...SKRVATDAVSAVFTGIEE
A5CZA3_PELTS/1-91----------------------------MIKRD--FLEAVR.....AA-G......NYK...TLAEAKRALDAVTEAITF
A5K6B8_PLAVS/58-147----------------------------ITKKQ--IIEEVS.....ME-T......K.E...SKKTVEKIMNGIFDNIYK
Q98RC2_MYCPU/36-125----------------------------MTKKE--FMQKIS.....EH-S......F.I...SQRDVEAIINSMVFVIKE
Q4Z999_BPTWO/2-92----------------------------ANRKD--IVRRIS.....DK-T......G.Y...YMQDIEEILNAEAESIYE
A6LF78_PARD8/1-90----------------------------MNKSQ--LIEELS.....KR-V......G.N...DKAEIRYILEELNNIILE
Q4A5S4_MYCS5/1-90----------------------------MTKTE--FIKAVS.....DK-T......G.L...TVGELNRVFDGFVYVLQE
Q8EWF7_MYCPE/19-108----------------------------LTKKE--IIKLIS.....NN-S......N.I...SEPIIKELIEDLLSLIKA
Q00ZQ3_OSTTA/31-120----------------------------LNKKT--LIDAVA.....AE-T......G.E...TKASVGRVLNACFDVIGA
A1ANQ1_PELPD/1-91----------------------------MTKSE--LIEKVV.....QE-H......AVL...NMKVSEMLVNTVFDSIED
Q7NRB4_CHRVO/1-89----------------------------MTKAE--LIALLS.....DK-S......G.L...TKADVLRVLGAFDEVLLD
A5CCR4_ORITB/34-124----------------------------LNKAE--FVNFIH.....KN-N......TNM...TKADIERALNLILRGVEK
A6LHR2_PARD8/1-90----------------------------MNRRE--LVKTLA.....DK-L......S.V...TQAEAMRFVQAWEETTTE
Q02AB3_SOLUE/6-95----------------------------LTQTQ--LVRQLA.....EK-A......E.V...NNKVARALLDNLAATAIS
Q1GT13_SPHAL/1-91----------------------------MIRSE--LVQKIA.....NE-N......SDL...RVEEVERIVDTFFDSIVD
Q2JN90_SYNJB/93-183----------------------------LTRRL--LARQMA.....AQ-V......DGL...TVEMAAAALEAMLDSISQ
A1AQA1_PELPD/1-87----------------------------MTKAE--FVAAIA.....AE-L......D.V...PKNVAAETVEAFLKVTTD
Q6F0E7_MESFL/335-425----------------------------VSKKD--LLIKLE.....ET-H......SEF...SKKSVKEVVDSAFEIMSN
A0LE54_SYNFM/3-92----------------------------LTKAH--IVENLF.....AK-N......I.F...TKTESAQIIETLFEIVKQ
Q2IHA7_ANADE/1-90----------------------------MTQAQ--FFQAVA.....EG-S......Q.V...SKAQVRAVFEAVEEVVTK
E0TIA2_PARBH/1-93----------------------------MSKAE--FISNV......AA-A......GDM...SNAEAKRMVELVFGEIEA
Q73M03_TREDE/5-96----------------------------RSKID--IIDSVY.....RN-N......PQY...QLKQINAIANLFLDELSV
Q317H0_DESAG/2-94----------------------------LTKAE--FVAAFK.....DA-L......PEVF.ETKVSAEKAYDAFCQVLAD
DBH_TREPA/6-95----------------------------RTRSF--VVDALC.....DE-V......D.L...SRRHVARVVDSFVSVVTA
Q47FH4_DECAR/2-92----------------------------IVRSE--LSQRLH.....QR-F......PQL...NRGDIDVAVGEILGAIGQ
Q7NW27_CHRVO/1-90----------------------------MTKQD--LIKHLA.....AH-A......D.V...TNKQAESVLNALTTAVLD
B6V2J6_BPSP1/1-89----------------------------MNKTE--LIKAIA.....QD-T......E.L...TQVSVSKMLASFEKITTE
B9KHE3_ANAMF/5-94----------------------------LTRAR--LADEIN.....RE-I......G.I...SREDALVLVGEILDEMVS
D6Z3W1_DESAT/1-88----------------------------MLKRD--LINAVA.....EE-M......PGF...LKKDLDQALDIMLENILQ
J9ZA58_LEPFM/1-90----------------------------MTRDD--LIKRIA.....EK-N......AGI...SLSDSRELVLDLFESMKS
J9ZCC4_LEPFM/1-91----------------------------MKRLD--IVQRIL.....EK-P......E.YSRYTAKFVGQIFDGILEEISA
DBH_HELPY/1-90----------------------------MNKAE--FIDLVK.....EA-G......KYN...SKREAEEAISAFTLAVET
DBH_STRP1/3-91----------------------------.NKQD--LIAKVA.....EA-T......E.L...TKKDSAAAVDAVFSTIEA
DBH_CHLTR/4-93----------------------------MTKKK--LISTIS.....QD-H......K.I...HPNHVRTVIQNFLDKMTD
Q13L47_BURXL/53-148----------------------------.TKAS--LAAHVA.....ER-A......A.V...EPKTAKAVLAALEDTILG
Q1D6M8_MYXXD/1-91----------------------------MTRSE--LIERIV.....ER-A......THV...PRREVEAIVHAVFEEMSQ
IHFA_RHOPB/9-97----------------------------.TRVD--LCEAVY.....QK-V......G.L...SRTESSAFVELVLKEITD
Q2GG31_EHRCR/1-90----------------------------MSKDM--VVRTLM.....GE-L......G.L...TKKVSSQAYDLVMLSIQN
Q2GH63_EHRCR/1-86----------------------------MLKSH--LIQHIS.....KK-N......PSL...SEEIVSKILNIFFSLIVD
Q4AAR0_MYCHJ/7-94----------------------------MNKKE--LIEQIA.....IK-T......N.L...PIKNIELVLNEFFGITAD
Q4FLU7_PELUB/8-97----------------------------LTKKD--LINSIY.....MQ-I......G.F...SKNISENLIDDFLITIVD
Q4FNC6_PELUB/5-93----------------------------..KSK--LLKQLA.....NN-Y......PNF...LKKDLEKFTDIILTEIKQ
IHFA_PSEF5/4-92----------------------------LTKAE--MAERLY.....EE-L......G.L...NKREAKELVELFFEEIRH
DBH_BORBU/9-103----------------------------VTKSD--IVDQISLNIKNNN-L......K.L...EKKYIRLVIDAFFEELKS
Q5L7Q1_BACFN/1-86----------------------------MKKID--LIRSIA.....VK-S......N.L...KKEQIAIVVEGVMEAIAE
Q72F19_DESVH/5-94----------------------------LTKAE--IVDAIY.....EK-T......D.R...NRAEVKGVVESLLGIMKQ
Q72WT5_DESVH/5-92----------------------------.SKPQ--LVAYLR.....ER-A......H.L...TEEQALMTLKALYLFSLE
Q73G73_WOLPM/3-91----------------------------.TKSD--IIARVA.....KR-H......PFL...DKIVIAAIVDRFFGILSS
Q73IT4_WOLPM/1-95----------------------------MSKED--IIKQLKEDCSSQN-I......D.I...TKSDLSKIHDAFIKIIKN
Q83E58_COXBU/32-128----------------------------MTKSQ--ILAHLA.....ES-T......E.L...TKKQVTMIFEALSDLTHA
Q8EFV2_SHEON/1-90----------------------------MNKAQ--LIQRIA.....TS-L......E.Q...SQASTKPVVEQILQQIHI
Q8RF98_FUSNN/1-91----------------------------MTKKE--FAKLLF.....EK-G......VFT...TRTEAEKKVDIIFDSIEK
Q9CH59_LACLA/3-89----------------------------.SKQE--LIDYVA.....DR-T......E.L...SKVNAAKAINAFVEAITY
DBHB_VIBCH/1-90----------------------------MNKTQ--LVEQIA.....AN-A......D.I...SKASAGRALDAFIEAVSG
IHFB_VIBCH/1-91----------------------------MTKSE--LIERLC....AEQ-T......H.L...SAKEIEDAVKNILEHMAS
R5U7R0_9BACE/6-94----------------------------.TIQD--LTDLLA.....AK-H......S.M...TKKDAEVFVKEFFLLIEQ
R5UEH1_9BACE/1-89----------------------------MNNKE--FTSELA.....ER-L......G.Y...TIKDTSELIGSLLSDMIQ
R6T3Q9_9BACE/1-88----------------------------MTKAD--IVNEIT.....KK-T......G.I...DKQTVLTTVEAFMDAVKD
R6WNH2_9PORP/3-91----------------------------.TKRA--LIKELA.....QR-M......E.C...TDVAAKKFLNSYIELITE
R6WQH1_9PORP/1-90----------------------------MNRSQ--LINILA.....QK-T......G.L...NKKDVKRTIDEMQKLIIQ
R6Y704_9PORP/34-119----------------------------..LDA--LAEQIA.....GS-S......T.F...SYGEVKGLVENLTILIAE
S6AYA3_PSERE/1-90----------------------------MNRQE--LVKAIA.....DE-S......G.H...SQSTVGEVLNSLISTVQN

PF05261

Q93GP1_SALTY/1-126----------------------------MAKVNVYISNEVH-----NK-I------TAIVEKRRQEGARDKDISFSGTSS
A6TIF7_KLEP7/3-128----------------------------MAKIQAYVSDEVA-----EK-I------NAIVEKRKAEGAREKDVSFSSVST
E0WR85_9ENTR/1-126----------------------------MPKIQVFVSKAIL-----EN-I------NTIVIDKRNDGAKEHEANTSNTAS
W8UCC4_YEREN/1-125----------------------------MAKIQTYVNNNVY-----EQ-I------NDLVAQRKQEGV..GDANVSNIAS

PF14848

E4T5P8_PALPW/4-122EV--FTGKN--------VNTGLVNISPTV---KGSL-N..EKRWNP....R---ANRIEIGLKIGEEL.TNALSETVLEL
D6D350_9BACE/4-125LI--LSGYS--------VNTGLFRAVPQF---RGVV-D..GGQWDQ....K---KNSIYVSFTQDKDL.REAIAQTSVNI
F2NY32_TRES6/1-126YV--QLGYK--------VYCPFGQVYICA---KGTA-NDKLASFEPHLSGN---DHDLNLKLTVDSSVAKTVLANTKTER
F2NW27_TRES6/6-129YA--LSGCT--------YSNEVGSLSPRV---SGVF-EDINSVFDT....A---LHKCSFDIMPSASL.RAETSKISVKV
Q73KF9_TREDE/1-123LI--KDGAA--------VNTPLMNTSLSI---SGVF-IGATDSFDK....K---RHSVNLNLTAGPVL.KEALSKIKCEK
Q73Q73_TREDE/1-124IV--EEGGT--------LNTPLINTSMSI---SGVF-DGADDAFDK....K---RHTVNLNINAGTAL.KTAVGKVKTIK
F0SCQ0_PEDSD/6-130QL--CDGFS--------VNTGYFTASVTI---KGVF-DSPTENFNP....R---KQNLIFRFAQGDRL.RAEIKNIEVNI
A6L2B2_BACV8/5-125AL--MNGES--------VNTGLFRGVAQF---RGVA-K..QNAWDA....A---TNSIYVSLTQGKAL.REAIKDTRVDV
A6LBW1_PARD8/4-124LI--LNGYS--------VNTGLFRAVPQL---KGVV-E..GGAWNK....E---NNSIYVSFTQDKAL.REAIAKTVVEI
A6LDD4_PARD8/15-135AI--EEGYN--------VDFGFGRTELTV---NGPF-ESLYEKFDP....N---RHTLAPRLRPAPEL.KQRVANLRAVN
A6LGM9_PARD8/7-127AL--AQGRC--------VVNKFGQWLLTI---NGSF-DGKKSDFRS....T---ENKITVMFTPSATL.LKALENIYVNA
D6D4G8_9BACE/8-129AI--AEGKS--------VVDGVGQYIVTV---RGSF-LGENAQFDA....T---KHSLGVSYTPGQLL.RDQLKAVKVIC
D6D8K9_9BACE/4-124LI--LSGYS--------VNTGLYHAVAQL---RGVI-D..GGKWNP....E---KNSVYVSFTQDKEL.REAIAQTSISI
J9QY98_RIEAN/3-123LV--LNGYS--------VNTGLVYMRPAI---KGVF-Y..DKTWDK....E---KHSVYVNVNQGTDL.RKAANDTKIEI
Q5L7Z0_BACFN/5-125LV--LNGYS--------VNTGLFRAVPQF---RGVI-D..GGVWNP....E---RNSIYVSFNQDKDL.REAIARTGVKI
R6WTD6_9PORP/9-130AI--AEGKS--------VIDGVGQYLVTA---RGSF-IGENAQFDP....V---KHSLGVSYTPGQLL.RSQLKKTKVVC
R6X4U5_9PORP/16-136AI--EEGFN--------VDFGFGRTEITA---SGSF-ESLGEKFNR....K---KHTLTPCLHPSPQL.KQRTARIPVEN

PF00216

B9LTH2_HALLT/1-88AL..EKGDS...A....VLVGFGSFSISK...RSAR.TGRNPSSRNGPV......DDSPVTFDACPEF-AAALD------
B3EBV2_GEOLS/3-92TL..ESGES...L....KIAKFGLFEVKE...KHAR.RGRNPQTGE.AITI...EPRKVISFKPSVLL-RQAIN------
B2JWH4_BURP8/1-93AV..TRGETIQLI....QLIGFGSFSTGA...RLER.TGRNLSTGD.TITI...AAAKTVKFTAGKSF-MEAVN------
B4U8N4_HYDS0/1-90GL..IQDER...I....ELRRLGIFLLKK...KPSK.MVINPRTGV.QTLV...SERYLPYFKMGKYI-KKELN------
B4U6N1_HYDS0/1-97AIISKKENK...I....QLSGFGTFYIKE...RKPR.IGRNPKTGD.LYKI...PPRYNLTFKPSQNF-VLQVN------
B0SZ60_CAUSK/2-91SL..KAGED...V....RLVGFGTFKAVA...RAAG.TARNPRTGE.TVNR...PASKTARFQVGEGL-KTTLN------
Q2LU73_SYNAS/3-92EL..EKGNP...V....MISGFGKWTVRP...KRER.KGRNPQTGE.DLTI...TARKVVTFKASPNL-ISSIN------
A6W9K1_KINRD/1-89TV..AKGDK...I....AISGFGTFEKQA...RNAR.TGRNPRTGE.AVKI...KKTSVPRFRPGTAF-KEIVS------
Q6MI01_BDEBA/1-90SV..KKGDD...V....KLVGFGTFTKAK...RKAR.TGRNPQTGK.AIKI...PAAWAPKFRAGAEF-KAMVK------
Q73IU0_WOLPM/11-100SL..VKDGI...V....KISSFGTFLVKK...KKER.PGNIPNTSE.KVMI...QARNSVSFRPSKII-KKSIN------
A6LAJ8_PARD8/5-94GV..YTDKI...V....KVKGLGTFKIIS...VEKR.ESIHVNTGE.RFLI...PEHYKFSFLPDKDL-REQVN------
A6QBH0_SULNB/1-91AL..VNKDT...V....SLVGFGTFSTVD...VAEK.SGKVPGTNK.TYTK...PAHTAPKFKIGKTL-KDAVA------
Q88P78_PSEPK/3-92QL..ENGAE...I....TLPGIGKLKVSE...RPAR.TGRNPSTGA.AIEI...AAKKVVKFVPAKVL-TDAIN------
Q310Q0_DESAG/1-90AL..AEGDR...V....EIRGFGSFKVKQ...YEGY.SGRNPKTGE.IVNV...QPKQLPFFRAGKEL-KEFLN------
Q2LSR6_SYNAS/1-90EL..QKGGR...I....EIRGFGSFVVRN...YNAY.TGRNPKTGK.NIKV...SPKRLPFFKVGKEL-KERVD------
DBHA_PSEAE/1-90AL..NRKDS...V....TLVGFGTFLQRH...RGAR.TGKNPQTGQ.PVKI...KASNTVAFKPGKAL-RDAVN------
A7AMR9_BABBO/79-168HL..GENKE...V....SIAKFGLFHNSL...RGPR.LMKNLQTGE.MYTA...KPVYVPNVRFYEAV-KAEVN------
Q3J8B8_NITOC/20-109DL..ASGQE...V....RLSHFGKFYAKH...MNAR.EARNPRTGE.AIQV...PPRSYLRFKAFDTG-NSRLN------
Q7NFI0_GLOVI/7-97AL..AQGRT...V....KLSGFGSFQVRR...RPAR.TNIHPRTGQ.PVLV...PAAWNAVFSPAQAL-RERLR------
Q2S2T0_SALRD/3-92AM..KEGRR...I....ELREFGVFEVQH...RAPR.TGRNPQTNE.PVEI...EDRYKPVFRPSDKL-SEAVD------
DBH_BUCBP/1-90SL..KDGNS...V....QLVGFGTFKVNN...RAAR.IGRNPQTGQ.TIHI...SATKTPVFISGKTF-KTAIK------
Q2S3N6_SALRD/8-101A...DPERR...I....ELRNFGVFEVKK...TKAKPTARNPKTNE.PMFV...PSRRKTLFRPGKRV-EEVLK------
A6Q378_NITSB/1-90AL..KNGDE...V....AFIGFGTFTTAQ...RAAR.EAKVPGTDR.VVKV...PATRVVKFKVGKKL-KEAVA------
Q6F136_MESFL/157-247HL..ISGEE...V....IIENFGKLIKVE...KPVK.QAINPSNGE.IVEV...PATTIIKFKPSRNL-KLIMS------
A0L9H9_MAGSM/1-90CL..SRHEP...V....ILPEFGQFAVKK...VPPW.LGRHPQTGE.MMKL...PGKNVPFFKSDSEL-RKRLN------
Q1ATP8_RUBXD/1-90SL..KKGEP...V....QITGFGKFYVQE...REAR.EGINPQTKQ.KITI...PPSKVPKFTAGNSL-KEAIR------
Q3J6Y8_NITOC/1-90VL..SEEGR...V....NLVGFGSFSVQK...RAAR.SGRHPQSGE.VIII...QAKSAPTFKPSKAL-KEIVQ------
Q72CZ7_DESVH/1-95EL..LEGGD...V....PLPVLGKLRSVE...RAAR.AGRNPRTGE.SIAI...PARRVVTFKAGKDL-REALG------
Q2GDC8_NEOSM/1-90SL..KRRKS...I....RIPKIGTLSVVK...KKAT.TYCDPKTKQ.MVRQ...AETERVKFTISSVV-KGDLR------
A1A0V0_BIFAA/3-92AM..QSGEG...L....KLTGLFSAERVK...RAAR.TGRNPRTGE.TIEI...PATYGVRISAGSLL-KKAVT------
Q1J206_DEIGD/28-115AL..REGKT...V....GLPGLGTLSVTE...TAAR.TGVRPGTSE.RIQI...PAGKKIRFKVATTL-KG..N------
Q0BZC9_HYPNA/2-91HL..KKGKK...L....RIAGLGILQVRK...SPAR.KGRNPATGE.EIKI...KASKKVAFRPSKDL-KERVL------
Q8RES0_FUSNN/1-90AL..LKGDG...V....RFIGFGSWEVKE...RSAR.EVKNPQTGK.MIKV...EAKKVVKFKVGKPL-ADKVA------
Q30VZ6_DESAG/1-95EL..AGGDP...V....RLTGFGAFKVTR...RTAR.IGRNPKTGE.PVEI...PASTGVKFSPGKTL-KEALN------
DBH_UREPA/8-97EL..SRAKE...V....RLGNIGKFKVSV...RAER.KGINPKTGE.TVII...PEKTIPKFTFTKGI-KEIIN------
Q01W44_SOLUE/20-108AL..EQGDR...I....ELRGFGVFNVKP...RKTG.IGRNPRTGA.EVSI...PPGKAVRFKPGKEL-.QTLQ------
Q6F109_MESFL/281-373NL.VNEGSE...I....KINNFAKFSTVF...VDET.TMKDMKTGE.LKMV...PSRKTIKFKSLKGL-RESLN------
Q0BSK0_GRABC/1-90AL..KRHEE...V....RLVGFGSFSVAS...RKAS.VGRNPRTGE.EIAI...PPALSVRFKAGKTL-KDALN------
Q6ANC3_DESPS/13-102AL..IEGES...I....KLVHFGTFTVRD...KAPR.TGRNPRTGE.PITI...TKRQAVSFRPSKKL-REQVN------
A6LAJ7_PARD8/1-90KL..VDNDT...I....YLQGFGQFEVKK...KAER.ISVNPANGK.RYLV...PPKLVPVFKPGTTV-KNRLK------
Q5NQY6_ZYMMO/1-90AA..VAGEE...I....ALNGFGKFKVKH...SAAR.KGHNPATLQ.EIEI...PASNRLTFTSAKAV-KDRLN------
Q2LSX6_SYNAS/1-90EL..NKTGK...L....GLVGFGTFSVVM...REAR.EGRNPQTGD.IIKI...PAKKVVKFKPGKEL-SEKIK------
Q7NFV0_GLOVI/1-90AV..SRGDK...V....TLVGFGSFEPRK...RAAR.EGRNPKTRE.KMTI...AATTVPAFSAGKQF-REAVS------
Q3ASB2_CHLCH/5-94SL..KAGRR...I....EIRGFGSFNIRQ...KNVR.KARNPRTGE.KVMV...ESKQVPSFKISREF-KLAVS------
A5WFT6_PSYWF/5-95KL..ISNNR...I....EVRGFGTFCLHH...REAR.QGRNPKTGE.MVLV...PQKAIPHFKPGKAL-REGVN------
O67923_AQUAE/1-90KI..LNGEK...V....EVRGLGTFKLKR...KPGR.FVKNPKTGI.EIYV...KERYVPYYKMSKLL-RKKLN------
Q602W2_METCA/1-92AL..ANGDE...V....TIPGVAKLTVKE...RAAR.TGRNPQTGE.TVEI...PAKRVARASFVKAL-KERVQ------
A0L712_MAGSM/1-90AL..AKGER...V....ELRGFGVFEPRA...RKPR.AARNPKTGE.KVAV...ESKTAVHFKPGLDM-RKRVD------
A0L640_MAGSM/1-90SL..GQSAT...V....SLLGFGTFSVGE...RAAR.EGRNPQTGE.KINI...SASRTIRFKAGQSL-REKVN------
Q7NBW7_MYCGA/2-91EI..KSQGQ...V....RLPELGTFRVTI...GRER.ISVNPITGA.QTRI...PPKPKVKFRAAKPL-KEVTA------
A6LB49_PARD8/1-90RM..SENEE...I....VLVGFGTLIPRP...QTQR.LARNPKTGT.PVMI...PARTTVKFKPGKFL-LEAMN------
Q2INU3_ANADE/1-90AL..CKGEN...I....EIRGLGAFHVKH...YDGY.QGRNPKTGE.VIPV...KPKRGILFRTGKEL-RDRVN------
Q6KHG3_MYCMO/18-107EL..VADKK...I....NLSSFGIFEISE...RAAR.SGINPKTSE.IIQI...KATKSVKFKVSKSL-KDQVN------
Q4FMF5_PELUB/1-90AL..KGDDT...V....KIAGFGTYKVAK...RKAR.VGRNPRTGE.QIQI...GASQKVKFLPAKAL-KEIFN------
Q5HMK7_STAEQ/4-104AI..HAADE...VGYDSFSTNFGTFKIVE...VSEK.SGVSRLGGEEKFWT..SPAHKTVRFKLNKSV-KDKLK------
Q0C311_HYPNA/6-95AL..EQEQE...V....KLARFGNFVVRS...KAAR.EGRNPKTGE.EAPI...AARRVVTFRPSPML-KSQVG------
Q83GW5_TROWT/4-93TV..RAGGK...V....TIPGWCSVTRSH...RAAR.TGRNPQTGK.TVEI...PAGYSVRIAPGSKL-KAAVK------
DBH_AQUAE/1-93CL..LKGEK...V....KISGFGTFVVKT...RKPK.KGMNIKKRE.IVEV...PERKIVLFKPSKNF-...IK------
A1WXD6_HALHL/1-90SL..ASGED...V....SIPGFGKFAVVA...RPER.QGRNPQTGE.LIDI...PAGMNVRFKPGAPL-KRSVD------
A5CZA3_PELTS/1-91AS..ANHNT...V....RLRGFGAFIIRD...RSPR.AGRDIRTGQ.PISI...PAKKVIVFKPGKAL-RQAVL------
A5K6B8_PLAVS/58-147HL..ENNEK...I....YIHKFGMYYNIF...RKKR.CIKNMRTKE.DIHI...ESSHMPHFKFSKIF-RDLIK------
Q98RC2_MYCPU/36-125SL..ISEEK...V....TIPMLGTFETKI...KAAR.EGIKFTTGE.KILI...PEKRVVKFKPTKYI-KEVVN------
Q4Z999_BPTWO/2-92LL..KEGND..KI....KYHKFYQIEVET...REPK.EAWDGLNKR.YFQI...PEKKYIKFRPMSEL-EKVIK------
A6LF78_PARD8/1-90KT..RAGEK...V....CIQGFGVYTPRL...QTSR.LARNPKSGE.TLML...IPRTIVHFKCAPNL-LKEIN------
Q4A5S4_MYCS5/1-90QL..VAGEK...V....QLSNLGIFDVAT...RAER.TIKNHFTGK.EQVV...AAKKVVKYKPSKYL-TDVVN------
Q8EWF7_MYCPE/19-108EL..DRCEQ...F....RLFDLGKIKVKP...GHKK.LTTNPLTGE.TSTE...WTKSKIKFVFSKQY-KELVE------
Q00ZQ3_OSTTA/31-120TV..QSGDK...V....AISKFGTFARKT...RAAR.DGRNPMTGA.PLKI...PATDYPSFSASSTW-KDAVA------
A1ANQ1_PELPD/1-91AL..RAGDK...V....EIRGFGSFTIRE...RTGR.EARNPKSGE.VVSI...PAKKTPFFKTGKDL-KERVN------
Q7NRB4_CHRVO/1-89TL..ADNGE...I....SIVA.GKFKVKE...TAAR.TGRNPKTGE.TIQI...AAKRKVSFVASKQL-KDRIA------
A5CCR4_ORITB/34-124AI..ENGHD...I....NIVGFGSFCVRF...RAAR.DGHNPKTGA.KIII...PESYQVVFKPGKTL-KDACN------
A6LHR2_PARD8/1-90AL..ESDGS...L....MLLGFGTLSAWE...QTER.IGRNPKNGV.AYMI...RARKSVKFKPGKLL-LKQLN------
Q02AB3_SOLUE/6-95EV..KKNGV...F....VLPGIGRLVRVD...RKAR.MGRNPATGE.AIKI...AAKKVVKFRVAKSA-KDAIV------
Q1GT13_SPHAL/1-91QL..ATGGR...V....ELRGFGAFSTRA...RESR.TGRNPRTGA.AVEV...KAKKVPYFKPGKEM-RERLN------
Q2JN90_SYNJB/93-183CL..AQGGS...V....RLARFGTFSLRH...RPAR.QTYHPRTKA.PVHI...PAADVPHFVPSPEL-GRPAG------
A1AQA1_PELPD/1-87LL..KAGDK...I....TFPGFGTFGVSE...RAAR.TGRNPQTGA.EIQI...AASKSGKFTAGKNL-K...N------
Q6F0E7_MESFL/335-425AI..INNEE...V....LISNFGKLTKIH...KEAK.KGINPSTGE.TIDI...PASNTVKFKANKHL-KENMS------
A0LE54_SYNFM/3-92TL..EHGED...V....LISGFGKFSVKE...KNQR.RGRNPQTGD.PIML...SPRKVVTFKCSGVL-RERIN------
Q2IHA7_ANADE/1-90RL..KAEGK...I....PLGGLGAVKLVD...RKAR.IGRNPATGE.QIKI...PARTAIKLTPAKAL-KDIFN------
E0TIA2_PARBH/1-93GL..KRAKKDGKY....TIGTFGTFTITK...RPAR.KGRNPRTGE.EIKI...KASKSLRFRPSSNL-KAAAG------
Q73M03_TREDE/5-96LL..QQGIP...V....EIRGLGSFDFAV...LHGRKNARNPKTGE.AVLT...ADRCKVRFKPGKEL-KEALH------
Q317H0_DESAG/2-94GI..AKNEG...V....RLPNVGALTVAE...RAER.QGRNPQTGQ.PMTI...PARKVVKFSPAKSL-VDGVN------
DBH_TREPA/6-95AL..ERGET...V....ELRDFGVFESRV...RKAS.VGKSIKTGE.VVSI...PSHCVVVFRPSKRL-KSAVR------
Q47FH4_DECAR/2-92QL..AKGGR...V....EVRGFGSFALNY...RPPR.LGRNPMTGE.RVAV...PAKWTPHFKAGKEL-RELVM------
Q7NW27_CHRVO/1-90TV..RAGGE...L....AISDLGKFGTTQ...RAAK.TGRNPKTGE.TIQI...AAKRAPKFSPAKAL-KDAAA------
B6V2J6_BPSP1/1-89TV..AKGDK...V....QLTGFLNIKPVA...RQAR.KGFNPQTQE.ALEI...APSVGVSVKPGESL-KKAA.------
B9KHE3_ANAMF/5-94SL..VRGGL...L....KISSFGTFKVIR...KKER.IGRNPKTLE.QFIV...KEHNTVTFCPSVTM-KRLIN------
D6Z3W1_DESAT/1-88AL..EDNRR...V....EIRGFGSFSVRE...RKAR.TTKNPRTGK.VMHI...PPRKNVHFTMSKSL-KD...------
J9ZA58_LEPFM/1-90VI..LEGES...L....EIRRFGVFEIHH...RKPR.IARNPRTGE.KVSV...GERKSLIFRPGKIL-KLRM.------
J9ZCC4_LEPFM/1-91TL..ENGED...V....KITGFGTFIVRK...INDR.PGRNPKTGE.PVLI...PAHHTVLFHPSRSL-LKA..------
DBH_HELPY/1-90AL..SKGES...V....ELIGFGKFETAE...QKGK.EGKVPGSDK.TYKT...EDKRVPKFKPGKTL-KQKV.------
DBH_STRP1/3-91FL..AEGEK...V....QLIGFGNFEVRE...RAAR.KGRNPQTGA.EIEI...AASKVPAFKAGKAL-KDAVK------
DBH_CHLTR/4-93AL..VQGDR...L....EFRDFGVLQVVE...RKPK.VGRNPKNAAVPIHI...PARRAVKFTPGKRM-KRLI.------
Q13L47_BURXL/53-148AV..HKKGAG.EF....TLSGLLKIVVQAVPAKKKR.FGKDPFSGE.ERWFPAKPASVRIKARPLKKL-KDAA.------
Q1D6M8_MYXXD/1-91AL..IAGRR...I....ELRGFGVFCVRT...RRAR.TGRNPKTGQ.RVSV...PARRTLSFAAGKDL-RERLN------
IHFA_RHOPB/9-97CL..EKGET...V....KLSSFGSFMVRK...KGQR.IGRNPKTGT.EVPI...SPRRVMVFKPSAIL-KQRIN------
Q2GG31_EHRCR/1-90AL..ETSHL...I....RLHNVGTLHVIQ...CAEK.KYHNPKTGK.LETL...APKKRVRFRSSKKL-SNAIN------
Q2GH63_EHRCR/1-86YL..KNDCR...V....ELRGFGSFTVRS...YNIK.TA.....NA.RLAK...SKYKKVYFRASSKF-IKIIN------
Q4AAR0_MYCHJ/7-94VV..KKQGK...L....VINSFGTFQGVF...KPAS.SSFNPLTKT.QITV...NAKTTVRFKPSKVL-KDF..------
Q4FLU7_PELUB/8-97NL..KIEKK...L....KLSKFGTFSIRA...KKSR.IGRNPKTKE.QTTI...SNRDVVLFKASKEF-KDLVN------
Q4FNC6_PELUB/5-93AL..KRGDR...V....ELRGFGMFSTNI...QKAR.ISRNPKTGE.KVNT...PEKKTIHFKMSKEM-FKKLN------
IHFA_PSEF5/4-92AL..EDNEQ...V....KLSGFGNFDLRD...KRQR.PGRNPKTGE.EIPI...TARRVVTFRPGQKL-KARV.------
DBH_BORBU/9-103NL..CSNNV...I....EFRSFGTFEVRK...RKGRLNARNPQTGE.YVKV...LDHHVAYFRPGKDL-KERV.------
Q5L7Q1_BACFN/1-86AL..HQGES...V....TLVGFGTFEVKE...RKAR.KGYNLSTGE.IMTI...PGKKTVRFKPGAKM-N....------
Q72F19_DESVH/5-94AI..KKDHA...L....LISGFGKFEAYD...KKAR.KGRNPQTDE.TITL...PPRKVVVFRLSRKF-RAELN------
Q72WT5_DESVH/5-92HL..EKGVG...V....VLPDIGQIKPSM...GKGG.VGRNFRTGE.ATVI...EPKLKLTFSASKAL-KEPL.------
Q73G73_WOLPM/3-91TL..KHHNR...V....EIRGFGSFSVRS...YNLK.ETS.HLMLQ.KFTK...NQYFKTYFRSSKKL-SDLIN------
Q73IT4_WOLPM/1-95EL..HGKGE...I....RLHGIGTFSTAI...SQEK.QCRNPQSGQ.IMTV...PKKTRVKFKASQTL-LSILN------
Q83E58_COXBU/32-128HL..KKGGAG.EF....VVPGLCKCSVKRKPATKAR.KGINPFTGE.SMTFKAKPARNVVKIRPLKRL-KEMV.------
Q8EFV2_SHEON/1-90AL..SEGEK...V....FLPLFGTFELRY...HLPK.SGRNPQTGE.AIEI...AGFNQPSFKAATAL-KQAIN------
Q8RF98_FUSNN/1-91IL..LDGEN...L....SIINWGKLEIVE...RAPR.LGRNPKTGE.EVKI...GKRKSVKFRPGKAF-LEKLN------
Q9CH59_LACLA/3-89YI..SEGTP...V....HISNFGTFEVRK...RAAR.VSHDVHSRE.KILV...GEQNIPVFRAGKAL-KLA..------
DBHB_VIBCH/1-90TL..QSGDQ...V....ALVGFGTFSVRT...RAAR.TGRNPKTGE.EIKI...AEAKVPSFKAGKAL-KDACN------
IHFB_VIBCH/1-91TL..EAGER...I....EIRGFGSFSLHY...REPR.VGRNPKTGD.KVEL...EGKYVPHFKPGKEL-RERVN------
R5U7R0_9BACE/6-94AL..ENEKT...V....KIKGLGTFKLID...VDSR.ESVNVNTGE.RFQI...KGHTKVSFSPDANL-RDTIN------
R5UEH1_9BACE/1-89EL..EEGNV...I....AVQGFGSFEVKK...KAER.ISINPASKQ.RMLV...PPKLVLSYKPSNTL-KDKF.------
R6T3Q9_9BACE/1-88SL..SNDEN...V....YLRGFGSFVVKK...RAQK.TARNISKNT.TIII...PEHNIPAFKPAKTF-TIS..------
R6WNH2_9PORP/3-91KL..SEGEG...V....SIHYFGKLVPHY...QTER.PGRNLRTGE.ECKI...RARTSVKFKASEIL-IQKLN------
R6WQH1_9PORP/1-90EV..KGGQR...I....CLHGFGSFKPRF...QSSR.PARNLKNGT.AVQL...SPRTIIHFKCAPHL-LEQMN------
R6Y704_9PORP/34-119AL..EGGNT...V....TIDGLGTFSVTA...RPNR.EVEDPLKIR.AESI....KLKGIGFKPSPKL-KERL.------
S6AYA3_PSERE/1-90VV..AGGDK...V....SLVGFGTFESTK...QAER.QGRNPSTGA.PITI...AASIKPKFTPGKSF-KERVN------

PF05261

Q93GP1_SALTY/1-126ML---------------LELGLRVYEAQM---ERKE-SPFNQTEFN-KVLL---ENVLKTQSSVAKILGIGSLSPHVAGN
A6TIF7_KLEP7/3-128ML---------------VELGLRVYEAQM---ERKE-SGFNQMAFN-KVLL---ETVLKTQFATNKILGISCLSPHISGN
E0WR85_9ENTR/1-126ML---------------IELGLKVYELQQ---KKTD-SNFNQTEFN-KVIL---ENVVKTSFICQKLLGINSFMSEIQDN
W8UCC4_YEREN/1-125ML---------------LELGLRVYNIQR---EKRE-GGFNQMEYN-RLML---DHMTRVRAMCTEIMKMGALSQESIAS

PF14848

E4T5P8_PALPW/4-122...I--------------------------
D6D350_9BACE/4-125LG.E--------------------------
F2NY32_TRES6/1-126...V--------------------------
F2NW27_TRES6/6-129TG.C--------------------------
Q73KF9_TREDE/1-123TE.A--------------------------
Q73Q73_TREDE/1-124TETA--------------------------
F0SCQ0_PEDSD/6-130LG.V--------------------------
A6L2B2_BACV8/5-125LG..--------------------------
A6LBW1_PARD8/4-124LG..--------------------------
A6LDD4_PARD8/15-135E...--------------------------
A6LGM9_PARD8/7-127D...--------------------------
D6D4G8_9BACE/8-129NG..--------------------------
D6D8K9_9BACE/4-124LG..--------------------------
J9QY98_RIEAN/3-123LG..--------------------------
Q5L7Z0_BACFN/5-125LG.A--------------------------
R6WTD6_9PORP/9-130NG..--------------------------
R6X4U5_9PORP/16-136IT..--------------------------

PF00216

B9LTH2_HALLT/1-88------------------------------
B3EBV2_GEOLS/3-92------------------------------
B2JWH4_BURP8/1-93------------------------------
B4U8N4_HYDS0/1-90------------------------------
B4U6N1_HYDS0/1-97------------------------------
B0SZ60_CAUSK/2-91------------------------------
Q2LU73_SYNAS/3-92------------------------------
A6W9K1_KINRD/1-89------------------------------
Q6MI01_BDEBA/1-90------------------------------
Q73IU0_WOLPM/11-100------------------------------
A6LAJ8_PARD8/5-94------------------------------
A6QBH0_SULNB/1-91------------------------------
Q88P78_PSEPK/3-92------------------------------
Q310Q0_DESAG/1-90------------------------------
Q2LSR6_SYNAS/1-90------------------------------
DBHA_PSEAE/1-90------------------------------
A7AMR9_BABBO/79-168------------------------------
Q3J8B8_NITOC/20-109------------------------------
Q7NFI0_GLOVI/7-97------------------------------
Q2S2T0_SALRD/3-92------------------------------
DBH_BUCBP/1-90------------------------------
Q2S3N6_SALRD/8-101------------------------------
A6Q378_NITSB/1-90------------------------------
Q6F136_MESFL/157-247------------------------------
A0L9H9_MAGSM/1-90------------------------------
Q1ATP8_RUBXD/1-90------------------------------
Q3J6Y8_NITOC/1-90------------------------------
Q72CZ7_DESVH/1-95------------------------------
Q2GDC8_NEOSM/1-90------------------------------
A1A0V0_BIFAA/3-92------------------------------
Q1J206_DEIGD/28-115------------------------------
Q0BZC9_HYPNA/2-91------------------------------
Q8RES0_FUSNN/1-90------------------------------
Q30VZ6_DESAG/1-95------------------------------
DBH_UREPA/8-97------------------------------
Q01W44_SOLUE/20-108------------------------------
Q6F109_MESFL/281-373------------------------------
Q0BSK0_GRABC/1-90------------------------------
Q6ANC3_DESPS/13-102------------------------------
A6LAJ7_PARD8/1-90------------------------------
Q5NQY6_ZYMMO/1-90------------------------------
Q2LSX6_SYNAS/1-90------------------------------
Q7NFV0_GLOVI/1-90------------------------------
Q3ASB2_CHLCH/5-94------------------------------
A5WFT6_PSYWF/5-95------------------------------
O67923_AQUAE/1-90------------------------------
Q602W2_METCA/1-92------------------------------
A0L712_MAGSM/1-90------------------------------
A0L640_MAGSM/1-90------------------------------
Q7NBW7_MYCGA/2-91------------------------------
A6LB49_PARD8/1-90------------------------------
Q2INU3_ANADE/1-90------------------------------
Q6KHG3_MYCMO/18-107------------------------------
Q4FMF5_PELUB/1-90------------------------------
Q5HMK7_STAEQ/4-104------------------------------
Q0C311_HYPNA/6-95------------------------------
Q83GW5_TROWT/4-93------------------------------
DBH_AQUAE/1-93------------------------------
A1WXD6_HALHL/1-90------------------------------
A5CZA3_PELTS/1-91------------------------------
A5K6B8_PLAVS/58-147------------------------------
Q98RC2_MYCPU/36-125------------------------------
Q4Z999_BPTWO/2-92------------------------------
A6LF78_PARD8/1-90------------------------------
Q4A5S4_MYCS5/1-90------------------------------
Q8EWF7_MYCPE/19-108------------------------------
Q00ZQ3_OSTTA/31-120------------------------------
A1ANQ1_PELPD/1-91------------------------------
Q7NRB4_CHRVO/1-89------------------------------
A5CCR4_ORITB/34-124------------------------------
A6LHR2_PARD8/1-90------------------------------
Q02AB3_SOLUE/6-95------------------------------
Q1GT13_SPHAL/1-91------------------------------
Q2JN90_SYNJB/93-183------------------------------
A1AQA1_PELPD/1-87------------------------------
Q6F0E7_MESFL/335-425------------------------------
A0LE54_SYNFM/3-92------------------------------
Q2IHA7_ANADE/1-90------------------------------
E0TIA2_PARBH/1-93------------------------------
Q73M03_TREDE/5-96------------------------------
Q317H0_DESAG/2-94------------------------------
DBH_TREPA/6-95------------------------------
Q47FH4_DECAR/2-92------------------------------
Q7NW27_CHRVO/1-90------------------------------
B6V2J6_BPSP1/1-89------------------------------
B9KHE3_ANAMF/5-94------------------------------
D6Z3W1_DESAT/1-88------------------------------
J9ZA58_LEPFM/1-90------------------------------
J9ZCC4_LEPFM/1-91------------------------------
DBH_HELPY/1-90------------------------------
DBH_STRP1/3-91------------------------------
DBH_CHLTR/4-93------------------------------
Q13L47_BURXL/53-148------------------------------
Q1D6M8_MYXXD/1-91------------------------------
IHFA_RHOPB/9-97------------------------------
Q2GG31_EHRCR/1-90------------------------------
Q2GH63_EHRCR/1-86------------------------------
Q4AAR0_MYCHJ/7-94------------------------------
Q4FLU7_PELUB/8-97------------------------------
Q4FNC6_PELUB/5-93------------------------------
IHFA_PSEF5/4-92------------------------------
DBH_BORBU/9-103------------------------------
Q5L7Q1_BACFN/1-86------------------------------
Q72F19_DESVH/5-94------------------------------
Q72WT5_DESVH/5-92------------------------------
Q73G73_WOLPM/3-91------------------------------
Q73IT4_WOLPM/1-95------------------------------
Q83E58_COXBU/32-128------------------------------
Q8EFV2_SHEON/1-90------------------------------
Q8RF98_FUSNN/1-91------------------------------
Q9CH59_LACLA/3-89------------------------------
DBHB_VIBCH/1-90------------------------------
IHFB_VIBCH/1-91------------------------------
R5U7R0_9BACE/6-94------------------------------
R5UEH1_9BACE/1-89------------------------------
R6T3Q9_9BACE/1-88------------------------------
R6WNH2_9PORP/3-91------------------------------
R6WQH1_9PORP/1-90------------------------------
R6Y704_9PORP/34-119------------------------------
S6AYA3_PSERE/1-90------------------------------

PF05261

Q93GP1_SALTY/1-126PKFEYANMVEDIKEKVSSEMERFFHENE.E
A6TIF7_KLEP7/3-128QKFEWRFMIDTILEDTKEVVDTFFPESE.D
E0WR85_9ENTR/1-126EKLDYKLMAYAVRNDTAEVINEFFPKNE.E
W8UCC4_YEREN/1-125GNFELEVIKKAVARYAEEQTSIFFPDEEDE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window