Sequence alignment for CL0551

PF10186

A2R922_ASPNC/36-386SCHTCFRAP.ASRTRFFCPTCARN...........Q...LYQLRVETARVLLEKQSIAERIQAGVILETTQAEWSGEIKE
A6RN46_BOTFB/2-356QCDICFRTG.GHKLPFLCPTDARN...........Q...LYELRVQTAGIHLEKDAIDREISRRCPLPLSKAERSSNETS
A7F2W3_SCLS1/2-356QCDICFRTG.GHKLPFLCPTDARN...........Q...LYEFRVQTAGVLLEKDALDREISGRFPPPSSKGIKKEDEPP
A7SI99_NEMVE/2-360TCPLCL....RRSKYLTCCSCLRSGSVTHTGK...RPESYCEKVKRLADLKHVKEAFQKRVTEEIA..............
ATG14_VANPO/4-287QCSVCR....NHVQSMYCAHCINT...........SPNLLHPLRMQLLMVQQKNKVLKGKVEDILSHALDKNWKSSDNDT
A9TM71_PHYPA/7-362VCGICE....SVNLPSVCSACINY...........R...LLERYKLLKNLAQGRDFLRQRLDEKLI..............
B0DVS0_LACBS/2-334DCKICE....FKQRQFFCQTCLKT...........H...LRDFQHQTQHFAADRDEQVLKASKALE..............
B0YA63_ASPFC/2-386NCPICSRVS.SSRLRFYCPTCACN...........Q...IYTLRIDNARALLEKETLGRQVEKALLHQTSPTLSYHRFEE
B2AYN4_PODAN/6-338NCDICHRGHHSKDRPFLCVVDARN...........R...LYETRLEYTKALIETDQLEREVNAAISSETGQIPN......
B2WCB9_PYRTR/2-373ECDICGRDG.SLSQPLHCITCARA...........Y...LEHPRIELAKTLIDLDGVEKHVKAIINGSEDKAIQHVSLTD
B4F8Q5_MAIZE/9-367SCALCE....GSNLPSCCASCVNA...........R...LVEYHTRLRMMRSLRDSLHGRIAARLE..............
B6HV92_PENCW/42-413SCSICSRAP.HSRLSFHCPTCARN...........Q...LYQLRIDSTQVLLEKEVLGKQIESAVTCGSPWDKPSPHAQD
B6K450_SCHJY/2-286RTSTGPHNS.LERRKPLCGYEATS...........R...LVALAYCVQDLMRVQLRLKQEIQQHM...............
B6QMH1_PENMQ/2-365SCSICTCSA.SNRTPFYCPTCARS...........H...LYTLRYENARVLLEKESIGKEVEAAVAGNTGVQRRQQQQNA
B8B4V4_ORYSI/14-362CCALCE....GSNLPSCCSACVNS...........K...LAEYHAKLRMMKNLRDSLNARIATRLD..............
B8NYP4_ASPFN/2-372SCHVCSRAP.TSRLKYLCPSCARN...........Q...LYQLRIENARILLENESLGQQINETVSSTSILEALSERPDS
B9GUI0_POPTR/7-365CCAICE....NSNRASICPICVNY...........R...LNEYGTLLKSLNSRRDSLYSKLSVVLI..............
C0NNR8_AJECG/2-365NCHVCDRGP.NSQHHLLCPTCTRN...........Q...LYPLRFDHARVLLEKEAIGKKIKAAVATENTYDTESVENGC
C0RX80_PARBP/2-365SCHVCNRGP.NTRLQLLCPTCSRN...........H...LYPLRFDHAKVLLEKEALGKEIEAAVAVKDTGNIGFAENEQ
C4JIE0_UNCRE/2-361SCQLCGRSP.GSSLPFYCLTCARN...........Q...MYPLRFEIAKTLLEKEAAGQQIEEAV..SDATRTDEGENER
C5DLA9_LACTC/4-280KCCTCH....RQSKVMYCSHCINT...........SPRLLLRYKMELYQVTAAREELRAQVDEILRDAMNGDEQPS....
C5DUI4_ZYGRC/2-311QCSICH....KSGRPMYCAHCMSS...........SPHMLLKLKLDLLILRETNGHLKSRVEDILEYGLGQIAGKEPKSA
ATG14_YEAST/2-295HCPICH....HRAHVVYCAHCINT...........SPSLLLKLKLDLILLKDENKELNGKVEQILNEAMNYDQLDIKRME
Q0TZA4_PHANO/2-373ECDICGKAG.NLTHPLHCITCARS...........H...LEQPRIDLARTLIDKDGVEKHVKAIIQGSEDKSSQHVSLSD
Q147F2_ARATH/6-368KCAVCY....KSFRPSICVDCVNR...........G...LNEYKVKLDSLKSLREVSYFRLSGLLV..............
Q17M47_AEDAE/34-384RCPLCN....YSKRHFHCKSCIRKGDFIHSTH..HILERFSEKQLRHMNLKSAHATLEGKCVKLLE..............
Q2HG05_CHAGB/2-272NCSICHRPHHARKLPFLCAMDARN...........C...LYESRIDYVQALIENEDAERRVEAVLSSEA...........
Q54QH5_DICDI/6-304NCCSCNNR..FNFQESYCEPCLQRIKN........DQSRVFELIQSIFDKKKANLIAKNKILESISQPKNQ.........
Q5KCM1_CRYNJ/8-348NCNCCQ....VNQKALYCPACLRE...........G...ITLHKELLQNLQARLSTIRQHSQKLLTGTENETKDKADR..
Q6C401_YARLI/66-385PCSICDQR..VPEHHMMCCGCANY...........S...ILAHRVAQIKIDASLDTVTQKIENIDKLDCPDKDPGT....
ATG14_KLULA/3-281HCGICGSPK.IPNVEFLCAHCING...........SPSILLRDKLKLLLLRQEVEQLKHDVGEQLEAGFAGN........
ATG14_CANGA/4-309QCPICE....TQSHVFYCAHCINS...........SPDLLIRLKFDLYILGKINNALRNKVDQYLEEVDDELNTNIRNGE
Q6NWB8_DANRE/17-367RCPLCN....TARRRLTCARCIQNGDFVYFDG..RNPERYSEKLERLQKLKNEKEDLQQRVIKAMD..............
BAKOR_HUMAN/42-389RCPLCN....TTRRRLTCAKCVQSGDFVYFDG..RDRERFIDKKERLSRLKSKQEEFQKEVLKAME..............
ATG14_ASHGO/2-272QCTICH....RPSTVWYCAHCVNT...........SPKLILRYKLELTQICEEVTEMRDIVTSTLENAISEKE.......
Q7Q037_ANOGA/42-403RCPLCG....AHRRHFHCKSCIRHGDFLHTAVYCQLPERFGEKQQRLRNLRTANATLESKGSLMLE..............
Q7SFY9_NEUCR/3-349CCSLCDRSH.YGRVPFLCAVDARN...........R...LYPLRVQNARVLIENEELERTVVEEEAEGPC..........
Q8H1E1_ARATH/7-368NCAICD....NTNRPCICTACVNH...........R...LIEYNTLLKSLKTRRDSLLSRFNELLE..............
Q9VAP6_DROME/69-419RCPLCHS...CSASRFHCRNCVRNGNITHSQA..ERPESLTEKQQRYINLQAGLKTFSTRYERLIG..............

PF00452

B2L13_MOUSE/101-197--------------------------------------------------------------------------------
B2LA1_HUMAN/37-140--------------------------------------------------------------------------------
B2L10_HUMAN/39-153--------------------------------------------------------------------------------
Q53D42_9GAMA/49-147--------------------------------------------------------------------------------
Q2PFS6_MACFA/46-144--------------------------------------------------------------------------------
Q1WCD0_ICTPU/34-134--------------------------------------------------------------------------------
A7SPR2_NEMVE/52-148--------------------------------------------------------------------------------
Q4T1V9_TETNG/71-169--------------------------------------------------------------------------------
B2L13_HUMAN/104-200--------------------------------------------------------------------------------
Q568W6_DANRE/62-163--------------------------------------------------------------------------------
Q0KFR9_SALSA/147-247--------------------------------------------------------------------------------
A7SRF5_NEMVE/1-99--------------------------------------------------------------------------------
AR1_XENLA/81-179--------------------------------------------------------------------------------
Q687D9_MESAU/8-103--------------------------------------------------------------------------------
NR13_COTJA/35-134--------------------------------------------------------------------------------
Q497M6_MOUSE/37-140--------------------------------------------------------------------------------
A7RF38_NEMVE/83-183--------------------------------------------------------------------------------
A7SFS9_NEMVE/45-142--------------------------------------------------------------------------------
Q8BQK4_MOUSE/94-192--------------------------------------------------------------------------------
Q5EAR7_DANRE/62-157--------------------------------------------------------------------------------
Q005W0_FELCA/2-104--------------------------------------------------------------------------------
Q3HLW5_AIPPA/52-148--------------------------------------------------------------------------------
A7LM80_HYDVU/50-150--------------------------------------------------------------------------------
B2L10_RAT/39-145--------------------------------------------------------------------------------
P90504_HHV8/36-134--------------------------------------------------------------------------------
Q4SCG3_TETNG/61-157--------------------------------------------------------------------------------
Q5YFF0_9VIRU/15-112--------------------------------------------------------------------------------
Q90ZH2_XENLA/62-160--------------------------------------------------------------------------------
Q17KY0_AEDAE/81-186--------------------------------------------------------------------------------
Q9W6F1_CHICK/70-169--------------------------------------------------------------------------------
Q9I9N3_DANRE/117-217--------------------------------------------------------------------------------
Q9NGX3_DROME/153-258--------------------------------------------------------------------------------
CED9_CAEBR/111-216--------------------------------------------------------------------------------
Q28WX1_DROPS/144-249--------------------------------------------------------------------------------
Q8NFF3_HUMAN/57-156--------------------------------------------------------------------------------
BOKB_DANRE/71-172--------------------------------------------------------------------------------
MCL1_CANFA/213-312--------------------------------------------------------------------------------
Q564A4_DANRE/86-184--------------------------------------------------------------------------------
A7RN20_NEMVE/1-102--------------------------------------------------------------------------------
A7LM76_HYDVU/90-195--------------------------------------------------------------------------------
A1E3K7_HYDVU/44-142--------------------------------------------------------------------------------
Q9I9N4_DANRE/65-160--------------------------------------------------------------------------------
BOKA_DANRE/68-180--------------------------------------------------------------------------------
Q568W5_DANRE/90-190--------------------------------------------------------------------------------
B2CL2_BOVIN/46-144--------------------------------------------------------------------------------
Q1RPT5_9METZ/75-164--------------------------------------------------------------------------------
BOK_CHICK/71-172--------------------------------------------------------------------------------
Q4SR59_TETNG/74-172--------------------------------------------------------------------------------
A7S109_NEMVE/32-131--------------------------------------------------------------------------------
Q4RVC0_TETNG/71-172--------------------------------------------------------------------------------
ARBH_ASFM2/43-134--------------------------------------------------------------------------------
Q5F404_CHICK/83-182--------------------------------------------------------------------------------
Q4S998_TETNG/65-160--------------------------------------------------------------------------------
Q8BEN2_9GAMA/51-143--------------------------------------------------------------------------------
Q5TJD7_SUBDO/76-175--------------------------------------------------------------------------------
Q08BX9_DANRE/78-172--------------------------------------------------------------------------------
A7S0T4_NEMVE/5-100--------------------------------------------------------------------------------
B2LA1_BOVIN/37-140--------------------------------------------------------------------------------
A1E3K6_HYDVU/95-192--------------------------------------------------------------------------------
Q8C264_MOUSE/76-175--------------------------------------------------------------------------------
Q17KY1_AEDAE/143-248--------------------------------------------------------------------------------
Q5BWX6_SCHJA/75-180--------------------------------------------------------------------------------
Q9YTQ0_ATHV3/41-135--------------------------------------------------------------------------------
Q5BJ77_XENTR/115-211--------------------------------------------------------------------------------
Q9W6F2_CHICK/37-140--------------------------------------------------------------------------------
A7S9S4_NEMVE/48-145--------------------------------------------------------------------------------
Q4KLS7_XENLA/94-193--------------------------------------------------------------------------------
V039_FOWPN/44-135--------------------------------------------------------------------------------
A1E3K5_HYDVU/78-181--------------------------------------------------------------------------------
Q9DH00_MEHV1/35-134--------------------------------------------------------------------------------
VG16_SHV21/27-121--------------------------------------------------------------------------------
Q6P4Y4_XENTR/93-188--------------------------------------------------------------------------------

PF15286

B1PZP0_9GAMA/8-133----------TYWATLITAFLKTV-----------S--------------------------------------------
D0U1R1_MHV68/8-133----------TYWATIITAFLKSV-----------S--------------------------------------------
E9M5Q5_9GAMA/5-127----------TEWRSLLKVFLLKS-----------S--------------------------------------------

PF10186

A2R922_ASPNC/36-386......TSI.AYQNGLSTKRSLQIIAKGEAESSERMRLLGDQLDNLTAEIKDKRLEISQRKLALARR--HSDSE..SAQY
A6RN46_BOTFB/2-356..............ATITQLDHDALISERERIIDRTNQIIAHADELKANLERAKEERNKKKIANDRR--KAELT..SASK
A7F2W3_SCLS1/2-356..............LVVTQSNYDALLAEREKIIDRTNQIIAHADELKAKLERAKEERSKKKAANGQR--RADLV..LASS
A7SI99_NEMVE/2-360.................NRQAVQQLNDAVILKREKISCIQSVIRLIQQHTSQDQQSLDSIRKSNAVK--KVKLK...SNA
ATG14_VANPO/4-287EG...............IILADRLHKLEVLKRTKRNNRVRYRISQLTKRIENKQQRLQSLRLQITT.--...........
A9TM71_PHYPA/7-362.................AKREAELQQHWRVEHAERRAQLKERLRQCKEDFIQGKMKRDLMQHDLDAQ--VRFLS..AASA
B0DVS0_LACBS/2-334.................TIQAARLFRAHVADCQSRLEEVMAGLAQLRKENDKKRDRLRALRESLATR--RRSLS....AA
B0YA63_ASPFC/2-386.......CSTQSPDKVPSPQDVLQIITAKAESSIRRKELALQIQQLKSEIKDRQLGISQRRLTLARR--RSDAE..SSKF
B2AYN4_PODAN/6-338.................KAVRLETLKSDTAAAVERTNEIIAQADKLRSEVDAARKAIEDKKKLLAQR--RSDLE..AVST
B2WCB9_PYRTR/2-373....SKGGLLVDRQECTNNLNWQRTKAETAEIQERLGNISDHAHQLRQQMEATRKLLEAKRAANAQR--KSDLS..SATY
B4F8Q5_MAIZE/9-367.................AKRKTDEQRIWRTSKEQDIMELRNRLTELKRKTAVDKTEVEQASSDLKAK--IVPLN..LALA
B6HV92_PENCW/42-413........LLDTDKACSPRWVLQTISTRHAVSLAKRELVSHQLEALKIEVEAKKAKIAKQKEVLARR--RSDAE..SANF
B6K450_SCHJY/2-286.................NAKHLQQLSRVVSKKQHDLQQLQTTRYAYVNQIRQLRSLLNSKQRLIESL--KQRLTKQNYCY
B6QMH1_PENMQ/2-365.NTNANNNTRQASRERNLKWDAQAAQTEQARSSDRIRAMRDCIETLRSDIEQRKAQIRHMKLQQKQR--RSDAE..SANF
B8B4V4_ORYSI/14-362.................AKTIILKDCIFDLFIEER..........GRAEKLEEKKKAEQASRDLRER--TALLN..LAFV
B8NYP4_ASPFN/2-372......GHL.SLKNEGHIAWPIQIIANEKTRSSLRIKLLKSRTENLRLEIKNKKRNISEHKLTLAQR--RSDAG..SAKY
B9GUI0_POPTR/7-365.................AKGKADDQFNWRVQQNEKLASSREKLHRNKEQLAQGKAKVEKLSQDLKKK--NGMLE..SARN
C0NNR8_AJECG/2-365......LGDLRAK.ERPSRWAIQAAKSRVSQSTVRTSDIFDRMTTLREEIREGKENITHRKALLKQR--RSDME..SATY
C0RX80_PARBP/2-365......PDGSESQ.QHSSLWVLQAVKSRSSQSAARTSTILNRIRALREEIREGKEKIAHRKALLKLR--RSDVG..SATY
C4JIE0_UNCRE/2-361......PGLSRWP.NEPSKIAIETMRTLTTQSEIRKEAIQVQIARLRAEIEEGKEEIAKRRAALAKR--RSDAE..SANY
C5DLA9_LACTC/4-280.................DVLGKHLAMLRKTHLKRRTNKIRSKLQQLQEVVQVKRERVRTLKAQMNQP--NPRVA......
C5DUI4_ZYGRC/2-311STNVEG...........DILGRRLRKLDSVILRRKNNRVKYRISQLNRRIYEKRHRIEALRSKLQLP--SKIGI......
ATG14_YEAST/2-295KKK..............DPLMNSLMKLDVLRMKKNNNLIRHRIEQLNERIYSKRNHISELKVEIDNY--KC.........
Q0TZA4_PHANO/2-373....SKGGLLVDRQECTHHLNWQRTKAETAEIQERTQLITEQSKHIRDQMEATRKRIESQRAANAQR--KSDLS..SATY
Q147F2_ARATH/6-368.................TKEKAISQRCWKELQNEKLAKLREKLQLQVEKLQQSKNTFRSLSRNLKER--YGIIE..STNV
Q17M47_AEDAE/34-384.................RRRLSCQLRAEIKQRTENIDNIRKLMALKRENVGRLQALRKELYESNRLL--RMKLP...RCD
Q2HG05_CHAGB/2-272......................DRLKTEEAAARDRTSQIIAQADRLKSEIDAAQKEIAARKDAIARR--KSDLA..SVSA
Q54QH5_DICDI/6-304.................LQEQIDIKKTYLESKKIQIEILKNKIQTLKTTVIKDNGLIDVKKKYLSTR--RSSLKKNKISF
Q5KCM1_CRYNJ/8-348.................GLNAWRELRSDVASSEARCHQIKMTISQRQAAISACRKRIAE..NNIRDR--RESLS......
Q6C401_YARLI/66-385.................DPFRLRLLKIKQQGVRRELDVVRKARDLQTDEIAAKKRHLATLRNQVSTM--RETAA..SLHT
ATG14_KLULA/3-281.................GQFGKQLQKLDVYNEKRRLIKLRQRVQLVKNKIDVKRNRYQELERYLKDE--DHFDK......
ATG14_CANGA/4-309QLESNIGV.........QILKERLGKVQVLRKERQNNKIKHKISQQDRRIKEKSRYIAELRSLINGP--PKN........
Q6NWB8_DANRE/17-367.................KKVQADQLRWKIMSCKMKIQQLKEAICTSNEEVKSGKELLLRSQEEGQRL--QRRAS...RHQ
BAKOR_HUMAN/42-389.................GKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKL--YSRAQ...RHQ
ATG14_ASHGO/2-272.................GLLGKHMERLQHLRLKRYNARLSHRARELEQHLDSKLSRRDGLRRALKQL--SPDVA......
Q7Q037_ANOGA/42-403.................KLHQAGRLAGEIKQRSDKADIIRKTIELKRIAIEELRLKQRHLGDAIRKL--RITLP...RYD
Q7SFY9_NEUCR/3-349.................RKPYLDRLKSEVAAANARTAEIMAQCERLKRQTEQTRKEVEKKKDVLARK--KSDLS..AMST
Q8H1E1_ARATH/7-368.................SKGKADDQKNWRLIQNEKISKLKKKLKSNKELVTQGKVKIERGSSDLKVK--YGVLD..SARS
Q9VAP6_DROME/69-419.................QHRSNEDRLMAIKAKRKQLELLQQLISGTGQRLRVLGERRDELRRANAEK--RKNLP...KYP

PF00452

B2L13_MOUSE/101-197-----------------------------------LAHLGERVSQDLKEP..LQKALQTILSQPV....TYEA.------
B2LA1_HUMAN/37-140-----------------------------------LQNVAFSVQKEVEKN..LKSCLDNVNVVSVDT..ARTL.------
B2L10_HUMAN/39-153-----------------------------------LRSAAARLRQIHRSF..FSAYLG.....YPGN..RFEL.------
Q53D42_9GAMA/49-147-----------------------------------IKEFISSFLKDSARL..YERLLRHTDYRSLRG.......------
Q2PFS6_MACFA/46-144-----------------------------------LREAGDEFELRYRRA..FSDLTSQLHI.TPGT..AYQS.------
Q1WCD0_ICTPU/34-134-----------------------------------MKCVVDRLLVKHDLV..YKGMLAKLRLDERGD..DLSV.------
A7SPR2_NEMVE/52-148-----------------------------------LRKLSNQIENKHELF..LRNMCDRLDI.RQHN..APET.------
Q4T1V9_TETNG/71-169-----------------------------------LRDTGNEFELRYTCA..FSDLHNQLHI.TPAT..AYQS.------
B2L13_HUMAN/104-200-----------------------------------LAHLGEKVSQELKEP..LHKALQMLLSQPV....TYQA.------
Q568W6_DANRE/62-163-----------------------------------MRYLAKEMEQQHRTK..FRSLSQEFLDTCGAD..PSKC.------
Q0KFR9_SALSA/147-247-----------------------------------MKRVVEDVIAKHRYA..YNGMVAKLDLDDRCD..DMGV.------
A7SRF5_NEMVE/1-99-----------------------------------LRSLASHMEAEYPDL..FETACTKLGI.TPAT..ARST.------
AR1_XENLA/81-179-----------------------------------MRAAGDEFEERFRQA..FSEISTQIHV.TPGT..AYAR.------
Q687D9_MESAU/8-103-----------------------------------LRRIGDELDSNME....LQRMIANVDT.NS....PREV.------
NR13_COTJA/35-134-----------------------------------LRRAAAELERRERPF..FRSCAPLARAEPRE...AAAL.------
Q497M6_MOUSE/37-140-----------------------------------LQRVAFSVQKEVEKN..LKSYLDDFHVESIDT..ARII.------
A7RF38_NEMVE/83-183-----------------------------------LGEVGDEIDAKYRDQ..FHDMIESLHL.TPGT..AYDT.------
A7SFS9_NEMVE/45-142-----------------------------------LRKLADKIEEQYPAL..LNHLCHKLNI.SRST..AYST.------
Q8BQK4_MOUSE/94-192-----------------------------------LRRAGDDFSRRYRRD..FAEMSSQLHL.TPFT..ARGR.------
Q5EAR7_DANRE/62-157-----------------------------------IKVIGDKLDQ..DQA..FNDMIDG..L.VKVA..DKSS.------
Q005W0_FELCA/2-104-----------------------------------LQDVAFSVQGEVEKK..LKPCLDKFHVVSVDT..ARTI.------
Q3HLW5_AIPPA/52-148-----------------------------------LRKLSTQIEQKHEAL..FKNLCNRLDL.NERN..VTET.------
A7LM80_HYDVU/50-150-----------------------------------LQRVGDELESANTDF..FKNMCDQLQI.TPST..AYPT.------
B2L10_RAT/39-145-----------------------------------LRSVTSQIQQEHQDL..FNSFRDYQGN.......RLEL.------
P90504_HHV8/36-134-----------------------------------IKLYITGLMRDKESL..FEAMLANVRFHSTTG.......------
Q4SCG3_TETNG/61-157-----------------------------------LRKATDDFEKKLTRA..CGDLSSYL...PSKI..SHQN.------
Q5YFF0_9VIRU/15-112-----------------------------------MCPLTREIHSQMLIVTKSYSLVETFRAFPRLP.N.....------
Q90ZH2_XENLA/62-160-----------------------------------LLEATEEFELRYQRA..FSDLTSQLHI.TQDT..AQQS.------
Q17KY0_AEDAE/81-186-----------------------------------LNGMGEELERMHPRL..YTNVSRQISVEPWGELTEPDSV------
Q9W6F1_CHICK/70-169-----------------------------------LRRVGDGVMQKHELA..FQGMLRKLEIKKE.D..DLQA.------
Q9I9N3_DANRE/117-217-----------------------------------MKRVVDNILVKHQIA..YKGMIQRLQLDSQPA..SLDF.------
Q9NGX3_DROME/153-258-----------------------------------VQVLGDELERMHPRI..YNGVARQICRNPGGEFHTPDAV------
CED9_CAEBR/111-216-----------------------------------MRSLGTIFEKRHMEM..FENFSEQLLA.VPKI..SFSL.------
Q28WX1_DROPS/144-249-----------------------------------LNSMGEELERMHPRV..YTNISRQLSRAPFGELEDGDMA------
Q8NFF3_HUMAN/57-156-----------------------------------LAIIGDDINRRYDSE..FQTMLQHLQP.TAEN..AYEY.------
BOKB_DANRE/71-172-----------------------------------LLKLGDELECMRPYV..YRNIAKQLNISVSVEAVVSDA.------
MCL1_CANFA/213-312-----------------------------------LQRVGDGVQRNHETA..FQGMLRKLDIKNE.D..DVKS.------
Q564A4_DANRE/86-184-----------------------------------LRDAGDEIERIYQRE..FEEMSQQMVF.NPNS..AQRS.------
A7RN20_NEMVE/1-102-----------------------------------IIQIGELLETAYPYL..YHNVSKHLKIRLRSEVIVGDV.------
A7LM76_HYDVU/90-195-----------------------------------LEEQGGIAIQKYHHA..FLSLINQLQI.TDEYNFAYTQ.------
A1E3K7_HYDVU/44-142-----------------------------------MMRLVEEIEIKHELF..LSNMCKRLNL.NTEN..AQSM.------
Q9I9N4_DANRE/65-160-----------------------------------LQQIGDELDGNAQ....LQSMLNNSNL.QP....TQDV.------
BOKA_DANRE/68-180-----------------------------------LLWLGDELEYLRPNV..YRNVARQLNITIASENIVSDA.------
Q568W5_DANRE/90-190-----------------------------------MRRVVDNLAVKHELA..YKGMIARLNLEQKGE..DVSF.------
B2CL2_BOVIN/46-144-----------------------------------MRAAGDEFETRFRRT..FSDLAAQLHV.TPGS..AQQR.------
Q1RPT5_9METZ/75-164-----------------------------------LAEFGDQVDGQFYQE..MEEIVELTG..TPEK..AFAI.------
BOK_CHICK/71-172-----------------------------------LLRLGDELEYIRPNV..YRNIARQLNISLHSETVVTDA.------
Q4SR59_TETNG/74-172-----------------------------------LRDSAEEFEKLFAQA..FSDLSSQLVI.TPDT..AYQS.------
A7S109_NEMVE/32-131-----------------------------------LRIVADELIADNSEL..FHSMCDQLHL.TPIS..TYPT.------
Q4RVC0_TETNG/71-172-----------------------------------LLCLGDELESMQPSL..YRNVARQLNISVAMENMVSDA.------
ARBH_ASFM2/43-134-----------------------------------LTYYDECLNKQVTIT..F.SLTNAQEIKTQ.........------
Q5F404_CHICK/83-182-----------------------------------LAIIGDDINKRYDAE..FRHMLKSLQP.TKEN..AYEY.------
Q4S998_TETNG/65-160-----------------------------------LQKIGDELDSNME....LQRMIDDSAL.KP....TKDM.------
Q8BEN2_9GAMA/51-143-----------------------------------IQEICRDQESTLSAS..FQSLQNDADVENF.........------
Q5TJD7_SUBDO/76-175-----------------------------------IERIVCQLEDERSQQ..FIDILRGLEIDQQNLRIT....------
Q08BX9_DANRE/78-172-----------------------------------LLKIADDLNKNAE....LQHLIS..TV.QSNC..AQDV.------
A7S0T4_NEMVE/5-100-----------------------------------LREIGDQLTNDAT....LNNLIAECHV.TKDT..AFDT.------
B2LA1_BOVIN/37-140-----------------------------------LQDVASSVQDEVERT..LKQCLDKFDVVSVDT..ARTI.------
A1E3K6_HYDVU/95-192-----------------------------------LRRVSSELEDMHIDF..FENVCH..AI.NEEN..AGEV.------
Q8C264_MOUSE/76-175-----------------------------------LALIGDDINRRYDTE..FQNLLEQLQP.TAGN..AYEL.------
Q17KY1_AEDAE/143-248-----------------------------------LLSVGEELERMYPRV..YNGVARQLSRIGRGELKTPETA------
Q5BWX6_SCHJA/75-180-----------------------------------LLQLVGDFNQRFSQTHEIEPVAQSLGIDSDKPVDKTALE------
Q9YTQ0_ATHV3/41-135-----------------------------------IVRAIHSVIQQYNK...FEDLMPDFSICAHDR.......------
Q5BJ77_XENTR/115-211-----------------------------------LSHLCEKLATEIRES..LDKASEGLLSGSL....AAEE.------
Q9W6F2_CHICK/37-140-----------------------------------LRNIASSLQDQTEEA..LRPFLDRIDITSVDV..AKRI.------
A7S9S4_NEMVE/48-145-----------------------------------MRRLSDELEERHGPL..LCNMCNSLNM.TANS..AHEK.------
Q4KLS7_XENLA/94-193-----------------------------------LAKIGDDINERYQEQ..FDNILKNLNP.SLDN..AYSY.------
V039_FOWPN/44-135-----------------------------------LKAACKSVIKTNYNE..FDIIISRNID............------
A1E3K5_HYDVU/78-181-----------------------------------LASFGDEINDKYRQV..FSDMLCRLNIETEDV..AYET.------
Q9DH00_MEHV1/35-134-----------------------------------LRRAAAELERRERPF..FRSCAPLASGGTQA...ALSA.------
VG16_SHV21/27-121-----------------------------------VVRAVHSVIHQYNK...FEALMPDFSLCVHDR.......------
Q6P4Y4_XENTR/93-188-----------------------------------LRKIGDELDANIE....LQRRIECVPC.NS....PKQV.------

PF15286

B1PZP0_9GAMA/8-133-----------------KVEELDCVDSAVLVDVSKIITLTQEFRRHYDSV--YRADYGPALKNWKRD-------------
D0U1R1_MHV68/8-133-----------------KVEELDCYDSDVLDDVSKIITLTQEFRSHYDSV--FHMDYGPALQNWKGG-------------
E9M5Q5_9GAMA/5-127-----------------GC.SCQGVSAGLLADVDVLDKLTTDFITKYESV--YGK.LPLTQSDWVNN-------------

PF10186

A2R922_ASPNC/36-386QLGEREAAILANIQNNTKRTDHLWHS.LHSKTAEARIFLCREAANLYGLQRK.................TRNKEGLS...
A6RN46_BOTFB/2-356GIEARRTKQIEAVEGSTQRTKYRWNQ.TYDFVGESRAYLCYESANLYGLQRF....................KASNG...
A7F2W3_SCLS1/2-356GIEARRTKQIQDIEGSTRRTKYRWNQ.AYNLIAGSRAYLCYEAAKLYGLQRV....................KRSNG...
A7SI99_NEMVE/2-360DEIKTLLEVKKKHLATLSKRMRDLKSLQNELGQVRQRSMALVQKYLFPIQAIPVYPVMGTPPPPQHTPESLDLSRELSFE
ATG14_VANPO/4-287...TDVAKVSNANKKEIEEIRTKYLQ.LNEVVKREQELECQSLVDWFIL.......................RKRNSY..
A9TM71_PHYPA/7-362QVATKRLELLAHFYPDLIRAQSLVHTAVASDLYQKRRMVIRQLCKILPLRRS................SWEGSCSGPQ..
B0DVS0_LACBS/2-334KLQPARHSPAPGLSHLTQRETQELNA.LSMTIARARSGLVQELVEVFNVVEV............GGRPPIGGKAGT....
B0YA63_ASPFC/2-386QLESREVALICGVQNTIKRTERLWHS.LHSKTVEARIFLCREVANLYSLRQW..................MKQDGSEM..
B2AYN4_PODAN/6-338GAEARRSRQLEETQRAIHRTRYKWNR.SADTMAATRAFLCEEAARLYGLRQV....................KKGS....
B2WCB9_PYRTR/2-373GIESRRANELDKVQQKVKRLDYNADK.MHHDTIDLRMQLCTTAAKLAGLKMQ................RRKTRDGGV...
B4F8Q5_MAIZE/9-367TLKKRRADAVAMHTNAMKVAQMNLMA.TTSDCMKMQSKSVKQLCRLFPMRRV................IKEGEKKDGY..
B6HV92_PENCW/42-413QLEERETGILAGVQNTSKRVEHVWHS.LHSKTAESRIYLCREVANIYGLRKA.................TKKGQG.....
B6K450_SCHJY/2-286NQQQSVGDNVVKSLDSIEETNSQISL.LQTKYVQRHVRLLEEVYPITYV.......................DQSN....
B6QMH1_PENMQ/2-365QLSERRNAALASIQNGIKRTEHLWHS.LHNKTAESRIFLCREAAFLYGLRQE.................VGKREGGRK..
B8B4V4_ORYSI/14-362TLKKKRNDSSVMHTNAMKAAQMGLMA.TTSEHLKMQSKAMKQLCRLFPLRRV................IKDGEQNDGY..
B8NYP4_ASPFN/2-372QLAEREAAILSGIHNNAKRTDHLWHS.LHSKTAEARIFLCREAAYLYNLQQK.................VKKRDGEV...
B9GUI0_POPTR/7-365VLEKNRMEQLEKFYPNLICTQSLGHMAITSELLHKQSVVIKQICKLFPQRRV................NVDGERN..F..
C0NNR8_AJECG/2-365QVTDRRASMLATVQDSIKRTEHLWNS.LHNKTAQSRVFLCREVANLYRLRQR.................TRRKNGEL...
C0RX80_PARBP/2-365QVDNRRASMLSTVQNNIKKTEHLWNS.LHDKTAQSRVFLCREVANLYRLRQR.................SRRKNGEL...
C4JIE0_UNCRE/2-361QLSERRAATLNSVQNEAKKIENAWNS.LHAKTAESRMFLCREVASLYNLRQK.................SRRRNGEI...
C5DLA9_LACTC/4-280.....HSVETDEKIAQFRSSQQKLTM.LQRVLESSKALKFQALAHLFLI.......................RQREHP..
C5DUI4_ZYGRC/2-311.HEKELKAKRESQELTISEGKQQLTQ.IRKVLLKSQLSKIRSLVEWFVI.......................RKRESY..
ATG14_YEAST/2-295.YKVGTGTDKLREQVEISDAKNKLAQ.VSKICESARDYKLNLLNNWFVIQ......................KLQDNF..
Q0TZA4_PHANO/2-373GIDSRRANELDKVQQHLKRIDYKSDK.MHHDTMELRMQLCTTAAKLAGLKTT................RRRNKDESV...
Q147F2_ARATH/6-368ALEESRVHQLENHYSDTIGNHYLVYIDLTSERLYKQALVMKQICKLFPLSRV................TVEGQNKDGS..
Q17M47_AEDAE/34-384DQVKRISSYVLSKLEESERRRASINELQDEIKQFRRDQIGKLIRYIFPISRA............ISNRSGFSSSDGES..
Q2HG05_CHAGB/2-272GTQARRNRQLEEAERSCQRLRYKWNR.CADSIADVRGFLCEGSARLYGLRQV....................KKGS....
Q54QH5_DICDI/6-304EAVNNSKSGFSSLTDEIQKKKDQLTAENTSLQIVKRSKIEQLTNSMTRL...................QLNPTTPD....
Q5KCM1_CRYNJ/8-348.MLKSRPSPVSSLRDSIKQVHSQQQV.ITSRIIHARRVLVREAVNVFGV.......................RQRP....
Q6C401_YARLI/66-385QSVNEHQKIKRKLSQDVQELKTKVNTEIPHSLLAKRSVLCRELVSLYNIRLR............KVRRGSGITSVGST..
ATG14_KLULA/3-281...DKKVFDVEEIVNDEALTMSK....LSQVLQRKQTALFKELCQWFRI.......................EKCDEDVN
ATG14_CANGA/4-309...QNRFTDPQTILKAQKQLQDKLEI.AKRLSIQTRSEKLAMLNKWYSI.......................RKRDSH..
Q6NWB8_DANRE/17-367EKRDKIKRHNQRLGELLEKRSKEMQGRLEALAEVRREHILELTTHIFNIQEE............KQGSRDPADPAVAEYD
BAKOR_HUMAN/42-389EKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEV............KTGVRDPADVS.SESD
ATG14_ASHGO/2-272.......VVPAEDPDEYRELRHKLTL.LQNVVSMKSTQKFEELCQWFVFTC.....................STTEDD..
Q7Q037_ANOGA/42-403DKVKTLSEFVAGKLEESEHRKARLAAVQERLRQRKRDQVQQLVRIIFPITQT............IASRSSLTGSSSTA..
Q7SFY9_NEUCR/3-349GVAARRNRQLEETQESIRRIRFKWAA.CADTMASTRSFLCEEAARLFGLRQI....................RKGS....
Q8H1E1_ARATH/7-368TLEKTRVEQVEKYFPNLICTQSLGHMAISSERLHKQSVVVKQICKLFPLRRV................SFDGESQNGS..
Q9VAP6_DROME/69-419DKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRSIQQLVTYVFPIAEV............VLKEEQQRRASVERTE

PF00452

B2L13_MOUSE/101-197--------------------------------------------------------------------------------
B2LA1_HUMAN/37-140--------------------------------------------------------------------------------
B2L10_HUMAN/39-153--------------------------------------------------------------------------------
Q53D42_9GAMA/49-147--------------------------------------------------------------------------------
Q2PFS6_MACFA/46-144--------------------------------------------------------------------------------
Q1WCD0_ICTPU/34-134--------------------------------------------------------------------------------
A7SPR2_NEMVE/52-148--------------------------------------------------------------------------------
Q4T1V9_TETNG/71-169--------------------------------------------------------------------------------
B2L13_HUMAN/104-200--------------------------------------------------------------------------------
Q568W6_DANRE/62-163--------------------------------------------------------------------------------
Q0KFR9_SALSA/147-247--------------------------------------------------------------------------------
A7SRF5_NEMVE/1-99--------------------------------------------------------------------------------
AR1_XENLA/81-179--------------------------------------------------------------------------------
Q687D9_MESAU/8-103--------------------------------------------------------------------------------
NR13_COTJA/35-134--------------------------------------------------------------------------------
Q497M6_MOUSE/37-140--------------------------------------------------------------------------------
A7RF38_NEMVE/83-183--------------------------------------------------------------------------------
A7SFS9_NEMVE/45-142--------------------------------------------------------------------------------
Q8BQK4_MOUSE/94-192--------------------------------------------------------------------------------
Q5EAR7_DANRE/62-157--------------------------------------------------------------------------------
Q005W0_FELCA/2-104--------------------------------------------------------------------------------
Q3HLW5_AIPPA/52-148--------------------------------------------------------------------------------
A7LM80_HYDVU/50-150--------------------------------------------------------------------------------
B2L10_RAT/39-145--------------------------------------------------------------------------------
P90504_HHV8/36-134--------------------------------------------------------------------------------
Q4SCG3_TETNG/61-157--------------------------------------------------------------------------------
Q5YFF0_9VIRU/15-112--------------------------------------------------------------------------------
Q90ZH2_XENLA/62-160--------------------------------------------------------------------------------
Q17KY0_AEDAE/81-186--------------------------------------------------------------------------------
Q9W6F1_CHICK/70-169--------------------------------------------------------------------------------
Q9I9N3_DANRE/117-217--------------------------------------------------------------------------------
Q9NGX3_DROME/153-258--------------------------------------------------------------------------------
CED9_CAEBR/111-216--------------------------------------------------------------------------------
Q28WX1_DROPS/144-249--------------------------------------------------------------------------------
Q8NFF3_HUMAN/57-156--------------------------------------------------------------------------------
BOKB_DANRE/71-172--------------------------------------------------------------------------------
MCL1_CANFA/213-312--------------------------------------------------------------------------------
Q564A4_DANRE/86-184--------------------------------------------------------------------------------
A7RN20_NEMVE/1-102--------------------------------------------------------------------------------
A7LM76_HYDVU/90-195--------------------------------------------------------------------------------
A1E3K7_HYDVU/44-142--------------------------------------------------------------------------------
Q9I9N4_DANRE/65-160--------------------------------------------------------------------------------
BOKA_DANRE/68-180--------------------------------------------------------------------------------
Q568W5_DANRE/90-190--------------------------------------------------------------------------------
B2CL2_BOVIN/46-144--------------------------------------------------------------------------------
Q1RPT5_9METZ/75-164--------------------------------------------------------------------------------
BOK_CHICK/71-172--------------------------------------------------------------------------------
Q4SR59_TETNG/74-172--------------------------------------------------------------------------------
A7S109_NEMVE/32-131--------------------------------------------------------------------------------
Q4RVC0_TETNG/71-172--------------------------------------------------------------------------------
ARBH_ASFM2/43-134--------------------------------------------------------------------------------
Q5F404_CHICK/83-182--------------------------------------------------------------------------------
Q4S998_TETNG/65-160--------------------------------------------------------------------------------
Q8BEN2_9GAMA/51-143--------------------------------------------------------------------------------
Q5TJD7_SUBDO/76-175--------------------------------------------------------------------------------
Q08BX9_DANRE/78-172--------------------------------------------------------------------------------
A7S0T4_NEMVE/5-100--------------------------------------------------------------------------------
B2LA1_BOVIN/37-140--------------------------------------------------------------------------------
A1E3K6_HYDVU/95-192--------------------------------------------------------------------------------
Q8C264_MOUSE/76-175--------------------------------------------------------------------------------
Q17KY1_AEDAE/143-248--------------------------------------------------------------------------------
Q5BWX6_SCHJA/75-180--------------------------------------------------------------------------------
Q9YTQ0_ATHV3/41-135--------------------------------------------------------------------------------
Q5BJ77_XENTR/115-211--------------------------------------------------------------------------------
Q9W6F2_CHICK/37-140--------------------------------------------------------------------------------
A7S9S4_NEMVE/48-145--------------------------------------------------------------------------------
Q4KLS7_XENLA/94-193--------------------------------------------------------------------------------
V039_FOWPN/44-135--------------------------------------------------------------------------------
A1E3K5_HYDVU/78-181--------------------------------------------------------------------------------
Q9DH00_MEHV1/35-134--------------------------------------------------------------------------------
VG16_SHV21/27-121--------------------------------------------------------------------------------
Q6P4Y4_XENTR/93-188--------------------------------------------------------------------------------

PF15286

B1PZP0_9GAMA/8-133--------------------------------------------------------------------------------
D0U1R1_MHV68/8-133--------------------------------------------------------------------------------
E9M5Q5_9GAMA/5-127--------------------------------------------------------------------------------

PF10186

A2R922_ASPNC/36-386....QEVYT.MG...G................................................................
A6RN46_BOTFB/2-356....GEEYR.IA...G...........VNIVDLRLMNT..........................................
A7F2W3_SCLS1/2-356....EEEYK.IG...G...........VGIVDLRLMNT..........................................
A7SI99_NEMVE/2-360DQADASVESALAEATQ...........TSYVQGKWVNE...TATLELSIIDS..SLPWSGDYSAYRHWVK..........
ATG14_VANPO/4-287....EIPYT.LV...F...........LPVVSLKNFHK..........................................
A9TM71_PHYPA/7-362....SVR...IC...G...........ARLPLGDDPLT..........................................
B0DVS0_LACBS/2-334....KGEWT.IG...D...........LILPVPGDIRR..........................................
B0YA63_ASPFC/2-386....KETYV.IG...G...........VPIVDLRDLNG..........................................
B2AYN4_PODAN/6-338....TKRFE.IG...G...........IEIFDLHAMNN..........................................
B2WCB9_PYRTR/2-373....KEVFN.IGPGSR...........LRIYDLRDMND..........................................
B4F8Q5_MAIZE/9-367....NGPYDSIC...G...........VRLPRGLDPHS..........................................
B6HV92_PENCW/42-413....RETYV.LGMASPHRPEVAFKQSFIPWHTNRAGTG..........................................
B6K450_SCHJY/2-286....PPEFA.IR...N...........ISLCRSPNMTQ..........................................
B6QMH1_PENMQ/2-365....SEKYY.IG...G...........VQIVDLRSLNG..........................................
B8B4V4_ORYSI/14-362....NGPYDVIC...N...........ARLPRGLDPHS..........................................
B8NYP4_ASPFN/2-372....KEAYT.IG...G...........IPIIDLRDMNG..........................................
B9GUI0_POPTR/7-365....SGQYDQIC...N...........ARLPRGLDPHS..........................................
C0NNR8_AJECG/2-365....IAVYT.IG...G...........VSIVDLRDLNS..........................................
C0RX80_PARBP/2-365....VTVYT.IG...G...........VNIFDLRDLNG..........................................
C4JIE0_UNCRE/2-361....ISTYS.IG...G...........VNMVDPRDMNG..........................................
C5DLA9_LACTC/4-280....EFPFT.IS...F...........QPIVNVQNLCH..........................................
C5DUI4_ZYGRC/2-311....EFPYT.LA...F...........QPIVSLRNVYK..........................................
ATG14_YEAST/2-295....QIPFA.IA...F...........QPLISLKNFRI..........................................
Q0TZA4_PHANO/2-373....KVVYN.IGPGSR...........LRIWDLRDLNE..........................................
Q147F2_ARATH/6-368....SVQYDQIC...N...........ALLPQGLNPLS..........................................
Q17M47_AEDAE/34-384....KHTISEISDATR...........TAYVRGKWVLQDS.FGEIQHIIVAP..ALPGNGNYSAYNDWAT.........V
Q2HG05_CHAGB/2-272....IKRYE.IG...G...........VEIIDLHAMNS..........................................
Q54QH5_DICDI/6-304.....HFFL......F...........NMVLNDQQLLK..........................................
Q5KCM1_CRYNJ/8-348....SGDWE.IA...G...........IPLPDPETFRV..........................................
Q6C401_YARLI/66-385....ADTFPLIG...T...........LSLPDIITLCL..........................................
ATG14_KLULA/3-281NNNNVSAYT.IW...G...........VPMINLKYSNE..........................................
ATG14_CANGA/4-309....DIPFT.IS...Y...........QPVISLKNFNR..........................................
Q6NWB8_DANRE/17-367LALTSSTVSELAEARR...........TTYHSGRWIWDDQ.NGETSISITGPHVTLPSNGDCSAYYSWVE..........
BAKOR_HUMAN/42-389SAMTSSTVSKLAEARR...........TTYLSGRWVCDDH.NGDTSISITGPWISLPNNGDYSAYYSWVE..........
ATG14_ASHGO/2-272....HFPYS.IR...F...........IPVCNIRNWRL..........................................
Q7Q037_ANOGA/42-403....SSGSSACGGATR...........TAYVRGQWILQDS.FGEVQHVIVAP..ALPGTGNYSAYNEWATGGGDGGGAVA
Q7SFY9_NEUCR/3-349....SKRYE.LG...G...........VEIIDLHALNS..........................................
Q8H1E1_ARATH/7-368....VRQYDVIC...N...........SRLPSGLDPHS..........................................
Q9VAP6_DROME/69-419E...AETIAALADAKN...........TSYIRGKWVFHGSGISEVQYRIVGP..SLPANGDYTAYLDWLA..........

PF00452

B2L13_MOUSE/101-197----...YRECT---------------VETAVH.....------------------------------------------
B2LA1_HUMAN/37-140----...FNQVM---------------EKEFED.....------------------------------------------
B2L10_HUMAN/39-153----...VALMA---------------DSVLSD.....------------------------------------------
Q53D42_9GAMA/49-147----...LNAIG---------------QGMLHIN....------------------------------------------
Q2PFS6_MACFA/46-144----...FEQVV---------------NELFRD.....------------------------------------------
Q1WCD0_ICTPU/34-134----...ISSVA---------------MEMFSD.....------------------------------------------
A7SPR2_NEMVE/52-148----...FKQVA---------------DEIFGD.....------------------------------------------
Q4T1V9_TETNG/71-169----...FENVM---------------DEVFRD.....------------------------------------------
B2L13_HUMAN/104-200----...FRECT---------------LETTVH.....------------------------------------------
Q568W6_DANRE/62-163----...LQSVM---------------RELVGD.....------------------------------------------
Q0KFR9_SALSA/147-247----...INSVA---------------KTMFSD.....------------------------------------------
A7SRF5_NEMVE/1-99----...FFSVA---------------KEIFQT.....------------------------------------------
AR1_XENLA/81-179----...FAEVA---------------GSLFQG.....------------------------------------------
Q687D9_MESAU/8-103----...FFRVA---------------ADMFAD.....------------------------------------------
NR13_COTJA/35-134----...LRKVA---------------AQLETD.....------------------------------------------
Q497M6_MOUSE/37-140----...FNQVM---------------EKEFED.....------------------------------------------
A7RF38_NEMVE/83-183----...FAAVA---------------RRLFRS.....------------------------------------------
A7SFS9_NEMVE/45-142----...FVEIA---------------GEVFAD.....------------------------------------------
Q8BQK4_MOUSE/94-192----...FATVV---------------EELFRD.....------------------------------------------
Q5EAR7_DANRE/62-157----...FWKLV---------------EKVFTD.....------------------------------------------
Q005W0_FELCA/2-104----...FHQVM---------------EKEFED.....------------------------------------------
Q3HLW5_AIPPA/52-148----...CGQIA---------------DELIGN.....------------------------------------------
A7LM80_HYDVU/50-150----...FQSIA---------------DEIFVS.....------------------------------------------
B2L10_RAT/39-145----...VTQMA---------------DELLSN.....------------------------------------------
P90504_HHV8/36-134----...INQLG---------------LSMLQVS....------------------------------------------
Q4SCG3_TETNG/61-157----...FNNTM---------------DQIFEG.....------------------------------------------
Q5YFF0_9VIRU/15-112----...ILEIG---------------NNIVSD.....------------------------------------------
Q90ZH2_XENLA/62-160----...FQQVM---------------GELFRD.....------------------------------------------
Q17KY0_AEDAE/81-186----CYLLHIVA---------------KDLFKT.....------------------------------------------
Q9W6F1_CHICK/70-169----...VCEVA---------------AQVFND.....------------------------------------------
Q9I9N3_DANRE/117-217----...IRCIA---------------STMFKD.....------------------------------------------
Q9NGX3_DROME/153-258----SLLLGAVG---------------RELFRV.....------------------------------------------
CED9_CAEBR/111-216----...YQEVV---------------QTVGNSSN...------------------------------------------
Q28WX1_DROPS/144-249----PMLLNLVA---------------KDLFRS.....------------------------------------------
Q8NFF3_HUMAN/57-156----...FTKIA---------------TSLFES.....------------------------------------------
BOKB_DANRE/71-172----...FLSVA---------------TEVIAM.....------------------------------------------
MCL1_CANFA/213-312----...LSRVI---------------VHVFSD.....------------------------------------------
Q564A4_DANRE/86-184----...FLTVA---------------EELFRD.....------------------------------------------
A7RN20_NEMVE/1-102----...FRTFG---------------RELFRD.....------------------------------------------
A7LM76_HYDVU/90-195----...FVEVA---------------KKLFEN.....------------------------------------------
A1E3K7_HYDVU/44-142----...FHTIA---------------EEIFSD.....------------------------------------------
Q9I9N4_DANRE/65-160----...FIRVA---------------REIFSD.....------------------------------------------
BOKA_DANRE/68-180----...FLAVA---------------AEIFSTEYSRK------------------------------------------
Q568W5_DANRE/90-190----...IKQVA---------------TELFSD.....------------------------------------------
B2CL2_BOVIN/46-144----...FTQVS---------------DELFQG.....------------------------------------------
Q1RPT5_9METZ/75-164----...FSDVV---------------KNLFEWDE...------------------------------------------
BOK_CHICK/71-172----...FLAVA---------------AQIFTA.....------------------------------------------
Q4SR59_TETNG/74-172----...FKNVM---------------DEVFKD.....------------------------------------------
A7S109_NEMVE/32-131----...FVGIA---------------NEIFQS.....------------------------------------------
Q4RVC0_TETNG/71-172----...FIAVA---------------TEILST.....------------------------------------------
ARBH_ASFM2/43-134----...FTGVV---------------TELFKD.....------------------------------------------
Q5F404_CHICK/83-182----...FTTIA---------------SSLFDS.....------------------------------------------
Q4S998_TETNG/65-160----...FMKVA---------------FEIFSD.....------------------------------------------
Q8BEN2_9GAMA/51-143----...IWGVQ---------------EELFGD.....------------------------------------------
Q5TJD7_SUBDO/76-175----...YQTIV---------------GEIFND.....------------------------------------------
Q08BX9_DANRE/78-172----...FMTVA---------------RSIFDD.....------------------------------------------
A7S0T4_NEMVE/5-100----...FLAVA---------------LQIFQD.....------------------------------------------
B2LA1_BOVIN/37-140----...FNQVM---------------EKEFED.....------------------------------------------
A1E3K6_HYDVU/95-192----...FNEVS---------------QKVLTD.....------------------------------------------
Q8C264_MOUSE/76-175----...FTKIA---------------SSLFKS.....------------------------------------------
Q17KY1_AEDAE/143-248----PVLLSAIA---------------RDLFRS.....------------------------------------------
Q5BWX6_SCHJA/75-180----.IFYLEIL---------------NGLFE......------------------------------------------
Q9YTQ0_ATHV3/41-135----...IKFVG---------------EAIMLTT....------------------------------------------
Q5BJ77_XENTR/115-211----...FRKAV---------------ALISVH.....------------------------------------------
Q9W6F2_CHICK/37-140----...FNGVM---------------EEKFAD.....------------------------------------------
A7S9S4_NEMVE/48-145----...FVQVA---------------DEVFKD.....------------------------------------------
Q4KLS7_XENLA/94-193----...FKKIA---------------SSLFEN.....------------------------------------------
V039_FOWPN/44-135----...FNVIV---------------TQVLED.....------------------------------------------
A1E3K5_HYDVU/78-181----...FANIA---------------RRLFEN.....------------------------------------------
Q9DH00_MEHV1/35-134----...LQSVV---------------SELNSG.....------------------------------------------
VG16_SHV21/27-121----...IKFTG---------------EAILLTT....------------------------------------------
Q6P4Y4_XENTR/93-188----...FFHVA---------------KELFAD.....------------------------------------------

PF15286

B1PZP0_9GAMA/8-133-------LSKLF---------------TSLFVD-----------------------------------------------
D0U1R1_MHV68/8-133-------LARLF---------------TSLFGD-----------------------------------------------
E9M5Q5_9GAMA/5-127-------ITALL---------------F.FMLD-----------------------------------------------

PF10186

A2R922_ASPNC/36-386......................TTPAYISTSLFNVAHLLVLISHYLSLRLPAEITLP..HKDHPIPTICAP........S
A6RN46_BOTFB/2-356......................ASPAQISTSLAHIAHVLMLATYYLAVRLPAEITLP..HRDYPRPTIFSL........S
A7F2W3_SCLS1/2-356......................ASPAQISTSLSHITHVLMLATHYLAIRLPAEVTLP..HRDYPLPTIFSL........A
A7SI99_NEMVE/2-360......AHKNGSKGPDDDVGLRNPAYTISSALTHAAQLLELLASLLDVNLPSKLSYSEFCQN..................
ATG14_VANPO/4-287......................LPKAVTISSLHKMFQFLEIYSQIISFPL..............................
A9TM71_PHYPA/7-362......................TPHMELAASLGYMVQLVSLAARYISGPLLHSSGFAASSSRVWQRSSYFD.SRPASRSE
B0DVS0_LACBS/2-334......................YPPDHINAVITHTIHFLSLLTFYLGVKLPFEFVWTGGKLGVGQPWIGAI...MGSESG
B0YA63_ASPFC/2-386.KSQNCPLLLDMPAPSINAQIGATAVQISTSFSNIARLLVLVSHYLSLRLPAEITLP..HKDHPVPTIHAP........I
B2AYN4_PODAN/6-338......................LSPEVISTVFAHVAHILVLASHYLAIRLPAEITLP..HRDYPRPTIFSV........N
B2WCB9_PYRTR/2-373......................VAPDSLSASLAAVAQLLVRVAAYLGIRLPAEITLP..HSDYPQPTIFSP........A
B4F8Q5_MAIZE/9-367......................ISSEELSASLGHMLHFINIAVRILSAPALHVSGCKGSCSNIWQRSSYWS..TRQSQSK
B6HV92_PENCW/42-413......................IPHEQISTSFSNIAHLLIIVSHYLSLRLPAEITLP..HKNHPAPTIYTP........S
B6K450_SCHJY/2-286......................L..EDLAVALGYAAHIIAFLAGHLGFALPYPLYPMCSTS...................
B6QMH1_PENMQ/2-365......................ASPPQISTALSNISHLLILVSHYLSLRLPAEIILP..HRNHAIPTIFTP........A
B8B4V4_ORYSI/14-362......................VPSEELSASLGYMLQLLSIVVPILAAPALHISGFGASCSRVWQRSSYWS..TRQSQSK
B8NYP4_ASPFN/2-372...............KLRSLFRATPSQISTSFSYIAQLLVLVSHYLSLRLPAEITLP..HRNYPAPTIYAP........S
B9GUI0_POPTR/7-365......................VSSEELAASLGYMVQLLNLVAHNLAAPTLHNAGFAGSCSRIWQRDSYWN.ACPSSRSN
C0NNR8_AJECG/2-365......................ANHLLITTSLTYISHLLVLVSHYLSLRLPAEITLP..HRNYPLPTIFPP........S
C0RX80_PARBP/2-365......................ANHTHITTSLTYISHLLCLVSHYLSLRLPAEITLP..HRNYPLPTIFSP........S
C4JIE0_UNCRE/2-361......................ASPAQITTSLSHIAHLLVLVSHYLALRLPAEITLP..HRGYPLPTIFPS........G
C5DLA9_LACTC/4-280......................LPQNVVECSLRSMWDFLLLAGRVLLIELPL............................
C5DUI4_ZYGRC/2-311......................LPSSVVWGSISTMSRYLKLFAEILFFTLPHNELVAPNAPE..................
ATG14_YEAST/2-295......................LPLAITNDSINIMWKYISFFSDILMIKLPYTNKIC.......................
Q0TZA4_PHANO/2-373......................APPDQLSASLGAVAQLLVRVAAYLGIRLPAEITLP..HNDYPQPTVFSP........A
Q147F2_ARATH/6-368......................VPPKELAASLGYMVQLLNLVVHKLSVPALHNLGFAGSCSRIWERDSYWN.SYPSSPSN
Q17M47_AEDAE/34-384NPATDVSSTGRSEDGVRNVASRNPAHTIAAALTYTAQLVHIVCFYLDIRAPYKVSYSDFCTT..................
Q2HG05_CHAGB/2-272......................LSPEVISTSLAHIAHILVLAARYLGIRLPAEITVP..HADYPRPTIFSL........A
Q54QH5_DICDI/6-304......................FPKDVIFTTLGYISKIVVLISGILGITLPYHLLSKGSKSTIHH...............
Q5KCM1_CRYNJ/8-348......................HPSSSINAALSHVIHLVSLITTYLSISLPFVPMPP...PPFYHPHVGRPLMKANLPFV
Q6C401_YARLI/66-385......................SSHREINTALDRLASFTCLAAYYLGAPLPYVILLPQRRHPYIRISSNNY.........
ATG14_KLULA/3-281......................MDRDKQVISMRYIHQFINFSFNIWLFEGISDVS.........................
ATG14_CANGA/4-309......................LPLPLIEGSLRKLIQYMNLLEHIYCIKYPSAMFVH...........EDE.........
Q6NWB8_DANRE/17-367.........EKSGNQGPELDYINPAHTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGD..................
BAKOR_HUMAN/42-389.........EKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGE..................
ATG14_ASHGO/2-272........................LSTAQESLQHMCEFVIYASRALLVDIPFGSHS........................
Q7Q037_ANOGA/42-403SASSTAASTMEASASPAKVGSHNPAHTIAAALTYTSQLVALLGYYLDVRLPYRVSYADFCTT..................
Q7SFY9_NEUCR/3-349......................LSPEVINTSLANITHLVMLTSHYLAIRLPSQITLP..HQDYPRPTILWP........Q
Q8H1E1_ARATH/7-368......................IPSEELAVSLGYMVQLLNLVVHNLAAPALHSSGFAGSCSRIWQRDSYWD.GRTSTRSN
Q9VAP6_DROME/69-419....DNKDDVPKATANEITPSRFEAYRIVGALTYTAQLTQLLSFYLNVRLPHKIAYGDFCRK..................

PF00452

B2L13_MOUSE/101-197----------------------......ASGWNKLLVPLVLLQHLLL...............------------------
B2LA1_HUMAN/37-140----------------------.....GIINWGRIVTIFAFEGILIK...............------------------
B2L10_HUMAN/39-153----------------------....SPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQ------------------
Q53D42_9GAMA/49-147----------------------...TDGRHNWGRALAVLGLGAYVVD...............------------------
Q2PFS6_MACFA/46-144----------------------......GVNWGRIVAFFSFGGALCV...............------------------
Q1WCD0_ICTPU/34-134----------------------.....GVTNWGRIASLLAFGAVVSK...............------------------
A7SPR2_NEMVE/52-148----------------------......GINWGRIVVLYTFAGKVAK...............------------------
Q4T1V9_TETNG/71-169----------------------......GVNWGRIVGLFAFGGALCV...............------------------
B2L13_HUMAN/104-200----------------------......ASGWNKILVPLVLLRQMLL...............------------------
Q568W6_DANRE/62-163----------------------.....GKMNWGRVVSIFTFTGVLAS...............------------------
Q0KFR9_SALSA/147-247----------------------.....GITNWGRIASLVAFGAVVSQ...............------------------
A7SRF5_NEMVE/1-99----------------------......GINWGRIVALFTFGGVVAH...............------------------
AR1_XENLA/81-179----------------------......GVNWGRIVAFFVFGAALCA...............------------------
Q687D9_MESAU/8-103----------------------.....GNFNWGRVVALFYFASKLVL...............------------------
NR13_COTJA/35-134----------------------.....GGLNWGRLLALVVFAGTLAA...............------------------
Q497M6_MOUSE/37-140----------------------.....GIINWGRIVTIFAFGGVLLK...............------------------
A7RF38_NEMVE/83-183----------------------......GISWGRIIALLCFGYEIAI...............------------------
A7SFS9_NEMVE/45-142----------------------......GVNWGRIVVLYAFGGRLAV...............------------------
Q8BQK4_MOUSE/94-192----------------------......GVNWGRIVAFFEFGGVMCV...............------------------
Q5EAR7_DANRE/62-157----------------------.....GQINWGRIIVLFYSVGKLSA...............------------------
Q005W0_FELCA/2-104----------------------.....GIINWGRIVTIFAFEGILIK...............------------------
Q3HLW5_AIPPA/52-148----------------------......DINWGRIVVLYTFGAKVAE...............------------------
A7LM80_HYDVU/50-150----------------------......GKNWGRVVAFLTFGGNFAV...............------------------
B2L10_RAT/39-145----------------------....DQEFNWGRLVMLLAFVGTLMNQD...........RT------------------
P90504_HHV8/36-134----------------------...GDGNMNWGRALAILTFGSFVAQ...............------------------
Q4SCG3_TETNG/61-157----------------------......NVHWGVVIGLFVVGGAMCV...............------------------
Q5YFF0_9VIRU/15-112----------------------.....GNLNWGRILILLGISQLYFT...............------------------
Q90ZH2_XENLA/62-160----------------------......GTNWGRIVAFFSFGRALCV...............------------------
Q17KY0_AEDAE/81-186----------------------......DITWGKVISLFAIAGGLAV...............------------------
Q9W6F1_CHICK/70-169----------------------.....GVTNWGRVVTLISFGAFVAK...............------------------
Q9I9N3_DANRE/117-217----------------------.....GVTNWGRIASLVAFGAVVCS...............------------------
Q9NGX3_DROME/153-258----------------------......EITWSKVISLFAIAGGLSV...............------------------
CED9_CAEBR/111-216----------------------...TPCPMSYGRLIGLISFGGMVAA...............------------------
Q28WX1_DROPS/144-249----------------------......SITWGKIISIFSVCGGFAI...............------------------
Q8NFF3_HUMAN/57-156----------------------......GINWGRVVALLGFGYRLAL...............------------------
BOKB_DANRE/71-172----------------------......GITWGKVVAIYAVAAGLAV...............------------------
MCL1_CANFA/213-312----------------------.....GVTNWGRIVTLISFGAFVAK...............------------------
Q564A4_DANRE/86-184----------------------......GVNWGRIIAFFEFGGTMCV...............------------------
A7RN20_NEMVE/1-102----------------------......GVSWAKVIALFAFAASMSE...............------------------
A7LM76_HYDVU/90-195----------------------.....DNIAWSHIVSLICFGVEISV...............------------------
A1E3K7_HYDVU/44-142----------------------......GINWGRIIVLYAFAGKIAE...............------------------
Q9I9N4_DANRE/65-160----------------------.....GKFNWGRVVALFYFACRLVI...............------------------
BOKA_DANRE/68-180----------------------GLEKHKGVTWGKIVSLYAVAGALAV...............------------------
Q568W5_DANRE/90-190----------------------.....GTTNWGRIASLLTFGAMLCK...............------------------
B2CL2_BOVIN/46-144----------------------......GPNWGRLVAFFVFGAALCA...............------------------
Q1RPT5_9METZ/75-164----------------------..NGLPKINLGRIAALLGYCYHLCR...............------------------
BOK_CHICK/71-172----------------------......GITWGKVVSLYAVAAGLAV...............------------------
Q4SR59_TETNG/74-172----------------------......GVNWGRIVGLFAFGGVLCV...............------------------
A7S109_NEMVE/32-131----------------------......GKNWGRVVAFLAFGATLAV...............------------------
Q4RVC0_TETNG/71-172----------------------......GITWGKVVSMYAVAGALAV...............------------------
ARBH_ASFM2/43-134----------------------......LINWGRICGFIVFSARMAK...............------------------
Q5F404_CHICK/83-182----------------------......GINWGRVIALLGFGYCMAI...............------------------
Q4S998_TETNG/65-160----------------------.....GKFNWGRVVALFYFACRLVI...............------------------
Q8BEN2_9GAMA/51-143----------------------......GCNWGRIVVWLAWCCFMCRC..............------------------
Q5TJD7_SUBDO/76-175----------------------......GVHWGRIVAFLVFSGHLAV...............------------------
Q08BX9_DANRE/78-172----------------------......GINWGRVVALFHLAYRLIF...............------------------
A7S0T4_NEMVE/5-100----------------------.....GVINWGRIVTLFYFGYKLAL...............------------------
B2LA1_BOVIN/37-140----------------------.....GIVNWGRIVTIFAFEGILTK...............------------------
A1E3K6_HYDVU/95-192----------------------.....DNLNWGRVVSLITFGGKLAQ...............------------------
Q8C264_MOUSE/76-175----------------------......GISWGRVVALLGFGHRLAL...............------------------
Q17KY1_AEDAE/143-248----------------------......DITWGKVVSLFAIAGGLSV...............------------------
Q5BWX6_SCHJA/75-180----------------------......KLNWGRIVAMFAFLRILVL...............------------------
Q9YTQ0_ATHV3/41-135----------------------....KHNTNWGKVVAMISFSVAALQ...............------------------
Q5BJ77_XENTR/115-211----------------------......ATGWNKVLAPLVLLQQLLL...............------------------
Q9W6F2_CHICK/37-140----------------------.....GNTNWGRIMTIFTFGGLLTK...............------------------
A7S9S4_NEMVE/48-145----------------------......GINWGRIVAVFTFGGRLAQ...............------------------
Q4KLS7_XENLA/94-193----------------------......GINWGRILSLLGFGYRMAV...............------------------
V039_FOWPN/44-135----------------------......KINWGRIITIIAFCAYYSK...............------------------
A1E3K5_HYDVU/78-181----------------------......GINWGRIVALLCFGYEVAF...............------------------
Q9DH00_MEHV1/35-134----------------------.....SGFNWGRCLATIVLGGSLAT...............------------------
VG16_SHV21/27-121----------------------....EHTTNWGKVVAMLSFSAAVLQ...............------------------
Q6P4Y4_XENTR/93-188----------------------.....GVFNWGRVVALFYFACKLVV...............------------------

PF15286

B1PZP0_9GAMA/8-133----------------------------VINSGRIVGFFDVGRYVCE---------------------------------
D0U1R1_MHV68/8-133----------------------------AINRGRIVGFFDVGRYVCE---------------------------------
E9M5Q5_9GAMA/5-127----------------------------KINFGRFIGLFAVGKFVCQ---------------------------------

PF10186

A2R922_ASPNC/36-386A..SYLSRD.PNSVAYSLRNPPSVPSGPRTAS...PRP..SRPRPL...SIDRALPKLARED.......PGTYALFLEGV
A6RN46_BOTFB/2-356S..SYMHTNVPFPGGTSSSSNSPSTSRHT......ENAYQPRPRPL...WINKPLPILVNED.......SVAHSSFLEGA
A7F2W3_SCLS1/2-356S..SYLHTNVPFPGGTSSSSNSPSTSRHA......ENSNQPRPRPL...WINKPLPILANED.......SAVHTYFLEGA
A7SI99_NEMVE/2-360.....................................................................EMGRKEFQSAL
ATG14_VANPO/4-287...................................................LYKGDEIKEKT.......INTDEEIAKLI
A9TM71_PHYPA/7-362EFPLFIPRKGGCTSSGDDNELSKSVGSTLGFSSMES....PRIDTVESTASLVNYGTSSG.T.......RESYPDVQKGI
B0DVS0_LACBS/2-334GWARWSTKHPLHLSSSPNPPQPDETPPTPTA.............PLSESYIDTTPP.............PNTPSSFTTAL
B0YA63_ASPFC/2-386A..SYISRESILTATSTQPHNLASSTTHPLG....FQSNHYQPRPL...TIDRSLPKLARED.......PESYVLFLEGV
B2AYN4_PODAN/6-338S..SYHHGDVPFPGTAMSGQSGN.................PRPRPL...FIEKALLTLAKDD.......PNTYSAFLEGV
B2WCB9_PYRTR/2-373S..SYQGKKVPFPGSTPSHSSSASPETSRTLE...ARIHLPKPRTL...FVDRPLSALSAED.......PPAYGSFIEGV
B4F8Q5_MAIZE/9-367VYPLFIPRKNVC.TGGEETSLTESGSSNFGVDSVDSVKK.PSFDPKR..SNSFNFSGASSHS.......MERHQYLQRGI
B6HV92_PENCW/42-413A..SYRSRD....GHDGADYQSSSPAASRTVD...PRIHTPRPRPL...FIDKPLPRLAKED.......PATYAFFLEGA
B6K450_SCHJY/2-286.................................................YISDPFAEDSKERFLPLFPYKETPEMFQHGV
B6QMH1_PENMQ/2-365A..SYSSAQDNLSDVYHPYNHSKPGDTRK...........HRARPL...SVEKTLPKLVKEE.......PATYALFIEGV
B8B4V4_ORYSI/14-362VYPLFIPRKNNC.SVGEDNSWTESGSGNFGVQSVDSDNK.SVLDSKR..SNSFNFSIASSHS.......MERHQDLQRGI
B8NYP4_ASPFN/2-372G..SYLLRE.MLPASSTLQPSPSSSTPSRTAD...PRSCFPRPRPL...SIDRSLPKLARED.......PGTYALFIEGA
B9GUI0_POPTR/7-365EYPLFIPRQNYC.STSSENSWTDKSSSNFGVASMESERR.PHLDSTR..SNSFNYSSVSPHS.......VETHKDLQKGV
C0NNR8_AJECG/2-365S..SYLSQETAFPGASPSQSSSSSPTASRTTD...TRPP.PRPRPL...YVNKSLPKLAHED.......PATYGLFLEGV
C0RX80_PARBP/2-365S..SYSSRKATFPGTSPYQSTSTSPTASRTAD...VRPL.PRPRPL...FINKSLPKLAQED.......PATYGLFIEGV
C4JIE0_UNCRE/2-361S..SYLAKDVPFPGLSP..SNSFSPATTRGSD...SRPL.PRPRPL...FLDRSLPKLAKED.......PAGYTLFLEGV
C5DLA9_LACTC/4-280.....................................................................QKPAKDVLDSL
C5DUI4_ZYGRC/2-311.................................................LELEVSAKTADES.......SSDENTIVDHL
ATG14_YEAST/2-295.......................................................EQPMFEF.......SDSIQTVVQRL
Q0TZA4_PHANO/2-373S..SYKGKKVPFPGSTPSHSSSNSPEASRTID...PRVHLPKPRTL...FIDRPLGHLSAED.......PPAYSSFIEGV
Q147F2_ARATH/6-368GYPLFVPIHDHY.SFEEKSSWTGRDTTNFGVTSLKSDGS.IEEDYHDLDLDVVSLSSASPHS.......VETFRNLQQGI
Q17M47_AEDAE/34-384.....................................................................ALSEAQFNRKV
Q2HG05_CHAGB/2-272S..SYKHGEVAFPGSLV...............................................................
Q54QH5_DICDI/6-304.................................................NMKSKDYPLYYQQ.......KTKSREFQKAL
Q5KCM1_CRYNJ/8-348STTKWREKHVLWMSSTASVSSKIKPQSTPPISNL...............LAQPSICSIIAKS.......TSKHKQFLVSF
Q6C401_YARLI/66-385............................................PL...HLEDPLPQVSSEK.......PAVFSKFAHAL
ATG14_KLULA/3-281.....................................................................IENEQNVIQNY
ATG14_CANGA/4-309...................................................MLSLQGHSAKL.......KRNAPELLQVL
Q6NWB8_DANRE/17-367.....................................................................NLTRYRFTRTV
BAKOR_HUMAN/42-389.....................................................................NLSKQKFTRAV
ATG14_ASHGO/2-272.....................................................................EKLTTDHIAAV
Q7Q037_ANOGA/42-403.....................................................................TLSEAQFARKV
Q7SFY9_NEUCR/3-349A..SYQLEEPPFPAAMLSGQHQQSGLEGPPIDVEKTRSFPHRPRPL...WIEKPLPALVKED.......PQTAGMFIEAV
Q8H1E1_ARATH/7-368EYPLFIPRRNYC.STSVENSWTDKNSSNFGVASMESDRKEPRLDSPG..SNSFKYSSASPHS.......IESHRDLQKGI
Q9VAP6_DROME/69-419.....................................................................LLNEEQFRRKI

PF00452

B2L13_MOUSE/101-197---------------------------------------------------------------------.ELTRRGQ...
B2LA1_HUMAN/37-140---------------------------------------------------------------------.KLLRQQIAPD
B2L10_HUMAN/39-153---------------------------------------------------------------------PRLKEQEGD.V
Q53D42_9GAMA/49-147---------------------------------------------------------------------.KIRDDERL.L
Q2PFS6_MACFA/46-144---------------------------------------------------------------------.ESVDKEM...
Q1WCD0_ICTPU/34-134---------------------------------------------------------------------.YEQESGR...
A7SPR2_NEMVE/52-148---------------------------------------------------------------------.YCQENQL...
Q4T1V9_TETNG/71-169---------------------------------------------------------------------.ECVEKEM...
B2L13_HUMAN/104-200---------------------------------------------------------------------.ELTRRGQE.P
Q568W6_DANRE/62-163---------------------------------------------------------------------.ELLSRGEN.S
Q0KFR9_SALSA/147-247---------------------------------------------------------------------.HLKERGR...
A7SRF5_NEMVE/1-99---------------------------------------------------------------------.HFIESER...
AR1_XENLA/81-179---------------------------------------------------------------------.ESVNKEM...
Q687D9_MESAU/8-103---------------------------------------------------------------------.KALCTKV...
NR13_COTJA/35-134---------------------------------------------------------------------.ALAESAC...
Q497M6_MOUSE/37-140---------------------------------------------------------------------.KLPQEQI...
A7RF38_NEMVE/83-183---------------------------------------------------------------------.TVIRRGF...
A7SFS9_NEMVE/45-142---------------------------------------------------------------------.YCEQHNM...
Q8BQK4_MOUSE/94-192---------------------------------------------------------------------.ESVNREM...
Q5EAR7_DANRE/62-157---------------------------------------------------------------------.KMVVARL...
Q005W0_FELCA/2-104---------------------------------------------------------------------.KLLQERI...
Q3HLW5_AIPPA/52-148---------------------------------------------------------------------.HFHENG....
A7LM80_HYDVU/50-150---------------------------------------------------------------------.HCALRADM.G
B2L10_RAT/39-145---------------------------------------------------------------------VKRRRDQRN.R
P90504_HHV8/36-134---------------------------------------------------------------------.KLSNEPHL.R
Q4SCG3_TETNG/61-157---------------------------------------------------------------------.QCVRNNH...
Q5YFF0_9VIRU/15-112---------------------------------------------------------------------.KSESESE...
Q90ZH2_XENLA/62-160---------------------------------------------------------------------.ESANKEM...
Q17KY0_AEDAE/81-186---------------------------------------------------------------------.DCVRQEH...
Q9W6F1_CHICK/70-169---------------------------------------------------------------------.HLKSINQ...
Q9I9N3_DANRE/117-217---------------------------------------------------------------------.RLKELQQ...
Q9NGX3_DROME/153-258---------------------------------------------------------------------.DCVRQGH...
CED9_CAEBR/111-216---------------------------------------------------------------------.KMMESAEL.Q
Q28WX1_DROPS/144-249---------------------------------------------------------------------.DCVRQGH...
Q8NFF3_HUMAN/57-156---------------------------------------------------------------------.HVYQHGL...
BOKB_DANRE/71-172---------------------------------------------------------------------.DCVRLGH...
MCL1_CANFA/213-312---------------------------------------------------------------------.HLKSINQ...
Q564A4_DANRE/86-184---------------------------------------------------------------------.ESVNREM...
A7RN20_NEMVE/1-102---------------------------------------------------------------------.DCVMQGR...
A7LM76_HYDVU/90-195---------------------------------------------------------------------.YIVEHGK...
A1E3K7_HYDVU/44-142---------------------------------------------------------------------.HCRKSND...
Q9I9N4_DANRE/65-160---------------------------------------------------------------------.KAISTRV...
BOKA_DANRE/68-180---------------------------------------------------------------------.DCVRNGH...
Q568W5_DANRE/90-190---------------------------------------------------------------------.YQNDRGH...
B2CL2_BOVIN/46-144---------------------------------------------------------------------.ESVNKEM...
Q1RPT5_9METZ/75-164---------------------------------------------------------------------.KFVQQKA...
BOK_CHICK/71-172---------------------------------------------------------------------.DCVRHAQ...
Q4SR59_TETNG/74-172---------------------------------------------------------------------.ECVEKDA...
A7S109_NEMVE/32-131---------------------------------------------------------------------.YCAQREE..L
Q4RVC0_TETNG/71-172---------------------------------------------------------------------.DCVRQGH...
ARBH_ASFM2/43-134---------------------------------------------------------------------.YCKDANNH.L
Q5F404_CHICK/83-182---------------------------------------------------------------------.HVYQQGI...
Q4S998_TETNG/65-160---------------------------------------------------------------------.KALVTHV...
Q8BEN2_9GAMA/51-143---------------------------------------------------------------------TRCCEDYNL.V
Q5TJD7_SUBDO/76-175---------------------------------------------------------------------.HCARSNGL.E
Q08BX9_DANRE/78-172---------------------------------------------------------------------.QALTQNH...
A7S0T4_NEMVE/5-100---------------------------------------------------------------------.KVLNQ.....
B2LA1_BOVIN/37-140---------------------------------------------------------------------.KLLGKCI...
A1E3K6_HYDVU/95-192---------------------------------------------------------------------.WFWARQP..N
Q8C264_MOUSE/76-175---------------------------------------------------------------------.YVYQRGL...
Q17KY1_AEDAE/143-248---------------------------------------------------------------------.DCVRQGH...
Q5BWX6_SCHJA/75-180---------------------------------------------------------------------.RLSKHGH...
Q9YTQ0_ATHV3/41-135---------------------------------------------------------------------.TIDEDYR...
Q5BJ77_XENTR/115-211---------------------------------------------------------------------.ELTRRGEY.Q
Q9W6F2_CHICK/37-140---------------------------------------------------------------------.KLQEHGV...
A7S9S4_NEMVE/48-145---------------------------------------------------------------------.FCARNGL...
Q4KLS7_XENLA/94-193---------------------------------------------------------------------.YVVRNGQ...
V039_FOWPN/44-135---------------------------------------------------------------------.KVKQDTS...
A1E3K5_HYDVU/78-181---------------------------------------------------------------------.AIIKRNA...
Q9DH00_MEHV1/35-134---------------------------------------------------------------------.ALYENGC...
VG16_SHV21/27-121---------------------------------------------------------------------.TIDEEYK...
Q6P4Y4_XENTR/93-188---------------------------------------------------------------------.KALCTKV...

PF15286

B1PZP0_9GAMA/8-133----------------------------------------------------------------------EVLCP.GSWT
D0U1R1_MHV68/8-133----------------------------------------------------------------------ELLCP.GSWT
E9M5Q5_9GAMA/5-127----------------------------------------------------------------------ELLLSSTTWS

PF10186

A2R922_ASPNC/36-386TLLAWNVSWLCR........TQ...GINIT...SESWEEVCNIGKNMWQLLVAP
A6RN46_BOTFB/2-356ILLAYNVAWLCK........SQ...GVPVGDSDTTSFEDICNIGKNLWKLLIGD
A7F2W3_SCLS1/2-356VLLAYNVAWLCK........SQ...GISVGENGTTTFEDICNIGKNLWKLLIGD
A7SI99_NEMVE/2-360SRLNTNVLHLCF........TQ...HVDPT..LLHPHRTLNNLYALINTTCTGR
ATG14_VANPO/4-287TKLVINVLQIGRFKNLIP..KD...AIDLV.WLLDQYDVDSLFYNVIVNHKMEC
A9TM71_PHYPA/7-362KLLRRSVGCLCAYGFG....QL...SLSVP.TDMSIFDAFAELLNILSS.KETR
B0DVS0_LACBS/2-334AMLLYDVSYLAH........TQ...NVDVP......LSQAGDVLSNLWSVCCSA
B0YA63_ASPFC/2-386TLLAWNVSWLCR........TQ...GLNIA...SDSWEEICNIGKNMWQLLVAP
B2AYN4_PODAN/6-338GLLAHDVAWLCA........SQ...GVSFG..DRESYDDVCNIGHNLWRLLIGD
B2WCB9_PYRTR/2-373SLLAYNVAWLCR........TQ...GMKES...FKQWEDTCVIGRNLYRLLIAQ
B4F8Q5_MAIZE/9-367SLLKTSVTAITTYYYN....SL...GLDVP.SNLSTFEAFAKLLHMLSSSKALR
B6HV92_PENCW/42-413TLLAWNVAWLCR........TQ...GINLS...SDSWEEVCDIGKSLWQLLVAP
B6K450_SCHJY/2-286ILLNRDISTLLH.............AYGLP......DDMPNLTLANCHKLLQFV
B6QMH1_PENMQ/2-365SLLAWNVSWLCR........TQ...GLNIG...SDSWEDICNIGKNMWQLLVSP
B8B4V4_ORYSI/14-362SLLKTSVTAITTYYYN....SL...GMDVP.SNLSTFEAFAKLLHMLSSLKVLR
B8NYP4_ASPFN/2-372TLLAWNISWLCR........TQ...GLHIT...SDSWEEICSIGKHMWQLLVAP
B9GUI0_POPTR/7-365SLLKKSVACVTAYCYN....LL...CLDVP.SDTSTFEAFAKLLSTLSSSKEVR
C0NNR8_AJECG/2-365ALLAWNIYWLCR........TQ...GLHVG...VDSWEDVYDIGRNLWMLLVAQ
C0RX80_PARBP/2-365ALLAWDISWVCR........TQ...GLDIG...FDSWENICDVGHNLWMLLVAQ
C4JIE0_UNCRE/2-361SLLAWNVSWVCR........SQ...GLQIG...QDSWEDVCEMGRNLWQLLVAP
C5DLA9_LACTC/4-280TGIVLNLLVFLQSLELVP..QKFCGDRGYLRSLLRNYDVDRLFYYMVMNRDIEL
C5DUI4_ZYGRC/2-311TKIFINIIQISRHLNLIS..KD...PIDLA.WMLDQNDLDTLFYNMAMRLETKS
ATG14_YEAST/2-295IKLIINILQICRHLKLVP..ST...PMDIP.WLLDQYDVDGLFYNMVKRNKMKC
Q0TZA4_PHANO/2-373SLLAYNVAWLCR........TQ...GMKDS...FKQWEDICPMGQNLHRLLISQ
Q147F2_ARATH/6-368AHLKQSVAHLTVYGYR....SL...SLEVP.SGTSTFETFAKLLATLSSLKEVQ
Q17M47_AEDAE/34-384ARLNANILYLCY........TQ...GCQLN..ELRPTHTLENIQRLMNSTHADL
Q2HG05_CHAGB/2-272....................SQ.........IPFDSYEDVCNMGQNLWRLLIGD
Q54QH5_DICDI/6-304HLLGENIIFLRY........YH...GIQTP......KESNLLFLKNIYELIKSN
Q5KCM1_CRYNJ/8-348ALLSFSIAYLAW........SQDVPGIGIR.GEVDGDDNAGVLFDEESKVTQGQ
Q6C401_YARLI/66-385AMLCLNLASISH.............KLGFH.SHLNTPEEIVKIDKIISRMFLTI
ATG14_KLULA/3-281SQLIYDTLRLLQVRKLV...SE...SVSIR.DILIRYDLDGMIYYLSKSKYLSS
ATG14_CANGA/4-309IKLIQMILVVMTRSKLIDERKQ...NIDYA.WILDQYDIDGLFYHMAMSIPIDT
Q6NWB8_DANRE/17-367NKLNTNVLHLCS........EH...PLDESAYVLFYFRYFFLYYQLLNTSAIKL
BAKOR_HUMAN/42-389KKLNANILYLCF........SQ...HVNLD..QLQPLHTLRNLMYLVSPSSEHL
ATG14_ASHGO/2-272SHFTVNLLTILIKRKRL...QE...RPDVP.DLLGRYDIDGLLYLLCSGGDVES
Q7Q037_ANOGA/42-403ARLNADIVFLCH........TQ...GCRLN..DMNPTHTLENLLCLLKSPELGH
Q7SFY9_NEUCR/3-349CLLAHNIAWACC........TQ...GLPFGFDSRDTYDELCNMGHNLYRLLIGD
Q8H1E1_ARATH/7-368ALLKKSVACLTAYCYN....SL...CLEVP.PEASTFEAFAKLLATLSSSKEVR
Q9VAP6_DROME/69-419SRLNSNIMYLAY........TQ...QVKLR..ALIEQHTLENLLAILDLERSDL

PF00452

B2L13_MOUSE/101-197EP....LRMLLQ--------------------FGVMYL.EEHAAEFIIQQG.GW
B2LA1_HUMAN/37-140VDT...YKEISY--------------------FVAEFI.MNNTGEWIRQNG.GW
B2L10_HUMAN/39-153ARD...CQRLVA--------------------LLSSRL.MGQHRAWLQAQG.GW
Q53D42_9GAMA/49-147TFA...IAVLPV--------------------YAYEAL.ESQ...WFRSHG.GW
Q2PFS6_MACFA/46-144QVL...VSRIAA--------------------WMATYL.NDHLEPWIQENG.GW
Q1WCD0_ICTPU/34-134GHC...PSIVAE--------------------EISSYL.LCNQKEWLLKNN.SW
A7SPR2_NEMVE/52-148DN....AENVAT--------------------WVGNYV.A.SKSDWVKKAG.GW
Q4T1V9_TETNG/71-169NPL...VGRIIE--------------------WMTVYL.DNHIQPWIQSQG.GW
B2L13_HUMAN/104-200......LSALLQ--------------------FGVTYL.EDYSAEYIIQQG.GW
Q568W6_DANRE/62-163EG....SRRLAE--------------------TIADYL.GGEKQDWLVENG.GW
Q0KFR9_SALSA/147-247GHC...VELVGQ--------------------EIAKYL.LSDQSDWLIKNN.AW
A7SRF5_NEMVE/1-99PEM...VPHVVE--------------------WIPSFI.ADNLLSWIMENG.GW
AR1_XENLA/81-179SPL...LPRIQD--------------------WMVTYL.ETNLRDWIQSNG.GW
Q687D9_MESAU/8-103PEL...IRTIMG--------------------WTLDFL.RERLLVWIQDQG.GW
NR13_COTJA/35-134EEG...PSRLAA--------------------ALTAYL.AEEQGEWMEEHG.GW
Q497M6_MOUSE/37-140ALDVGAYKQVSS--------------------FVAEFI.INNTGEWIRRNG.GW
A7RF38_NEMVE/83-183SGS..FLRRIIR--------------------FVVDFIFRERIARWIAEHG.GW
A7SFS9_NEMVE/45-142KDL...VQSVTD--------------------WVGKYI.A.GLSEWIANEG.GW
Q8BQK4_MOUSE/94-192SPL...VDNIAL--------------------WMTEYL.NRHLHTWIQDNG.GW
Q5EAR7_DANRE/62-157PRI...VSDILS--------------------LSLDYF.KRNLLQWILTVG.GW
Q005W0_FELCA/2-104VPDADAFK.VSY--------------------FVAEFI.TKHTGEWIRQNG.GW
Q3HLW5_AIPPA/52-148TDL...SDEISK--------------------WIGNYM.A.KKSDWIRKAG.GW
A7LM80_HYDVU/50-150EEY...VDRVVN--------------------WISKYM.AVNLDYWINQQG.GW
B2L10_RAT/39-145LLLERDCYLIVS--------------------LLYNRL.TGRHRSWLEAHG.GW
P90504_HHV8/36-134DFA...LAVLPV--------------------YAYEAI.GPQ...WFRARG.GW
Q4SCG3_TETNG/61-157EEL...VCHIAD--------------------WMTAYL.DEHLEPWIQRQG.GW
Q5YFF0_9VIRU/15-112......RTQITE--------------------QLERFFRQDAISNWIVSNG.GW
Q90ZH2_XENLA/62-160TDL...LPRIVQ--------------------WMVNYL.EHTLQPWMQENG.GW
Q17KY0_AEDAE/81-186YDY...LQQLIE--------------------GTTDVI.EEDLSLWLVEKG.GW
Q9W6F1_CHICK/70-169EKC...ITSLAG--------------------IITDAL.VSSKREWLMSQG.GW
Q9I9N3_DANRE/117-217DQC...VERVAE--------------------QISSYL.TSEQQDWILKNK.SW
Q9NGX3_DROME/153-258PEY...LPKLME--------------------SVSEVI.EDELVPWINENG.GW
CED9_CAEBR/111-216GQ....VRNLLM--------------------YTSLFIKTRIRQSWKEHNR.SW
Q28WX1_DROPS/144-249YDY...LQCLVD--------------------GLAEII.EDDLVYWLIDNG.GW
Q8NFF3_HUMAN/57-156TGF...LGQVTR--------------------FVVDFMLHHCIARWIAQRG.GW
BOKB_DANRE/71-172PVM...VHTIVD--------------------SLGEFV.RRSLVPWLKKRG.GW
MCL1_CANFA/213-312ESC...IEPLAE--------------------SITDVL.VRTKRDWLVKQR.GW
Q564A4_DANRE/86-184ASQ...VDNIAH--------------------WMTDYL.NGPLENWIEENG.GW
A7RN20_NEMVE/1-102PEL...VKSILN--------------------NVRAYV.RDHLAVWIRNHG.GW
A7LM76_HYDVU/90-195VGLASFLKKICS--------------------FIVDFIVKEEILQWIAQHG.GW
A1E3K7_HYDVU/44-142EQI...IDKIAL--------------------WVAGFV.A.KKSSWIRDSGRGW
Q9I9N4_DANRE/65-160PDI...IRTIIS--------------------WTMSYI.QEHVINWIREQG.GW
BOKA_DANRE/68-180PAM...VHTIVD--------------------CMGEFV.RKSLASWLKKRG.GW
Q568W5_DANRE/90-190SKY...VRLVGE--------------------EISSYL.LTEQRDWILRNK.AW
B2CL2_BOVIN/46-144EPL...VGQVQE--------------------WMVAYL.ETRLADWIHSSG.GW
Q1RPT5_9METZ/75-164GAF.........--------------------.........TLVSFLGMVG.TW
BOK_CHICK/71-172PAM...VHTIVD--------------------CLGEFV.RKTLVTWLKRRG.GW
Q4SR59_TETNG/74-172SEL...VCRIAD--------------------WMTIYL.DEHINPWIQSQG.GW
A7S109_NEMVE/32-131HEL...VNDIVE--------------------WVSRYM.DQNLSCWIRENG.GW
Q4RVC0_TETNG/71-172PTT...VHILVD--------------------SLGQFV.RRFLVPWLKRRG.GW
ARBH_ASFM2/43-134EST......VIT--------------------TAYNFM.KHNLLPWMISHG.GQ
Q5F404_CHICK/83-182TGF...LRRIAR--------------------YVTEFMLRNRIARWIAQQG.GW
Q4S998_TETNG/65-160PDI...IRTIIS--------------------WTMDYL.QEHVANWIREQG.GW
Q8BEN2_9GAMA/51-143DAV...FRGVLE--------------------S......TEGIDGWIHSHG.GW
Q5TJD7_SUBDO/76-175NR....VRDVVE--------------------WTEAEM.RLRVHQWVEDRG.GW
Q08BX9_DANRE/78-172LEI...IKNIIS--------------------WFLQFM.KKHISAWIRQQG.GW
A7S0T4_NEMVE/5-100IPL...IKMIIE--------------------WVVKFV.KEKLVKWIFQQG.GW
B2LA1_BOVIN/37-140ASDMDMCKDISF--------------------FVAEFI.TENTGEWIKQNG.GW
A1E3K6_HYDVU/95-192NEL...IEEIED--------------------WLTESL.S.DKKDWIKQKG.GW
Q8C264_MOUSE/76-175TGF...LGQVTC--------------------FLADIILHHYIARWIAQRG.GW
Q17KY1_AEDAE/143-248PDY...LPKLIE--------------------GVADVI.EDELVTWISENG.GW
Q5BWX6_SCHJA/75-180SDA...IQMLIK--------------------TTSQYS.DEKLKNWINLHD.GW
Q9YTQ0_ATHV3/41-135.......RVATS--------------------TLSSYIAKSVGVNWFIDHG.GK
Q5BJ77_XENTR/115-211......LKALVQ--------------------LGVSYI.EDMCADFIIQQG.GW
Q9W6F2_CHICK/37-140QLTGEEKEKISY--------------------FITEYI.INNKAAWIDANG.GW
A7S9S4_NEMVE/48-145HDG...VREVEA--------------------WLGDYI.A.NLSHWIQTQG.GW
Q4KLS7_XENLA/94-193RGF...FRIINQ--------------------WMMTYVMESCVAQWISDRG.GW
V039_FOWPN/44-135PQY..YDGIISE--------------------AITDAI.LSKYRSWFIDQD.YW
A1E3K5_HYDVU/78-181RGFGKFLRKLIR--------------------FVVDFIVNEKIAKWIAKNG.GW
Q9DH00_MEHV1/35-134EEG...PSRLAA--------------------ALAAYL.AEEQGEWLREHG.GW
VG16_SHV21/27-121.......CVATS--------------------MLSSYISRSVGANWFIENG.GE
Q6P4Y4_XENTR/93-188PEM...IRTIIN--------------------WTMEYL.REYVVQWIRDQG.GW

PF15286

B1PZP0_9GAMA/8-133ED----HELLND--------------------CMTHFFIENNLMNHFP------
D0U1R1_MHV68/8-133EE----HDLLNE--------------------YMTQFFIENNLMNYFS------
E9M5Q5_9GAMA/5-127MA----HDLLFH--------------------KL.ALVLEVKIMPWLT------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window