Sequence alignment for CL0552

PF09814

A4D9F3_ASPFU/21-420ELLPNIRHITFYISI-PA--------------------------------------------------------------
UBE3D_HUMAN/13-385EVRGQLQSALLILGE-PK--------------------------------------------------------------
A5DDI0_PICGU/5-350ELLPRLNSLTVISDF-SG--------------------------------------------------------------
Q6BMI9_DEBHA/5-363EYLPRINSISVIVEN-ND--------------------------------------------------------------
Q0TZD4_PHANO/225-279IAHGHV.........-..--------------------------------------------------------------
Q29GF2_DROPS/8-386EIRPYLNCGQVYIQL-HR--------------------------------------------------------------
Q6CWI5_KLULA/6-349EYHHWIGAVQLWVEN-DG--------------------------------------------------------------
A1CJR3_ASPCL/19-424ELLPNIRHITLYISL-PS--------------------------------------------------------------
Q9VWP0_DROME/9-390ELRPNLRSGVVFLRF-DQ--------------------------------------------------------------
UBE3D_PONAB/13-385EVRGQLQSALLILGE-PK--------------------------------------------------------------
Q6FK88_CANGA/6-347EELENVGVTLIAVEA-LN--------------------------------------------------------------
Q7SDG7_NEUCR/13-382ELLSNIRQISLAISL-GS--------------------------------------------------------------
Q4P6X1_USTMA/1030-1417LYIGTVHDDIVLVCG-SC--------------------------------------------------------------
YHFA_SCHPO/4-322EYLVHVGRVNV....-..--------------------------------------------------------------
A7TPW1_VANPO/6-340EELPRVDSLNILVDG-RV--------------------------------------------------------------
Q75DV5_ASHGO/6-339EYLPRIGVMLIVVAG-EA--------------------------------------------------------------
YJ9I_YEAST/7-342EWLPRIQSISVVVEG-WK--------------------------------------------------------------
Q16XY0_AEDAE/12-444ELRPRLQSANFFICF-SR--------------------------------------------------------------
Q5B919_EMENI/28-412EYLPNIRQVSLQISA-AG--------------------------------------------------------------
A5DWX9_LODEL/10-366EYLSKLGQMSVTVQV-QT--------------------------------------------------------------
Q5PQ45_XENLA/37-407EIRKNMQTASLIVGG-LG--------------------------------------------------------------
Q6C9F9_YARLI/6-329EYLPNVGQVSVTFQG-ND--------------------------------------------------------------
Q59X25_CANAL/5-343EYLPRLNSISVALDV-QS--------------------------------------------------------------
UBE3D_MOUSE/13-364EVRRRLQSALLILGG-PD--------------------------------------------------------------
UBE3D_BOVIN/13-385EVRRRLQSALLILGD-SK--------------------------------------------------------------
A7USM4_ANOGA/14-434ELRPRLQCANFFISF-PR--------------------------------------------------------------
A7SC58_NEMVE/7-362DLRELL.........-..--------------------------------------------------------------
Q5EAZ8_DANRE/20-391ELRQKLQSGLLFIRS-DV--------------------------------------------------------------

PF00632

HACE1_MOUSE/602-909DIL.....SNEIV.N.PD......Y..ALF.......................................T..........
Q7QE66_ANOGA/554-863YLL.....SRQLF.S.PY......R..NMF..................................................
NEDD4_HUMAN/1013-1318FLI.....SKEMF.N.PY......Y..GLF........................................E.........
A4IBF5_LEIIN/1897-2310YDL.....SKAAF...................................................................
A4IC88_LEIIN/3812-4131SEM.....CRELM.S.GR......L..PFF......................................V.P.........
Q4WHR7_ASPFU/967-1337RVL.....MAEAL.N.PS......Y..GMF..................................................
A4HPV4_LEIBR/2168-2551ELI.....AEELL.N.PQ......H..GLWRTEPIP..........................IDELTDS.PTLKTTH...
A4HF82_LEIBR/3619-3949QLC.....SHSTI................F..................................................
A4IAG7_LEIIN/1051-1369YTE.....LSAYF.R.AE......S..KFW..................................................
UBE3B_HUMAN/736-1068EEI.....IKRVF.D.PA......L..NLF..................................................
A3GHK0_PICST/646-950LLL.....TRALF.N.PQ......A..GMV..................................................
UPL3_ARATH/1518-1888TLL.....SHDLQ.K.AS......L..GMWRSSSGDK.........................VSMQIGR.DEIEDGK...
Q0UNY9_PHANO/908-1229RVV.....LSEAF.K.PD......H..GMF..................................................
Q9BL11_CAEEL/717-1019ILV.....MRKIL.Q.SD......Y..GMF........................................S.........
A0EFC1_PARTE/672-969RLM.....MEKLI.S.PD......Y..GMF........................................I.........
Q2GSX9_CHAGB/694-1033TSV.....TTEAF.T.PN......E..GLF..................................................
Q5KIA2_CRYNJ/1499-1843ALA.....SKEFA.R.RN......L..HVWRD..................................EDP.SIA.......
HUL5_YEAST/607-910TTV.....SDEGFKD.PK......H..ELF..................................................
Q38D88_TRYB2/1472-1912TLI.....ARELTKC.RL.........RLWN....................................NS.SR........
A0E799_PARTE/3885-4178DMV.....GNTLKDD.TY.........KFF........................................Q.........
Q00WM5_OSTTA/458-763SIL.....AREVF.N.PN......I..ALF..................................................
A2DUY0_TRIVA/771-1054QVF.....FKEIALS.KQ......F..RMI..................................................
Q6BGB8_PARTE/609-908TRV.....VNQAL.D.PT......F..GLF..................................................
A2FLN6_TRIVA/2545-2849TEA.....CMEIMDP.SM.........QLF..................................................
Q7PSQ3_ANOGA/541-897YLL.....SHEML.N.PQ......Y..GLF........................................Q.........
Q6NNZ7_DROME/211-561TTV.....VQHNT.T.TN............NSS.................................IIT.TTT.......
A4IBT8_LEIIN/1017-1343LIL.....VKKAL...................................................................
A0D2G1_PARTE/170-483TSI.....LQQLVDQ............GYL........................................Q.........
K0317_MOUSE/512-823ELI.....CKALF.D.TT......S..QLF......................................A.R.........
A2FVL0_TRIVA/2315-2604YDI.....CREIVNP.NN.........KIF........................................I.........
Q8SS57_ENCCU/454-746QLL.....SQEIKED.........E..RLF..................................................
Q4E2E5_TRYCC/2646-2975TMM.....CDELNYREEDDGRRVDPLLPFF..................................................
A2F794_TRIVA/2662-2959SQM.....CIELFHP.ST.........GLF..................................................
TOM1_YEAST/2962-3268QVL.....SRQMF.N.PD......Y..ALF........................................L.........
A7SQ93_NEMVE/299-612LLL.....VRKIF.K.PE......Y..GMF........................................S.........
A2DAV4_TRIVA/452-719FSL.....TNEFL...........QRDQTF..................................................
Q6C901_YARLI/697-1001LLL.....KTALF.N.PA......R..NLF........................................V.........
A0DAX5_PARTE/100-320EDI.....TAEDMEN.................................................................
Q6C8U2_YARLI/491-779LLV.....GLES...............PYF..................................................
Q9W0H2_DROME/761-1058MLL.....LKDLL.D.PK......Y..GMF........................................K.........
A0BRN4_PARTE/3724-4023SLI.....GNELK...GENLKSEQY..GYF..................................................
A2FJ59_TRIVA/1204-1414TMI.....GEEIKNN.............LF..................................................
Q6PDJ9_MOUSE/738-1060LLC.....PSSAVNK.NK.........GKY..................................................
A4S7N1_OSTLU/131-443SQV.....TEQGL.D.PN......R..GLF..................................................
A2FR71_TRIVA/373-670YLL.....VNAVF.S.PD......Y..GMF........................................R.........
A0DNI8_PARTE/201-510NLI.....MKEIVHP.ES.........GMF........................................Q.........
Q5BG86_EMENI/848-1165LLL.....VREVF.D.PH......H..GLF........................................I.........
A5K4K7_PLAVS/1441-1991ILL.....CREIL.H.AK......F..FLF..................................................
Q55NG7_CRYNB/3037-3342SVL.....AQQIF.D.PN......F..ALF........................................E.........
A2DQ34_TRIVA/412-708YLL.....TSQIF.S.PD......Y..GMF........................................T.........
A7AV31_BABBO/1338-1643DKF.....TFDMFRR.AS......K..G....................................................
A2E999_TRIVA/2659-2965TEL.....ALDICSP.NC.........GLV..................................................
A2F3T0_TRIVA/1939-2179AQI.....AEELNNP.NL.........GVF..................................................
A2FXS6_TRIVA/392-692HLI.....CQTLF.S.SD......Y..GMF........................................E.........
Q6NVK6_XENTR/557-856QLV.....VEEIF.N.PD......I..GMF........................................T.........
A2DWM0_TRIVA/796-1093NLM.....SREFM.K.KS......L..NMWRN...................................ED.PK........
A2DYB1_TRIVA/1674-1977TSL.....IHQLF.N.PN......Y..VLF..................................................
A2EEN6_TRIVA/766-1053DMI.....VKKLT.S.PD......L..SLF........................................V.........
A4I8L1_LEIIN/3799-4087F.........ELMQH.PD.........KCY......................................P.N.........
HUL4_ASHGO/526-839LLL.....TRDLF.N.PN......N..GLF..................................................
A2DKE7_TRIVA/929-1162FLM.....VNELMDV.NI.........RYF..................................................
Q247X9_TETTS/2115-2420SKV.....VEQTFLN.NK.........ELF..................................................
A5K5J0_PLAVS/8258-8564SIL.....AKEIF.N.PN......Y..ALF........................................C.........
A2DXG0_TRIVA/2382-2669SEI.....CQEMFLP.FN.........KVF..................................................
A4RVZ5_OSTLU/490-781SLM.....ANELCDG.NR......ADRQLF..................................................
UPL7_ARATH/828-1142TDI.....TKAAF.A.TE......Y..GLF......................................S.Q.........
MUG30_SCHPO/482-807LLL.....TRKVF.S.PE......F..GLF........................................V.........
Q6GP47_XENLA/736-1028LVL.....LESMV.N.PD......Y..GMF........................................S.........
A3FPU7_CRYPI/497-797QLL.....VQEIF.N.ID......F..GMF........................................I.........
Q38A01_TRYB2/1526-1868NLL.....ARKFQ.D.VQ......L..HMWRTE.................................EFT.DES.......
A1CTM1_ASPCL/1468-1817STV.....SKEFS.K.KK......L..KIWRE..................................NDC.NND.......
A2ECJ9_TRIVA/791-1087TLF.....SHELC.R.TS......R..GLWRT...................................ND.PQ........
Q7PSA4_ANOGA/2506-2929ALV.....AAELQ.R.SD......L..GMWLCDDEE...........................PKLIED.EIDLGEG...
Q4UD92_THEAN/251-554ITL.....CTLIF.D.PT......Y..GIF..................................................
A2FK98_TRIVA/1968-2204SQM.....VDELMDV.NF.........RMF..................................................
A3LSX3_PICST/660-977TSV.....VREGF.D.PS......NELELF..................................................
A0DLU6_PARTE/3989-4284NKV.....GELMKSQ.SN.........GFF..................................................
Q00Y47_OSTTA/1123-1477TLL.....SKQFK.R.RK......L..QLWRD..................................SGI.ANE.......
SPKUL_DICDI/1577-1887LLN.....SNDLF.N.NN......N..NNN........................................E.........
A7SNF7_NEMVE/430-737SLH.....SSSVAGN.PE......D.......................................................
A7SP65_NEMVE/115-400YIV.....NRLIF..............PLL........................................T.........
A2ERB6_TRIVA/1571-1861SSF.....ISSIF.D.EK......D..SYF..................................................
Q4Q7L2_LEIMA/1091-1400VSL.....CKEGF.A.AE......Y..GLF..................................................
Q9CYM1_MOUSE/752-912LLL.....LKELL.N.PI......Y..GMF........................................T.........
Q54KP2_DICDI/1482-1898TLV.....SKELQ.R.KD......L..NLWYTDNNDQIPDEDDDKMKIDSTISTTSTIPPISPIISTTTISSTTTTTTTT
A4VDG4_TETTS/2059-2356SLI.....FNQLL.D.PN......F..GLF..................................................
Q22F29_TETTS/3398-3694VLA.....LNDIL.D.PQ......K..GLF..................................................
A0DLB8_PARTE/2812-3098CLF.....GRNLK.D.PQNNLCLQT..HMI........................................G.........
A5DS31_LODEL/333-694ATV.....SKEFI.R.KK......L..KLWRDQS..............................LSNFG.SKKGL.....
A2DQ30_TRIVA/383-682GLI.....SQQMI.D.PS......F..SMF..................................................
UBR5_MOUSE/2479-2792SVVDMDLEDTDDGDD.NA.........PLF..................................................
Q54GG5_DICDI/425-720QLI.....VRKIF.D.PE......Y..GMF........................................K.........
Q5CW92_CRYPI/1231-1561TSI.....SKELC.S.ES......F..GLF..................................................
A2E5Q8_TRIVA/658-966SEV.....SLDLRNP.NC.........GFV..................................................
A0BRI8_PARTE/1050-1354QLL.....TKQIV.D.PN......N..KLF..................................................
A7SML1_NEMVE/1229-1585ALV.....SKEFQ.R.SS......M..EMWRGTE..............................VAPPV.TEDAD.....
A2FIB4_TRIVA/386-683FKL.....TEIAF.S.PD......Y..GMF........................................R.........
A2DAL9_TRIVA/1571-1869TSF.....AEEMV.K.PE......R..GLF......................................I.P.........
A2D760_TRIVA/795-1094TLL.....SREFC.R.PI......R..GLWRN...................................SD.PE........
Q01B14_OSTTA/546-834QLC.....DADQPQT............QLF..................................................
A0DH95_PARTE/2-219QEC.............................................................................
O17736_CAEEL/692-1001SEL.....LKTAF.N.VE......R..GFF..................................................
A8BIP6_GIAIC/2319-2632NLV.....TSDLMNH.................................................................
A2FPQ0_TRIVA/408-705YLI.....TAELF.N.PD......H..GMF........................................T.........
A2F5A6_TRIVA/682-951QIL.....AKEFA...SD......K..KMW......................................S.E.........
Q580A5_TRYB2/986-1286QEL.....YAELSRR.YR......SMSELW..................................................
A2F7U9_TRIVA/2273-2579TEC.....ATSIFEK.TS.........CLC..................................................
A5D6V3_DANRE/704-994SLI.....SKSFI.E.WD......K..KIL........................................E.........
A2F3N1_TRIVA/2072-2351SQV.....CEEIL.K.PQ......M..KLF..................................................
Q9W196_DROME/819-1122SEL.....IKTAF.D.PN......R..GFF..................................................
Q381G0_TRYB2/3834-4128TFL.....SEEIMTH.PD.........MCY......................................P.N.........
A2EDQ8_TRIVA/2183-2490TEA.....AASIFEP.TT.........LLA..................................................
A2EM50_TRIVA/2501-2807SEL.....AKDICDP.NI.........GLF..................................................
A2EQW9_TRIVA/2209-2511NEI.....AISIFQS.QS.........KLF..................................................
Q54QF1_DICDI/778-1120EEL.....ANTPLNG.........Y..HLF..................................................
Q8SR14_ENCCU/2104-2410VLL.....AKDLL.D.PN......F..ALF........................................E.........
A2DAJ9_TRIVA/133-438IEL.....ANSIFQP.TS.........HLF..................................................
Q580G4_TRYB2/3999-4304QLI.....AEEMV.N.DN......Y..ALF..................................................
A8BLR8_GIAIC/875-1158TVI.....TREDLHD.........VDEELYFS...................................LT.NL........
A2E5X8_TRIVA/301-578NLM.....AEIIDSD............EYF..................................................
Q4PHJ7_USTMA/908-1208TSL.....VREAF.D.TN......R..GLW..................................................
A7RSK9_NEMVE/1024-1329TEM.....CQELEEG.VV.........NLLIH...................................TP.NS........
Q2GVQ3_CHAGB/742-1078TLLDDADLVGEFE.A.WE......RRQGRF..................................................
A0D383_PARTE/180-477TLI.....FKEMC.K............DIF........................................T.........
A2E4I7_TRIVA/2634-2943LDA.....INESIIP.SI.........GLF..................................................
Q019K0_OSTTA/1236-1531AVL.....CD....M.PS......Y.............................................G.........
A2DBI7_TRIVA/375-665YIL.....TNELI.K.PD......L..KLF..................................................
A2G1R0_TRIVA/764-1050QLM.....SRELMKN.ER.........KMWLS...................................DN.YT........
A4VD17_TETTS/793-1095NDL.....SKIVF.D.PN......Y..GMF..................................................
A8BYQ3_GIAIC/636-950NLI.....CDEMF.S.KA......L..DLF........................................E.........
PUB2_SCHPO/367-671YIL.....SHAIF.N.PG......Y..SLF........................................E.........
Q00WR0_OSTTA/203-456NDL.....IAEAFNP.KF.........GLF..................................................
A2FG81_TRIVA/782-1072TDF.....SVELASN.KN......I..YLW........................................R.........

PF09814

A4D9F3_ASPFU/21-420-----------------------------NLGSQNIQPLITLSESRRSVSVSLPA..............PFDHVADTIKL
UBE3D_HUMAN/13-385-----------------------------EGGMPMNI...SIMPSSLQMKTPEG....................CTEIQL
A5DDI0_PICGU/5-350-----------------------------DVKDIK.....GIRIDKNDLAISTE..................GSTLRIKL
Q6BMI9_DEBHA/5-363-----------------------------PIGNLIDI...RLS.SRDQVLIKFH..................DNEISVNL
Q0TZD4_PHANO/225-279-----------------------------...................................................
Q29GF2_DROPS/8-386-----------------------------NDASNM.....RVVILEQRIYIDDADR............GTGKSIDTEIMR
Q6CWI5_KLULA/6-349-----------------------------QPIAT......EIPHDRRHINVTIG.................NKRVITINL
A1CJR3_ASPCL/19-424-----------------------------HLNTNNTSPTITLSESRQAVTVSLPG..............PFSHVSDTIKL
Q9VWP0_DROME/9-390-----------------------------QVSQSQKT...RVVVRDYNVYISEKPKNQAIDLDSSSESDSEDSDKLMLIR
UBE3D_PONAB/13-385-----------------------------EGGMPMNI...SIMPSSLQMKTPEG....................CTEIQL
Q6FK88_CANGA/6-347-----------------------------NVSYSI.....STNRSTLELRVIND..................SYKTSIRL
Q7SDG7_NEUCR/13-382-----------------------------ASDASTRV...VVAADGENVELTHH..................GQSHTLHL
Q4P6X1_USTMA/1030-1417-----------------------------ESESESASK.SESSGSGGERKRKQDAH............HVSSARGVRMSL
YHFA_SCHPO/4-322-----------------------------...........FLDPETKDIPKCVA......................DLKF
A7TPW1_VANPO/6-340-----------------------------PVRVV......SLSGVKIELEVVDEV...............GKLEVVDILF
Q75DV5_ASHGO/6-339-----------------------------GEVELG.....KLGGHRLTVTVNGA....................AEVIEL
YJ9I_YEAST/7-342-----------------------------QVEIK......NLKDTLMSISGDEE...................QVEDILL
Q16XY0_AEDAE/12-444-----------------------------RFAEIKTT...KIDLGSDRITISTE................NNDERYEIRL
Q5B919_EMENI/28-412-----------------------------ALYAYPE...ISLSESRRAVTVSLTLP............ESQEAVMETIKL
A5DWX9_LODEL/10-366-----------------------------DLKLQQVLDIKLISIDTMSININDDG..............NNIKSPLQIRL
Q5PQ45_XENLA/37-407-----------------------------SLIVDV.....SLSPSFLQIQTSEQ....................SERFCI
Q6C9F9_YARLI/6-329-----------------------------GS.........DVVARPDSVTIGKD......................TVPL
Q59X25_CANAL/5-343-----------------------------GFNIDEINR.ISIAGELLSIELKNS...................PPIDVHL
UBE3D_MOUSE/13-364-----------------------------EGGMHLDI...SITPTSLLVRTPDG....................CTEIRL
UBE3D_BOVIN/13-385-----------------------------EGGLPMAV...SVTPSSLRMQSPGG....................CTELRL
A7USM4_ANOGA/14-434-----------------------------KFVDIEST...TIELATDRITIVMK................GERERYEIRT
A7SC58_NEMVE/7-362-----------------------------...........QANPHYAHVRYPDGR...............ETTVSTKHLA
Q5EAZ8_DANRE/20-391-----------------------------IGGGADVKI.ESKPDSILNVQTPDS....................SFQVTL

PF00632

HACE1_MOUSE/602-909..............................QSADGT....TFQPNSN.......SYVNP.............D.......
Q7QE66_ANOGA/554-863..............................EYSAND....IYTVQIA....PERPTDRD.............D.......
NEDD4_HUMAN/1013-1318.............................YSATDNY....TLQINPNS......GLCNE.....................
A4IBF5_LEIIN/1897-2310........................................LVDRNVGLMRDYVLEQRER.....................
A4IC88_LEIIN/3812-4131............................TANHVHNT....GSHREAYVPAA...SARSA.....................
Q4WHR7_ASPFU/967-1337.............................TMDARTR....ISWFQPCSLEPLYK..........................
A4HPV4_LEIBR/2168-2551.......................SPDRSISLSTHSG....AAVRRRPCMPLFPAAKQTP.....................
A4HF82_LEIBR/3619-3949.............................TVVPNMS....ALYAS....EAAADGVESS.....................
A4IAG7_LEIIN/1051-1369.............................FVTEDDG....GADPV.....TLPFPTTKA.....................
UBE3B_HUMAN/736-1068.............................KTTSGDE....RLYPSPT.......SYIHE.....................
A3GHK0_PICST/646-950.............................YNIEDSN....YLWFN..........LVPI.....................
UPL3_ARATH/1518-1888......................PSAANRDIVLAPLG....LFPRPWPSTADISEGGQFH.....................
Q0UNY9_PHANO/908-1229.............................TLDPQTR....MTWFQPGTLEPV.WK.........................
Q9BL11_CAEEL/717-1019.............................E.DEESH....LVWFSGL........PSEF.....................
A0EFC1_PARTE/672-969.............................P.KNNGT....MYWFNPQ..........SF.....................
Q2GSX9_CHAGB/694-1033.............................IANS.KN....SYYPN.........PCSID............Q.S......
Q5KIA2_CRYNJ/1499-1843...........................GNYVHHPHG....LF..PSPLP..RASAELVA.....................
HUL5_YEAST/607-910.............................R.TNDRY....ELYPS.......VVYD.................A......
Q38D88_TRYB2/1472-1912...........................SSTTHESGDSCGNRQLRSKSNSGTFDDEQRVESRPEGLFPCSSVPKVLQRFST
A0E799_PARTE/3885-4178.............................PVQGNLG....KYFLHSNFNKIKNKKEYA......................
Q00WM5_OSTTA/458-763.............................ELSHDKG....CYQPN.........PNSVV............H.P......
A2DUY0_TRIVA/771-1054.................................KSG....YF..PSPFSDS.............................
Q6BGB8_PARTE/609-908.............................IETP.EK....TMIPN.........PAFMQ............E.E......
A2FLN6_TRIVA/2545-2849.............................IQTPNKR.......RKIATAQDYLIPNPSPLT.........PQ.SR.....
Q7PSQ3_ANOGA/541-897.............................YSRDDHY....SLQIN.........PDSYLKQRK....TIHFF.PVLFL..
Q6NNZ7_DROME/211-561..........................TTSYVHAVHG....LF..PLPLG.KSSKLPQMT.....................
A4IBT8_LEIIN/1017-1343.............................VCAASEE....AGAASPHSAGSPVSSGTAAASASASNEPGIRSVLFSTVPY
A0D2G1_PARTE/170-483.............................KTDTKEL....TYKFNPNVQSNT.I..........................
K0317_MOUSE/512-823.............................FTDSNQA....LVHPN.........PNRPA..............H......
A2FVL0_TRIVA/2315-2604.............................LSNVDKE....KLFPNPFVSNEF.E..........................
Q8SS57_ENCCU/454-746.............................EHTENRI....WIRPHEGDGEG.............................
Q4E2E5_TRYCC/2646-2975.............................RLTGHTT....MAGVVPNMDFYRENPEHRL.....................
A2F794_TRIVA/2662-2959.............................ISSPNTQ.....YLPRNAQNVDRFVPNPSC............T........
TOM1_YEAST/2962-3268.............................PVPSDKT....TFHPN.........RTSGI............N.P......
A7SQ93_NEMVE/299-612.............................C.NDKSR....LYWFNKE..........CL.....................
A2DAV4_TRIVA/452-719..............................RKYEMG....YMPIHGAKNM..............................
Q6C901_YARLI/697-1001.............................E.DEESH....YCWFNPG.......CKAQD.....................
A0DAX5_PARTE/100-320................................................................................
Q6C8U2_YARLI/491-779..............................QHDDNG....VVWPRDNPDVSREK..........................
Q9W0H2_DROME/761-1058.............................E.YEQSR....LLWFADL..........TF.....................
A0BRN4_PARTE/3724-4023..............................SMLAPG....YYYIDPKFLNIPKKNDYA......................
A2FJ59_TRIVA/1204-1414..............................TVDEKG....FYHLKTKDPQYQ............................
Q6PDJ9_MOUSE/738-1060........................................ILTPSPITYGEEQLL.........................
A4S7N1_OSTLU/131-443.............................QSNA.TG....LIYPS.........PRAGD............T.H......
A2FR71_TRIVA/373-670.............................I.INQ.N....TYWFVHS..........DF.....................
A0DNI8_PARTE/201-510.............................LADCEDV....SYKINCEADTDEHIIDC.......................
Q5BG86_EMENI/848-1165.............................Y.DEDSR....YCYFNPY.......CLESS.....................
A5K4K7_PLAVS/1441-1991..............................DYVHNG....TLYPK.........RFHSN.....................
Q55NG7_CRYNB/3037-3342.............................PCAADQQ....TYQPN.........KTSWI............N.D......
A2DQ34_TRIVA/412-708.............................T.I.N.G....YYWFSIT..........PF.....................
A7AV31_BABBO/1338-1643...............................TSSYN....SAGQSAIITASCQKDTFTI.....................
A2E999_TRIVA/2659-2965.............................IPTPNSR.......NEIGQYRDTVIPLPHPMI.........KN.SP.....
A2F3T0_TRIVA/1939-2179........................................ELSPNSILNSEKILIPNFSC..........DE.K......
A2FXS6_TRIVA/392-692.............................L.YGN.H....YLWFTPL........ASSI.....................
Q6NVK6_XENTR/557-856.............................Y.DESTK....HSWFNPS..........SF.....................
A2DWM0_TRIVA/796-1093...........................SEFAFTKDG....LF..PSPAADK.............................
A2DYB1_TRIVA/1674-1977.............................APSANGR....SFQPN.........PASNI............N.Y......
A2EEN6_TRIVA/766-1053.............................Q.MRD......CFWFNKD.................................
A4I8L1_LEIIN/3799-4087.............................SDFHRNP....LFVFVNNSQRISLVPDSQA............N.S......
HUL4_ASHGO/526-839.............................VYVPESR....LCWFSIMESIEHELLQGEG.....................
A2DKE7_TRIVA/929-1162..............................IKPPST....LHCEKNRLVPASNLPIKVA.....................
Q247X9_TETTS/2115-2420.............................TFTPNQM....SVYPNKDAISK.............................
A5K5J0_PLAVS/8258-8564.............................REGKKSE....FNHPN.........PLSYI............N.P......
A2DXG0_TRIVA/2382-2669.............................IQTPRTR....AQNQMCEFIPDPDSSEERL.....................
A4RVZ5_OSTLU/490-781..............................TQDDAR....TYKRKEGIDRPSVLKEL.......................
UPL7_ARATH/828-1142.............................TPTS.DR....LLVPS.........PSARH............L.E......
MUG30_SCHPO/482-807.............................NCEESSN....YLWFNYS.........HRS.....................
Q6GP47_XENLA/736-1028.............................C.SDPLL....PRWFPST..........PL.....................
A3FPU7_CRYPI/497-797.............................Y.YEDTR....LFWFNMA..........SL.....................
Q38A01_TRYB2/1526-1868..........................AKTARRVQLP....LF..PSLFQDD.............................
A1CTM1_ASPCL/1468-1817...........................EEFAFGRRG....LF..PAPMSEEQAASESGK.....................
A2ECJ9_TRIVA/791-1087...........................AEFAFSQTG....LY..PSPAASN.............................
Q7PSA4_ANOGA/2506-2929.......................SKPVGYYVRRSTG....LF..PAPLPQDSDISEDVS.....................
Q4UD92_THEAN/251-554.............................EEVPEER....SYYPC.........PNSGI............I.H......
A2FK98_TRIVA/1968-2204..............................VPPQPS....LKNVNYGLVPSSSLSEKRS.....................
A3LSX3_PICST/660-977.............................KETISDN....QIYPNDDIHKSITVGDDPQ............L.Q......
A0DLU6_PARTE/3989-4284.............................RLNAKSQ....TYFFSPKFQPDKEKEQYA......................
Q00Y47_OSTTA/1123-1477...........................EDLVVAPHG....LF..PAPMAAPRMSGKTHA.....................
SPKUL_DICDI/1577-1887.............................ENNNNNN....NNNNNNNNNNNNNNNNNNNNNNNN...NNNEE.NPLLI..
A7SNF7_NEMVE/430-737.............................QEKTWMK....CEEWN.........PETNV............S.V......
A7SP65_NEMVE/115-400.............................IWMSDNI....HVQF...........................E.Y......
A2ERB6_TRIVA/1571-1861..............................YLNERG....RHEPK......KIIDESLI..............D......
Q4Q7L2_LEIMA/1091-1400.............................RQTP.DG....YVYPNSFSAVATSDP.........................
Q9CYM1_MOUSE/752-912.............................Y.YQDSN....LLWFSDT..........CF.....................
Q54KP2_DICDI/1482-1898TPPPPTSLSSNTTTTITTPIIEQLTIIHQYIYSSGG....LF..PKPI...NPNITIEK.....................
A4VDG4_TETTS/2059-2356.............................VQSKKNY....TYMPNPFSFLVP............................
Q22F29_TETTS/3398-3694.............................KLSSNGV....TMQPSPTSFLVP............................
A0DLB8_PARTE/2812-3098.............................YYYLNKG....ILLLNDSIT...............................
A5DS31_LODEL/333-694........................ELNDPYIINSNG....LF..PAPMDRTQILSDNGK.....................
A2DQ30_TRIVA/383-682.............................T.VVNGS....YHWFNIM..........FK.....................
UBR5_MOUSE/2479-2792.............................YQPGKRG....FYTPRPGKNTEARLNC........................
Q54GG5_DICDI/425-720.............................Y.NTTTN....CFWFNPD..........SV.....................
Q5CW92_CRYPI/1231-1561.............................KSCKDNT....IIPREYDSLIEISNKFKDL............L.I......
A2E5Q8_TRIVA/658-966.............................CPTPNSI.......SQVGYYRDKFIFVPTNNE.........LR.SN.....
A0BRI8_PARTE/1050-1354.............................VPTSNKL....FYQINRE.......SYQDP.....................
A7SML1_NEMVE/1229-1585.........................GGIKYVYSESG....LF..PIPIP.RNARVAMVS.....................
A2FIB4_TRIVA/386-683.............................Y.VNS.K....YYWFVPE..........SK.....................
A2DAL9_TRIVA/1571-1869.............................SINNCSY....TINPSCT.................................
A2D760_TRIVA/795-1094...........................SEFVYSPMG....LF..PSPVANP.............................
Q01B14_OSTTA/546-834..............................ELDDSH....TYSLKRGIDRQGRAEEL.......................
A0DH95_PARTE/2-219................................................................................
O17736_CAEEL/692-1001.............................TFTE.SK....LLYPN.........PTAPFL...........L.G......
A8BIP6_GIAIC/2319-2632.............................CQAFSRK....NYLPKTCKTSASPLKRQSG.....................
A2FPQ0_TRIVA/408-705.............................L.IDN.S....FYWFNIS..........SI.....................
A2F5A6_TRIVA/682-951............................NQ...EFG....LF..PCRDAK..............................
Q580A5_TRYB2/986-1286..............................HHRDDG....VCIAFPSMQQVHPKR.........................
A2F7U9_TRIVA/2273-2579.............................FPVPNAR.......HHRGQFKDLFVPYDETN..........GE.YS.....
A5D6V3_DANRE/704-994.............................A.HESSL.....VWFNPH..........HT.....................
A2F3N1_TRIVA/2072-2351.............................CLTPNAK....SFHEEEYLPCIPNGLS........................
Q9W196_DROME/819-1122.............................MVTT.DN....KLYPN.........PNVAD............L.F......
Q381G0_TRYB2/3834-4128.............................TSFNRSP....LFHYPEHSQRVGLVPNSSA............N.S......
A2EDQ8_TRIVA/2183-2490.............................ISTPNMR.......NHTGQYKDVYIPFDKTM..........SR.L......
A2EM50_TRIVA/2501-2807.............................VSTPNFV.......NHRGSFRECIVPNP.ISE.........WG.RT.....
A2EQW9_TRIVA/2209-2511.............................ILSPNGR.......NHSGGMRDVYIPFSSLRP.........FT.SR.....
Q54QF1_DICDI/778-1120.............................QEYSNSN....KYHPSPFSNLIP............................
Q8SR14_ENCCU/2104-2410.............................FATEDKT....TVVPC.........KNSYV............N.P......
A2DAJ9_TRIVA/133-438.............................IQSPNGR.......NHCGSFRDAYVPSTTLG..........KD.SY.....
Q580G4_TRYB2/3999-4304.............................IHSREGM....TYQPN.........PLSGV............N.P......
A8BLR8_GIAIC/875-1158...........................WKHAHNEDS....QLTVNLQESSDPILT.........................
A2E5X8_TRIVA/301-578.............................VRSPKSKEMGSVVKIPSLTARPEYI..........................
Q4PHJ7_USTMA/908-1208.............................KATD.AQ....ELYPN.........PHTYA............T.S......
A7RSK9_NEMVE/1024-1329...........................TAEVGFNRD....RFLLNPAATSEDDLVL........................
Q2GVQ3_CHAGB/742-1078........................................SFCQHPF.................................
A0D383_PARTE/180-477.............................LTETNDV....TYKIA...................................
A2E4I7_TRIVA/2634-2943.............................IQCPNSK.......FPNSENFDCLIPVPDPNN.........MH.SE.....
Q019K0_OSTTA/1236-1531.............................QGTSGFL....TLRPDAP.................................
A2DBI7_TRIVA/375-665...............................QETKT....GYWFVPG.................................
A2G1R0_TRIVA/764-1050...........................DEYAYTARG....LFPRPDANPDD.............................
A4VD17_TETTS/793-1095.............................RLVENNQ....KLCPNQDSL........EF............L.G......
A8BYQ3_GIAIC/636-950.............................E.NQETH....SFYFNRKNGTVAEGSEQWI.....................
PUB2_SCHPO/367-671.............................YATDDNY....GLQIS.........PLSSV............N.P......
Q00WR0_OSTTA/203-456..............................IETPER....TLYPNPASEMHAGERHLQY.....................
A2FG81_TRIVA/782-1072.............................RENDECG....LF..PSFAASEK.D..........................

PF09814

A4D9F3_ASPFU/21-420PARVNEASRRVLATSRQGDAATADNDSGVRRREF---SFRMQIDEPDDSLPSKDPLID........DFVPWTAADMS---
UBE3D_HUMAN/13-385PAEVRLVPSSCRGLQFVVG............DGL---HLRLQTQAKLGT.................KLISMFNQSSQ---
A5DDI0_PICGU/5-350PIDGNHNVADMTISSLKYI.............DS---CLRLSIS.FPGTKLSEHTQSFMDF..NHSNVQKWSCSDLR---
Q6BMI9_DEBHA/5-363PVKIKRDDKIRIANANQTA............DYL---QLTIALTPHDSNDVSEKTESFMDF.SSSNLVQKWSCKDLK---
Q0TZD4_PHANO/225-279.................................L---ALIALLQTHKLM.................PTLPLDTERVD---
Q29GF2_DROPS/8-386VNEFDMDLSSLSGFLLSGK.............NM---SFRFSFNRIAVAVLDKRTVRV........PMQPLLLSCCE---
Q6CWI5_KLULA/6-349PCVVDVNTKGEVQR..................GK---LFNVRLNELKSGKTFDRSSNHIM....EKLVAKWMRKDLV---
A1CJR3_ASPCL/19-424PARVNEASRHTLNTSRQAPTQPAND.SHSARQEY---SFRMRIDSEDDALPRTEAVD.........DFVPWTAADMG---
Q9VWP0_DROME/9-390HAQYGMDIVCLSTFLVSGR.............NI---SFRFNYNQIDLASVDGSAVDV........PLAPLLLSCQE---
UBE3D_PONAB/13-385PAEVRLVPSSCRGLQFVAG............DGL---HLRLQAHAELGT.................KLISMFNQSLQ---
Q6FK88_CANGA/6-347KGLNLDNLYDEKNGHIHLS............ETS---CGYVRLKRKTQALTNRISLVD.......LPDDKWNIERFK---
Q7SDG7_NEUCR/13-382PAKVALGGAILPIQRPGAS.............AL---SWRLPLGQGTYTDASSA............ESSTWTATDLK---
Q4P6X1_USTMA/1030-1417PDRAKAQSGRVTLERSGAV............ARV---KLIMSEAEQRAAALECRSENI........VEFPLSAACLS---
YHFA_SCHPO/4-322PLPLTLSRSTPINPIIRSD.............TI---QLVISCPPVTYSDE...............IQVPWKAIDLN---
A7TPW1_VANPO/6-340PNEIKLRGSELRFVQN................GL---CYSSRLRYFGDRVNVLSMAMD........LEEKWSKKWLL---
Q75DV5_ASHGO/6-339PCEVDPLARPRIRHS.................EG---AFEVRLKAVNGTEGRGADFTML......AAEDGWGRKDLA---
YJ9I_YEAST/7-342PVEVEEKVDASYKFKNRGK.............DL---EWMTKLRSKSSKIYDSSIMSL........PDGRWTKEELR---
Q16XY0_AEDAE/12-444GDYFKLHTQTLSSLLIKNN.............YI---CFRINTNENKFHSEVLEINEYN.....ACTDLKLECGLQA---
Q5B919_EMENI/28-412PAKVTEGSRRLLSNATQSAGQGKGT.ITGTEREF---SYRMQVDDTEFVVRDAVEEHM.......DSFVPWSAGDML---
A5DWX9_LODEL/10-366PVCISQFSIKSARVVGR...............NL---ALSLSVQTIEKCDENEKASNE.......IVDDLWSCKWLK---
Q5PQ45_XENLA/37-407PADVKLLPSSCRIMHQIAG............EGL---YMQLKVETANNT.................DMPLLLKEILK---
Q6C9F9_YARLI/6-329PAEIQVREMPPVGRLS................TL---RFRASPDAAHTAVSDQIDSIH........IDSPYGSSFVR---
Q59X25_CANAL/5-343PCKASQASITGLKLANN...............TV---SFGVKIHEKRLDSTVPFTDQ.........AIEKWSCKDLS---
UBE3D_MOUSE/13-364PAGVRLVPSSCGGLQYISG............DGL---HLRLRVQAESSP.................QPISVFNQSLQ---
UBE3D_BOVIN/13-385PAGVRLAPSTCRGLQHVPG............DGL---HLRLHARAESRP.................ELISVFNQSSQ---
A7USM4_ANOGA/14-434GDYFQLHTQTLSSLVIKNR.............YI---CFRVNTNESVFGSERLSTGQEMPGSDQHEENFRLACNVQP---
A7SC58_NEMVE/7-362PKDLKLKPDSCNGLKISLG............EEL---HMRLQMTSDNGTDVMDRET..........LMVKEERNSLQ---
Q5EAZ8_DANRE/20-391TPGVSLVETQKQKSPANSE............QGS---HYRLRLKVEQPT.................ESPCSVIGQLR---

PF00632

HACE1_MOUSE/602-909.........HLNY....................F...RFAGQILGLALNH.......RQ.L.....VNIYFTRSFYK...
Q7QE66_ANOGA/554-863.........ILEW....................Y...RFAGRVLGLALVH.......QY.L.....LDAFFTRPFYK...
NEDD4_HUMAN/1013-1318........DHLSY....................F...KFIGRVAGMAVYH.......GK.L.....LDGFFIRPFYK...
A4IBF5_LEIIN/1897-2310........A..KA....................Y...YVIGAALGRAFVD.......EQ.V.....FPLPLSRAVAY...
A4IC88_LEIIN/3812-4131........YDLEA....................F...AFIGKLMGGALRS.......ED.P.....LDLFLPPLVWR...
Q4WHR7_ASPFU/967-1337.................................F...ELLGLLMSLAIYN.......GL.T.....LPVNFPVAFYR...
A4HPV4_LEIBR/2168-2551........TTLHY....................W...KLLGVLLGRLLVI.......GT.T.....TSLNFHPLLLR...
A4HF82_LEIBR/3619-3949........VLRRM....................F...EWLGKIMGNMVLC.......GT.L....KASFDFPQMLWK...
A4IAG7_LEIIN/1051-1369........LFLKE....................F...FALGAACARAFID.......EY.R.....MDMDLLPQAWP...
UBE3B_HUMAN/736-1068........NYLQL....................F...EFVGKMLGKAVYE.......GI.V.....VDVPFASFFLS...
A3GHK0_PICST/646-950........ENFEM....................Y...YLLGAVLGLAIYN.......ST.I.....LDLHFPMALYK...
UPL3_ARATH/1518-1888........KVIEY....................F...RLLGRVMAKALQD.......GR.L.....LDVPLSTAFYK...
Q0UNY9_PHANO/908-1229.................................F...EMLGMIFSLAVYN.......GI.T.....LPVTFPHAFYQ...
Q9BL11_CAEEL/717-1019........CDREQ....................F...HQLGRLVGLSIYN.......HS.I.....VPFPFPLALYK...
A0EFC1_PARTE/672-969........EIPIY....................Y...SLIGKLLGLALYN.......QV.L.....LDVRFPTVLFK...
Q2GSX9_CHAGB/694-1033.......KNALQEAQIPENSEEWAETITSRLRQY...EFLGRVIGKCLYE.......GI.L.....IDVSFAGFFLL...
Q5KIA2_CRYNJ/1499-1843........SRLKW....................F...KTLGQFIGRSMLD.......SR.I.....IDISFNKVFLK...
HUL5_YEAST/607-910........TKLKY....................I...WFLGKVVGKCLYE.......HV.L.....IDVSFADFFLK...
Q38D88_TRYB2/1472-1912DLSLSSCRDTKALTERFLCMNDFFEVDEERAQLY...YLVGTVLGRAFTD.......AV.V.....FPLDISPALAL...
A0E799_PARTE/3885-4178.....................................LLFGKLIANAIAN.......GY.L.....IGIDIISPFWK...
Q00WM5_OSTTA/458-763........EYLSY....................F...RFVGRLVGKALVD.......DI.L.....LNAYFTRPIYK...
A2DUY0_TRIVA/771-1054...........DE....................F...YLIGVFSAKMILM.......DS.I.....CGLTLSKFFLK...
Q6BGB8_PARTE/609-908.......KQK.......................Y...AFIGKIIGKAIYE.......GV.L.....IEKVLNQVFLN...
A2FLN6_TRIVA/2545-2849.......DF........................F...FYAGVLMTICYTS.......RL.P.....EPFKFARFVWN...
Q7PSQ3_ANOGA/541-897...AAINPEHLSY....................F...HFVGRILGIAVFH.......NH.V.....LDGGFTLPFYK...
Q6NNZ7_DROME/211-561........KAKAK....................F...KFLGKFMAKAVMD.......SR.M.....LDLPFSLPFYR...
A4IBT8_LEIIN/1017-1343LPAPDADGIAPDL....................F...VLLGKVLLKSIIE.......NR.Q.....IPLQLSSAVLK...
A0D2G1_PARTE/170-483........DKRQL....................F...SFLGIIVGKCLFE.......RI.P.....LSSFLDRTIIK...
K0317_MOUSE/512-823........LRLKM....................Y...EFAGRLVGKCLYESSLGGAYKQ.L.....VRARFTRSFLA...
A2FVL0_TRIVA/2315-2604.................................F...ICAGALIGCAAVS.......YI.T.....FDFNFSPFVWR...
Q8SS57_ENCCU/454-746.................................Y...EAIGRIIAIALYN.......NV.V.....LNIPFPSLFFK...
Q4E2E5_TRYCC/2646-2975........LFVEV....................F...TWLGKLIGNATMS.......GYLM.....FSFTFPRLLWK...
A2F794_TRIVA/2662-2959........D........................LVQLEYAGVLMSIAYVS.......RM.P.....QPFRFAEFVWR...
TOM1_YEAST/2962-3268........EHLSF....................F...KFIGMIIGKAIRD.......QC.F.....LDCHFSREVYK...
A7SQ93_NEMVE/299-612........DQDEE....................F...NLVGVLMGLAVYN.......SI.I.....LDIHFPSCCYK...
A2DAV4_TRIVA/452-719.....................................KEFGILIAKTIIM.......QA.T.....INDAFCDAFFK...
Q6C901_YARLI/697-1001........GDLRE....................Y...RLAGVITGLALYN.......SS.M.....LDLPLPPVVFK...
A0DAX5_PARTE/100-320.....................................RERKRLIRKNKKK...................QLNDEVLK...
Q6C8U2_YARLI/491-779.................................W...VCIGVVVGLALFN.......GC.P.....LSFDMPLSFYR...
Q9W0H2_DROME/761-1058........ETENM....................Y...FLIGVLCGLAIYN.......FT.I.....INLPFPLALFK...
A0BRN4_PARTE/3724-4023.....................................YVFGKFVANSIFN.......NH.Q.....IGIQFQPQFWK...
A2FJ59_TRIVA/1204-1414.....................................LFIGVFIAYCFYY.......GE.P.....FEINLPFDIKD...
Q6PDJ9_MOUSE/738-1060.....................................HFLGQLLGIAIRA.......DV.P.....LPLDLLPSFWK...
A4S7N1_OSTLU/131-443........EGILL....................L...EMIGMMIGKGMYE.......GI.L.....QDINMAPFFAA...
A2FR71_TRIVA/373-670........SEPMK....................F...NVLGTVVALAIAN.......SV.I.....LPIRFPIALYK...
A0DNI8_PARTE/201-510.................................F...KLLGIVVGKCIFE.......RI.P.....LNIYFDRSIIK...
Q5BG86_EMENI/848-1165...........EQ....................F...FLVGVVLGLAIYN.......SI.I.....LDIALPPFAFK...
A5K4K7_PLAVS/1441-1991........DNLNL....................Y...TFAGKVIGKAIYE.......RI.L.....IESVFNDVFLS...
Q55NG7_CRYNB/3037-3342........VHLSY....................F...KFVGRVIGKAVYD.......GR.L.....LDAYFNRAFYK...
A2DQ34_TRIVA/412-708........EDYSA....................Y...MMLGTAVSLAIYN.......NV.V.....LPIRFPTLLYK...
A7AV31_BABBO/1338-1643........RVFRT....................F...KLLGQLVALALID.......HK.L.....LDLRLNPLFWH...
A2E999_TRIVA/2659-2965.......ER........................Y...RVFGAVIAICIRT.......GL.V.....QFFNFPPLVWE...
A2F3T0_TRIVA/1939-2179.......FL............................SYAGSFICCCMIT.......DH.P.....HQFLLPDLFWN...
A2FXS6_TRIVA/392-692........EDDHL....................F...TLYGLIIGLAIYN.......EI.L.....LPVHFPRALFK...
Q6NVK6_XENTR/557-856........ETEGQ....................F...TLIGIVLGLAIYN.......NC.I.....LDVHFPMVVYR...
A2DWM0_TRIVA/796-1093...........KL....................F...RTLGVLFGKALAS.......DV.V.....LPIPLSNNFLR...
A2DYB1_TRIVA/1674-1977.......MEHKQY....................F...KFAGRIMAKAIIE.......EQ.Y.....LDAHLTMSILK...
A2EEN6_TRIVA/766-1053........LDPFL....................FPNIKLAGQIVGLAIYN.......GN.F.....INIRFPLALYK...
A4I8L1_LEIIN/3799-4087.......IYDLNL....................F...TFFGKIMGHSARA.......KT.P.....LDIDFSPFFWK...
HUL4_ASHGO/526-839........SSSEL....................Y...YLFGVVLGLAIYN.......ST.I.....LDLKFPRAFYK...
A2DKE7_TRIVA/929-1162.....................................STIGSLIASAIAT.......RNAH.....KAWNLPRFIWD...
Q247X9_TETTS/2115-2420........KALEQ....................I...ELLGKFVGKSMME.......DW.S.....LMLSFAPFFIK...
A5K5J0_PLAVS/8258-8564........DHLHF....................F...KFVGKFIAKAIYD.......GQ.V.....IDAYFCRSFYK...
A2DXG0_TRIVA/2382-2669.....................................LYAGAFVALCFVT.......QS.P.....QPLKLNFSVWK...
A4RVZ5_OSTLU/490-781.....................................QCFGELLAHVVLF.......GSAV.....LPIPFSKVFLR...
UPL7_ARATH/828-1142........NGIQM....................I...EFLGRIVGKALYE.......GI.L.....LDYSFSHVFIQ...
MUG30_SCHPO/482-807........KEIDY....................Y...HMSGILMGIAIHN.......SI.N.....LDVQMPRAFYK...
Q6GP47_XENLA/736-1028........VEKKK....................Y...FYFGVICGLAVYN.......QT.V.....IYLPFPLALFK...
A3FPU7_CRYPI/497-797........ESNGE....................F...ELIGIVLALAIYN.......GI.I.....LDVHFPLAVYK...
Q38A01_TRYB2/1526-1868........ESLSN....................F...ELLGMLVGRVLME.......ER.V.....VDLPLSECFLR...
A1CTM1_ASPCL/1468-1817........RQLSL....................F...KTLGKFVARSMLD.......SR.I.....IDISFNPAFFR...
A2ECJ9_TRIVA/791-1087...........ED....................L...RLLGMFCAKALQT.......QF.I.....VDLPLSPHFIR...
Q7PSA4_ANOGA/2506-2929...........GY....................F...WFLGVFLAKVLQD.......NR.L.....VDLPLSNSFLQLLS
Q4UD92_THEAN/251-554.......ENHLEL....................F...CFIGKIVGKALYE.......QI.L.....IEPVLSRLLLN...
A2FK98_TRIVA/1968-2204.....................................FAIGALIACEVAT.......NN.T.....AKWTLPMFIWN...
A3LSX3_PICST/660-977.......QKKLSY....................L...KFLGSIVGKCLYE.......NV.L.....IDVSFAPFFLN...
A0DLU6_PARTE/3989-4284.....................................IAFGKLIANSILN.......KE.I.....IGVPFAHQFWK...
Q00Y47_OSTTA/1123-1477........SRIKN....................F...KLLGQAIGKVLQD.......GR.M.....LDLPLAPAFYR...
SPKUL_DICDI/1577-1887...LKNEFT...I....................F...KILGKIFLKSIID.......GK.P.....IPDCFPTSFFK...
A7SNF7_NEMVE/430-737.......ALRLKLR..................QL...RLIGRLIGAAICD.......DL.L.....LSLHLSKPFVK...
A7SP65_NEMVE/115-400........SFTCI....................I...KVSMELSARFLCE.......RG.L.....FSTSLNILFVK...
A2ERB6_TRIVA/1571-1861........DYDDL....................L...MVYGMILGRALIE.......DI.P.....INRRMESYFYK...
Q4Q7L2_LEIMA/1091-1400........QHLLK....................I...RFLGAMVGRALRD.......GV.L.....QDVPFALHFRN...
Q9CYM1_MOUSE/752-912........VEHNW....................F...HLIGITCGLAVYN.......ST.V.....VDLHFPLALYK...
Q54KP2_DICDI/1482-1898........KTLEY....................F...KFLGMFIAKAFFD.......QR.L.....IDLPLSKPMYK...
A4VDG4_TETTS/2059-2356........DHLIY....................F...KFLGILLGKAFLE.......NY.P.....VQANFAKPFLK...
Q22F29_TETTS/3398-3694........NHLTH....................F...RFAGRLIAKGLIE.......KL.D.....FEVDFTKSFLK...
A0DLB8_PARTE/2812-3098.................................F....AIGMLLAYAIAN.......KL.K.....VGISFALPFWK...
A5DS31_LODEL/333-694........KILYF....................C...SSLGKFVARALLD.......SR.I.....IDFNFNPIFLK...
A2DQ30_TRIVA/383-682........GDPGY....................F...KFVGTIVGLAAVN.......SY.N.....LNVQFPSLLFK...
UBR5_MOUSE/2479-2792.................................F...RNIGRILGLCLLQ.......NE.L.....CPITLNRHVIK...
Q54GG5_DICDI/425-720........DYT.E....................F...ELIGIIIGLALYN.......NI.I.....LDVHFPLVIFK...
Q5CW92_CRYPI/1231-1561.......DEPLSLKKSN...........NILYLF...EFLGKIVGKAIYE.......KI.L.....LEIEFNPVFLN...
A2E5Q8_TRIVA/658-966......KKL........................Y...KSIGGLLLLIIRT.......GL.V.....QEFDFAPVVWR...
A0BRI8_PARTE/1050-1354........DHLKK....................F...KFVGMIFAIATAN.......GV.K.....VFGRFPISFFK...
A7SML1_NEMVE/1229-1585........RLKSK....................F...RFLGRFLGRALLD.......FR.M.....VDIPFSCAFYK...
A2FIB4_TRIVA/386-683........SENSL....................F...RLLGLVIGLGAVN.......KV.P.....LPVRFPLLMYK...
A2DAL9_TRIVA/1571-1869........DYSKF........................EGIGRFIGIVVLH.......GE.I.....LGYQLAHHLIK...
A2D760_TRIVA/795-1094...........KE....................M...RLFGILCARAIAA.......NC.L.....IDVPLSESFFK...
Q01B14_OSTTA/546-834.....................................ETFGELLAYTLLH.......GT.F.....LPIPFSKVFLK...
A0DH95_PARTE/2-219..................................................................PESTFEENIFE...
O17736_CAEEL/692-1001.......VDCLAH....................F...QFIGRMIGKLIYE.......RQ.L.....QEVRFAEFFIA...
A8BIP6_GIAIC/2319-2632.................................YLEYIILAYLISRSITE.......FL.S.....LSFDIPTTLLR...
A2FPQ0_TRIVA/408-705........EQTYL....................F...NLLGTIIGLAIYN.......GV.I.....LPIKFPCVMYK...
A2F5A6_TRIVA/682-951...........EN....................F...YEFGIFIARVLLL.......EC.L.....VDIPLSPAFYK...
Q580A5_TRYB2/986-1286.................................F...FVLGASCGRAFAD.......GY.T.....MDISLLPVVWP...
A2F7U9_TRIVA/2273-2579.......DI........................Y...RGIGIYIGMVVRT.......GF.V.....QDMPFVPFVWK...
A5D6V3_DANRE/704-994........QDHRD....................F...YYLGVICGMALYN.......KH.H.....INIDFPLGLFK...
A2F3N1_TRIVA/2072-2351.....................................TCAGAFIAACATS.......ML.P.....FQFKICTPFWR...
Q9W196_DROME/819-1122.......EDYEKH....................Y...YFIGRILGKSIYE.......NL.L.....VELPLAEFFLT...
Q381G0_TRYB2/3834-4128.......AHSLAL....................F...NLLGKIMAHCIVA.......KS.P.....VSLDFSPFLWK...
A2EDQ8_TRIVA/2183-2490.......QD........................Y...YTIGVLLGIIIRT.......GL.Q.....QDLPFAPIVWK...
A2EM50_TRIVA/2501-2807......SHI........................Y...ESVGCLIAISIRT.......GM.V.....QPFTFPPFFWT...
A2EQW9_TRIVA/2209-2511.......SL........................F...YAVGVFIGIVIRN.......GY.F.....QDFPFAPFVWK...
Q54QF1_DICDI/778-1120........DYRSI....................F...KTLGRITGKSIID.......SI.TKADRHFSLRFTPIFYK...
Q8SR14_ENCCU/2104-2410........EHLSY....................F...KFVGRIIAKAIMD.......GN.F.....INLHLSKFIYQ...
A2DAJ9_TRIVA/133-438.......DQ........................Y...KAIGTFLGIIIRN.......GF.P.....QDIPFAPFIWK...
Q580G4_TRYB2/3999-4304........LHLQY....................F...RFAGIVVGMAVAH.......RV.A.....IDVHFTRAVYR...
A8BLR8_GIAIC/875-1158.................................F...VGLGAILTEIVSE.......EL.......VSMNRTVSVRT...
A2E5X8_TRIVA/301-578.....................................SLVGSLVASTFLN.......GV.R.....FPFRFEKYIWK...
Q4PHJ7_USTMA/908-1208.......SDQL..E..................WY...EFLGRVIGKALYE.......GI.L.....VDAKFAGFFLS...
A7RSK9_NEMVE/1024-1329.................................Y...KFLGILFGVAVRT.......KK.P.....LDLHLAPLVWK...
Q2GVQ3_CHAGB/742-1078.................................L...LSIGAKIQILEHD.......ARRQ.....MSNKARDAFFD...
A0D383_PARTE/180-477........KQSQY....................F...DLAGLAIAKALFE.......RM.T.....ICVEFDRPLVK...
A2E4I7_TRIVA/2634-2943.......DM........................Y...KMLGVLFGISTRC.......GL.T.....KPLPFPDFFWK...
Q019K0_OSTTA/1236-1531.................................LPAAMFFGKVIGLIISS.......NV.N.....VVLPLAPWIWS...
A2DBI7_TRIVA/375-665........GDQKL....................L...KLFGIIVGLAITN.......QL.I.....LPVRFPKIFYK...
A2G1R0_TRIVA/764-1050.................................F...FTLGVLASKALQE.......SL.F.....LDIEISPAFVK...
A4VD17_TETTS/793-1095.......PEHLE....................IF...HFLGSVVGRAIYD.......QI.Q.....IQPIFSVFFLR...
A8BYQ3_GIAIC/636-950........KLSKN....................Y...CFAGMILGMCLLN.......RV.N.....ITNHFPRVLYR...
PUB2_SCHPO/367-671........DFRSY....................F...RFVGRVMGLAIYH.......RR.Y.....LDVQFVLPFYK...
Q00WR0_OSTTA/203-456.................................F...FFLGAILGKACYE.......GI.L.....LDVPLAGFLLA...
A2FG81_TRIVA/782-1072.................................L...EFFGGFLSKSISH.......NR.L.....LDLPLNPSFFK...

PF09814

A4D9F3_ASPFU/21-420-----------------------------------------PST.........RLRCSGCENVILNN........PRCAD
UBE3D_HUMAN/13-385-----------------------------------------TQE.......CCTFYCQSCGEVIIKD........RKLL.
A5DDI0_PICGU/5-350-----------------------------------------RTPQNAEKQNIFHFGCAYCDKNIINS........KDCS.
Q6BMI9_DEBHA/5-363-----------------------------------------TKTPQTDNKNNFKLTCLKCSHAIIDS........KEYD.
Q0TZD4_PHANO/225-279-----------------------------------------GEA....................................
Q29GF2_DROPS/8-386-----------------------------------------NES........LAIQCVGCQAEVAPR........RIYT.
Q6CWI5_KLULA/6-349-----------------------------------------KHP........FVFYCLDCDTPVISS........INCK.
A1CJR3_ASPCL/19-424-----------------------------------------PSS.........KLRCRRCAGLILDA........PGLDS
Q9VWP0_DROME/9-390-----------------------------------------NEP........ITINCRDCRAELVAG........RSYR.
UBE3D_PONAB/13-385-----------------------------------------AQE.......CCTFYCQSCGEVIIND........RKLL.
Q6FK88_CANGA/6-347-----------------------------------------KMQ.......GFQIACNNCKLVVLDS.......EVNIK.
Q7SDG7_NEUCR/13-382-----------------------------------------AGS.........EVVCRQCQAVVVKR........DVVK.
Q4P6X1_USTMA/1030-1417-----------------------------------------STR..........LGCAVCSKAAPKGEVVKGLLGSNEV.
YHFA_SCHPO/4-322-----------------------------------------KDDA.....VKSTIKCKQCQSFL...........TSIS.
A7TPW1_VANPO/6-340-----------------------------------------SMG.......HISFSCIGCKKVLLQK.......GDNVT.
Q75DV5_ASHGO/6-339-----------------------------------------RAE..........LRCAACDGLLVTG........EACR.
YJ9I_YEAST/7-342-----------------------------------------SDS.......DFSIECLNCKQKIISK........DNCQ.
Q16XY0_AEDAE/12-444-----------------------------------------GKG........YRLMCSNCGNPLKDE.......TVSFR.
Q5B919_EMENI/28-412-----------------------------------------PTT.........KLRCVKCEQVILDK........PSNTA
A5DWX9_LODEL/10-366-----------------------------------------SETPTIDKKNVFQFVCFKCKHLLINS........QNHV.
Q5PQ45_XENLA/37-407-----------------------------------------IQN.......NYTFYCQSCGEVIIKE........QQFF.
Q6C9F9_YARLI/6-329-----------------------------------------KLP.......KATLLCDHTDGSPILT........AALDT
Q59X25_CANAL/5-343-----------------------------------------QTPKIG.RNHKFIFVCKNCNSELIDS........SQYD.
UBE3D_MOUSE/13-364-----------------------------------------AQE.......CCTFYCQSCGEVTIKD........RKLL.
UBE3D_BOVIN/13-385-----------------------------------------DQE.......CCTFYCQSCGEVIIRD........RMLL.
A7USM4_ANOGA/14-434-----------------------------------------GQR........YRVLCSNCAGPLQQSADPAGDPDTSFQ.
A7SC58_NEMVE/7-362-----------------------------------------AVT........LNLTCRTCENPILST........VRFS.
Q5EAZ8_DANRE/20-391-----------------------------------------VDE.......SYSVLCQSCGSRVLQH........RSFG.

PF00632

HACE1_MOUSE/602-909.........................................HIL.....................GIP......VN.YQ-
Q7QE66_ANOGA/554-863.........................................ALL.....................RLP......VS.LS-
NEDD4_HUMAN/1013-1318.........................................MML.....................HKP......IT.LH-
A4IBF5_LEIIN/1897-2310.........................................FIRR.......G.V.........PAYQ......CV.VS-
A4IC88_LEIIN/3812-4131.........................................YLC.....................AYP......IT.EA-
Q4WHR7_ASPFU/967-1337.........................................KLL.....................GLK......VKHLE-
A4HPV4_LEIBR/2168-2551.........................................RLR.....................GESLNSTAGEA.SR-
A4HF82_LEIBR/3619-3949.........................................TLT.....................FQED....TIT.LA-
A4IAG7_LEIIN/1051-1369.........................................LLMLPSLGLPVGQKAGARSSPCASTLA......AL.TN-
UBE3B_HUMAN/736-1068.........................................QLL.....................GHHHS.VFYSS.VD-
A3GHK0_PICST/646-950.........................................ILL.....................DKP......VG.LD-
UPL3_ARATH/1518-1888.........................................LIL.....................GQE......LD.LH-
Q0UNY9_PHANO/908-1229.........................................FLLHGV...APL.RAT.....NLHNIR......DC.LD-
Q9BL11_CAEEL/717-1019.........................................YLL....................D.TP......PD.LE-
A0EFC1_PARTE/672-969.........................................KLQ....................N.EK......VT.EE-
Q2GSX9_CHAGB/694-1033.........................................KWAT......SA.GA.......SDTYR......AN.IN-
Q5KIA2_CRYNJ/1499-1843.........................................LL.L......DK.P........IK.........KN.LS-
HUL5_YEAST/607-910.........................................KLLN......YS.NG.......FLSSF......SD...-
Q38D88_TRYB2/1472-1912.........................................FLC....................RGIPPS..RIVLRCT-
A0E799_PARTE/3885-4178.........................................VVY.....................DEK......IV.FE-
Q00WM5_OSTTA/458-763.........................................HLL.....................GQA......LT.YE-
A2DUY0_TRIVA/771-1054.........................................MVF........D.E.........N.............V-
Q6BGB8_PARTE/609-908.........................................QVL........G...........ITNT......IN...-
A2FLN6_TRIVA/2545-2849.........................................SLT.....................QRP......VT.LD-
Q7PSQ3_ANOGA/541-897.........................................QLL.....................NKP......IT.LS-
Q6NNZ7_DROME/211-561.........................................WLVS.......E.E........HS.........IG.LA-
A4IBT8_LEIIN/1017-1343.........................................FLS.....................GAE......PS.FV-
A0D2G1_PARTE/170-483.........................................HIL.....................RQK......IV.LE-
K0317_MOUSE/512-823.........................................QII.....................GLR......MH.YK-
A2FVL0_TRIVA/2315-2604.........................................YLC.....................GID......LT.ID-
Q8SS57_ENCCU/454-746.........................................KLL.....................DRR......PT.LD-
Q4E2E5_TRYCC/2646-2975.........................................FLT.....................FDN......LT.IE-
A2F794_TRIVA/2662-2959.........................................FLT.....................GHQ......LT.IE-
TOM1_YEAST/2962-3268.........................................NIL.....................GRP......VS.LK-
A7SQ93_NEMVE/299-612.........................................KLLSPA..VVPF.HNPN...ARVGLAN......LG.LE-
A2DAV4_TRIVA/452-719.........................................LLC.....................GER......FDWTE-
Q6C901_YARLI/697-1001.........................................KLL........G.C.........P.........VG.LE-
A0DAX5_PARTE/100-320.........................................HIK.................................LQ-
Q6C8U2_YARLI/491-779.........................................NLQ........E.F.........WGSPCR..VTEE...-
Q9W0H2_DROME/761-1058.........................................KLL....................G.KP......VD.LS-
A0BRN4_PARTE/3724-4023.........................................VIF.....................SEK......IQ.FK-
A2FJ59_TRIVA/1204-1414.........................................YIL...................................-
Q6PDJ9_MOUSE/738-1060.........................................TLV.....................GEP......LDPDQ-
A4S7N1_OSTLU/131-443.........................................HVL........G...........TART......ID...-
A2FR71_TRIVA/373-670.........................................KLL....................G.MK......MT.LE-
A0DNI8_PARTE/201-510.........................................HII.....................GQS......IF.LE-
Q5BG86_EMENI/848-1165.........................................KLLAGAP.QTTG.PQPL...TTRPTYK......CS.LE-
A5K4K7_PLAVS/1441-1991.........................................FLLC......DD.L........DLDVD......VA.IN-
Q55NG7_CRYNB/3037-3342.........................................QIL.....................GRT......VD.MR-
A2DQ34_TRIVA/412-708.........................................KIL....................G.KP......IT.LT-
A7AV31_BABBO/1338-1643.........................................LCQH.......P.S.........MVNN......CS.LS-
A2E999_TRIVA/2659-2965.........................................FLI.....................TGE......IA.LE-
A2F3T0_TRIVA/1939-2179.........................................YIF.....................KGK......IE.IE-
A2FXS6_TRIVA/392-692.........................................SIL....................NFSN......FT.LN-
Q6NVK6_XENTR/557-856.........................................KLM....................G.KK......GT.FR-
A2DWM0_TRIVA/796-1093.........................................LV.....................L.........GD.SL-
A2DYB1_TRIVA/1674-1977.........................................AIL.....................GIP......VT.LR-
A2EEN6_TRIVA/766-1053.........................................KLK....................G.VS......VG.IN-
A4I8L1_LEIIN/3799-4087.........................................FLV.....................DDE......LT.IK-
HUL4_ASHGO/526-839.........................................KIC.....................GEV......LS.VN-
A2DKE7_TRIVA/929-1162.........................................SFV.....................TNS...........-
Q247X9_TETTS/2115-2420.........................................SVL.....................KRD......LS.IG-
A5K5J0_PLAVS/8258-8564.........................................HML.....................GRK......IL.PA-
A2DXG0_TRIVA/2382-2669.........................................YLT.....................GNE......IS.DQ-
A4RVZ5_OSTLU/490-781.........................................RVI.....................ANEKC..DAFT.LD-
UPL7_ARATH/828-1142.........................................KLL........G...........RYSF......ID...-
MUG30_SCHPO/482-807.........................................KLL....................Q.LP......LS.FN-
Q6GP47_XENLA/736-1028.........................................KLL....................D.KK......AT.LE-
A3FPU7_CRYPI/497-797.........................................KLL....................G.YK......VD.IG-
Q38A01_TRYB2/1526-1868.........................................GILG......DL.D........DT.............N-
A1CTM1_ASPCL/1468-1817.........................................IA.D......SG.SS.......VA.........PS.LG-
A2ECJ9_TRIVA/791-1087.........................................TL.....................R.........NE.DV-
Q7PSA4_ANOGA/2506-2929HSRSMARGATSQTGSLLGKSGVSDDIMMSSILSEDSDRDRDLLVDSYQ.SKMA.MASD...GAWYDGI......LT.QE-
Q4UD92_THEAN/251-554.........................................LIL........K...........RRNT......LD...-
A2FK98_TRIVA/1968-2204.........................................YLA...................................-
A3LSX3_PICST/660-977.........................................KWCN.......D.N........MKNSI......ND...-
A0DLU6_PARTE/3989-4284.........................................LIF.....................NKP......IV.FE-
Q00Y47_OSTTA/1123-1477.........................................ALL........G.R.........C.........LG.LQ-
SPKUL_DICDI/1577-1887.........................................YLL.....................GVK......VN.LR-
A7SNF7_NEMVE/430-737.........................................QIL.....................GIP......LSHPD-
A7SP65_NEMVE/115-400.........................................HTL.....................N.T......VR.PQ-
A2ERB6_TRIVA/1571-1861.........................................FLK.....................DRK......PT.IR-
Q4Q7L2_LEIMA/1091-1400.........................................AIL........G...........RRNT......LS...-
Q9CYM1_MOUSE/752-912.........................................KLL....................N.VK......PS.LE-
Q54KP2_DICDI/1482-1898.........................................YMID.......Q.E........LN.........FD...-
A4VDG4_TETTS/2059-2356.........................................LFL.....................KKK......IV.IS-
Q22F29_TETTS/3398-3694.........................................HIL.....................HKT......LF.IS-
A0DLB8_PARTE/2812-3098.........................................IIC.....................DLP......LE.FD-
A5DS31_LODEL/333-694.........................................LIQFLNR.KTLQ.AHTT...PKQSRKF......AT.LS-
A2DQ30_TRIVA/383-682.........................................KLV....................G.KK......LI.LD-
UBR5_MOUSE/2479-2792.........................................VLL.....................GRK......VN.WH-
Q54GG5_DICDI/425-720.........................................KLL....................N.LD......LT.ME-
Q5CW92_CRYPI/1231-1561.........................................SVF.....................EQN......ND.FT-
A2E5Q8_TRIVA/658-966.........................................FLV.....................SNK......VS.IE-
A0BRI8_PARTE/1050-1354.........................................HII.....................GQK......LS.IF-
A7SML1_NEMVE/1229-1585.........................................WMLG.......F.E........AT.........FD.YR-
A2FIB4_TRIVA/386-683.........................................KIL....................N.KT......IT.LN-
A2DAL9_TRIVA/1571-1869.........................................AMI.....................GRN......VN.AS-
A2D760_TRIVA/795-1094.........................................YITYN.....LK.KK.......QS.........AN.QV-
Q01B14_OSTTA/546-834.........................................RVI.....................GGAST..ASIT.IE-
A0DH95_PARTE/2-219.........................................NWV...................................-
O17736_CAEEL/692-1001.........................................QIFE.......T.D.........KNKD......VD.LQ-
A8BIP6_GIAIC/2319-2632.........................................RIL.....................GLS......FK.AQ-
A2FPQ0_TRIVA/408-705.........................................KLQ....................E.LA......TS.VE-
A2F5A6_TRIVA/682-951.........................................LIQ..............................LE.YV-
Q580A5_TRYB2/986-1286.........................................LIR.....................SQTPS..VEVL.WH-
A2F7U9_TRIVA/2273-2579.........................................FIA.....................GGE......LS.SN-
A5D6V3_DANRE/704-994.........................................KLL....................Q.QK......PS.LD-
A2F3N1_TRIVA/2072-2351.........................................SMT.....................GKP......IT.IH-
Q9W196_DROME/819-1122.........................................KLA........G...........KYSD......VD.IH-
Q381G0_TRYB2/3834-4128.........................................YMV.....................GDV......LM.VR-
A2EDQ8_TRIVA/2183-2490.........................................FIA.....................NEH......VG.ID-
A2EM50_TRIVA/2501-2807.........................................CLV.....................TGE......IT.ID-
A2EQW9_TRIVA/2209-2511.........................................YLA.....................NEP......LD.KN-
Q54QF1_DICDI/778-1120.........................................MIL.....................GEK......IT.LD-
Q8SR14_ENCCU/2104-2410.........................................YIL.....................GKS......CD.LQ-
A2DAJ9_TRIVA/133-438.........................................HLA.....................GEL......LQ.EN-
Q580G4_TRYB2/3999-4304.........................................HMI.....................GIQ......PT.FG-
A8BLR8_GIAIC/875-1158..........................................................................ISHFG-
A2E5X8_TRIVA/301-578.........................................SLF.....................GYP......IT.AS-
Q4PHJ7_USTMA/908-1208.........................................KML........G.K.........QSYL......DD.LG-
A7RSK9_NEMVE/1024-1329.........................................QLV.....................GIP......LT.PD-
Q2GVQ3_CHAGB/742-1078.........................................SIL.....................TNRVV..QQFF.VL-
A0D383_PARTE/180-477.........................................KLL.....................GQE......IS.FQ-
A2E4I7_TRIVA/2634-2943.........................................YIA.....................QGI......LT.IE-
Q019K0_OSTTA/1236-1531.........................................ALL.....................GKR......GT.LS-
A2DBI7_TRIVA/375-665.........................................KFA.....................RTQ......VT.IN-
A2G1R0_TRIVA/764-1050.........................................MIF.....................GRE......VT.FE-
A4VD17_TETTS/793-1095.........................................QMI.....................GKQ......NN.LV-
A8BYQ3_GIAIC/636-950.........................................KLL....................G.YK......GV.FE-
PUB2_SCHPO/367-671.........................................RIL.....................QKP......LC.LE-
Q00WR0_OSTTA/203-456.........................................ALK.....................GRR......VE.FN-
A2FG81_TRIVA/782-1072.........................................LLRG.......Q.E.........V..............-

PF09814

A4D9F3_ASPFU/21-420GSGD.....TSPAGWTWK-D---------------------LPSGNWAE-MMDFWHCHKPDPPEGHRHVEDPNAQTK...
UBE3D_HUMAN/13-385...............RVL-P---------------------LPSENWGA-LVGEWCCHPDPFAN................
A5DDI0_PICGU/5-350................FF-D---------------------MPSELWSE-MMDFWHCHKPHDHGNHGEHQHTTN......
Q6BMI9_DEBHA/5-363...............RFF-D---------------------MPSELWSE-MMEFWHCHKPAEDPNEKDSHRNY.......
Q0TZD4_PHANO/225-279..................-.---------------------........-..............................
Q29GF2_DROPS/8-386...............RLR-E---------------------FPNCIVDP-..NEFFCHGHGHDHGHGHGQDRP.......
Q6CWI5_KLULA/6-349...............RIR-D---------------------MPSEFWAD-FMDYWHCHKPDMEPHQKGHHVAASETL...
A1CJR3_ASPCL/19-424ADSQM...SDASDGWVWK-D---------------------LPSGNWAE-MMDFWHCHKPDPEDHGHGDG...EDGNAQ.
Q9VWP0_DROME/9-390...............RLR-E---------------------FPSLLVDP-..TEFFCHNHGPAGKTQP............
UBE3D_PONAB/13-385...............RVL-P---------------------LPSENWGA-LVGEWCCHPDPFAN................
Q6FK88_CANGA/6-347...............KIS-E---------------------MPSEFWAE-FMDYWHCHKPTIGESKTDAKPYD.......
Q7SDG7_NEUCR/13-382...............VWK-D---------------------LPSENWAE-MMEFWHCHKPGDHDHDHHHHDKSNGVDANG
Q4P6X1_USTMA/1030-1417...............VWK-A---------------------LPSEGWEE-LVDAWMCHADQELNASLTQTAVRFASRIS.
YHFA_SCHPO/4-322...............SWK-D---------------------LPSANWME-MLDCWSCHTDYPTVLSKRGGP.........
A7TPW1_VANPO/6-340...............KLN-S---------------------LPSEFWME-LMDYWHCHKPHVEGQAVVDYSKK.......
Q75DV5_ASHGO/6-339...............RVS-A---------------------MPSEFWTE-LMDYWHCHKPADESAGAQQYLTK.......
YJ9I_YEAST/7-342...............VLN-D---------------------MPSEFWFE-LMDYWHCHKPDVKEDKSSYTRF........
Q16XY0_AEDAE/12-444...............RIL-E---------------------LPSDHMDS-..NEWYCHQHPHGEGKTDDTHAHAECSSS.
Q5B919_EMENI/28-412APTLSDENSTSHAGWLWK-D---------------------LPSGNWAE-MMDFWHCHKPDPHEGQDADGAAKQTIEDEN
A5DWX9_LODEL/10-366................FK-D---------------------MPNEYWYE-LMDFWHCHKPETGEFNDKNF..........
Q5PQ45_XENLA/37-407...............RVL-P---------------------LPGENWSS-LIEEWCCHPDPFAN................
Q6C9F9_YARLI/6-329..............FRLR-N---------------------MPSEHWAE-MMDFWHCHKPHEKSAQFNPAYAV.......
Q59X25_CANAL/5-343................FK-D---------------------MPSEQWYE-MMDFWHCHKPENYEKHKKEYK.........
UBE3D_MOUSE/13-364...............RVL-P---------------------LPSENWSA-LVGEWCCHPDPFAN................
UBE3D_BOVIN/13-385...............RVL-P---------------------LPGDNWGA-LVDEWCCHPDPFAN................
A7USM4_ANOGA/14-434...............RVL-E---------------------LPSEQLDT-..DDWFCHRHDHQPSEGAPEPCHGRQQG..
A7SC58_NEMVE/7-362...............RVL-D---------------------LPSESWEQ-LSKDLCCHGTSLSEAY..............
Q5EAZ8_DANRE/20-391...............RVL-P---------------------LPNGNWNA-LVDDWCCHPDPFAN................

PF00632

HACE1_MOUSE/602-909---------------DVA.S.....................IDPEYAKN.LQWILDNDISDLG.................
Q7QE66_ANOGA/554-863---------------DLE.S.....................LDSSFHQS.LLWIR..DNNMDN.................
NEDD4_HUMAN/1013-1318---------------DME.S.....................VDSEYYNS.LRWIL..ENDPTE.................
A4IBF5_LEIIN/1897-2310---------------DVT.HIDPPPEYPIDLFELPLTAASWVDQGIADS.LACLSTMDSSTLA.................
A4IC88_LEIIN/3812-4131---------------EVE.Q.....................VDVICVQC.VREFRVLSATHAAAAVADADE.........
Q4WHR7_ASPFU/967-1337---------------HIR.D.....................GWPELTKG.LELLL..SWQDGD.................
A4HPV4_LEIBR/2168-2551---------------NMS.Q.....................VDAALELT.LHRLEMMDAGSLA.................
A4HF82_LEIBR/3619-3949---------------DYAHD.....................IDDNIIAA.LEDEE.FVLSEGFFASLPEHVRASPVFLRS
A4IAG7_LEIIN/1051-1369---------------LLE.V.....................LDPSLHRS.FAQLR.......R.................
UBE3B_HUMAN/736-1068---------------ELP.S.....................LDSEFYKN.LTSIKRYDGDITD.................
A3GHK0_PICST/646-950---------------DYK.Q.....................LFPVSYGN.LMKLK..KYSTEE.................
UPL3_ARATH/1518-1888---------------DIV.L.....................FDAELGKT.LQELRVVVARKHYLEGVGGDNSS.......
Q0UNY9_PHANO/908-1229---------------LVA.D.....................GWPELAKS.FGQLLSFEGDVAD.................
Q9BL11_CAEEL/717-1019---------------DLC.E.....................LSPSEGKG.LKMLLSY..EEDD.................
A0EFC1_PARTE/672-969---------------DLK.E.....................LDMEIYTG.FQYLRE.QTDSNL.................
Q2GSX9_CHAGB/694-1033---------------DLR.E.....................LDEELYQG.MLRLK..NYPGN..................
Q5KIA2_CRYNJ/1499-1843---------------TLR.A.....................VDPSLARS.LERLQGYYCVRKEIEALPIPASSRR.....
HUL5_YEAST/607-910---------------.LG.S.....................YDSVLYNN.LIKLL..NMTTDE.................
Q38D88_TRYB2/1472-1912---------------EKEEQPWEPERPIDF.MSLGIEEVEMMDKQVASS.LRSLLSMSSKELS.................
A0E799_PARTE/3885-4178---------------DLVLI.....................WDKQTYSN.YANLKSMSPET...................
Q00WM5_OSTTA/458-763---------------DME.G.....................VDPDYYKS.LKWML..ENSIDG.................
A2DUY0_TRIVA/771-1054---------------TIS.D.....................TDSDILEN.LSNKDYYLG.....................
Q6BGB8_PARTE/609-908---------------DFR.F.....................YDSDQYHR.ICNLK..NQD....................
A2FLN6_TRIVA/2545-2849---------------DIY.E.....................IDSNFKQF.ILSIENSSSMSPQ.................
Q7PSQ3_ANOGA/541-897---------------DIE.D.....................VDPDLHRS.LTWIL..ENNITG.................
Q6NNZ7_DROME/211-561---------------DLM.R.....................VAPEVQNT.LVRLQDLVRQREYILSDPNIDAMEK.....
A4IBT8_LEIIN/1017-1343---------------DLE.E.....................YDPNIAST.LKRLRLLSAAD...................
A0D2G1_PARTE/170-483---------------DIK.Y.....................FDEDLFYS.WQYLLNNNSDQLD.................
K0317_MOUSE/512-823---------------YFE.T.....................DDPEFYKSKVCFIL..NNDMSE.................
A2FVL0_TRIVA/2315-2604---------------DIY.S.....................IDNSFRD..FVSILENSNSKES.................
Q8SS57_ENCCU/454-746---------------DLR.E.....................ISSGIATS.LRNLRRLSRDE...................
Q4E2E5_TRYCC/2646-2975---------------DYHAD.....................IDDTVRG..ALNDDEFILNDEFFYSIPGIE.........
A2F794_TRIVA/2662-2959---------------DIY.S.....................VDSAFASS.IKAFKENPAKTLL.................
TOM1_YEAST/2962-3268---------------DME.S.....................LDPDYYKS.LVWIL..ENDITD.................
A7SQ93_NEMVE/299-612---------------DLA.E.....................VMPELARG.LKELLSYEGDVE..................
A2DAV4_TRIVA/452-719---------------..........................IDKSYANM.FNNPEKLIGC....................
Q6C901_YARLI/697-1001---------------DFT.V.....................VNPTVGRS.LSQLLKF..TESE.................
A0DAX5_PARTE/100-320---------------DVFEK............................................................
Q6C8U2_YARLI/491-779---------------DYE.Q.....................QDPVAYSS.LVSLRNLPKAELA.................
Q9W0H2_DROME/761-1058---------------DLR.Q.....................LSPPEANS.MQSLLDY..QGDD.................
A0BRN4_PARTE/3724-4023---------------DLNGF.....................LDPITFQN.YEMMLSYDEKT...................
A2FJ59_TRIVA/1204-1414---------------.................................S...............................
Q6PDJ9_MOUSE/738-1060---------------DLQ.E.....................ADILTYNY.VKKFESINDESELEALCAEIA.........
A4S7N1_OSTLU/131-443---------------DIP.S.....................LDEDLARS.IVQIL..EYEGD..................
A2FR71_TRIVA/373-670---------------DLN.Q.....................IEPDIVKG.IKEMRQMVQEGKD.................
A0DNI8_PARTE/201-510---------------DIY.Y.....................YDRQLYQS.WDFLVNNKFEADD.................
Q5BG86_EMENI/848-1165---------------DLA.E.....................YRPVLARG.LRALLEF..EGDV.................
A5K4K7_PLAVS/1441-1991---------------DLY.F.....................IDQHVFNS.LLYIQ....NTPH.................
Q55NG7_CRYNB/3037-3342---------------DLE.S.....................IDPEYHKS.LQWML..DNDITG.................
A2DQ34_TRIVA/412-708---------------DIG.E.....................IDPDFMKS.ALDMINMRTKKED.................
A7AV31_BABBO/1338-1643---------------VLS.S.....................VDPTLARS.LGNLLVA....DD.................
A2E999_TRIVA/2659-2965---------------RIM.E.....................IDDHYKTT.IDSFKEAMKEGMTD................
A2F3T0_TRIVA/1939-2179---------------DLL.E.....................IDAKINER...............................
A2FXS6_TRIVA/392-692---------------DLE.Q.....................IEPDVAKS.LREILLMPENGEN.................
Q6NVK6_XENTR/557-856---------------DLA.D.....................SHPVLYQS.LKELLEYEGNVE..................
A2DWM0_TRIVA/796-1093---------------TVS.E.....................VDKMLDKS.LNSDKTAL......................
A2DYB1_TRIVA/1674-1977---------------DLE.D.....................VDEQLHNS.LQWIL..ENDIED.................
A2EEN6_TRIVA/766-1053---------------DLE.E.....................IDPQLVST.LMNILSYEGDVE..................
A4I8L1_LEIIN/3799-4087---------------DFYTH.....................VDSVVEA................................
HUL4_ASHGO/526-839---------------DFL.E.....................LYPETGTN.MLKMLEYDGED...................
A2DKE7_TRIVA/929-1162---------------DLSLL.....................VD.....................................
Q247X9_TETTS/2115-2420---------------DFY.S.....................YDFNSAQQ.HQWLLEND......................
A5K5J0_PLAVS/8258-8564---------------DAE.S.....................VDPEFYNS.LIKIA..EYKLED.................
A2DXG0_TRIVA/2382-2669---------------DLL.D.....................MDPDFAA................................
A4RVZ5_OSTLU/490-781---------------DLA.D.....................VEPAVVKS.IKVVLETDDVESL.................
UPL7_ARATH/828-1142---------------ELS.G.....................LDPELYRN.LMYVK..HYDGD..................
MUG30_SCHPO/482-807---------------DLD.D.....................FQPSLYRG.LKELLLFEGD....................
Q6GP47_XENLA/736-1028---------------DLK.E.....................IQPTMGRG.MQDLLDA..DSA..................
A3FPU7_CRYPI/497-797---------------DLY.E.....................IQPEVANS.LLSLLSIKSDSE..................
Q38A01_TRYB2/1526-1868---------------RLP.Y.....................IDPQLDKQ.LDSLLKLTA....N................
A1CTM1_ASPCL/1468-1817---------------TVK.A.....................VDRDLANS.LLLLKRFASVKKTIEGDKSLSKAQK.....
A2ECJ9_TRIVA/791-1087---------------TVQ.D.....................VDPQLAIA.LE.NPEGL......................
Q7PSA4_ANOGA/2506-2929---------------NLQ.E.....................IDPIRYQF.LRELQELVQQKQAIEQNDALSSEEKLQ...
Q4UD92_THEAN/251-554---------------DLK.L.....................FDSALYRN.ITMLR..GMSESE.................
A2FK98_TRIVA/1968-2204---------------..........................SDEK...................................
A3LSX3_PICST/660-977---------------.LN.Y.....................LDHELFMG.LMKLV..KMPEQE.................
A0DLU6_PARTE/3989-4284---------------DLEGI.....................MDDVEFKN.IKSLRQMTKED...................
Q00Y47_OSTTA/1123-1477---------------DLI.E.....................IDPGLGNT.LRRLDAAANEIENMKRQGLPEST.......
SPKUL_DICDI/1577-1887---------------DLE.I.....................YDPQLAQS.FKKV.........LV...............
A7SNF7_NEMVE/430-737---------------DLS.S.....................FDHELHSNQITWVQ..ENSVDD.................
A7SP65_NEMVE/115-400---------------KLE.L.....................GDTLQKVA.LY............................
A2ERB6_TRIVA/1571-1861---------------DVK.A.....................IDEQIYDS.LMYIK..ENDVTD.................
Q4Q7L2_LEIMA/1091-1400---------------NLK.S.....................FDAELYHQ.LMSLT..QLSEEE.................
Q9CYM1_MOUSE/752-912---------------DLK.E.....................LSPTEGRS.LQELLDY..PGED.................
Q54KP2_DICDI/1482-1898---------------DLR.Q.....................LAPTYASS.LNRLYSLVTSIKQIQARSDLDGAAK.....
A4VDG4_TETTS/2059-2356---------------DIE.E.....................IDPELYKN.LNWLLKNQINADE.................
Q22F29_TETTS/3398-3694---------------DLE.D.....................IDPDEANN.LLWILDHDVTDLCLT...............
A0DLB8_PARTE/2812-3098---------------DLSCV.....................VEPQIYQS.YQYLRNLKED....................
A5DS31_LODEL/333-694---------------NLH.L.....................VDPELARS.LEHLQKYIKVYERTPELQKR..........
A2DQ30_TRIVA/383-682---------------DLA.E.....................IDPAFVQQ.VKTF.....DGD..................
UBR5_MOUSE/2479-2792---------------DFA.F.....................FDPVMYES.LRQLILASQSSDA.................
Q54GG5_DICDI/425-720---------------DIE.S.....................LDPEVYQS.FIKIKTTEEDV...................
Q5CW92_CRYPI/1231-1561---------------DLL.N.....................LDEELYKS.LNYIKSLENYQE..................
A2E5Q8_TRIVA/658-966---------------DIY.E.....................IDVNYKNT.IESLKDAINSRISE................
A0BRI8_PARTE/1050-1354---------------DIS.Y.....................HDEGLYQQ.FYSLYYSKSNAD..................
A7SML1_NEMVE/1229-1585---------------DLF.D.....................IDPVLAKS.ISQLQGLVRQKHRLEKDSSLTPESL.....
A2FIB4_TRIVA/386-683---------------DLA.E.....................IDPHFVTS.VSQMREMKEKGEN.................
A2DAL9_TRIVA/1571-1869---------------DLA.D.....................YSPVVYDT.ITWIQDTKNDPAD.................
A2D760_TRIVA/795-1094---------------TID.D.....................IDPTFASS.LN.DKEGL......................
Q01B14_OSTTA/546-834---------------ELE.D.....................VEPQQVKS.IRYVQQTDAVEEL.................
A0DH95_PARTE/2-219---------------TLRTD.....................KSKQFY.................................
O17736_CAEEL/692-1001---------------HMK.S.....................FDPIIFKH.LKALQ..KMNNRE.................
A8BIP6_GIAIC/2319-2632---------------DIM.L.....................SSPEMYYGNLIALLNVDRSRFE.................
A2FPQ0_TRIVA/408-705---------------DLK.E.....................IMPQEYQS.LMSLKELVAAGED.................
A2F5A6_TRIVA/682-951---------------DIQ.E.....................VDTQIANS.LSVKENLI......................
Q580A5_TRYB2/986-1286---------------LLE.E.....................VEPALANS.YKCVLQATDA....................
A2F7U9_TRIVA/2273-2579---------------DIL.M.....................VDKMLSDQ.FAQLRQAEADKDF.................
A5D6V3_DANRE/704-994---------------DLE.E.....................LSPVEARS.LKNLLEE..DEEE.................
A2F3N1_TRIVA/2072-2351---------------DVY.S.....................IYNDFAML.VLKLQHANYESEEE................
Q9W196_DROME/819-1122---------------QLA.S.....................LDPELYRN.LLYLK..DYSGD..................
Q381G0_TRYB2/3834-4128---------------DYYLY.....................VDNAAEK................................
A2EDQ8_TRIVA/2183-2490---------------DVT.A.....................IDSGLLEH.FNHIRSVSNDADF.................
A2EM50_TRIVA/2501-2807---------------DVF.S.....................IDNEYKDF.VTNLEKDSKEKTPQ................
A2EQW9_TRIVA/2209-2511---------------DIL.C.....................LDEHFAN..MANSLVTINEHDF.................
Q54QF1_DICDI/778-1120---------------DLE.L.....................IDPELYNNKVKLILNTPMNQVN.................
Q8SR14_ENCCU/2104-2410---------------DLE.S.....................ADPEFHKS.LVWIR..DNPVDK.................
A2DAJ9_TRIVA/133-438---------------DIM.M.....................VDEQVKTL.FDRLRQSKNDLDF.................
Q580G4_TRYB2/3999-4304---------------DLK.S.....................VDPELYEN.LKWLL..VNDVSD.................
A8BLR8_GIAIC/875-1158---------------DFL.C.....................SNSFPPNSILWQLKELVKDRHH.................
A2E5X8_TRIVA/301-578---------------DAM.S.....................IDSELMST.VNSLRCGYKGVVR.................
Q4PHJ7_USTMA/908-1208---------------SID.S.....................LDKELYKG.LISLK..NYQGN..................
A7RSK9_NEMVE/1024-1329---------------DIEES..............................LRGIRDIHESGVDE................
Q2GVQ3_CHAGB/742-1078---------------NIRREC...................LVDDSLKA..VSEVIGSG......................
A0D383_PARTE/180-477---------------DMQ.C.....................YDKSLFLS.WKYLLENQFDENQ.................
A2E4I7_TRIVA/2634-2943---------------DIY.S.....................IDTPYKEL.MISLENNIQNITDE................
Q019K0_OSTTA/1236-1531---------------QLA.A.....................VDEEFGRT.LMTLNTHSISHQSNKW..............
A2DBI7_TRIVA/375-665---------------DFE.Q.....................YDPSIAQS.FKMLRNIAKSGGD.................
A2G1R0_TRIVA/764-1050---------------....E.....................IDPVIANS.LKDEDGLI......................
A4VD17_TETTS/793-1095---------------ELE.N.....................FDKELYKN.LKFLK..EYKGD..................
A8BYQ3_GIAIC/636-950---------------DLE.N.....................YDLTIYKG.LCNLYNYAAQLREGSN..............
PUB2_SCHPO/367-671---------------DVK.D.....................VDEVYYES.LKWIK..NNDVDE.................
Q00WR0_OSTTA/203-456---------------DLV.T.....................LDPELYRN.LVSLKRYPGNVED.................
A2FG81_TRIVA/782-1072---------------SIM.E.....................VDPMLGRS.LEVKDGLF......................

PF09814

A4D9F3_ASPFU/21-420.............GYGAANQVVATAGT.VLVDVA----------------------------------------------
UBE3D_HUMAN/13-385..................KSLHPQEND.CFIGDS----------------------------------------------
A5DDI0_PICGU/5-350................QYEELKPKQMD.VIIGGF----------------------------------------------
Q6BMI9_DEBHA/5-363.................NGNLKPGDND.VIIGSS----------------------------------------------
Q0TZD4_PHANO/225-279..................................----------------------------------------------
Q29GF2_DROPS/8-386..................QSLLPGEKD.LFYGLN----------------------------------------------
Q6CWI5_KLULA/6-349.............LHRYNNPLNPAVGE.IMLSDS----------------------------------------------
A1CJR3_ASPCL/19-424...........TKGYGAANQVVARRGT.VLVDVV----------------------------------------------
Q9VWP0_DROME/9-390..................ISLVPAETD.LFYGLN----------------------------------------------
UBE3D_PONAB/13-385..................KPLHPQEND.CFIGDS----------------------------------------------
Q6FK88_CANGA/6-347................YYKELKPRLNE.VLVGNT----------------------------------------------
Q7SDG7_NEUCR/13-382QSDRADDMSLAARGYGASSAISAQQGV.GFVDLT----------------------------------------------
Q4P6X1_USTMA/1030-1417..........DTSTPAERHQQMPT....GWVGDT----------------------------------------------
YHFA_SCHPO/4-322..................SMFQPTDDC.AYLGTS----------------------------------------------
A7TPW1_VANPO/6-340.................YNSLQPSQGE.LLLGPS----------------------------------------------
Q75DV5_ASHGO/6-339.................YNALLPADGE.LLVGDT----------------------------------------------
YJ9I_YEAST/7-342..................ETLKPSKNE.ILIGSS----------------------------------------------
Q16XY0_AEDAE/12-444...........STKAPHPNKFSPTEVD.LFYGPF----------------------------------------------
Q5B919_EMENI/28-412.........SKVKGYGASNQVLATPGT.VLVDVA----------------------------------------------
A5DWX9_LODEL/10-366..................NTLKPSDNATVLIGSY----------------------------------------------
Q5PQ45_XENLA/37-407..................RSCLPKVND.CFLGDT----------------------------------------------
Q6C9F9_YARLI/6-329..................SQFKPNPGE.ILFGQE----------------------------------------------
Q59X25_CANAL/5-343..................GILKPDNKT.IIIGSY----------------------------------------------
UBE3D_MOUSE/13-364..................RPLHPREND.CFIGDS----------------------------------------------
UBE3D_BOVIN/13-385..................KPLHPREND.CFTGDC----------------------------------------------
A7USM4_ANOGA/14-434...........EPSSQLSTKFEPQPGD.LFYGTF----------------------------------------------
A7SC58_NEMVE/7-362..................TSLNPSQDD.CLLGSY----------------------------------------------
Q5EAZ8_DANRE/20-391..................RKLLPRAGD.CLLGDT----------------------------------------------

PF00632

HACE1_MOUSE/602-909....................L...ELTFS.V.ETDVF.............GAM...........................
Q7QE66_ANOGA/554-863.................CGEL...GLNFT.VTEERSD.............GTS...........................
NEDD4_HUMAN/1013-1318....................L...DLRFI.I.DEELF.............GQT...........................
A4IBF5_LEIIN/1897-2310...................AL...DLRFTLPGDDS.............................................
A4IC88_LEIIN/3812-4131.........SGGTETELFEDV..FGEEFF.VTQLS................DH...........................
Q4WHR7_ASPFU/967-1337.................VGDVFMRTYEFT.FEVFGAV.............ETVDMEKVGRDAVWPLRARDRSKSSELATN
A4HPV4_LEIBR/2168-2551...................AC...ELFFT.IPVSEADGY.........VPGEV...........................
A4HF82_LEIBR/3619-3949LQGGGTGVMDGAVAPLVARPLR.PYACMT.PEMSMQD.............MSH...........................
A4IAG7_LEIIN/1051-1369.................ISEA...ELAAVGLEMDD.............................................
UBE3B_HUMAN/736-1068....................L...GLTLS.YDEDVMG.............QLVC..........................
A3GHK0_PICST/646-950.................LLAL...DLTFE.VSYQDLF.............GKT...........................
UPL3_ARATH/1518-1888......TISDLCLRGCRIEDL...SLEFT.LPGYP.............................................
Q0UNY9_PHANO/908-1229.................IFMR...EYVFS.YDVFGHRVD.........HDMDE...........................
Q9BL11_CAEEL/717-1019.................VEDV..FGLNFC.ISFNILG..............ET...........................
A0EFC1_PARTE/672-969.................IQSL...TLNFN.ASYVVWG..............EA...........................
Q2GSX9_CHAGB/694-1033.................VGDL...SLDFT.I.TDQISLP........GEPFRT...........................
Q5KIA2_CRYNJ/1499-1843.....TKLAALTVGDAKLADL...ALDFT.LP...GY..............DI...........................
HUL5_YEAST/607-910.................IKSL...DLTFE.I.DEPES..............SA...........................
Q38D88_TRYB2/1472-1912.....................S.LDLPFTMPGDDR.............................................
A0E799_PARTE/3885-4178.................IESL...YLDFTYQIGNS.............................................
Q00WM5_OSTTA/458-763.................V..M...EYTFS.E.TTSYF.............GET...........................
A2DUY0_TRIVA/771-1054....................L...DVPYC.FP...GI.............MDA...........................
Q6BGB8_PARTE/609-908.................VTDF...GLTFS.I.TQEFY.............GQI...........................
A2FLN6_TRIVA/2545-2849.................DFHST.YMLNFTAENSLG.............................................
Q7PSQ3_ANOGA/541-897.................I..I...DSTFS.V.ENNSF.............GVL...........................
Q6NNZ7_DROME/211-561....TEKIEQLDLDGCPIADL...GLDFV.LP...GH.............ANI...........................
A4IBT8_LEIIN/1017-1343.................LEDA...GLDFSYFTHEF.............................................
A0D2G1_PARTE/170-483.........................LYFQLEYFGK.............................................
K0317_MOUSE/512-823....................M...ELVFA.EEKYNKS.............GQL...........................
A2FVL0_TRIVA/2315-2604.....................F.SDVNWSVTLLSG.............................................
Q8SS57_ENCCU/454-746.................VDSL...DLRFVVEHSVDGIP...........RSYP...........................
Q4E2E5_TRYCC/2646-2975........WSGESVTDTMGMVR.STRGYPVVTP...............................................
A2F794_TRIVA/2662-2959.....................A.HEYSFTVVNVAG.............................................
TOM1_YEAST/2962-3268.................I..I...EETFS.V.ETDDY.............GEH...........................
A7SQ93_NEMVE/299-612..................NDL...CQTFQ.VSFTSYG..............EV...........................
A2DAV4_TRIVA/452-719................................................................................
Q6C901_YARLI/697-1001.................VESL...NLSYN.VII.DSE.............GVK...........................
A0DAX5_PARTE/100-320................................................................................
Q6C8U2_YARLI/491-779........................GLGLA...................................................
Q9W0H2_DROME/761-1058.................FKEV..FDLTFE.ISRDVFG..............EA...........................
A0BRN4_PARTE/3724-4023.................LESL...GINFTYQKKKE.............................................
A2FJ59_TRIVA/1204-1414................................................................................
Q6PDJ9_MOUSE/738-1060.........SQHLATESPEGPK.PCCRFTYLTMTG.............................................
A4S7N1_OSTLU/131-443.................VADL...CLDFT.C.SEEIY.............GEL...........................
A2FR71_TRIVA/373-670.................VKDL...YLTFE.ATVTMFG..............DP...........................
A0DNI8_PARTE/201-510.......................ISEFFVIYRKSKGD..............YY...........................
Q5BG86_EMENI/848-1165.................AETF...CHTFV.ADV.DRY.............GEV...........................
A5K4K7_PLAVS/1441-1991.................VESL...ALTFC.IYERKKPGVRD....VRKYEDIISYFQALGRKLSGGSGSMGGSGGVGGSG
Q55NG7_CRYNB/3037-3342.................V..I...DQEFT.I.EDDQF.............GEK...........................
A2DQ34_TRIVA/412-708.................VSEL...CLTFT.TTIEQFG..............ER...........................
A7AV31_BABBO/1338-1643.................IDSA...GLVFT......Y................G...........................
A2E999_TRIVA/2659-2965................EEFKAR.LNHKFVIQDARG.............................................
A2F3T0_TRIVA/1939-2179................................................................................
A2FXS6_TRIVA/392-692.................VADL...CLTFS.SVVDIFG..............HQ...........................
Q6NVK6_XENTR/557-856..................EDM...MMTFQ.ISQTDLF.............GNP...........................
A2DWM0_TRIVA/796-1093....................Y...GLPFT.YP...GL.............DNI...........................
A2DYB1_TRIVA/1674-1977.................AC.L...DLNFT.Y.NYDYL.............GRV...........................
A2EEN6_TRIVA/766-1053..................NDM...CLDFT......Y................E...........................
A4I8L1_LEIIN/3799-4087....................TV.RDDNFLLSGVAD.............................................
HUL4_ASHGO/526-839.................FEDI..FALTFE.TCFPDRFD..........ESKIH...........................
A2DKE7_TRIVA/929-1162................................................................................
Q247X9_TETTS/2115-2420.................INGLD.LGITFSYISYSNGA..............SK...........................
A5K5J0_PLAVS/8258-8564.................LN.L...EINFS.T.EIDEF.............GKT...........................
A2DXG0_TRIVA/2382-2669.................SLNVT.GQRPLSIISLSG.............................................
A4RVZ5_OSTLU/490-781........................CLTFIDPTTN..............................................
UPL7_ARATH/828-1142.................LKEL...CLDFT.V.TEEFC.............GKM...........................
MUG30_SCHPO/482-807.................VKNT..YGLNFT.INLKAVE..............GF...........................
Q6GP47_XENLA/736-1028..................ESM...ELYFC.FSWEN.................K...........................
A3FPU7_CRYPI/497-797.................MEQL...CLTFS.ATINNFG..............VM...........................
Q38A01_TRYB2/1526-1868................ELEEC...ELMFV.IQHGDAE............HNGG...........................
A1CTM1_ASPCL/1468-1817....SQALQNVEVDGVKVEDL...SLDFT.LP...GY.............PSI...........................
A2ECJ9_TRIVA/791-1087....................I...GLDFT.YP...GL.............YDF...........................
Q7PSA4_ANOGA/2506-2929..QISELKLNTKTGCVALEDL...ALTFTYLPSSRNYG...........YASA...........................
Q4UD92_THEAN/251-554.................IEDL...GLTFT.C.TTQCF.............GSS...........................
A2FK98_TRIVA/1968-2204................................................................................
A3LSX3_PICST/660-977.................LDSL...DLNFT.V.NETLK.............GKN...........................
A0DLU6_PARTE/3989-4284.................IDSL...CITFTHSQGTH.............................................
Q00Y47_OSTTA/1123-1477.......WKQVTVDGANIEDL...CLTFV.VP...GS..............SV...........................
SPKUL_DICDI/1577-1887..............LDNIEEY..LSTTFE...................................................
A7SNF7_NEMVE/430-737....................L...GFTFS.IDATNPW............TGRP...........................
A7SP65_NEMVE/115-400....................I...LFTIA.R.LVREF.............GLS...........................
A2ERB6_TRIVA/1571-1861....................L...CLTFS.LSIDN.................K...........................
Q4Q7L2_LEIMA/1091-1400.................LEAV...GLTFV.Y.TVNAL.............GIT...........................
Q9CYM1_MOUSE/752-912.................IEET..FCLNFT.VCRESYG..............VI...........................
Q54KP2_DICDI/1482-1898....KEEVGKLRVDGAVIEDL...CLDFT.LP...GF.............AGW...........................
A4VDG4_TETTS/2059-2356.......................IDINFAYDKFYAGQ..............KY...........................
Q22F29_TETTS/3398-3694...............HSIDRVV.LGQNYT...................................................
A0DLB8_PARTE/2812-3098..................ELFQ.QDIYFVNQSDEA.............................................
A5DS31_LODEL/333-694.........DLRIDDATIEDL...SLYFV.LP...GY.............PNY...........................
A2DQ30_TRIVA/383-682.................WAEW...GLSFE.VSVQDID.............GTL...........................
UBR5_MOUSE/2479-2792..................DAVF.SAMDLAFAIDLC.............................................
Q54GG5_DICDI/425-720..................SDW...SLYFC.ATYESIY.............GQT...........................
Q5CW92_CRYPI/1231-1561.................VKNL...CLTFS.L.TLDLGSLT.......DVGNNN...........................
A2E5Q8_TRIVA/658-966................DEFNKQ.FNLYFVVKDSLG.............................................
A0BRI8_PARTE/1050-1354.................FEQY....FLYT.I.VNNG...............IP...........................
A7SML1_NEMVE/1229-1585....QLAVENLTLDGASVEDL...GLDFV.LP...GY.............TNI...........................
A2FIB4_TRIVA/386-683.................IEDI...GLYFT.TSYEAYG..............EM...........................
A2DAL9_TRIVA/1571-1869....................L...CLDFT.VDSGND................S...........................
A2D760_TRIVA/795-1094....................I...GLDFT.YP...GL.............PNL...........................
Q01B14_OSTTA/546-834........................CLSFMDPKTN..............................................
A0DH95_PARTE/2-219................................................................................
O17736_CAEEL/692-1001.................LDEL...QLDFS.V.VTSDM.............GLV...........................
A8BIP6_GIAIC/2319-2632................................................................................
A2FPQ0_TRIVA/408-705.................IEDC...CLTFS.VTYNKFD..............AQ...........................
A2F5A6_TRIVA/682-951........................GLNFD.M.................................................
Q580A5_TRYB2/986-1286................................................................................
A2F7U9_TRIVA/2273-2579....................QR.CAVPWKIEQWNG.............................................
A5D6V3_DANRE/704-994.................VVDL..QHLDFT.C.....................K...........................
A2F3N1_TRIVA/2072-2351................FITNY...KLNFVIQ.................................................
Q9W196_DROME/819-1122.................VSEL...NLDFT.V.ASSSL.............GQT...........................
Q381G0_TRYB2/3834-4128....................IV.GDGDFLLSTAAE.............................................
A2EDQ8_TRIVA/2183-2490...................AQH.YAFQWKVDDWDG.............................................
A2EM50_TRIVA/2501-2807................QFQELY.GNNHNKIKNIRG.............................................
A2EQW9_TRIVA/2209-2511..................NKTY.ANMKWAVTDWDD.............................................
Q54QF1_DICDI/778-1120..................EILG.EPLCFVCDIYNQNELLKRSLNNNNNNDEDN...........................
Q8SR14_ENCCU/2104-2410.................S..L...GITFS.F.DDVSF.............GVH...........................
A2DAJ9_TRIVA/133-438...................TSR.FQQKWTYISWTG.............................................
Q580G4_TRYB2/3999-4304.................LG.L...FFTVS.C.EK.FG..............VT...........................
A8BLR8_GIAIC/875-1158................................................................................
A2E5X8_TRIVA/301-578................................................................................
Q4PHJ7_USTMA/908-1208.................VEDL...SLNFT.V.TDEEF.............GVS...........................
A7RSK9_NEMVE/1024-1329...............TTFAEII.PIETFETQSADG.............................................
Q2GVQ3_CHAGB/742-1078.................GEDIK.KKLKIVFKGEEGVDA...........GGLR...........................
A0D383_PARTE/180-477.......................LQQYFIICKDDE.............................................
A2E4I7_TRIVA/2634-2943................KVFSSR.FSLFFVVKDSLG.............................................
Q019K0_OSTTA/1236-1531.............VAMS.......ELNFVRTVRLPNGA...........LSEF...........................
A2DBI7_TRIVA/375-665.................VKDA...EINFVFTKSDK.................G...........................
A2G1R0_TRIVA/764-1050........................GLDFTYPG................................................
A4VD17_TETTS/793-1095.................TKDL...CLTFS......IG.............DQN...........................
A8BYQ3_GIAIC/636-950..............LPSIKDT..FCLTFT.ALG..P...............NG...........................
PUB2_SCHPO/367-671.................S..L...CLNFS.V.EENRF.............GES...........................
Q00WR0_OSTTA/203-456.......................LCLYFTAMDRSG.................M...........................
A2FG81_TRIVA/782-1072........................GLDFC.YP...GH.............PEI...........................

PF09814

A4D9F3_ASPFU/21-420--------------------------------------------------------------------------------
UBE3D_HUMAN/13-385--------------------------------------------------------------------------------
A5DDI0_PICGU/5-350--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-363--------------------------------------------------------------------------------
Q0TZD4_PHANO/225-279--------------------------------------------------------------------------------
Q29GF2_DROPS/8-386--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-349--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-424--------------------------------------------------------------------------------
Q9VWP0_DROME/9-390--------------------------------------------------------------------------------
UBE3D_PONAB/13-385--------------------------------------------------------------------------------
Q6FK88_CANGA/6-347--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-382--------------------------------------------------------------------------------
Q4P6X1_USTMA/1030-1417--------------------------------------------------------------------------------
YHFA_SCHPO/4-322--------------------------------------------------------------------------------
A7TPW1_VANPO/6-340--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-339--------------------------------------------------------------------------------
YJ9I_YEAST/7-342--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-444--------------------------------------------------------------------------------
Q5B919_EMENI/28-412--------------------------------------------------------------------------------
A5DWX9_LODEL/10-366--------------------------------------------------------------------------------
Q5PQ45_XENLA/37-407--------------------------------------------------------------------------------
Q6C9F9_YARLI/6-329--------------------------------------------------------------------------------
Q59X25_CANAL/5-343--------------------------------------------------------------------------------
UBE3D_MOUSE/13-364--------------------------------------------------------------------------------
UBE3D_BOVIN/13-385--------------------------------------------------------------------------------
A7USM4_ANOGA/14-434--------------------------------------------------------------------------------
A7SC58_NEMVE/7-362--------------------------------------------------------------------------------
Q5EAZ8_DANRE/20-391--------------------------------------------------------------------------------

PF00632

HACE1_MOUSE/602-909................................................................................
Q7QE66_ANOGA/554-863................................................................................
NEDD4_HUMAN/1013-1318................................................................................
A4IBF5_LEIIN/1897-2310................................................................................
A4IC88_LEIIN/3812-4131................................................................................
Q4WHR7_ASPFU/967-1337WSELS...........................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4HF82_LEIBR/3619-3949................................................................................
A4IAG7_LEIIN/1051-1369................................................................................
UBE3B_HUMAN/736-1068................................................................................
A3GHK0_PICST/646-950................................................................................
UPL3_ARATH/1518-1888................................................................................
Q0UNY9_PHANO/908-1229................................................................................
Q9BL11_CAEEL/717-1019................................................................................
A0EFC1_PARTE/672-969................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q5KIA2_CRYNJ/1499-1843................................................................................
HUL5_YEAST/607-910................................................................................
Q38D88_TRYB2/1472-1912................................................................................
A0E799_PARTE/3885-4178................................................................................
Q00WM5_OSTTA/458-763................................................................................
A2DUY0_TRIVA/771-1054................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q6NNZ7_DROME/211-561................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A0D2G1_PARTE/170-483................................................................................
K0317_MOUSE/512-823................................................................................
A2FVL0_TRIVA/2315-2604................................................................................
Q8SS57_ENCCU/454-746................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A2F794_TRIVA/2662-2959................................................................................
TOM1_YEAST/2962-3268................................................................................
A7SQ93_NEMVE/299-612................................................................................
A2DAV4_TRIVA/452-719................................................................................
Q6C901_YARLI/697-1001................................................................................
A0DAX5_PARTE/100-320................................................................................
Q6C8U2_YARLI/491-779................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
A2FJ59_TRIVA/1204-1414................................................................................
Q6PDJ9_MOUSE/738-1060................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2FR71_TRIVA/373-670................................................................................
A0DNI8_PARTE/201-510................................................................................
Q5BG86_EMENI/848-1165................................................................................
A5K4K7_PLAVS/1441-1991GVGGARWVGGSGGISGMGGTGWVGGTGWVGGSGGMGNARAIRGNVVRRVFAQSRGAAPDAENANNINSFFNIIDNLDALI
Q55NG7_CRYNB/3037-3342................................................................................
A2DQ34_TRIVA/412-708................................................................................
A7AV31_BABBO/1338-1643................................................................................
A2E999_TRIVA/2659-2965................................................................................
A2F3T0_TRIVA/1939-2179................................................................................
A2FXS6_TRIVA/392-692................................................................................
Q6NVK6_XENTR/557-856................................................................................
A2DWM0_TRIVA/796-1093................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EEN6_TRIVA/766-1053................................................................................
A4I8L1_LEIIN/3799-4087................................................................................
HUL4_ASHGO/526-839................................................................................
A2DKE7_TRIVA/929-1162................................................................................
Q247X9_TETTS/2115-2420................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
A2DXG0_TRIVA/2382-2669................................................................................
A4RVZ5_OSTLU/490-781................................................................................
UPL7_ARATH/828-1142................................................................................
MUG30_SCHPO/482-807................................................................................
Q6GP47_XENLA/736-1028................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2ECJ9_TRIVA/791-1087................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
Q4UD92_THEAN/251-554................................................................................
A2FK98_TRIVA/1968-2204................................................................................
A3LSX3_PICST/660-977................................................................................
A0DLU6_PARTE/3989-4284................................................................................
Q00Y47_OSTTA/1123-1477................................................................................
SPKUL_DICDI/1577-1887................................................................................
A7SNF7_NEMVE/430-737................................................................................
A7SP65_NEMVE/115-400................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
Q9CYM1_MOUSE/752-912................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A4VDG4_TETTS/2059-2356................................................................................
Q22F29_TETTS/3398-3694................................................................................
A0DLB8_PARTE/2812-3098................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
UBR5_MOUSE/2479-2792................................................................................
Q54GG5_DICDI/425-720................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
A7SML1_NEMVE/1229-1585................................................................................
A2FIB4_TRIVA/386-683................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A2D760_TRIVA/795-1094................................................................................
Q01B14_OSTTA/546-834................................................................................
A0DH95_PARTE/2-219................................................................................
O17736_CAEEL/692-1001................................................................................
A8BIP6_GIAIC/2319-2632................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2F5A6_TRIVA/682-951................................................................................
Q580A5_TRYB2/986-1286................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
A5D6V3_DANRE/704-994................................................................................
A2F3N1_TRIVA/2072-2351................................................................................
Q9W196_DROME/819-1122................................................................................
Q381G0_TRYB2/3834-4128................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A2EM50_TRIVA/2501-2807................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
Q54QF1_DICDI/778-1120................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q580G4_TRYB2/3999-4304................................................................................
A8BLR8_GIAIC/875-1158................................................................................
A2E5X8_TRIVA/301-578................................................................................
Q4PHJ7_USTMA/908-1208................................................................................
A7RSK9_NEMVE/1024-1329................................................................................
Q2GVQ3_CHAGB/742-1078................................................................................
A0D383_PARTE/180-477................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
Q019K0_OSTTA/1236-1531................................................................................
A2DBI7_TRIVA/375-665................................................................................
A2G1R0_TRIVA/764-1050................................................................................
A4VD17_TETTS/793-1095................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q00WR0_OSTTA/203-456................................................................................
A2FG81_TRIVA/782-1072................................................................................

PF09814

A4D9F3_ASPFU/21-420--------------------------------------------------------------------------------
UBE3D_HUMAN/13-385--------------------------------------------------------------------------------
A5DDI0_PICGU/5-350--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-363--------------------------------------------------------------------------------
Q0TZD4_PHANO/225-279--------------------------------------------------------------------------------
Q29GF2_DROPS/8-386--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-349--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-424--------------------------------------------------------------------------------
Q9VWP0_DROME/9-390--------------------------------------------------------------------------------
UBE3D_PONAB/13-385--------------------------------------------------------------------------------
Q6FK88_CANGA/6-347--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-382--------------------------------------------------------------------------------
Q4P6X1_USTMA/1030-1417--------------------------------------------------------------------------------
YHFA_SCHPO/4-322--------------------------------------------------------------------------------
A7TPW1_VANPO/6-340--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-339--------------------------------------------------------------------------------
YJ9I_YEAST/7-342--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-444--------------------------------------------------------------------------------
Q5B919_EMENI/28-412--------------------------------------------------------------------------------
A5DWX9_LODEL/10-366--------------------------------------------------------------------------------
Q5PQ45_XENLA/37-407--------------------------------------------------------------------------------
Q6C9F9_YARLI/6-329--------------------------------------------------------------------------------
Q59X25_CANAL/5-343--------------------------------------------------------------------------------
UBE3D_MOUSE/13-364--------------------------------------------------------------------------------
UBE3D_BOVIN/13-385--------------------------------------------------------------------------------
A7USM4_ANOGA/14-434--------------------------------------------------------------------------------
A7SC58_NEMVE/7-362--------------------------------------------------------------------------------
Q5EAZ8_DANRE/20-391--------------------------------------------------------------------------------

PF00632

HACE1_MOUSE/602-909................................................................................
Q7QE66_ANOGA/554-863................................................................................
NEDD4_HUMAN/1013-1318................................................................................
A4IBF5_LEIIN/1897-2310................................................................................
A4IC88_LEIIN/3812-4131................................................................................
Q4WHR7_ASPFU/967-1337................................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4HF82_LEIBR/3619-3949................................................................................
A4IAG7_LEIIN/1051-1369................................................................................
UBE3B_HUMAN/736-1068................................................................................
A3GHK0_PICST/646-950................................................................................
UPL3_ARATH/1518-1888................................................................................
Q0UNY9_PHANO/908-1229................................................................................
Q9BL11_CAEEL/717-1019................................................................................
A0EFC1_PARTE/672-969................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q5KIA2_CRYNJ/1499-1843................................................................................
HUL5_YEAST/607-910................................................................................
Q38D88_TRYB2/1472-1912................................................................................
A0E799_PARTE/3885-4178................................................................................
Q00WM5_OSTTA/458-763................................................................................
A2DUY0_TRIVA/771-1054................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q6NNZ7_DROME/211-561................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A0D2G1_PARTE/170-483................................................................................
K0317_MOUSE/512-823................................................................................
A2FVL0_TRIVA/2315-2604................................................................................
Q8SS57_ENCCU/454-746................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A2F794_TRIVA/2662-2959................................................................................
TOM1_YEAST/2962-3268................................................................................
A7SQ93_NEMVE/299-612................................................................................
A2DAV4_TRIVA/452-719................................................................................
Q6C901_YARLI/697-1001................................................................................
A0DAX5_PARTE/100-320................................................................................
Q6C8U2_YARLI/491-779................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
A2FJ59_TRIVA/1204-1414................................................................................
Q6PDJ9_MOUSE/738-1060................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2FR71_TRIVA/373-670................................................................................
A0DNI8_PARTE/201-510................................................................................
Q5BG86_EMENI/848-1165................................................................................
A5K4K7_PLAVS/1441-1991HTLDRNLSSLSPGPLEEHVPEVNATERYRGATYHLDAPLVQLLLRHNEVDLDPAPNGVLLGEDGEVLRYPLRSGDFDSEE
Q55NG7_CRYNB/3037-3342................................................................................
A2DQ34_TRIVA/412-708................................................................................
A7AV31_BABBO/1338-1643................................................................................
A2E999_TRIVA/2659-2965................................................................................
A2F3T0_TRIVA/1939-2179................................................................................
A2FXS6_TRIVA/392-692................................................................................
Q6NVK6_XENTR/557-856................................................................................
A2DWM0_TRIVA/796-1093................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EEN6_TRIVA/766-1053................................................................................
A4I8L1_LEIIN/3799-4087................................................................................
HUL4_ASHGO/526-839................................................................................
A2DKE7_TRIVA/929-1162................................................................................
Q247X9_TETTS/2115-2420................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
A2DXG0_TRIVA/2382-2669................................................................................
A4RVZ5_OSTLU/490-781................................................................................
UPL7_ARATH/828-1142................................................................................
MUG30_SCHPO/482-807................................................................................
Q6GP47_XENLA/736-1028................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2ECJ9_TRIVA/791-1087................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
Q4UD92_THEAN/251-554................................................................................
A2FK98_TRIVA/1968-2204................................................................................
A3LSX3_PICST/660-977................................................................................
A0DLU6_PARTE/3989-4284................................................................................
Q00Y47_OSTTA/1123-1477................................................................................
SPKUL_DICDI/1577-1887................................................................................
A7SNF7_NEMVE/430-737................................................................................
A7SP65_NEMVE/115-400................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
Q9CYM1_MOUSE/752-912................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A4VDG4_TETTS/2059-2356................................................................................
Q22F29_TETTS/3398-3694................................................................................
A0DLB8_PARTE/2812-3098................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
UBR5_MOUSE/2479-2792................................................................................
Q54GG5_DICDI/425-720................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
A7SML1_NEMVE/1229-1585................................................................................
A2FIB4_TRIVA/386-683................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A2D760_TRIVA/795-1094................................................................................
Q01B14_OSTTA/546-834................................................................................
A0DH95_PARTE/2-219................................................................................
O17736_CAEEL/692-1001................................................................................
A8BIP6_GIAIC/2319-2632................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2F5A6_TRIVA/682-951................................................................................
Q580A5_TRYB2/986-1286................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
A5D6V3_DANRE/704-994................................................................................
A2F3N1_TRIVA/2072-2351................................................................................
Q9W196_DROME/819-1122................................................................................
Q381G0_TRYB2/3834-4128................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A2EM50_TRIVA/2501-2807................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
Q54QF1_DICDI/778-1120................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q580G4_TRYB2/3999-4304................................................................................
A8BLR8_GIAIC/875-1158................................................................................
A2E5X8_TRIVA/301-578................................................................................
Q4PHJ7_USTMA/908-1208................................................................................
A7RSK9_NEMVE/1024-1329................................................................................
Q2GVQ3_CHAGB/742-1078................................................................................
A0D383_PARTE/180-477................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
Q019K0_OSTTA/1236-1531................................................................................
A2DBI7_TRIVA/375-665................................................................................
A2G1R0_TRIVA/764-1050................................................................................
A4VD17_TETTS/793-1095................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q00WR0_OSTTA/203-456................................................................................
A2FG81_TRIVA/782-1072................................................................................

PF09814

A4D9F3_ASPFU/21-420--------------------------------------------------------TFL..VSEADCGGLKKVQQPTPEE
UBE3D_HUMAN/13-385--------------------------------------------------------FFLVNLRTSLWQQRPELSPVEMCC
A5DDI0_PICGU/5-350--------------------------------------------------------YFL..VDKAGGLKVEADQ......
Q6BMI9_DEBHA/5-363--------------------------------------------------------YFL..INKSKQLEISDQD......
Q0TZD4_PHANO/225-279--------------------------------------------------------........................
Q29GF2_DROPS/8-386--------------------------------------------------------NVI..IRMVNLAKIVRRGE.....
Q6CWI5_KLULA/6-349--------------------------------------------------------FIY..INKDWIPEKFIYDE.....
A1CJR3_ASPCL/19-424--------------------------------------------------------SFL..VAEEDCRGVKKVQTLASGE
Q9VWP0_DROME/9-390--------------------------------------------------------YVV..INFNEESSCMLNRD.....
UBE3D_PONAB/13-385--------------------------------------------------------FFLVNLRTSLWQQRPELSPVEMCC
Q6FK88_CANGA/6-347--------------------------------------------------------YFQ..TIGSTIDRKVVVQT.....
Q7SDG7_NEUCR/13-382--------------------------------------------------------TLL..FVEQDCSNITLGFY.....
Q4P6X1_USTMA/1030-1417--------------------------------------------------------YLL..VGRDMLNFDAVAFEKNL..
YHFA_SCHPO/4-322--------------------------------------------------------YVL..IRLQSLEGKVAYGP.....
A7TPW1_VANPO/6-340--------------------------------------------------------VLC..CSQLTLDSSRITIA.....
Q75DV5_ASHGO/6-339--------------------------------------------------------FVT..VGEGLLSEKLAMSG.....
YJ9I_YEAST/7-342--------------------------------------------------------YFQ..GTPATFENVATTKE.....
Q16XY0_AEDAE/12-444--------------------------------------------------------YAL..LDRKHLERVHLRAE.....
Q5B919_EMENI/28-412--------------------------------------------------------TFL..VAAIECVE...........
A5DWX9_LODEL/10-366--------------------------------------------------------YLL..QLHNEYLEISKLDP.....
Q5PQ45_XENLA/37-407--------------------------------------------------------FLL..LNTANISDPIVENNEKSSV
Q6C9F9_YARLI/6-329--------------------------------------------------------YIM..VNKEDMRLEHNAVG.....
Q59X25_CANAL/5-343--------------------------------------------------------YLL...EKSNRNIVKIQDS.....
UBE3D_MOUSE/13-364--------------------------------------------------------FFLVNLKSDLEQ.......EP...
UBE3D_BOVIN/13-385--------------------------------------------------------FYLVNLKSDLWQPRPEGAPVETHH
A7USM4_ANOGA/14-434--------------------------------------------------------YAL..LHRNVLQRVHVRND.....
A7SC58_NEMVE/7-362--------------------------------------------------------YIV..VHPSSLEEKNIIIKQ....
Q5EAZ8_DANRE/20-391--------------------------------------------------------FIL..LLRDDGCDESLTRAAA...

PF00632

HACE1_MOUSE/602-909........................................EE..............VPL..K.PG..G...GSIL-----
Q7QE66_ANOGA/554-863........................................ID..............IEL..K.PN..G...RNIT-----
NEDD4_HUMAN/1013-1318........................................HQ..............HEL..K.NG..G...SEIV-----
A4IBF5_LEIIN/1897-2310........................................................VEL..C.PD..G...AQIP-----
A4IC88_LEIIN/3812-4131........................................ST..............KEL..I.EG..G...AQTR-----
Q4WHR7_ASPFU/967-1337........QHADPADLSPPCSMSADHVDFLECGSSHRSKSER..............LDY..CVPT..PPVEEASL-----
A4HPV4_LEIBR/2168-2551........................................EV..............LPL..I.PG..G...ANRR-----
A4HF82_LEIBR/3619-3949........................................LV..............LEE..L.EE......MAAS-----
A4IAG7_LEIIN/1051-1369.......................................................................GTLL-----
UBE3B_HUMAN/736-1068......................................HE..................L..I.PG..G...KTIP-----
A3GHK0_PICST/646-950........................................YS..............AEL..I.KD..G...RKIF-----
UPL3_ARATH/1518-1888.........................................................EY..I.LR..S...GDEI-----
Q0UNY9_PHANO/908-1229........................................PYTQ.........PGSPPLTST.PK......EPKM-----
Q9BL11_CAEEL/717-1019........................................HT..............TEL..L.SG..G...TEKP-----
A0EFC1_PARTE/672-969........................................YF..............DDL..K.PN..G...FQIN-----
Q2GSX9_CHAGB/694-1033........................................TT..............RDL..V.PN..G...ENVV-----
Q5KIA2_CRYNJ/1499-1843.........................................................EL..K.PG..G...AHIE-----
HUL5_YEAST/607-910........................................KV..............VDL..I.PN..G...SKTY-----
Q38D88_TRYB2/1472-1912..........................................................FEMIDKG......QSTC-----
A0E799_PARTE/3885-4178..........................................................TIDLIPN..G...SVMP-----
Q00WM5_OSTTA/458-763........................................QV..............YDL..V.EN..G...RHIT-----
A2DUY0_TRIVA/771-1054.........................................................KL.....N..E...KYEI-----
Q6BGB8_PARTE/609-908........................................VE..............FDL..I.PN..G...RQIN-----
A2FLN6_TRIVA/2545-2849........................................SIV............ELIP....GG......SLVP-----
Q7PSQ3_ANOGA/541-897........................................KV..............HEL..K.PN..G...ASIA-----
Q6NNZ7_DROME/211-561.........................................................EL..C.RG..G...RDTP-----
A4IBT8_LEIIN/1017-1343..........................................................LKTQ.TD..GRYTTDSP-----
A0D2G1_PARTE/170-483..........................................................TINLKEN..G...CEIK-----
K0317_MOUSE/512-823........................................DK.............IVEL..M.TG..G...AQTP-----
A2FVL0_TRIVA/2315-2604........................................EV.............HTI.............KPDQ-----
Q8SS57_ENCCU/454-746.............................................................LVKN..G...EDIK-----
Q4E2E5_TRYCC/2646-2975........................................TRS............TADMASIFPT..DGHEESVT-----
A2F794_TRIVA/2662-2959........................................QVK............ELIP....YG......SSVK-----
TOM1_YEAST/2962-3268........................................KV..............INL..I.EG..G...KDII-----
A7SQ93_NEMVE/299-612........................................VT..............HNL..K.PK..G...DTIP-----
A2DAV4_TRIVA/452-719........................................DLA............TFNL............GDGD-----
Q6C901_YARLI/697-1001........................................KS..............CDL..I.SN..G...SHVS-----
A0DAX5_PARTE/100-320.......................................................................QTTN-----
Q6C8U2_YARLI/491-779...............................................................LN......DGSP-----
Q9W0H2_DROME/761-1058........................................ET..............KCL..K.PN..G...NEIA-----
A0BRN4_PARTE/3724-4023..........................................................LIQLIPD..G...QNVT-----
A2FJ59_TRIVA/1204-1414...........................................................................-----
Q6PDJ9_MOUSE/738-1060........................................EEV............ELCS....RG......RHIP-----
A4S7N1_OSTLU/131-443........................................VT..............REL..V.AG..G...RDVE-----
A2FR71_TRIVA/373-670........................................IV..............VEF..I.PG..G...SQKD-----
A0DNI8_PARTE/201-510.........................................................EL..K.KG..G...QTIQ-----
Q5BG86_EMENI/848-1165........................................VS..............VPL..C.PG..G...EKKP-----
A5K4K7_PLAVS/1441-1991GPEAARGGDPPEGGRGSLAVASIDHPDAANRDNIAAANRDNLAGASA....EDLECIDL..I.EN..G...RNIP-----
Q55NG7_CRYNB/3037-3342........................................KT..............VEL..K.EN..G...ANIP-----
A2DQ34_TRIVA/412-708........................................IE..............IPL..V.QN..G...SNID-----
A7AV31_BABBO/1338-1643........................................N...............IPL..V.PG..G...ESMK-----
A2E999_TRIVA/2659-2965........................................NEM............PLIQ....RG......RTEF-----
A2F3T0_TRIVA/1939-2179...........................................................................-----
A2FXS6_TRIVA/392-692........................................ET..............VDF..I.KN..G...STID-----
Q6NVK6_XENTR/557-856........................................LM..............HDL..K.EN..G...DKIP-----
A2DWM0_TRIVA/796-1093.........................................................EL..V.PG..G...SDKE-----
A2DYB1_TRIVA/1674-1977........................................KA..............ANL..K.PD..G...AKIA-----
A2EEN6_TRIVA/766-1053........................................N...............VEL..V.PK..G...SQIP-----
A4I8L1_LEIIN/3799-4087.........................................................ELIPGFAE..SVEWLDSD-----
HUL4_ASHGO/526-839........................................Y...............RQL..C.PD..G...STQA-----
A2DKE7_TRIVA/929-1162...........................................................................-----
Q247X9_TETTS/2115-2420..........................................................VIELKND..G...QNIE-----
A5K5J0_PLAVS/8258-8564........................................KV..............IDL..I.PN..G...RNIP-----
A2DXG0_TRIVA/2382-2669........................................NKI............DLIPFCDQNS..........-----
A4RVZ5_OSTLU/490-781.......................................................................EETD-----
UPL7_ARATH/828-1142........................................SI..............IEL..K.PG..G...KDTS-----
MUG30_SCHPO/482-807........................................RT..............VEL..K.EG..G...SELS-----
Q6GP47_XENLA/736-1028........................................S...............TDL..I.PN..G...GSVQ-----
A3FPU7_CRYPI/497-797........................................AE..............VPI..A.PGEFD...PSEP-----
Q38A01_TRYB2/1526-1868........................................I...............VEL..C.PN..G...ATTQ-----
A1CTM1_ASPCL/1468-1817.........................................................EL..I.DN..G...SNIP-----
A2ECJ9_TRIVA/791-1087.........................................................PI..C.PN..G...QMIE-----
Q7PSA4_ANOGA/2506-2929.........................................................DL..L.PN..G...ANID-----
Q4UD92_THEAN/251-554........................................IQ..............ENL..I.PN..G...HNTR-----
A2FK98_TRIVA/1968-2204...........................................................................-----
A3LSX3_PICST/660-977........................................YV..............FDL..LPPN..G...ENTK-----
A0DLU6_PARTE/3989-4284..........................................................IINLIPN..G...YKIQ-----
Q00Y47_OSTTA/1123-1477.........................................................DL..I.KG..G...SDIV-----
SPKUL_DICDI/1577-1887.........................................................GL..I.EG..G...ESIP-----
A7SNF7_NEMVE/430-737........................................VT..............IDL....SE..N...PDEE-----
A7SP65_NEMVE/115-400........................................EI..............RDL..I.PN..G...RNIP-----
A2ERB6_TRIVA/1571-1861........................................T...............IKL..I.EN..G...ENVD-----
Q4Q7L2_LEIMA/1091-1400........................................RE..............VEL..V.PD..G...AQMH-----
Q9CYM1_MOUSE/752-912........................................EQ..............KKL..I.PG..G...DRVA-----
Q54KP2_DICDI/1482-1898.........................................................EL..K.PN..G...EQIN-----
A4VDG4_TETTS/2059-2356.........................................................EIELK.KN..G...RNMQ-----
Q22F29_TETTS/3398-3694..........................................................LDLI.PN..G...RNIE-----
A0DLB8_PARTE/2812-3098.........................................................EL..C.EN..G...KTKK-----
A5DS31_LODEL/333-694.........................................................EL..I.PN..G...REVQ-----
A2DQ30_TRIVA/383-682........................................KS..............IEL..K.KG..G...SDIA-----
UBR5_MOUSE/2479-2792........................................KEE............GGGQVELIPN..G...VNIP-----
Q54GG5_DICDI/425-720........................................KV..............HNL..K.QG..G...DDIQ-----
Q5CW92_CRYPI/1231-1561........................................KHL............EIDL..I.PN..G...RNIP-----
A2E5Q8_TRIVA/658-966........................................QDH............SLNQ....NG......TSCK-----
A0BRI8_PARTE/1050-1354........................................ED..............LEL..K.QG..G...GDIL-----
A7SML1_NEMVE/1229-1585.........................................................EL..K.KN..G...RNIP-----
A2FIB4_TRIVA/386-683........................................ME..............TPL..V.PD..G...DKIP-----
A2DAL9_TRIVA/1571-1869........................................PG..............IEL..C.EG..G...RDKM-----
A2D760_TRIVA/795-1094.........................................................EL..K.KG..G...KDIE-----
Q01B14_OSTTA/546-834.......................................................................TQVE-----
A0DH95_PARTE/2-219..........................................................ISYIFKN..G...SKIP-----
O17736_CAEEL/692-1001........................................RN..............VNL..K.PN..G...SKFR-----
A8BIP6_GIAIC/2319-2632........................................DCV............GLDITDVPFD..DAIDTEHS-----
A2FPQ0_TRIVA/408-705........................................VT..............EDL..I.TD..G...RNIP-----
A2F5A6_TRIVA/682-951...............................................................FD..G...EDIE-----
Q580A5_TRYB2/986-1286........................................ELE............QMGLEDEETG......EALT-----
A2F7U9_TRIVA/2273-2579........................................QQA............MLPG....HS......ADST-----
A5D6V3_DANRE/704-994........................................G...............QEL..V.PN..G...SQIQ-----
A2F3N1_TRIVA/2072-2351........................................DLY............GNQMEII.PN..G...KQIK-----
Q9W196_DROME/819-1122........................................QI..............VEL..K.PQ..G...QSIP-----
Q381G0_TRYB2/3834-4128.........................................................EIIPNFSKGLSAAFSNAT-----
A2EDQ8_TRIVA/2183-2490........................................TKV............SLPG....HD......KGDI-----
A2EM50_TRIVA/2501-2807........................................EEV............SVFS....FS.......SKS-----
A2EQW9_TRIVA/2209-2511........................................STN............WLKS............KDQI-----
Q54QF1_DICDI/778-1120........................................NKIENNNNNNNSEFKIQIMKTINLKPFG...NLIR-----
Q8SR14_ENCCU/2104-2410........................................RT..............VEL..V.EG..G...AHVF-----
A2DAJ9_TRIVA/133-438........................................EIV............NLPS....QH......HTDY-----
Q580G4_TRYB2/3999-4304........................................EE..............VEL..I.PN..G...SQVA-----
A8BLR8_GIAIC/875-1158.............................................................ILTA..PYDIELLP-----
A2E5X8_TRIVA/301-578..............................................................MKSLSGESLKAWE-----
Q4PHJ7_USTMA/908-1208........................................MT..............REL..V.PG..G...ANIP-----
A7RSK9_NEMVE/1024-1329.........................................................RFVPMVPS..G...HNIH-----
Q2GVQ3_CHAGB/742-1078........................................KEW...........FLLLVREVFNPDHGDAPPNLS-----
A0D383_PARTE/180-477..........................................................IIELKQN..G...ADIL-----
A2E4I7_TRIVA/2634-2943........................................QER............PLSE....YG......RTRP-----
Q019K0_OSTTA/1236-1531.........................................................EL..V.PG..G...RDIA-----
A2DBI7_TRIVA/375-665........................................E...............VEL..K.EG..G...SNIV-----
A2G1R0_TRIVA/764-1050..........................................................LPLKLTD......KHEE-----
A4VD17_TETTS/793-1095........................................QK.............EISL..V.PN..G...KNIP-----
A8BYQ3_GIAIC/636-950........................................ED..............VPL..I.EG..G...QEIY-----
PUB2_SCHPO/367-671........................................VT..............VDL..I.PN..G...RNIA-----
Q00WR0_OSTTA/203-456........................................EET............EIEL.I..PN..G...SNVL-----
A2FG81_TRIVA/782-1072.........................................................KM..V.DA..G...ESIE-----

PF09814

A4D9F3_ASPFU/21-420........SAQKKEISLNC--ANCNASIGI........EDAVAQGWRLFKT--------SLSASI.....-.........
UBE3D_HUMAN/13-385VSSDNHCKLEPKANTKVIC--KRCKVMLGE.........TVSSETTKFYMT--------EIIIQSSE...-........R
A5DDI0_PICGU/5-350................VYC--PSCDAELG..........VLDKSSKKVFKY--------NLKL.......-.........
Q6BMI9_DEBHA/5-363................VKC--GLCKYNLG..........ILDNSTLKLFKW--------NLAL.......-.........
Q0TZD4_PHANO/225-279...................--..............................--------...........-.........
Q29GF2_DROPS/8-386...............HLHC--QRCMRFLGM........AIFNGEAARLWAD--------TVRWLPSAQ..-......KSD
Q6CWI5_KLULA/6-349..............ELVRS--RSCNTVIGS.........FTKEGSVRIGKW--------NLRA.......-.........
A1CJR3_ASPCL/19-424.........TPKDSSSLAC--DTCDSLLGT........EDPVAQGWRLFKT--------SLSATIAN...-.......PS
Q9VWP0_DROME/9-390..............DHLYC--QRCMRYLGL........TMFDGAAARIWAD--------AVRWRPAG...-........A
UBE3D_PONAB/13-385VSSDNHCKLEPKANTKVIC--KRCKVMLGE.........TVSSETTKFYMT--------EIIIQSSE...-........R
Q6FK88_CANGA/6-347.............DGSVDC--SNCRSTLGY.........KEGSEILVLEKQ--------NLQLQD.....-.........
Q7SDG7_NEUCR/13-382...................--..................NFRTAAVTLLKW--------QIS........-.........
Q4P6X1_USTMA/1030-1417...........DDYKVLCC--TKCRSQLGETSTL.TGTGADEPNTVRLNKY--------MLERYPR....-.........
YHFA_SCHPO/4-322.............NFKLHC--SFCNAELGLP......NNKDSSNGVRLDKS--------SICI.......-.........
A7TPW1_VANPO/6-340.............EGSVVC--VSCDSLLGV.........VENDGLLKLNKW--------CLLL.......-.........
Q75DV5_ASHGO/6-339..............TAVLC--KACRAPLGA.........VTREKLLRLHKW--------NLVQV......-.........
YJ9I_YEAST/7-342.............NDNVLC--IKCSAVLGQ.........VTAGSLYKLHKW--------KLQL.......-.........
Q16XY0_AEDAE/12-444..............RFLYC--KRCLQFLGT.........MKRNGSAKLWYE--------NVRFKSVGED.-......QSD
Q5B919_EMENI/28-412...................--..................DTIARGWRLFKA--------SLAAEGR....-.........
A5DWX9_LODEL/10-366..............SVYIC--RNCGNEIG..........EKYQNIVRLLKW--------HISLQRLE...-.......LL
Q5PQ45_XENLA/37-407PRLADANALKSKENTKVIC--KRCKAMLGE.........KVSSDAIKYYIT--------EIMIHPSS...-........Q
Q6C9F9_YARLI/6-329...................--..................KEEGDSFKIPKW--------NLQFN......-.........
Q59X25_CANAL/5-343................ITC--NKCGQLLG..........EMFQGTLKIFKW--------CVELQFE....-........S
UBE3D_MOUSE/13-364...........KANTKVIC--KRCKVTLGE.........TMSSETTKFYMT--------EVIIRPSE...-........G
UBE3D_BOVIN/13-385LSSENHLKLKPKANTKVIC--KRCKVMLGE.........TVSSETTKFYMT--------EIIILPSE...-........R
A7USM4_ANOGA/14-434..............RFVYC--KRCLQYLGS........TRKNRTSVKLWYE--------NVRFQPS....-.........
A7SC58_NEMVE/7-362............GETTIDC--GRCRKSLGKLIIQQQYPGRADVSGIQLNKH--------CIIS.......-.........
Q5EAZ8_DANRE/20-391...........EKRVLVSC--RRCSTALGE.........EITAEVLKLYIT--------EISVKPSEDGE-CDLTQLSLE

PF00632

HACE1_MOUSE/602-909----------------VTQ..NNKAEYVQLV....TEL.RMTRAIQPQINA........FLQGFH..MFI.P......PS
Q7QE66_ANOGA/554-863----------------VSE..RNKRDYLDRI....IKW.RLERGVLEQTEW........LVRGFN..EVV.D......HR
NEDD4_HUMAN/1013-1318----------------VTN..KNKKEYIYLV....IQW.RFVNRIQKQMAA........FKEGFF..ELI.P......QD
A4IBF5_LEIIN/1897-2310----------------VTK..KNLRLYQRRV....VGA.LLYESVAVPLYF........LTMGCR..DVV.P......HE
A4IC88_LEIIN/3812-4131----------------VTL..ARSSEYAEAL....LQA.RLHE.FDLQLHK........MREGLL..SVV.P......EV
Q4WHR7_ASPFU/967-1337----------------VTN..DNRAQFVKDY....IFW.LTDKSIRPQFEA........FARGFY..TCL.D......RA
A4HPV4_LEIBR/2168-2551----------------VTV..DNVQEYTRCL....RTY.YLHTVLDLALLH........LRQGLQ..HTV.N......PL
A4HF82_LEIBR/3619-3949----------------VEA..AEVDRRRALA....QEA.LLHQ.YDPAFLA........IRAGLT..SVV.P......AT
A4IAG7_LEIIN/1051-1369----------------RTH..ADLEQHLQLT....VVT.RFEV.ALENLRH........FQWGLL..SVM.E......VE
UBE3B_HUMAN/736-1068----------------VTN..ENKISYIHLM....AHF.RMHTQIKNQTAA........LISGFR..SII.K......PE
A3GHK0_PICST/646-950----------------VTA..ETRKSYIEKY....TQF.FLQEGIKKQITA........FSSGFK..NVI.G......GN
UPL3_ARATH/1518-1888----------------VDI..TNLEEYISLV....VDA.TVKRGVTRQIEA........FRSGFN..QVF.D......IT
Q0UNY9_PHANO/908-1229----------------VTN..KNRAQFIWDY....LNH.LTYLSVQPQLHA........FKQGFY..ACL.N......TK
Q9BL11_CAEEL/717-1019----------------VTN..ANRDEYVRLY....V.....HHRLELGYNGEIAQQALLFRKGFS..ESL.H......SR
A0EFC1_PARTE/672-969----------------VTK..DNREEYIELY....TDW.YLNKLVKHQFDL........LYSGFK..SVV.D......GD
Q2GSX9_CHAGB/694-1033----------------VTN..ENRLLYISYV....ARH.RLIIQPYAQTRA........FLRGLG..MII.D......PS
Q5KIA2_CRYNJ/1499-1843----------------VDD..SNLGEYLEKV....LDW.TLGSGVAEQVKA........FQDGFS..SIF.P......IK
HUL5_YEAST/607-910----------------VTK..DNVLLYVTKV....TDY.KLNKRCFKPVSA........FHGGLS..VII.A......PH
Q38D88_TRYB2/1472-1912----------------VNS..TNVSAYIRRA....ASA.LLYESVVMPIRF........ITYGFR..DVV.P......CE
A0E799_PARTE/3885-4178----------------VTS..NNVHQYLDKT....AEY.IIYKQFQEIYKS........FIEGFR..TVI..........
Q00WM5_OSTTA/458-763----------------VTD..ENKFEYVNLV....TAY.RMTNAVKDQLAA........FVKGFE..EVV.P......RE
A2DUY0_TRIVA/771-1054----------------ITS..ENIDDYVNDV....KSH.ILSQNVLDSVQK........FKEGFC..KVF.D......IQ
Q6BGB8_PARTE/609-908----------------VTN..ENKISYINLY....CHF.RLNKQIKEQSQI........FRAGLE..QVI.D......PE
A2FLN6_TRIVA/2545-2849----------------VTF..DRRLEFLAKI....KKF.RVKE.FNESLEQ........LRRGFN..FFF.P......AP
Q7PSQ3_ANOGA/541-897----------------VTE..DNKREYVKLY....VNY.RFMRGIEQQFLA........LSKGFG..ELI.L......SH
Q6NNZ7_DROME/211-561----------------VTV..HNLHQYISLV....TYW.FLIEGVQKQFEA........LREGFD..SVF.P......IQ
A4IBT8_LEIIN/1017-1343----------------LTP..ESVSDYINLR....EKF.DLVERRRTALEA........MRKGFYCEPSL........EH
A0D2G1_PARTE/170-483----------------VTN..SNAQEYINLN....IFY.YTSQFLEPYLSD........FLTGFY..QVI.P......KT
K0317_MOUSE/512-823----------------VTN..ANKIFYLNLL....AQY.RLASQVKEEVEH........FLKGLN..ELV.P......EN
A2FVL0_TRIVA/2315-2604----------------VDF..SEKDYFIEEI....KK..IRINELKNSLEL........IRRGFY..IVS.P......VP
Q8SS57_ENCCU/454-746----------------LTS..ENMRLFIEKY....VEF.HTDALIKPQFES........IKRGFY..SII.D......KD
Q4E2E5_TRYCC/2646-2975----------------VAQRRKEAER.............ALLHQYDELLLA........MLSGIT..FVL.P......AS
A2F794_TRIVA/2662-2959----------------VTM..ENVQKYVKLC....KEY.RIKE.LLPHLTS........LRRGIL..HFL.P......TD
TOM1_YEAST/2962-3268----------------VTE..ANKQDYVKKV....VEY.KLQTSVKEQMDN........FLVGFY..ALI.S......KD
A7SQ93_NEMVE/299-612----------------VTN..TNRQEYVQLY....VDY.LLNSSIYKQFEA........FYHGFH..SVC.A......SN
A2DAV4_TRIVA/452-719----------------ITE..ENCQYVLEQF........KVENYFKYVLED........FIQGFG..TVM.A......PS
Q6C901_YARLI/697-1001----------------VTT..RNRRDYVSRL....VKF.FLETSISTTFAE........YKKGFH..SVV.G......GN
A0DAX5_PARTE/100-320----------------VSI..KHKRLICEYI....SKK.IMLEEINTQLQA........LREGFF..DIL.P......KE
Q6C8U2_YARLI/491-779----------------VST.LEDVNKYISEY....INSPYTSVRLDNIMNM........VAFGFQ..MVY.P......AE
Q9W0H2_DROME/761-1058----------------VTL..ENRQEFVDLY....VDF.VFNKSVELHYNA........FHKGFM..KVC.S......GR
A0BRN4_PARTE/3724-4023----------------VNK..ENCSVYLDKV....AEY.VIQTQYQDIYTP........FISGFQ..SVL.E......IK
A2FJ59_TRIVA/1204-1414----------------.....ESSNNY...................NPYSV........VKEGFQ..EIIPE......YR
Q6PDJ9_MOUSE/738-1060----------------VAW..ENKDIYAAAI....RSLRLRELQNMECVTA........VRAGLG..SII.P......LQ
A4S7N1_OSTLU/131-443----------------VTA..ANKLFYVFSL....ADY.HLNRRIATPMLA........FMRGLT..KII.N......QR
A2FR71_TRIVA/373-670----------------VTN..ENLEEYIQMS....IDF.YLNKHIANEFSA........FQRGFK..KLE.S......LH
A0DNI8_PARTE/201-510----------------LDM..DNCQEYVNLC....IDY.YTNISVKPFLTA........FLSTLY..SII.P......KQ
Q5BG86_EMENI/848-1165----------------VTN..ANRREFVDLF....VHY.HLDTAVARQFEP........FRRGFF..SVC.G......GN
A5K4K7_PLAVS/1441-1991----------------VDD..SNKKLYIKLY....INY.KFKKMVQKKTQA........FLKGLS..ELI.P......TK
Q55NG7_CRYNB/3037-3342----------------VTE..GNKEEYVRLV....VSY.RLDNSIRDQIKS........FLEGFY..DII.P......QE
A2DQ34_TRIVA/412-708----------------VTN..DNLDAFIASY....INW.WANISIAKQYEA........FLSGFM..KIS.I......SK
A7AV31_BABBO/1338-1643----------------VTS..SNLHEYVRAV....IRM.RLYDGIRLPIWA........FRMGFA..TIV.P......LS
A2E999_TRIVA/2659-2965----------------ITA..SNCAQFISLA....NEF.RINE.LKASLNA........IRDGLW..ENI.G......ID
A2F3T0_TRIVA/1939-2179----------------.....EDKEEYFNKL..............CEKLEI........IRNGFL..KVLPN......TQ
A2FXS6_TRIVA/392-692----------------VTN..ENVEQYVEQY....IKY.KFIKSIQFPMNY........LRKGFS..LVC.K......AG
Q6NVK6_XENTR/557-856----------------ITN..ENRKEFVSLY....TDY.ILNKSVEKQFKA........FRRGFH..MVTNE......SP
A2DWM0_TRIVA/796-1093----------------VNA..ENVDEYRKLV....EEF.TVRGNVLECALE........FKKGFS..SVV.P......SP
A2DYB1_TRIVA/1674-1977----------------VDN..KNKEEYVNLM....VQY.RLRGQISTQVDS........FLEGFH..SLI.P......QK
A2EEN6_TRIVA/766-1053----------------VTN..ANRQSYVDLI....VDY.VLNKSIDEQFRK........FKEGFF..TIP.T......NL
A4I8L1_LEIIN/3799-4087----------------DND..EVAAQQRRTI....AER.CLVHSMDEQLSA........IRSGLW..KTL.S......RR
HUL4_ASHGO/526-839----------------VTR..ENKHEYFRLW....MDF.YLNRSIAPGFES........FRNGFF..HVI.E......GN
A2DKE7_TRIVA/929-1162----------------.....CDDESYFNSL..............KNIVNA........MRKGFW..KVI.P......LD
Q247X9_TETTS/2115-2420----------------VND..QNKKEYIQLY....CKA.KMQDEIALQTQY........FQKGLF..SII.P......ED
A5K5J0_PLAVS/8258-8564----------------VTD..ENKHKYIELL....CEM.KVTNSIKEQLEA........FMDGFK..ELI.Q......PK
A2DXG0_TRIVA/2382-2669----------------.....VDSELYNQLA....MEY.RRNE.FNFAMKS........FRKGFE..IIM........EK
A4RVZ5_OSTLU/490-781----------------VTK..ANLQAFKRQK....IREMVSSIVDDASVHA........IRTGLL..QIM.R......KS
UPL7_ARATH/828-1142----------------VTN..ENKMQYIHAM....ADY.KLNRQIVPFSNA........FYRGLT..DLI.S......PA
MUG30_SCHPO/482-807----------------VDN..ENRKEYVLRY....VDY.LLNTTVKKQFSA........FFDGFM..KVC.G......GN
Q6GP47_XENLA/736-1028----------------VNN..LNKKEYVSKC....IDY.IFNTSVTESFEE........FKRGFY..KVC.D......KD
A3FPU7_CRYPI/497-797----------------VTI..CNVHRYVELY....LDW.FLNKSIESQFRA........FYNGFQ..SVC.G......GR
Q38A01_TRYB2/1526-1868----------------VSA..MNVNEYVQEV....RRY.YSKTALARPVSH........FIQGLR..YTL.I......PY
A1CTM1_ASPCL/1468-1817----------------VTT..DNVDQYVDRV....VDM.TLGRGVQHQVDA........FRAGFS..QVF.P......YS
A2ECJ9_TRIVA/791-1087----------------INQ..ENVNDYVSKI....RDF.TCGKVMKTKCHS........FIEGFN..QVL.H......WE
Q7PSA4_ANOGA/2506-2929----------------VTI..NNVEEYCNLT....VAF.CLQEGIAKQLAA........FHRGFC..EVF.A......LN
Q4UD92_THEAN/251-554----------------VTK..QNVESFIHQF....SNF.KCNRMIESQCSA........FLQGLS..SII.P......LE
A2FK98_TRIVA/1968-2204----------------.....AVLEEFVD......CDDKIYFNGLKSVLAH........IKKGFN..DVI.A......PE
A3LSX3_PICST/660-977----------------LNS..SNKLSYIHQI....SNF.KLNQSLHIQTKY........FIEGLF..GLI.S......SS
A0DLU6_PARTE/3989-4284----------------VTI..HNTERYLQKL....ADY.LIVGKFQAITQN........IIEGFD..TVL.N......RQ
Q00Y47_OSTTA/1123-1477----------------VNE..VNLREYVDAV....VEA.CVGSGVASYFES........IQAGLE..EVC.P......VA
SPKUL_DICDI/1577-1887----------------VTD..LNKEEFIQRN....IER.VLVGCRQSKLEA........FKSGFM..SIDSL......NA
A7SNF7_NEMVE/430-737----------------LTD..SNKSEYVKLV....SQF.KLQDSIAAEVKE........LAGGLN..EVV.P......QD
A7SP65_NEMVE/115-400----------------VTE..ENKREYVKLV....CQM.KMTGAIRKQIDS........FLEGFY..EII.P......KR
A2ERB6_TRIVA/1571-1861----------------VTN..ENKEKYIELY....INQ.FILRDHEREYKI........IRDGFY..SVI.S......KE
Q4Q7L2_LEIMA/1091-1400----------------VTP..RNCLFYVHLV....ADF.KLNREAAEQTRA........FCAGLH..SVI.D......TN
Q9CYM1_MOUSE/752-912----------------VCK..DNRQ...................AQLRHQA........F....................
Q54KP2_DICDI/1482-1898----------------VTL..DNIEEYLNLI....VKN.FLYDGVIRQITS........FKEGFN..QTF.P......IS
A4VDG4_TETTS/2059-2356----------------VCN..QNKKEYVKSI....CHA.KLIREIYYQAHA........ITSGFK..EIV.C......ED
Q22F29_TETTS/3398-3694----------------VTE..QNKKEYVKQI....AHF.KMTEEIKEQIQS........FLKGFY..EIL.P......QR
A0DLB8_PARTE/2812-3098----------------VDC..SNLEEYLNLS....AQY.ILQRQYDKVFKQ........LKRGFQ..GQF.D......AK
A5DS31_LODEL/333-694----------------VDH..TNLEAYIHKV....VDA.TLFTGVISQIKA........FMEGFS..KVF.P......IN
A2DQ30_TRIVA/383-682----------------LTN..DNYKEYIQLY....MEY.YMITSIEIPYQY........FERGFK..EVVENNDKMKASE
UBR5_MOUSE/2479-2792----------------VTP..QNVYEYVRKY....AEH.RMLVVAEQPLHA........MRKGLL..DVL.P......KN
Q54GG5_DICDI/425-720----------------VTN..ENRNEYLDLY....KDY.LLNKSISKQFAP........FFKGFR..MVC.D......SP
Q5CW92_CRYPI/1231-1561----------------VNN..ENKIVYIKLL....THY.KLITSIKLQAEA........FLRGLS..TVI.P......NE
A2E5Q8_TRIVA/658-966----------------VSI..SNANEYIALS....NEF.RIKE.LQKYLNW........VRIGFL..KNI.K......EG
A0BRI8_PARTE/1050-1354----------------VTQ..QNKKEFIKMY....CDQ.IMAKNVENQMKA........FLEGFY..SVI.P......RQ
A7SML1_NEMVE/1229-1585----------------VTI..HNLEKYIKLV....VHW.TLVEGVERQMQA........FQEGFD..SVF.P......LT
A2FIB4_TRIVA/386-683----------------VTN..DNFEQFVVMY....LDW.HTSESFRSKFES........LAEGFR..AVI.T......PE
A2DAL9_TRIVA/1571-1869----------------LTR..ENADEYVELL....TQY.YLYKETDKQIDA........LKKGFQ..FVL.K......PS
A2D760_TRIVA/795-1094----------------VTA..ENVDEYVSLV....KEF.TISGKIKDVMRA........FKDGFS..QII.P......YD
Q01B14_OSTTA/546-834----------------VTS..KNKREFIQVR....LQEIVSSIVDDTSAKC........IKRGLL..NLIEK......ES
A0DH95_PARTE/2-219----------------VKY..EERLEYINKL....IEVKCTESELQCES..........LIKGLI..KII.P......SP
O17736_CAEEL/692-1001----------------VTV..ENVHEYVRLY....VNY.HLKQRIASMVDA........VRKGIS..EII.S......IE
A8BIP6_GIAIC/2319-2632----------------TIKYSGDTMDHVNMM....VA..EITNRRSVPINV........VAKLVQ..RSL.P......SV
A2FPQ0_TRIVA/408-705----------------VTS..ENFDNYVKLY....VDW.YLNKSVDKMFDA........FKKGFD..KLC.H......RP
A2F5A6_TRIVA/682-951----------------VNE..ENVDEFIE......IGR.NMSSAASDAMKE........FRRGFR..TVI.P......AE
Q580A5_TRYB2/986-1286----------------V....STAKFYVEKC....VER.RLTNAVSNL.HW........FARGLA..SVV.D......LD
A2F7U9_TRIVA/2273-2579----------------VGP..GEVENFIIEC....INF.RINS.IKPTLQL........IRQGFI..DNT.K......ID
A5D6V3_DANRE/704-994----------------VNK..VNRQKYVDLY....VDL.VFNKSVKTQFEQ........FTEGFS..EGC.P......LD
A2F3N1_TRIVA/2072-2351----------------VTL..GNLQIFITTA....QE..KLVEQLNNAIDA........FKEGFY..QVL.P......QN
Q9W196_DROME/819-1122----------------VTN..SNRIEYLQLI....ADY.KLNVQIRRHCNA........FRKGLS..NVL.P......IE
Q381G0_TRYB2/3834-4128----------------MTG..ESQVAHYRRV....AES.CLLHSLDAQLSA........IRTGLW..AVL.P......RR
A2EDQ8_TRIVA/2183-2490----------------LNK..EDVEQYIKEC....VDY.RLNS.ILPLLRE........MKAAFR..RNT.G......FK
A2EM50_TRIVA/2501-2807----------------LNQ..GSAGRFISSA....NSL.RIQK.LLTPLLL........IRNGFW..KAL.D......LA
A2EQW9_TRIVA/2209-2511----------------VGY..NDIKNYLNMC....VGA.RINS.VKANLEN........MKRGFY..DNL.G......FS
Q54QF1_DICDI/778-1120----------------VTD..DNKLEYLELW....VNS.LFYNGVKTQIEE........YREGLF..QMI.P......HS
Q8SR14_ENCCU/2104-2410----------------VDD..SNKAEYVKLA....TQY.RLFNGIELQLSA........LKSGLF..EIL.G......SK
A2DAJ9_TRIVA/133-438----------------VTG..ESVEQFIDEF....VQA.RINE.ISQYLDL........IRSGFA..INI.G......FE
Q580G4_TRYB2/3999-4304----------------VTN..ANKSQYVRLR....CEF.CMTRQIEEQLQE........FLKGFY..AVI.P......RK
A8BLR8_GIAIC/875-1158----------------VNL..RTLPLFIRLK........QIATIYNKKIFE.......FIRSGFL..SMA.K......AR
A2E5X8_TRIVA/301-578----------------ITE..ETEEEKVQSILDEIISQ.RIKE.MNNGFAP........FKDGFL..TVI.P......FK
Q4PHJ7_USTMA/908-1208----------------VTN..LNRMEYIFRI....SHY.RLSTQIQHQCTA........FFNGLA..DIV.N......PR
A7RSK9_NEMVE/1024-1329----------------LTF..SNRSEYVEQA....LKF.RLQ.EFDRQVAA........VREGMG..WIL.P......VP
Q2GVQ3_CHAGB/742-1078----------------LPQTPRRPPPLPPYT....PTTTHTTTHPRPPMTY........TLDDLA..EYR.PHPRARGSA
A0D383_PARTE/180-477----------------VTN..QNKQEFVDLS....IQF.YSEKLISKQLAQ........IQNSLY..KYV.P......QD
A2E4I7_TRIVA/2634-2943----------------VTL..QNVREYISLS....KDF.RIKE.LKSNLDI........IRQGYW..ENL.G......LK
Q019K0_OSTTA/1236-1531----------------VTD..ANRKQFVQTYAWSSMEM.VNGESIETVAQA........ARKGVC..DVI.P......AE
A2DBI7_TRIVA/375-665----------------VDN..DSVEEYIRLY....IDY.VANKSIEKEFEA........FFSGYN..DVC.D......IP
A2G1R0_TRIVA/764-1050----------------VTA..ENVKEYVALV....KN..AAINGIEHIINQ........FRSGFS..RNA.E......LL
A4VD17_TETTS/793-1095----------------VDN..SNILRYIYLV....ADY.KMNKCIENQTKA........FMNGLT..KVI.P......KN
A8BYQ3_GIAIC/636-950----------------VDE..HNVEGYIKAY....ANY.ILNDSVSRQFED........FADGFH..LLV.R......SR
PUB2_SCHPO/367-671----------------VNN..QNKMNYLKAL....TEH.KLVTSTEEQFNA........LKGGLN..ELI.P......DS
Q00WR0_OSTTA/203-456----------------VTN..ANAPRYLNCM....SIF.LLRAQMYRQLAS........MKAGFE..IMM.R......KR
A2FG81_TRIVA/782-1072----------------VNE..QNVDDYVRLV....KDF.TCGNKMREKLQS........FLDGFN..KNL.Q......FN

PF09814

A4D9F3_ASPFU/21-420HDPTTWETHPIETIVAA-----QL---------LELIERQSAR.............RFVIHC..........GR------
UBE3D_HUMAN/13-385SFPIIPRSWFVQSVIAQ-----CL---------VQLSSARSTF.............RFTIQGQ.........DD------
A5DDI0_PICGU/5-350NYDTVSEQFPRYLYVYN-----CV---------LDKINSSACR.............TFVIK...........SD------
Q6BMI9_DEBHA/5-363KYKENIETFPSYIYVYN-----LI---------VDKINLSAIR.............KFNVTSE.........SR------
Q0TZD4_PHANO/225-279.................-----..---------........................FFIT.............------
Q29GF2_DROPS/8-386GLPPAIRHFFQFSTMTE-----LV---------LRLLNSLWPHVLPSI...NLTGSRAVLYASP......TSQQ------
Q6CWI5_KLULA/6-349EIGGFLDVFDPSNYVLY-----QI---------YNELKAHSIR.............LFHLK...........GD------
A1CJR3_ASPCL/19-424TPQPTWHSPPTESIIAA-----QL---------LELIERESTR.............RFVIHS..........GH------
Q9VWP0_DROME/9-390ATNAPDRHFFQNSTLTQ-----LF---------KRLLHSLWPQPLPQL...CLNTSRAVLVTSL......PNRN------
UBE3D_PONAB/13-385SFPIIPRPRFVQSVIAQ-----CL---------VQLSSARSTF.............RFMIQGQ.........DD------
Q6FK88_CANGA/6-347TFKELSEDYPGYLVVLA-----RI---------LSLLKFNSTR.............YFALKT..........GG------
Q7SDG7_NEUCR/13-382CDSVSNLSPGLEECLAA-----TL---------ISTIARSGSSK..........SLLLPITETIATTEEEGVGK------
Q4P6X1_USTMA/1030-1417......RAVTWIETLLS-----SL---------QYSAASHGSR.............RFLLRSG........TQT------
YHFA_SCHPO/4-322....DDQKIHPSFIVAS-----EI---------LTLRDMYATH.............KFVIV...........DG------
A7TPW1_VANPO/6-340...NDIERFPPEQHVIS-----SI---------SSHVINNSVR.............YFILR...........NG------
Q75DV5_ASHGO/6-339RSDGSRKKYRQASAVVA-----GL---------LSALNSHAAR.............VVHLRA..........ER------
YJ9I_YEAST/7-342IRSGNTYKFPPECDITI-----SL---------INVVKANSCR.............YVLVK...........CK------
Q16XY0_AEDAE/12-444ELNPTGQSLFCVDQSLP-----NF---------QYLVRKTVNDFNFISHLGLPPIFKLIFEMRRP....GLDGD------
Q5B919_EMENI/28-412LEEGSLEAHPTELIVAA-----QL---------LELIERQSAR.............RFIIHC..........GK------
A5DWX9_LODEL/10-366GRDVVFLDYNPLLYCIG-----LL---------KNKVNSLAIR.............KFQIEK..........ND------
Q5PQ45_XENLA/37-407GYCMISRMQFLESILVR-----LL---------MEHSNCRSTF.............RFCIQES.........DG------
Q6C9F9_YARLI/6-329CPDGEIIKVDPVQVLLF-----SM---------SELTNSHASH.............QFLLCDETQ....SDDDV------
Q59X25_CANAL/5-343GNAIHKEQYRPGLFIYN-----II---------LDKINFSAVR.............KFKIE...........VE------
UBE3D_MOUSE/13-364SFPNIPRSQFLQSIIAQ-----CL---------VELSSARSTF.............RFTIQGQ.........DG------
UBE3D_BOVIN/13-385NFPIIPRSQFVQSVLAQ-----CV---------VELSSARSTF.............RFTIQGH.........DD------
A7USM4_ANOGA/14-434ERSAIPLSLFRTDDALE-----LF---------HHLVRKTVREFNFVTHLGLPPSIKLLFELRRP....GMQGD------
A7SC58_NEMVE/7-362RNSDVFKNYSFETYITR-----CL---------KSKLQGKVNF.............KFCLQSHH......GGKT------
Q5EAZ8_DANRE/20-391PKSESVRQRFLEQTLAS-----RL---------VELSAAQSIF.............RFSIQSP.........DG------

PF00632

HACE1_MOUSE/602-909LIQ.LFDEYELELLLSG.....MP.E.......IDVNDWIKNT-------------E..YT.SGYE.....RED......
Q7QE66_ANOGA/554-863LVA.VFDASELELVISG.....TV.E.......IDVHDWRANT-------------E..YR.GGYH.....DTH......
NEDD4_HUMAN/1013-1318LIK.IFDENELELLMCG.....LG.D.......VDVNDWREHT-------------K..YK.NGYS.....ANH......
A4IBF5_LEIIN/1897-2310ALT.VMDVKELIGVLCG.....ED.KNP.SDPLWTTEEIRSVL-------------V..GD.HGYR.....NDS......
A4IC88_LEIIN/3812-4131AVL.LLTPEELELRVCG.....QA.D.......YTPEELRKGA-------------S..YE..GLT.....SED......
Q4WHR7_ASPFU/967-1337ALS.IFTPEAFKTVVEG.....IQ.E.......IDLGELERHA-------------R..YE.GGFG.....PHH......
A4HPV4_LEIBR/2168-2551YLQ.LFNVGELGRLLGS.....PL.DV...KVWETREQFARNV-------------E..AA.HGYH.....IKS......
A4HF82_LEIBR/3619-3949SLR.SVRWEDLRARVCG.....TA.P.......ASSEHVIAEL-------------D..MS..........PLS......
A4IAG7_LEIIN/1051-1369ALW.CLSDEERSMLICG.....SD.AKA.DGPLFTEEELRAQT-------------T..MG.SGYS.....SGS......
UBE3B_HUMAN/736-1068WIR.MFSTPELQRLISG.....DN.A......EIDLEDLKKHT-------------V..YY.GGFH.....GSH......
A3GHK0_PICST/646-950GLS.LFLPEEIQLLLCG.....SE.E.....GGIDVDVLKSVT-------------K..YV.GWKTPD.DGADS......
UPL3_ARATH/1518-1888SLQ.IFTPSELDYLLCG.....RR.E......LWEVETLAEHI-------------K..FD.HGYN.....AKS......
Q0UNY9_PHANO/908-1229AIA.LFTPYTLRHLVEG.....EQ.H.......ISIPALRRCA-------------R..YE.DGYS.....ATH......
Q9BL11_CAEEL/717-1019TLR.FFQPCELKEMIVG.....NE.N.......YDWNEFRDIL-------------M..YR.GEYS.....SSH......
A0EFC1_PARTE/672-969GIK.LFSGEELQALIIG.....LP.H.......FDLKDLELVT-------------K..YD..GFD.....DKS......
Q2GSX9_CHAGB/694-1033WLS.MFNQNELQRLVGG.....DS.S......EIDVEDLRKHT-------------A..YS.GVYEIGDDGQEH......
Q5KIA2_CRYNJ/1499-1843SIK.IFSLDELYLLF.G.....NA.DE....DW.SRETLEVAI-------------K..AD.HGYN.....QDS......
HUL5_YEAST/607-910WME.MFNSIELQMLISG.....ER.D......NIDLDDLKSNT-------------E..YG.GYKE......ED......
Q38D88_TRYB2/1472-1912ALA.ALDASEAMSLLCGNRIRDSEPL.......WTAAEIKSII-------------...VPDHGYN.....SES......
A0E799_PARTE/3885-4178.FQKWLKPFEISLLTQG.....LL.E.......IKPDVVLQKI-------------Q..YS.GGKA..............
Q00WM5_OSTTA/458-763TIS.LFNAAELELMISG.....TP.D.......IDVEDLYANT-------------E..YT.G.FN.....VGS......
A2DUY0_TRIVA/771-1054IMKNLFSAEEFSDILCG.....EE.T.....QQITTDKLNQYC-------------I..VE.LGYS.....KES......
Q6BGB8_PARTE/609-908KFK.LFTNQELQLLISG......Q.P......VIDIQDLISNT-------------K..YQ.GYQP......YD......
A2FLN6_TRIVA/2545-2849AAS.ILAPWELELIICG.....DN.E.......CPIEDMKRNC-------------S..FP..........AND......
Q7PSQ3_ANOGA/541-897LLR.PFDERELELLISG.....IS.K.......IDVNDWKANT-------------R..LK.Q.CT.....ADT......
Q6NNZ7_DROME/211-561RLR.MFYPEELECVFCG.....SG.SEQQHSRW.EIKMLQESC-------------R..TD.HGFH.....QDS......
A4IBT8_LEIIN/1017-1343HLK.LLSPSDLLLLLCG.....QL.H.......VSAQVIVDAL-------------E..FQ..GFG.....RNS......
A0D2G1_PARTE/170-483LLR.IFKPQELEMILFG.....LP.F.......IDLQDWSKYT-------------I..YK..DCS.....AED......
K0317_MOUSE/512-823LLA.IFDENELELLMCG.....TG.D.......INVSDFKAHA-------------V.VVG.GSWH.....FRE......
A2FVL0_TRIVA/2315-2604CNE.FLTPKYLEQLCRG.....KT.E.......ITSEDIKMIL-------------V..............SKN......
Q8SS57_ENCCU/454-746KLA.YLDPKELEKIMMG.....SN.T.......FDIKAIRSTT-------------T..YS..GFR.....EDS......
Q4E2E5_TRYCC/2646-2975SLQ.LIRWDDLQQRVCG.....NS.C.......ATAEDVISSL-------------D..LSL.........LSE......
A2F794_TRIVA/2662-2959AVT.LLSSWELELFVSG.....DT.N.......VSVDELKKCC-------------K..YD..........AMD......
TOM1_YEAST/2962-3268LIT.IFDEQELELLISG.....LP.D.......IDVDDWKNNT-------------T..YV.N.YT.....ATC......
A7SQ93_NEMVE/299-612ALI.MLRPEEVEMLVCG.....NP.E.......LDMEALKKVT-------------V..YD..GYS.....KND......
A2DAV4_TRIVA/452-719ALK.LFSSEELKQIICG.....NN.K.....YNYTIEDLRESI-------------D..CSQGVTP..............
Q6C901_YARLI/697-1001ALS.LFRPEELEALVKG.....SS.E......PLDIGTLKTVT-------------R..YQ.NFTTE..DPESE......
A0DAX5_PARTE/100-320FFS.YMDWRDLQKLIIG.....VP.S.......VDVDDLQENT-------------E..YI..SDE.....KTN......
Q6C8U2_YARLI/491-779LAR.KMPTKDLKRLVEG........SILADDSHIDVEPLLEQF-------------A..YE.GGYS.....ESS......
Q9W0H2_DROME/761-1058VIH.IFQPEELMAVVVG.....NE.D.......YDWQALQDNC-------------E..YR.EGYT.....SVD......
A0BRN4_PARTE/3724-4023DLKKFFKPNDMGLITLG.....VQ.D.......IKPEQILNIL-------------S..FK.GGQD..............
A2FJ59_TRIVA/1204-1414FVTIQYTIHKIALVFGS.....SDRK.......LKPEDIIHRL-------------S..............GYS......
Q6PDJ9_MOUSE/738-1060LLT.TLSPLEMELRTCG.....LP.Y.......INLEFLKAHT-------------M..YQ.VGLM.....ETD......
A4S7N1_OSTLU/131-443WLR.LFNVTELSLLLSG.....GE.S......AIDVDDWELHT-------------R..YS.GGYS.....SSS......
A2FR71_TRIVA/373-670ILD.YVLPDELDILVSG.....LP.T.......RDWNIFKKGV-------------K..YE.NGYS.....QNS......
A0DNI8_PARTE/201-510LLS.LLEPLELEMILYG.....TP.F.......IDINDWKDNT-------------D..YK.GAYY.....RTH......
Q5BG86_EMENI/848-1165ALS.LFRPEEIELLVRG.....SD.E......QLDVKSLRAVA-------------T..YL.NWGTP..KPESV......
A5K4K7_PLAVS/1441-1991WLK.LFNAHELKTLISG.....ND.K......CFDVDDLRRNV-------------V..YG.GGYN.....ANS......
Q55NG7_CRYNB/3037-3342LIQ.IFEPDQLELLISG.....IT.T.......VDVDELKNAT-------------Q..LN.G.WK.....ATD......
A2DQ34_TRIVA/412-708LYK.LFGADELDILVSG.....EA.V.......LDWAALKKNA-------------K..YI.DGYT.....KDS......
A7AV31_BABBO/1338-1643CLS.LFTPLELSSQMF......SV.VDQ..DCFWTVDHLEMYL-------------I..PD.HGYD.....VSS......
A2E999_TRIVA/2659-2965PLL.NLDWSTLEYAACG.....ER.E.......ITYEALRKVT-------------K..FEN.........LDN......
A2F3T0_TRIVA/1939-2179IIS.MMSEKIIKTLCCG.....DD.T.......LTLEKLSPYI-------------E.......................
A2FXS6_TRIVA/392-692MYQ.KLTPDELDLCMSG.....EE.K.......IDWDFIKRNT-------------E..YS..GYH.....KYD......
Q6NVK6_XENTR/557-856LKY.LFRPEEIELLICG.....SR.N.......LDFQALKDTT-------------E..YD.GGYT.....RDS......
A2DWM0_TRIVA/796-1093MWD.LLNSHELLHLLTG.....SE.V.....SL.SFDDLVDSI-------------D..VE.HGFT.....KNS......
A2DYB1_TRIVA/1674-1977DLS.MFSPNELDLLICG.....VP.E.......VDVDDMEKNC-------------V..IT.RPLT.....KDS......
A2EEN6_TRIVA/766-1053DMP.LFRPEELSLMVAG.....ED.E.......LDFTALEKNT-------------T..YE..NYT.....TDS......
A4I8L1_LEIIN/3799-4087VVR.CLSWRDLEHLVCG.....ES.N.......LTLQDLQRYI-------------R..VQ..........LTG......
HUL4_ASHGO/526-839SFR.LFGSEELEQLVCG.....SN.E.....QSLDVSMLRSVT-------------R..YQ.GGFD.....DNS......
A2DKE7_TRIVA/929-1162KVK.NFSGRFIEGLTCG.....VKKE.......LDFNSFIAYF-------------N..PP..........SRN......
Q247X9_TETTS/2115-2420ALE.ALEPDDFISFYQG.....VQ.E.......IDIQYLKKKM-------------K..YE..GFK.....STD......
A5K5J0_PLAVS/8258-8564LIS.IFDDKELELLISG.....IP.T.......IDLNDLKENV-------------E..YH.N.YS.....PNS......
A2DXG0_TRIVA/2382-2669SCRELLSPDQLKYIFCG.....PD.E.......ISAAQFISLL-------------R..YLTVADS..............
A4RVZ5_OSTLU/490-781QIE.VLAPEEFGLVAAG.....SQ.S.......IDPKEWRRHA-------------S..FSPS.................
UPL7_ARATH/828-1142WLK.LFNAHEFNQLLSG.....GN.H......DIDVDDLRRNT-------------K..YT.GGYS.....DSS......
MUG30_SCHPO/482-807AIS.LFQDNEISKLIRG.....SE.E......VIDWELLKNVC-------------V..YD..FYDQN.AISNSISESEP
Q6GP47_XENLA/736-1028IIS.FFQPDELRTVVAG.....TA.N.......YDWNTFEKTT-------------I..YL.GKYR.....LDH......
A3FPU7_CRYPI/497-797TLE.LFSPEELVLVICG.....SS.D.......FNIDSLIEAS-------------Q..YQ.DGYT.....KDS......
Q38A01_TRYB2/1526-1868HLR.LFDARELQLVISG.....P..EG...KIWESAGDLLTVI-------------T..TN.HGYD.....KNS......
A1CTM1_ASPCL/1468-1817ALR.TFTPSELVMLF.G.....RA.EE....DW.TIETLMDSI-------------K..AD.HGFN.....MDS......
A2ECJ9_TRIVA/791-1087PTC.VFTPEELIQIITG.....SF.Q.....RI.TIQDLMNNV-------------E..VG.TGYK.....KDS......
Q7PSA4_ANOGA/2506-2929KLA.AFTPDEIRKMLCG.....EQ.NP....EW.TREDIMTYT-------------E..PK.LGYT.....KES......
Q4UD92_THEAN/251-554WLQ.MFSPSELELLISG.....SS.E......VIDISDLRKNT-------------I..YA.GGFD.....ETN......
A2FK98_TRIVA/1968-2204KIA.HITGNYLKMLAIG.....SQEK.......MTLDKFKRFV-------------E..............PNG......
A3LSX3_PICST/660-977WLS.MFDSFELQMLISG.....GQ.N......DINILDWKNNV-------------E..YG.GYLD......SD......
A0DLU6_PARTE/3989-4284LLMDCFDATEMHTLTVG.....SS.E.......IKPEKVLELM-------------I..YI.NGSD..............
Q00Y47_OSTTA/1123-1477RLR.MFDEAELDTLICG.....QG.E.....AW.TPELLTDCI-------------T..FD.HGYN.....AQS......
SPKUL_DICDI/1577-1887HFA.LFSPTELQLLMCG.....NT.L.......VDSSVLQKNF-------------K..FI.G.FP.....DTS......
A7SNF7_NEMVE/430-737LLS.FFTADEFSLLING.....VS.K.......IDVQDWRANT-------------L..YR.GCKE......SD......
A7SP65_NEMVE/115-400LIS.IFNEQELELLISG.....LP.N.......IDLDDLKSHI-------------E..YH.K.YN.....ENS......
A2ERB6_TRIVA/1571-1861ELN.CFTPLEVELAICG.....YS.V.......IDVEDFIKCC-------------S..YE.HPFT.....KDH......
Q4Q7L2_LEIMA/1091-1400RLR.LFDSNEVGKLFGG.....DE.T.....GQIDLEDWKANT-------------V..YD.KPED.....VNT......
Q9CYM1_MOUSE/752-912...........................................-------------........................
Q54KP2_DICDI/1482-1898SLK.PFTISEVESLLCG.....SL.TGS.ESDW.TLDSLMDST-------------K..AD.HGYT.....LQS......
A4VDG4_TETTS/2059-2356LLQ.ILDEQMLSFIFSG.....NP.E.......ISIPELKETI-------------Q..LQ..GYT.....KND......
Q22F29_TETTS/3398-3694SLK.YMNEQELGLLLSG.....VK.K.......IDVDDMKKHM-------------R..YY..RYN.....KDS......
A0DLB8_PARTE/2812-3098LLIQNFALFEINQLIDI.....ID.Y......QINKEKLLKCI-------------H.......FS.....RKN......
A5DS31_LODEL/333-694SLI.IFSYKELVELF.G.....NA.EE....DW.SFDALSSAI-------------N..AN.HGYN.....KES......
A2DQ30_TRIVA/383-682TLK.CLSYDELQELVCG.....SQ.K.......FDWSEFKRNV-------------K..YS.GQYT.....PTS......
UBR5_MOUSE/2479-2792SLE.DLTAEDFRLLVNG.....CG.E.......VNVQMLISFT-------------S..FNDESGE.....NAEK.....
Q54GG5_DICDI/425-720ILK.ILKPEELGNLVCG.....VE.D.......LNFIELERGT-------------N..YE.GGYT.....QDD......
Q5CW92_CRYPI/1231-1561SLR.LFSPYELQSLISG.....VY.Q......KLDVNNLRLNT-------------C..YT..GYT.....ETS......
A2E5Q8_TRIVA/658-966IPN.SLDPDTLEFSCCG.....DP.E.......CSYENLVKIV-------------R..FEE.ISE..............
A0BRI8_PARTE/1050-1354YIS.IFDSIQLEQLLCG.....QT.Y.......IDVDDLISNL-------------Q..YV.D.YA.....PQD......
A7SML1_NEMVE/1229-1585NLK.VYYAVNMDQLLCG.....SV.GQ....KW.EVKELVESC-------------R..PD.HGYS.....HDS......
A2FIB4_TRIVA/386-683LIN.IFSPQDLDQIVSG.....SP.Q.......YDWPALKKAT-------------R..YV..GYQ.....MNS......
A2DAL9_TRIVA/1571-1869LFT.LFTSSEIGSIICG.....EQ.K.......TDVEELIKNF-------------E..IL.PPLS.....QEH......
A2D760_TRIVA/795-1094SLS.LFSPKEIIILLCG.....ST.E.....KW.TKEYLAANV-------------K..IE.HGYN.....SNS......
Q01B14_OSTTA/546-834TLK.FLTPEEFGSQIVG.....TH.D.......VDAQEWRKHV-------------D......DLA.....GNH......
A0DH95_PARTE/2-219LLN.WVSAEDLELWVCG.....RP.I.......VDVDLLKRHT-------------R..YS.GDLN.....ENS......
O17736_CAEEL/692-1001WMR.MFAPHELQIMIAG.....YE.E......VFTAKELRKFC-------------ELRFA.AGTQ......DI......
A8BIP6_GIAIC/2319-2632DLR.IFTPVELGLVISG.....IN.E.......LSSSQLVSLF-------------K..WIHPPPDVSSSLVSQ......
A2FPQ0_TRIVA/408-705EFK.IFTPDELQVLVSG.....ED.V.......FDWDALRLGT-------------K..YI.EGYK.....ETS......
A2F5A6_TRIVA/682-951ALS.LFTPTELSQLITG.....EM.T.....KI.TVKEFENNV-------------N..LT....K.....YAT......
Q580A5_TRYB2/986-1286AFW.FFTDDEMSAIICG.....FS.AEDSEEKLFSEEALRAAV-------------...MEAHGYS.....TGS......
A2F7U9_TRIVA/2273-2579SHP.LLTGARLSHMAQG.....SN.V.......ITTQQLRSIT-------------Q..VNDYK.G.....LED......
A5D6V3_DANRE/704-994AWT.MFHPEELQELLHG.....SP.Q.......YNWKELQQSA-------------S..YE.G.CS.....ASD......
A2F3N1_TRIVA/2072-2351LCA.TITTDSLVQACCG................IDFIPDSTFL-------------N..YF..........NMD......
Q9W196_DROME/819-1122WLY.MFSNKELQILISG.....AE.I......PIDLEDLKKHC-------------E..YG.GEFS.....PEH......
Q381G0_TRYB2/3834-4128VVR.CVSWRELERMVCG.....EP.D.......ITPEVMRQWL-------------E..VQ..........LPP......
A2EDQ8_TRIVA/2183-2490HNA.LLTGALLSRMAQG.....SG.D.......ISVQHLKQIT-------------H..VSDFEDG.....IKN......
A2EM50_TRIVA/2501-2807PPP.FVTPQLLEFLACG.....DR.T.......ISVSKLRALT-------------E..FQG.APR..............
A2EQW9_TRIVA/2209-2511NPS.IFNSNLISYLAQG.....SR.T.......VTTQAFKSIT-------------S..MLA.........PTN......
Q54QF1_DICDI/778-1120ILS.IFNWKELEMLICG.....RE.R.......INLDDLKQHS-------------S..FT.GYFN.......Q......
Q8SR14_ENCCU/2104-2410ALE.MFDESELELLICG.....IP.D.......IDVDDWKNNT-------------L..YY.G.YA.....ENS......
A2DAJ9_TRIVA/133-438THP.MMNATLIALLVQG.....SN.V.......ITTAQLRQIT-------------T..FDGFN.K.....SNE......
Q580G4_TRYB2/3999-4304EIR.NFSAQELELVICG.....MP.D.......IDVEDLRLNT-------------T..Y..DGYT.....STS......
A8BLR8_GIAIC/875-1158SLA.MFTASDLDLALTG.....EV.D.......LNFSLLEPFT-------------A..YE.NPYS.....SSH......
A2E5X8_TRIVA/301-578YLK.ILSPDVIEELLCG.....DN.E.......ITAYQLTSIL-------------R..FR.GNYP..............
Q4PHJ7_USTMA/908-1208WLR.NFNREELSILISG.....TE.D......PVDIDDLRKHT-------------V..LG.GYHE......AD......
A7RSK9_NEMVE/1024-1329LLS.LLTPDNLEQLVCG.....SA.E.......VSVDMLKRVV-------------R..YR..EID.....PSD......
Q2GVQ3_CHAGB/742-1078NSS...TTTATSRRPSGWYLPSTP.RATCAVDRAPLCPARRPP-------------R..RHQCQPAATEEEEEE......
A0D383_PARTE/180-477YLN.IFTAEEFEMILYG.....VP.V.......VDLAEWKQHT-------------I..YK.TPYA.....ENS......
A2E4I7_TRIVA/2634-2943PPP.FVTGDIIRSCCSP.....PN.E.......LTAEAILSVT-------------E..FDHGLPK..............
Q019K0_OSTTA/1236-1531LLS.SLSPVDLERMVCG.....KQ.Q......YMNPKWRASEE-------------E.......................
A2DBI7_TRIVA/375-665IVS.LLSSRDLELCVSG.....EE.T.......YNWIELQQSA-------------G..YN..GYD.....KSS......
A2G1R0_TRIVA/764-1050SAQ.LFEPEEFSRALCG.....DK.......ALFNARDLQMFL-------------I..PK.FGYT.....KKC......
A4VD17_TETTS/793-1095WLQ.MFNENEVQMLISG.....QE.K......GIDIENLKSNT-------------K..YE.GGYG.....SWD......
A8BYQ3_GIAIC/636-950SLT.LFTPADLEIALCG.....EP.N.......LDFIALKNNT-------------K..YD.EPLS.....PTH......
PUB2_SCHPO/367-671VLQ.IFNENELDTLLNG.....KR.D.......IDVQDWKRFT-------------D..YR.S.YT.....ETD......
Q00WR0_OSTTA/203-456WLN.MFTPAELRLLISG.....NR.T.....GSMDIADMAAHC-------------E..YS.GGYD.....ASH......
A2FG81_TRIVA/782-1072SLS.LFSENEFLFLING.....ID.M......KVTEDYLRNNI-------------V..VE.HGYD.....MKS......

PF09814

A4D9F3_ASPFU/21-420----------------PNGL.....LLW---------------------------------V---FNPDFRYSS....SS
UBE3D_HUMAN/13-385----------------KVYI.....LLW---------------------------------L---LNSDSLVIE....SL
A5DDI0_PICGU/5-350----------------SKSL.....FIW---------------------------------V---LNIGLDIST....ET
Q6BMI9_DEBHA/5-363----------------QDYM.....FIW---------------------------------I---MNIGVDVST....EN
Q0TZD4_PHANO/225-279----------------............---------------------------------.---...............
Q29GF2_DROPS/8-386----------------KQYM.....LIR---------------------------------V---VEPQLRVLR....RI
Q6CWI5_KLULA/6-349----------------DKRY.....IIW---------------------------------V---FGIGSCIQF....DK
A1CJR3_ASPCL/19-424----------------SSGL.....LLW---------------------------------A---FNPDFRYSN....SS
Q9VWP0_DROME/9-390----------------QQYM.....FLH---------------------------------V---VESQLRVLR....RI
UBE3D_PONAB/13-385----------------KVYI.....LLW---------------------------------L---LNSDSLVIE....SL
Q6FK88_CANGA/6-347----------------QKPI.....FIW---------------------------------V---LAYDCSVAY....TG
Q7SDG7_NEUCR/13-382----------------DQVV.....HIW---------------------------------V---LNSGIVFTS....SA
Q4P6X1_USTMA/1030-1417----------------EEAV.....QLW---------------------------------L---FSRCLLTS.....SL
YHFA_SCHPO/4-322----------------ERSI.....WTW---------------------------------C---FVPHLPISF....QK
A7TPW1_VANPO/6-340----------------KDHL.....FIW---------------------------------V---FAIGINVSF....TN
Q75DV5_ASHGO/6-339----------------GSQI.....ALW---------------------------------V---FNVGLDVST....AD
YJ9I_YEAST/7-342----------------TESL.....LVW---------------------------------I---FSVDIGVTL....TG
Q16XY0_AEDAE/12-444----------------VFYL.....LMQ---------------------------------I---MDANLNVFK...IRK
Q5B919_EMENI/28-412----------------EDGI.....LIW---------------------------------V---FNPDMRFSN....SS
A5DWX9_LODEL/10-366----------------KHHYIDGPMYIW---------------------------------I---ISTEVDVTI....NG
Q5PQ45_XENLA/37-407----------------KHFL.....LLW---------------------------------L---LNTDTLLVE....SP
Q6C9F9_YARLI/6-329----------------KPAA.....LVW---------------------------------I---FNRNLTYTL....SG
Q59X25_CANAL/5-343----------------AQSK.....FIW---------------------------------I---MSLGLNVVI....DG
UBE3D_MOUSE/13-364----------------KVYI.....LLW---------------------------------V---LNSDSLVIE....PL
UBE3D_BOVIN/13-385----------------KVYI.....LLW---------------------------------L---LNSDSLVIE....SL
A7USM4_ANOGA/14-434----------------VFYL.....LMQ---------------------------------I---MDCQLSVFRAKQKRT
A7SC58_NEMVE/7-362----------------KTHA.....LLW---------------------------------L---MNSDAAIVS....NL
Q5EAZ8_DANRE/20-391----------------KAEI.....LLW---------------------------------L---LNTDTLVAS....FP

PF00632

HACE1_MOUSE/602-909................PVIQ-----WFW.EV..............................VED.ITQEERVLLLQFVTG
Q7QE66_ANOGA/554-863................HVIM-----WFW.AV..............................IER.MSNEQRLRLLQFVTG
NEDD4_HUMAN/1013-1318................QVIQ-----WFW.KA..............................VLM.MDSEKRIRLLQFVTG
A4IBF5_LEIIN/1897-2310................PQLE-----LLA.KV..............................LGQRLTPAEQREFLLFCTG
A4IC88_LEIIN/3812-4131................RRVQ-----LLW.KA..............................LEE.ATPLQRRLFLRFVSG
Q4WHR7_ASPFU/967-1337................RVIQ-----DFW.SI..............................VKS.FSQEKKAQLLEFVTA
A4HPV4_LEIBR/2168-2551................DVVQ-----YLL.DI..............................VPA.WSAQMQHAFLKFVTG
A4HF82_LEIBR/3619-3949................PSMR-----AILTDV..............................LNG.FTESQLARFLLFCSG
A4IAG7_LEIIN/1051-1369................VHVE-----MLL.SI..............................VGGDFTRAQQRDFLEFLTG
UBE3B_HUMAN/736-1068................RVII-----WLW.DI..............................LASDFTPDERAMFLKFVTS
A3GHK0_PICST/646-950................TVVQ-----WFW.EY..............................MCE.INTQERKRLLMFVTG
UPL3_ARATH/1518-1888................PAII-----NLL.EI..............................MGE.LTADQQRAFCQFVTG
Q0UNY9_PHANO/908-1229................PTII-----TFW.RI..............................VEQ.YSQDDCRKLLEFVTA
Q9BL11_CAEEL/717-1019................PTIQ-----AFW.KA..............................F.FALTDDERRKFLQFLTG
A0EFC1_PARTE/672-969................EYIR-----YFW.SC..............................I.HSLSIEMQKRFLFFCTG
Q2GSX9_CHAGB/694-1033................PTVK-----LFW.EV..............................MYQ.LEDRERRDVLKYVTS
Q5KIA2_CRYNJ/1499-1843................RAVQ-----NLI.EV..............................MSS.YNKEQRRQFLQFMTG
HUL5_YEAST/607-910................QTIV-----DFW.EV..............................LNE.FKFEEKLNFLKFVTS
Q38D88_TRYB2/1472-1912................PQIT-----MLQ.NI..............................LAKRFGPREQRAFLLFCTG
A0E799_PARTE/3885-4178................NHKS-----YFE.TY..............................INQ.ADPQTLKNMLKFITG
Q00WM5_OSTTA/458-763................RQIR-----WFW.DI..............................VRE.MSKEDLARLLMFCTG
A2DUY0_TRIVA/771-1054................NQFK-----WLC.EF..............................VES.L.KEKTKLFVKFVTG
Q6BGB8_PARTE/609-908................KTIE-----DFW.SV..............................VND.FEYEQQSQFLFFFSS
A2FLN6_TRIVA/2545-2849................PSST-----MLW.DA..............................LEG.FTPEERMLFIKFGTG
Q7PSQ3_ANOGA/541-897................PQIV-----WFW.QVSSTDLQLSMSEDRLHVFNWLPFASCFFWQIVES.YSPEMRAQLLQFVTG
Q6NNZ7_DROME/211-561................QAIQ-----YLY.EI..............................LAS.YNRDEQRAFLQFVTG
A4IBT8_LEIIN/1017-1343................NTPK-----YLK.EV..............................LLD.MSQNNLRRFLQLCTA
A0D2G1_PARTE/170-483................YFII-----WFW.QI..............................LST.WNQAELSQFLRFCTG
K0317_MOUSE/512-823................KVMR-----WFW.AV..............................VSS.LTQEELARLLQFTTG
A2FVL0_TRIVA/2315-2604................YDTD-----LLF.KV..............................IDT.FSEENLRDFLRFSSG
Q8SS57_ENCCU/454-746................PIIV-----YFW.EI..............................FEA.FNRKKRKKLLQFITG
Q4E2E5_TRYCC/2646-2975................ELCH-----MLK.EV..............................VHA.WPQQRRSQFLLFCSG
A2F794_TRIVA/2662-2959................KSSI-----MLW.KV..............................IES.FTPNERMLFIKFATG
TOM1_YEAST/2962-3268................KEVS-----YFW.RA..............................VRS.FDAEERAKLLQFVTG
A7SQ93_NEMVE/299-612................NTIR-----YFW.DT..............................V.MNFNTDLKKKMLLFATG
A2DAV4_TRIVA/452-719................NIQK-----WLF.EI..............................LAE.FDQETFQNFLKFVTG
Q6C901_YARLI/697-1001................LVVR-----WFW.KW..............................A.ENLEEEKQKKLLRFITG
A0DAX5_PARTE/100-320................QTVL-----WFW.EV..............................LTT.LSDSEKADFLMFATG
Q6C8U2_YARLI/491-779................PQVK-----WLK.EY..............................LRG.LSVHQLKLFLHFTTG
Q9W0H2_DROME/761-1058................DTIK-----WFW.EV..............................I.HDMSEAEKKSFLLFLTG
A0BRN4_PARTE/3724-4023................YHIS-----FFT.NY..............................VNT.SSSKRLKELLQYITG
A2FJ59_TRIVA/1204-1414................ETVK-----VFS.DA..............................IRT.FSSEELSELLRFITG
Q6PDJ9_MOUSE/738-1060................QHIE-----LFW.GA..............................LEM.FTQEELCKFIKFACN
A4S7N1_OSTLU/131-443................ATVR-----NFW.RV..............................MRK.FTPKQRQDVLKFVTS
A2FR71_TRIVA/373-670................EPVI-----WFW.KI..............................F.DEMSEDDKAALMQFITG
A0DNI8_PARTE/201-510................QTIQ-----WFW.EI..............................LEQ.LDQFNLAKFLQFCTG
Q5BG86_EMENI/848-1165................PVVR-----WFW.EY..............................F.ERANPEAQRKILSFVTS
A5K4K7_PLAVS/1441-1991................ETVL-----NLF.HI..............................LKT.FSPKEKSLFLMFVTS
Q55NG7_CRYNB/3037-3342................PEVA-----WFW.RA..............................LRS.FSQEERSRFLMFVTS
A2DQ34_TRIVA/412-708................QQII-----WFW.EL..............................F.DQFSNDQKVEFLRFSTG
A7AV31_BABBO/1338-1643................SAYR-----YLL.TV..............................LSN.FTSAERAGFLRFCTG
A2E999_TRIVA/2659-2965................TQQD-----IFL.KV..............................CEM.MTSEQRSLLLKFSTG
A2F3T0_TRIVA/1939-2179................GVKS-----EILIKC..............................LSL.FSSEELKKFLEFVTG
A2FXS6_TRIVA/392-692................ITII-----RFW.EI..............................Y.DKMVEEDKRKLLKFITG
Q6NVK6_XENTR/557-856................NIIK-----EFW.EI..............................V.NSFTEEQKRLFLQFTTG
A2DWM0_TRIVA/796-1093................PQIS-----MLF.KL..............................IVK.MPSNEQSLFVKFVTG
A2DYB1_TRIVA/1674-1977................DVVK-----FFF.SA..............................IRK.WSSEDLAKLLLFITG
A2EEN6_TRIVA/766-1053................PAVK-----LFW.KI..............................VRDKLNIDEKKKLLYFVTS
A4I8L1_LEIIN/3799-4087................SREA-----HFW.QI..............................VEQ.LSMEQRASLICFASG
HUL4_ASHGO/526-839................PVVQ-----WFW.EI..............................L.SEMEYPQQRKLLHFVTG
A2DKE7_TRIVA/929-1162................CVVW-----PVFTQA..............................ISK.FTSQEFSKLMGFITG
Q247X9_TETTS/2115-2420................KIIE-----WFW.EI..............................LKD.WDNVQKKKFLSALTE
A5K5J0_PLAVS/8258-8564................IQII-----WLW.DV..............................LQE.FDENKKASFLQFVTG
A2DXG0_TRIVA/2382-2669................ASKE-----YFEWSI..............................LM..MTSEERSMLLKFITG
A4RVZ5_OSTLU/490-781................PEME-----WFW.DV..............................VER.MNNDDKSRLLQFSTG
UPL7_ARATH/828-1142................RTIK-----IFW.EV..............................MKG.FEPSERCLLLKFVTS
MUG30_SCHPO/482-807SMTASKYLCHSFVSKRKIIL-----WFW.DL..............................I.SHYSLKMQKLFLIFVTG
Q6GP47_XENLA/736-1028................PTIK-----MFW.KV..............................F.HALSLEKKKGFLMFLTG
A3FPU7_CRYPI/497-797................TTVV-----MFW.EI..............................V.KKLDLKLQKKLLFFVTG
Q38A01_TRYB2/1526-1868................LVVA-----YFV.EV..............................VSS.WDVSLQRSFLRFVTG
A1CTM1_ASPCL/1468-1817................KSVR-----NLL.QT..............................MSE.LDTQQRRDFLQFVTG
A2ECJ9_TRIVA/791-1087................PVIT-----NFF.EV..............................IEE.MNDEDQKLLIRFITG
Q7PSA4_ANOGA/2506-2929................PGFL-----RFV.NV..............................LMG.MNGSERKAFLQFTTG
Q4UD92_THEAN/251-554................ATIQ-----WLW.EI..............................LDE.YDNSERSSFLWFVTC
A2FK98_TRIVA/1968-2204................NITN-----VLF.DA..............................VAA.FTHEEFMQLIKFITG
A3LSX3_PICST/660-977................ITVR-----YFW.EV..............................VAE.MTPDERFALIKFVTS
A0DLU6_PARTE/3989-4284................QLIQ-----FFQ.KF..............................INQ.LEDEQLQDFLQFLTG
Q00Y47_OSTTA/1123-1477................PPIK-----NFC.DI..............................LSS.FTPEQQRAFMRFVTG
SPKUL_DICDI/1577-1887................STPK-----DFR.RA..............................VDE.MNQDEIRLFLRFVTG
A7SNF7_NEMVE/430-737................EIIT-----WLW.KT..............................IAS.LKEEEKALLLKFSTG
A7SP65_NEMVE/115-400................LQIQ-----WFW.RA..............................LRS.FDQAARAKFLQFVTG
A2ERB6_TRIVA/1571-1861................QTVK-----MFY.DA..............................IRT.FSNEEMNLLISFITG
Q4Q7L2_LEIMA/1091-1400................PQVR-----LFW.DV..............................VES.LTREQQRQLLKFATS
Q9CYM1_MOUSE/752-912....................-----.......................................................
Q54KP2_DICDI/1482-1898................KSVQ-----NIF.QI..............................MSE.FTPQERKQFLLFISG
A4VDG4_TETTS/2059-2356................KQIK-----WLF.EI..............................LES.FNNYEKSCFIFFITG
Q22F29_TETTS/3398-3694................QIIQ-----WFF.EV..............................MNE.YDEDQRSLFLFFVTG
A0DLB8_PARTE/2812-3098................QINE-----NYFTQY..............................ISE.ADQEKLEHLLTFATG
A5DS31_LODEL/333-694................EGIK-----NLI.SV..............................LVE.FDKEEKRQFLQFLTG
A2DQ30_TRIVA/383-682................KTIQ-----MFW.KI..............................F.EEFDEKQKRNLLTFITS
UBR5_MOUSE/2479-2792..............LLQFKR-----WFW.SI..............................VEK.MSMTERQDLVYFWTS
Q54GG5_DICDI/425-720................TTIK-----NFW.KV..............................L.HGLSDEDKRRFLTFVTG
Q5CW92_CRYPI/1231-1561................QQII-----WLW.DI..............................LENEFSTEEQGEFLLFVTS
A2E5Q8_TRIVA/658-966................DQQS-----IFF.KV..............................IQK.FTPEQRACLIKFATG
A0BRI8_PARTE/1050-1354................QVII-----WLQ.NT..............................LKN.FSQDLLAKFLKFATS
A7SML1_NEMVE/1229-1585................RAIK-----CLF.EI..............................LSE.YDADQQRLFLQFVTG
A2FIB4_TRIVA/386-683................RAIK-----NFW.SI..............................FENDFNDDNRRAFLKFVTG
A2DAL9_TRIVA/1571-1869................PIVQ-----MFF.KI..............................IRR.WNNELISRLLLFMTS
A2D760_TRIVA/795-1094................AEIN-----NLF.EI..............................LSE.MNDDERMNFVNFVTG
Q01B14_OSTTA/546-834................DQMK-----WFW.NV..............................ITR.MSAEDRSKLLQFSTG
A0DH95_PARTE/2-219................DRIK-----FFW.EA..............................LYE.LSEQEKLRFIKFCWG
O17736_CAEEL/692-1001................NYEE-----MFW.DV..............................IDK.LSNDDKKALLKFVTG
A8BIP6_GIAIC/2319-2632................ATEL-----AFS.TV..............................LNE.LTFEERADFLCFVTG
A2FPQ0_TRIVA/408-705................TSVK-----MFW.EI..............................F.NELPEEKKVKFLLFSTG
A2F5A6_TRIVA/682-951................PTMR-----TMLAEI..............................VSE.FDPETLSKFLYFTTG
Q580A5_TRYB2/986-1286................QEVE-----TFI.SL..............................VGDEFTREQQQLFIEFLTG
A2F7U9_TRIVA/2273-2579................KNIR-----WFF.NA..............................VDR.FNPDQRKLLLKFITT
A5D6V3_DANRE/704-994................ELIK-----NFW.TV..............................F.FELSEENKKKFLMFLYG
A2F3N1_TRIVA/2072-2351................LNST-----ILR.QS..............................LIQ.LTQEERFGLLKFASG
Q9W196_DROME/819-1122................PSIV-----TFW.EV..............................LEG.FDDMQRRQLLKFVTS
Q381G0_TRYB2/3834-4128................RSKR-----IFW.RV..............................MDD.FSPCQRSSFLCFGCG
A2EDQ8_TRIVA/2183-2490................EYVK-----RFF.RA..............................VDR.LNKEQKKLLLKFITT
A2EM50_TRIVA/2501-2807................KMID-----IFW.TV..............................ISR.LSEQEKRKFLQFATG
A2EQW9_TRIVA/2209-2511................QQER-----YFW.EA..............................VDR.MTNEQRSLLLKFATT
Q54QF1_DICDI/778-1120................TLID-----EFW.LI..............................VNG.FNEDEKKSLIKFVTG
Q8SR14_ENCCU/2104-2410................KTVI-----WFW.RA..............................VKS.LDSVSRAKLLQFVTG
A2DAJ9_TRIVA/133-438................YVIS-----NYW.AA..............................VDR.MSNEQRSLLLKFVTT
Q580G4_TRYB2/3999-4304................LQIR-----WFW.EV..............................VAA.MSKEDRANLLQFATG
A8BLR8_GIAIC/875-1158................PNIK-----NFW.RI..............................VAE.LTQEQQRRLLRFITG
A2E5X8_TRIVA/301-578................LHYT-----MFT.RC..............................IEE.MTNKERISLVKFITG
Q4PHJ7_USTMA/908-1208................LTVQ-----HFW.KV..............................LEG.FDQRMRKAFLKFVTS
A7RSK9_NEMVE/1024-1329................SLVS-----WLW.RV..............................LES.FTNEERILFMRFVSG
Q2GVQ3_CHAGB/742-1078................PTIR-----WFW.EA..............................FQT.APARDQRRLLAFITG
A0D383_PARTE/180-477................QQIQ-----WFW.KV..............................LSE.FDQDQLKKFLHYCTG
A2E4I7_TRIVA/2634-2943................ELKD-----LFI.EI..............................LNE.MNKSQLSLLLKFATA
Q019K0_OSTTA/1236-1531................RRVE-----WFW.QA..............................IES.FSSSDQALLLHFWAA
A2DBI7_TRIVA/375-665................KSVQ-----YLW.EI..............................F.MKMDETKKKAFLRFVTG
A2G1R0_TRIVA/764-1050................TEIK-----RLI.NM..............................IAN.FTPQEQRLFCKFITG
A4VD17_TETTS/793-1095................FYIR-----DFW.KL..............................VAS.LTEEEKILLIKFVTS
A8BYQ3_GIAIC/636-950................PLII-----WFW.DI..............................VLNVMTQDQRKALLKFVCG
PUB2_SCHPO/367-671................DIVI-----WFW.EL..............................LSE.WSPEKKAKLLQFATG
Q00WR0_OSTTA/203-456................PTIR-----VLW.NV..............................MRE.LTPDEQREVLKFITA
A2FG81_TRIVA/782-1072................PEIE-----MFV.KL..............................IPT.FDRETFSKFVRFVTG

PF09814

A4D9F3_ASPFU/21-420AEHT........................................ISSQ--RAMKVLFQEV.GDVDTILNP-----ARG..
UBE3D_HUMAN/13-385RNSKYIKKFPLL........................ENTFKADSSSAW--SAVKVLYQPC..IKSRNEKL-----VSLWE
A5DDI0_PICGU/5-350............................................GVFK--NALKLLYD............-----VDHPE
Q6BMI9_DEBHA/5-363............................................FVLN--NSMKVFYY........HDDI-----RGISK
Q0TZD4_PHANO/225-279................................................--NGEPVYFW............-----.....
Q29GF2_DROPS/8-386SGKAP......................................VLRGY--YAIKLSYGIYEDCHEEPPDI-----LQRWQ
Q6CWI5_KLULA/6-349S...........................................RMLN--NCLKILYR.........DGK-----PAESE
A1CJR3_ASPCL/19-424AEHS........................................VTAQ--RAVKIFFQEI.ADVDSFLDP-----GRGRP
Q9VWP0_DROME/9-390RPNSN......................................RLRCF--RACKLYYGV....FGANPPL-----LEKWQ
UBE3D_PONAB/13-385RNSKYIKKFPLL........................EDTLKADSSSAW--SAVKVLYQPC..IKSRNEKL-----ISSWE
Q6FK88_CANGA/6-347N...........................................ELVQ--RAYKLLYK............-----DSWDR
Q7SDG7_NEUCR/13-382MEATVTR..................................PGAESGI--PAMKLLYRL....VPREEAD-----RMLDS
Q4P6X1_USTMA/1030-1417TNRWNTLG...............................AQDAHASVR--KGSRVFFR..........TV-----STATA
YHFA_SCHPO/4-322SPFSSI...................................EFANSPI--STIKLLYQ........LEVP-----PDFTK
A7TPW1_VANPO/6-340G...........................................QIYK--NSIKLLYK.........EDI-----DQELC
Q75DV5_ASHGO/6-339............................................GLIR--CGLKILYT......DDVESV-----THAPS
YJ9I_YEAST/7-342N...........................................KSFK--RAMKLLYT.......NSVTT-----INRCL
Q16XY0_AEDAE/12-444DLDADSSASDDQTEERQAKEGVDEEDDEDDEVFVPTQKTHRNIHLDRH--RVMKVMYRY...EKFEQQPI-----INFWL
Q5B919_EMENI/28-412SQHS........................................ITSQ--RAMKVFFQPT.ADVEAILHP-----EPGKT
A5DWX9_LODEL/10-366............................................STIH--DGLKIWYT..........TQ-----ELPPD
Q5PQ45_XENLA/37-407RKPGTQNNCFFSD......................NNVMASSRALEAR--NAMRVLFLPC..SENRNKQL-----ADKWM
Q6C9F9_YARLI/6-329V...........................................DGKE--QGTKIYYT......VDPALV-----AELSE
Q59X25_CANAL/5-343............................................KICH--NALKVLCA............-----.DNVS
UBE3D_MOUSE/13-364RSSSCSRKFPLL........................ESSLEAGSGSAW--NAIKVLYQPC..IKSRNKEL-----ASSWE
UBE3D_BOVIN/13-385GQYTNIKKFPVL........................EDVLKPDSNSAC--NAVKVLYQPC..IKSRNAEL-----SSLWE
A7USM4_ANOGA/14-434GSGSSESCSDDVD.....................DCRADGKEDVAENV--ALERLMYQY...EKYDDQPL-----FVFWR
A7SC58_NEMVE/7-362TPGINTYGFHPKEEK.................RKNGKNSKSENKASLT--NVMKILYK.........ALP-----KNMSS
Q5EAZ8_DANRE/20-391APAARADGFISVG......................DSHPRMHQSCQAV--AAVKVLYILC..SDSKLRDV-----VDVWE

PF00632

HACE1_MOUSE/602-909SS------------------------------------------RVPH..GGFA.NIMGG...SGLQNFT.....IAAVP
Q7QE66_ANOGA/554-863TS------------------------------------------SIPH..DGFA.GLRGS...NGLRRFC.....IEKWG
NEDD4_HUMAN/1013-1318TS------------------------------------------RVPM..NGFA.ELYGS...NGPQSFT.....VEQWG
A4IBF5_LEIIN/1897-2310CP------------------------------------------RLPI..GGIR.AL.........GAIT.....VVRRS
A4IC88_LEIIN/3812-4131RD------------------------------------------RMPV...KLR.IL..........PLT.....TQADA
Q4WHR7_ASPFU/967-1337SD------------------------------------------RVPV..NGIA.SI..........MFV.....IQRNG
A4HPV4_LEIBR/2168-2551SS------------------------------------------AVPY..GGFT.Q...........HIT.....VVRRD
A4HF82_LEIBR/3619-3949QS------------------------------------------RIPL.........P........EKVL.....VECGD
A4IAG7_LEIIN/1051-1369SP------------------------------------------RLPF..NGLA.GLG........RLIT.....VAMKD
UBE3B_HUMAN/736-1068CS------------------------------------------RPPL..LGFA.YLK........PPFS.....IRCVE
A3GHK0_PICST/646-950SD------------------------------------------RVPA..TGIQ.NL..........SFK.....ISSQG
UPL3_ARATH/1518-1888AP------------------------------------------RLPP..GGLA.VLN........PKLT.....IVRKH
Q0UNY9_PHANO/908-1229SD------------------------------------------RVPV..TGYE.GI..........TFH.....IKRVG
Q9BL11_CAEEL/717-1019ST------------------------------------------RIPV..SGWE.EL..........HAA.....IQP..
A0EFC1_PARTE/672-969TD------------------------------------------RIPV..GGLK.SI..........KFV.....IQK..
Q2GSX9_CHAGB/694-1033TP------------------------------------------RAPL..LGFS.QLS........PPFS.....IRDGG
Q5KIA2_CRYNJ/1499-1843AP------------------------------------------KLPI..GGFR.GLT........PPFT.....VVRKP
HUL5_YEAST/607-910VP------------------------------------------QAPL..QGFK.ALD........PKFG.....IRNAG
Q38D88_TRYB2/1472-1912CP------------------------------------------RLPH..GGISALG..........AIT.....VVQST
A0E799_PARTE/3885-4178SS------------------------------------------TIPFDQGSY..............IIS.....VEFKS
Q00WM5_OSTTA/458-763TS------------------------------------------KVPL..EGFS.ALQGM...QGPQKFQ.....IHRQH
A2DUY0_TRIVA/771-1054ND------------------------------------------LLPI..GGIS.ALN........PQIR.....VIKMD
Q6BGB8_PARTE/609-908CS------------------------------------------RAPT..QGFK.SLD........PPFM.....IQKVP
A2FLN6_TRIVA/2545-2849RM------------------------------------------GLPP..PGSKWMT..........PLQ.....IQFKM
Q7PSQ3_ANOGA/541-897SC------------------------------------------RVPL..QGFR.ALQGSTGAVGPRLFT.....IHLTA
Q6NNZ7_DROME/211-561SP------------------------------------------RLPT..GGFK.ALT........PPLT.....IVRKT
A4IBT8_LEIIN/1017-1343TA------------------------------------------AVPV..SGAMK............KIK.....VLRCA
A0D2G1_PARTE/170-483ST------------------------------------------RVPV..EGFS.KLESNR..GEISYFC.....IQASN
K0317_MOUSE/512-823SS------------------------------------------QLPP..GGFA.ALC........PSFQ.....IIAAP
A2FVL0_TRIVA/2315-2604YS------------------------------------------SIPA..WNYKP............FISVYPMSIKDFE
Q8SS57_ENCCU/454-746ND------------------------------------------RIPV..SGPASL...........KLV.....IMRNG
Q4E2E5_TRYCC/2646-2975QR------------------------------------------RIPL.........P........EKVQ.....VACGD
A2F794_TRIVA/2662-2959RM------------------------------------------GLPS..PGMSWHS..........SLTITWLPLQGRT
TOM1_YEAST/2962-3268TS------------------------------------------KVPL..NGFK.ELSGV...NGVCKFS.....IHRDF
A7SQ93_NEMVE/299-612SD------------------------------------------RIPI..GGMA.EM..........EFK.....IVRMD
A2DAV4_TRIVA/452-719SQ------------------------------------------KFPQ..NDLKKLN.........PKISLDKGDQNLEA
Q6C901_YARLI/697-1001SD------------------------------------------RIPA..TGIS.NM..........NFK.....ITF..
A0DAX5_PARTE/100-320SP------------------------------------------LVPF..GGFK.NLRGP...NGPRKFS.....ISKDF
Q6C8U2_YARLI/491-779SE------------------------------------------RVSI..GSKQGQRV........VKIT.....VQLNG
Q9W0H2_DROME/761-1058SD------------------------------------------RIPI..QGMK.AL..........KLT.....IQP..
A0BRN4_PARTE/3724-4023SP------------------------------------------TLPS..NEKF.............KIQ.....VEFKQ
A2FJ59_TRIVA/1204-1414TS------------------------------------------TLSY..TTTRIEL..........NTYSGNSDISDES
Q6PDJ9_MOUSE/738-1060QE------------------------------------------RIPFTCPCKDGGPDTAH..VPPYPMK.....IAPPD
A4S7N1_OSTLU/131-443SP------------------------------------------RPPL..QGFK.HLN........PPFV.....IHKVR
A2FR71_TRIVA/373-670TD------------------------------------------RTPV..ATAK.PN..........FLV.....IRR..
A0DNI8_PARTE/201-510ST------------------------------------------RTPV..EGFR.KLESNR..GNCSKFC.....IESVP
Q5BG86_EMENI/848-1165SD------------------------------------------RIPA..MGAT.SL..........NIQ.....LIC..
A5K4K7_PLAVS/1441-1991CS------------------------------------------RSPL..LGFQ.ELH........PKFC.....IYRVV
Q55NG7_CRYNB/3037-3342SS------------------------------------------RVPL..GGFS.QLQGS...SGTQPLQ.....LQKLH
A2DQ34_TRIVA/412-708TP------------------------------------------RAPV..EGLG.EV..........QLT.....IQK..
A7AV31_BABBO/1338-1643VS------------------------------------------VLPK..QGFA.GLR........PIMR.....VVKKG
A2E999_TRIVA/2659-2965RI------------------------------------------RLPPNCGDDEK............FLK.....VDRAE
A2F3T0_TRIVA/1939-2179SS------------------------------------------TIPS..GHF..............RIKAHNYYMDNND
A2FXS6_TRIVA/392-692TD------------------------------------------RVPP..SGMMFKM..........KLL.....IKK..
Q6NVK6_XENTR/557-856TD------------------------------------------RAPV..GGLG.KL..........KMI.....IAK..
A2DWM0_TRIVA/796-1093SE------------------------------------------RLPI..GGLG.SLQ........PRIS.....IARKT
A2DYB1_TRIVA/1674-1977SS------------------------------------------QIPI..GGFA.TLKD......SHPIT.....IQPGG
A2EEN6_TRIVA/766-1053SP------------------------------------------RAPI..GGLG.KV..........PFK.....IMR..
A4I8L1_LEIIN/3799-4087QR------------------------------------------RLPL...................IRP.....ITVAE
HUL4_ASHGO/526-839SD------------------------------------------RVPA..TGVT.TI..........PFR.....ISRIR
A2DKE7_TRIVA/929-1162NE------------------------------------------T.PK..NAKDFCL..........KLADKSTSYQDEN
Q247X9_TETTS/2115-2420IP------------------------------------------GIPV..GGYPVRDVST...GNVKQLT.....ISFLN
A5K5J0_PLAVS/8258-8564TS------------------------------------------RVPL..GGFK.NLMGM...RGAQKMI.....IYRAY
A2DXG0_TRIVA/2382-2669RV------------------------------------------SIPVSGSGSNFAI..........NVH.....LVKLQ
A4RVZ5_OSTLU/490-781SS------------------------------------------LLPV..GSFAALCP.......PWSIE.....VGLHR
UPL7_ARATH/828-1142CS------------------------------------------RAPL..LGFK.YLQ........PTFI.....IHKVS
MUG30_SCHPO/482-807SD------------------------------------------RIPA..TGAH.NF..........QLR.....ISV..
Q6GP47_XENLA/736-1028ND------------------------------------------KLPV..FTSD.NV..........GMK.....ISRFG
A3FPU7_CRYPI/497-797SD------------------------------------------RVPM..KGLG.EL..........GFV.....IGR..
Q38A01_TRYB2/1526-1868ST------------------------------------------RIPI..GGL....R........PPIT.....VVRRS
A1CTM1_ASPCL/1468-1817SP------------------------------------------KLPI..GGFK.SLT........PIFT.....VVCRP
A2ECJ9_TRIVA/791-1087SV------------------------------------------NLPI..GGLA.GLQ........PKLT.....VAERA
Q7PSA4_ANOGA/2506-2929CS------------------------------------------SLPP..GGLA.NLH........PRLT.....VVRKV
Q4UD92_THEAN/251-554CK------------------------------------------RSPL..MGFK.QLQ........PPFC.....VHKEP
A2FK98_TRIVA/1968-2204QN------------------------------------------TIPP..DGIVIKV..........RSSPPRPNQRTEQ
A3LSX3_PICST/660-977VS------------------------------------------RAPL..LGFG.SLN........PKFG.....IRNSG
A0DLU6_PARTE/3989-4284SP------------------------------------------YLPW..NAKP.............TIQ.....IEFLE
Q00Y47_OSTTA/1123-1477AP------------------------------------------RLPP..GGLA.ALQ........PRLT.....VVCKQ
SPKUL_DICDI/1577-1887MV------------------------------------------ALPL..SGFE.K...........SIS.....IIQVP
A7SNF7_NEMVE/430-737SP------------------------------------------CVPI..GGFA.ALQGL...SGANKFT.....VSKIM
A7SP65_NEMVE/115-400TS------------------------------------------KVPL..QGFA.ALEGM...NGFQKFQ.....IHRDD
A2ERB6_TRIVA/1571-1861MS------------------------------------------QVP..........S........GDLS.....IVLSS
Q4Q7L2_LEIMA/1091-1400MT------------------------------------------RPPL..LGFR.FLA........PPFK.....VQLLA
Q9CYM1_MOUSE/752-912..------------------------------------------TVSL..EGLQ..........................
Q54KP2_DICDI/1482-1898SP------------------------------------------HLPL..QGFK.GLI........PRLT.....IVKKH
A4VDG4_TETTS/2059-2356SM------------------------------------------NLPH..GGFK.QF..........PIT.....ITLTQ
Q22F29_TETTS/3398-3694SF------------------------------------------KVPF..GGFK.NL..........QLE.....IAKID
A0DLB8_PARTE/2812-3098SK------------------------------------------YSNF..ENFKIEIQ........TNLE.....FQKNR
A5DS31_LODEL/333-694SP------------------------------------------RLPI..GGFK.SLR........PELT.....VVRKM
A2DQ30_TRIVA/383-682LT------------------------------------------VAPV..GGLK.NV..........PIT.....IEY..
UBR5_MOUSE/2479-2792SP------------------------------------------SLPASEEGFQPMP..........SIT.....IRPPD
Q54GG5_DICDI/425-720GD------------------------------------------RVPY..GGLE.KM..........SFT.....ITK..
Q5CW92_CRYPI/1231-1561SR------------------------------------------KAPL..LGFQ.HLN........PKFG.....IQIVP
A2E5Q8_TRIVA/658-966RS------------------------------------------RLPPSGSSNQ..............FK.....FTVDS
A0BRI8_PARTE/1050-1354LP------------------------------------------LAPI..GGFQ.NQE........KKIQ.....IRRFN
A7SML1_NEMVE/1229-1585SP------------------------------------------RLPV..GGFR.SLN........PPLT.....IVRKT
A2FIB4_TRIVA/386-683AD------------------------------------------YSPI..GGLG.TI..........KLV.....IEK..
A2DAL9_TRIVA/1571-1869AH------------------------------------------TIPI..GGYE.FMKAQ...GRQPKLK.....LAPMT
A2D760_TRIVA/795-1094SS------------------------------------------KLPI..GGLA.NLR........PKLT.....IARK.
Q01B14_OSTTA/546-834SP------------------------------------------LLPV..GGFANLQP.......QWRCW.....IDSSA
A0DH95_PARTE/2-219QE------------------------------------------RLPANDEEFDRNQ.........IRFMIKPSTVNTKQ
O17736_CAEEL/692-1001CS------------------------------------------RAPV..DGFK.SIQ........PRMG.....VLVIP
A8BIP6_GIAIC/2319-2632SS------------------------------------------RIPP..IGFEPEL..........KVQRLAADGETPD
A2FPQ0_TRIVA/408-705TD------------------------------------------KAPV..GGLA.QT..........HLV.....IQR..
A2F5A6_TRIVA/682-951SA------------------------------------------KLPV..GGLA.ALT........PKLE.....LQLKK
Q580A5_TRYB2/986-1286CP------------------------------------------QLPL..NGLDGLG.........RKITVVRKELEGRG
A2F7U9_TRIVA/2273-2579LT------------------------------------------RLPN..SSINSSF..........VLK.....IDKLE
A5D6V3_DANRE/704-994TE------------------------------------------RVPA..GGFS.KR..........ALK.....ISQTD
A2F3N1_TRIVA/2072-2351SR------------------------------------------NPKA...................KIH.....VHFDR
Q9W196_DROME/819-1122CS------------------------------------------RPPL..LGFK.DLD........PPFF.....IQNTG
Q381G0_TRYB2/3834-4128QK------------------------------------------RPPL...................AAK.....IRVLQ
A2EDQ8_TRIVA/2183-2490LT------------------------------------------RLPN..STLNPDF..........KLK.....IDLKD
A2EM50_TRIVA/2501-2807TT------------------------------------------QIPS.NAKYP.............FLI.....VDYNR
A2EQW9_TRIVA/2209-2511MT------------------------------------------RIPN..PAINLGF..........KLF.....VNFEA
Q54QF1_DICDI/778-1120SS------------------------------------------SVPL..GGFY.QLC........PHFT.....INLTP
Q8SR14_ENCCU/2104-2410TS------------------------------------------TLPF..EGFS.HLQGN...NEVQKFS.....IHKVS
A2DAJ9_TRIVA/133-438LT------------------------------------------RFPN..KELNPTF..........HIQ.....I..KS
Q580G4_TRYB2/3999-4304AS------------------------------------------RVPH..GGFS.NLESSN..GSPQRFT.....VSRWA
A8BLR8_GIAIC/875-1158SD------------------------------------------RVPA..GGVQNI...........GLK.....IIPNG
A2E5X8_TRIVA/301-578NT------------------------------------------TKPD...................SIT.....VHFYD
Q4PHJ7_USTMA/908-1208SP------------------------------------------NPPL..LGFS.QLN........PLFA.....IRKAG
A7RSK9_NEMVE/1024-1329RS------------------------------------------RLPANVGDITQRF..........QLVKLDRGVDS..
Q2GVQ3_CHAGB/742-1078SD------------------------------------------RLPA..LGAA.............SLA.....IRVAC
A0D383_PARTE/180-477SY------------------------------------------RIPV..NGFS.KLESNR..GMYSKFQ.....IVPID
A2E4I7_TRIVA/2634-2943RE------------------------------------------NLPFNPPSKP.............LLN.....ICYMN
Q019K0_OSTTA/1236-1531YT------------------------------------------HLPH..SGFE.GL..........NFK.....VRFDD
A2DBI7_TRIVA/375-665SD------------------------------------------RAPM..GGLK.KV..........IIY.....IHYSG
A2G1R0_TRIVA/764-1050SE------------------------------------------RLPP..GGLP.ALS........PPIV.....VGRRD
A4VD17_TETTS/793-1095CE------------------------------------------RPPL..LGFQ.NLE........PSFT.....VVKVS
A8BYQ3_GIAIC/636-950SA------------------------------------------RAPV..GGLS.RL..........RFK.....ITL..
PUB2_SCHPO/367-671TS------------------------------------------RLPL..SGFK.DMHGS...DGPRKFT.....IEKVG
Q00WR0_OSTTA/203-456CS------------------------------------------NTPL..LGF...........................
A2FG81_TRIVA/782-1072CA------------------------------------------HLPV..KGLA.GLE........PKLT.....IAKRI

PF09814

A4D9F3_ASPFU/21-420SS------------------------------------------------------------------------------
UBE3D_HUMAN/13-385SD------------------------------------------------------------------------------
A5DDI0_PICGU/5-350IE------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-363DD------------------------------------------------------------------------------
Q0TZD4_PHANO/225-279..------------------------------------------------------------------------------
Q29GF2_DROPS/8-386AH------------------------------------------------------------------------------
Q6CWI5_KLULA/6-349KN------------------------------------------------------------------------------
A1CJR3_ASPCL/19-424AL------------------------------------------------------------------------------
Q9VWP0_DROME/9-390AQ------------------------------------------------------------------------------
UBE3D_PONAB/13-385SD------------------------------------------------------------------------------
Q6FK88_CANGA/6-347PP------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-382LT------------------------------------------------------------------------------
Q4P6X1_USTMA/1030-1417DQ------------------------------------------------------------------------------
YHFA_SCHPO/4-322SS------------------------------------------------------------------------------
A7TPW1_VANPO/6-340SK------------------------------------------------------------------------------
Q75DV5_ASHGO/6-339GR------------------------------------------------------------------------------
YJ9I_YEAST/7-342NR------------------------------------------------------------------------------
Q16XY0_AEDAE/12-444QD------------------------------------------------------------------------------
Q5B919_EMENI/28-412SS------------------------------------------------------------------------------
A5DWX9_LODEL/10-366EA------------------------------------------------------------------------------
Q5PQ45_XENLA/37-407ND------------------------------------------------------------------------------
Q6C9F9_YARLI/6-329GR------------------------------------------------------------------------------
Q59X25_CANAL/5-343KE------------------------------------------------------------------------------
UBE3D_MOUSE/13-364GD------------------------------------------------------------------------------
UBE3D_BOVIN/13-385ND------------------------------------------------------------------------------
A7USM4_ANOGA/14-434ED------------------------------------------------------------------------------
A7SC58_NEMVE/7-362KA------------------------------------------------------------------------------
Q5EAZ8_DANRE/20-391KD------------------------------------------------------------------------------

PF00632

HACE1_MOUSE/602-909................................................................................
Q7QE66_ANOGA/554-863................................................................................
NEDD4_HUMAN/1013-1318T...............................................................................
A4IBF5_LEIIN/1897-2310NAFVDEHTEALRGEAAAATTSSSGGGGTLDMEGEEDDGGGGLMGGLYDHTAQSDVEDSPSGKREAPHRMFSPVYPAASEE
A4IC88_LEIIN/3812-4131D...............................................................................
Q4WHR7_ASPFU/967-1337VG..............................................................................
A4HPV4_LEIBR/2168-2551VDNSVADLSVTPTAHSFGT..........................................................SAA
A4HF82_LEIBR/3619-3949E...............................................................................
A4IAG7_LEIIN/1051-1369MES.............................................................................
UBE3B_HUMAN/736-1068VSDDQDTGDTLGSV..................................................................
A3GHK0_PICST/646-950KD..............................................................................
UPL3_ARATH/1518-1888SSTSSAAAN.......................................................................
Q0UNY9_PHANO/908-1229D...............................................................................
Q9BL11_CAEEL/717-1019SA..............................................................................
A0EFC1_PARTE/672-969HGE.............................................................................
Q2GSX9_CHAGB/694-1033RD..............................................................................
Q5KIA2_CRYNJ/1499-1843HEPP............................................................................
HUL5_YEAST/607-910TE..............................................................................
Q38D88_TRYB2/1472-1912HMPTLPDASHTEGNGKDGSNGGR..................................................KGGDRSR
A0E799_PARTE/3885-4178NL..............................................................................
Q00WM5_OSTTA/458-763AD..............................................................................
A2DUY0_TRIVA/771-1054EDI.............................................................................
Q6BGB8_PARTE/609-908IHHQ............................................................................
A2FLN6_TRIVA/2545-2849SE..............................................................................
Q7PSQ3_ANOGA/541-897DV..............................................................................
Q6NNZ7_DROME/211-561LDEN............................................................................
A4IBT8_LEIIN/1017-1343D...............................................................................
A0D2G1_PARTE/170-483FD..............................................................................
K0317_MOUSE/512-823T...............................................................................
A2FVL0_TRIVA/2315-2604NV..............................................................................
Q8SS57_ENCCU/454-746CD..............................................................................
Q4E2E5_TRYCC/2646-2975D...............................................................................
A2F794_TRIVA/2662-2959D...............................................................................
TOM1_YEAST/2962-3268GS..............................................................................
A7SQ93_NEMVE/299-612TAH.............................................................................
A2DAV4_TRIVA/452-719................................................................................
Q6C901_YARLI/697-1001SGP.............................................................................
A0DAX5_PARTE/100-320N...............................................................................
Q6C8U2_YARLI/491-779TN..............................................................................
Q9W0H2_DROME/761-1058TP..............................................................................
A0BRN4_PARTE/3724-4023DL..............................................................................
A2FJ59_TRIVA/1204-1414K...............................................................................
Q6PDJ9_MOUSE/738-1060GTAG............................................................................
A4S7N1_OSTLU/131-443CEASMFA.........................................................................
A2FR71_TRIVA/373-670TP..............................................................................
A0DNI8_PARTE/201-510YT..............................................................................
Q5BG86_EMENI/848-1165LGD.............................................................................
A5K4K7_PLAVS/1441-1991D...............................................................................
Q55NG7_CRYNB/3037-3342GK..............................................................................
A2DQ34_TRIVA/412-708TN..............................................................................
A7AV31_BABBO/1338-1643DN..............................................................................
A2E999_TRIVA/2659-2965................................................................................
A2F3T0_TRIVA/1939-2179PIPD............................................................................
A2FXS6_TRIVA/392-692CD..............................................................................
Q6NVK6_XENTR/557-856NGP.............................................................................
A2DWM0_TRIVA/796-1093PEGK............................................................................
A2DYB1_TRIVA/1674-1977D...............................................................................
A2EEN6_TRIVA/766-1053DG..............................................................................
A4I8L1_LEIIN/3799-4087N...............................................................................
HUL4_ASHGO/526-839SG..............................................................................
A2DKE7_TRIVA/929-1162S...............................................................................
Q247X9_TETTS/2115-2420CN..............................................................................
A5K5J0_PLAVS/8258-8564G...............................................................................
A2DXG0_TRIVA/2382-2669K...............................................................................
A4RVZ5_OSTLU/490-781D...............................................................................
UPL7_ARATH/828-1142CDTSLWA.........................................................................
MUG30_SCHPO/482-807LGP.............................................................................
Q6GP47_XENLA/736-1028VP..............................................................................
A3FPU7_CRYPI/497-797HGP.............................................................................
Q38A01_TRYB2/1526-1868VEVAPGEATNQLDTTN................................................................
A1CTM1_ASPCL/1468-1817SEPP............................................................................
A2ECJ9_TRIVA/791-1087PDKG............................................................................
Q7PSA4_ANOGA/2506-2929DA..............................................................................
Q4UD92_THEAN/251-554D...............................................................................
A2FK98_TRIVA/1968-2204Q...............................................................................
A3LSX3_PICST/660-977SD..............................................................................
A0DLU6_PARTE/3989-4284TM..............................................................................
Q00Y47_OSTTA/1123-1477PAPAVGSSSDS.....................................................................
SPKUL_DICDI/1577-1887L...............................................................................
A7SNF7_NEMVE/430-737G...............................................................................
A7SP65_NEMVE/115-400RN..............................................................................
A2ERB6_TRIVA/1571-1861GG..............................................................................
Q4Q7L2_LEIMA/1091-1400MNA.............................................................................
Q9CYM1_MOUSE/752-912................................................................................
Q54KP2_DICDI/1482-1898HSPP............................................................................
A4VDG4_TETTS/2059-2356K...............................................................................
Q22F29_TETTS/3398-3694N...............................................................................
A0DLB8_PARTE/2812-3098................................................................................
A5DS31_LODEL/333-694AEDG............................................................................
A2DQ30_TRIVA/383-682SG..............................................................................
UBR5_MOUSE/2479-2792D...............................................................................
Q54GG5_DICDI/425-720TA..............................................................................
Q5CW92_CRYPI/1231-1561D...............................................................................
A2E5Q8_TRIVA/658-966N...............................................................................
A0BRI8_PARTE/1050-1354CDFN............................................................................
A7SML1_NEMVE/1229-1585FEPP............................................................................
A2FIB4_TRIVA/386-683EK..............................................................................
A2DAL9_TRIVA/1571-1869GD..............................................................................
A2D760_TRIVA/795-1094DDG.............................................................................
Q01B14_OSTTA/546-834P...............................................................................
A0DH95_PARTE/2-219PN..............................................................................
O17736_CAEEL/692-1001SS..............................................................................
A8BIP6_GIAIC/2319-2632TKPE............................................................................
A2FPQ0_TRIVA/408-705SA..............................................................................
A2F5A6_TRIVA/682-951EE..............................................................................
Q580A5_TRYB2/986-1286E...............................................................................
A2F7U9_TRIVA/2273-2579R...............................................................................
A5D6V3_DANRE/704-994CPD.............................................................................
A2F3N1_TRIVA/2072-2351S...............................................................................
Q9W196_DROME/819-1122D...............................................................................
Q381G0_TRYB2/3834-4128G...............................................................................
A2EDQ8_TRIVA/2183-2490C...............................................................................
A2EM50_TRIVA/2501-2807V...............................................................................
A2EQW9_TRIVA/2209-2511QLS.............................................................................
Q54QF1_DICDI/778-1120PIQ.............................................................................
Q8SR14_ENCCU/2104-2410DR..............................................................................
A2DAJ9_TRIVA/133-438S...............................................................................
Q580G4_TRYB2/3999-4304DS..............................................................................
A8BLR8_GIAIC/875-1158D...............................................................................
A2E5X8_TRIVA/301-578DG..............................................................................
Q4PHJ7_USTMA/908-1208DD..............................................................................
A7RSK9_NEMVE/1024-1329................................................................................
Q2GVQ3_CHAGB/742-1078L...............................................................................
A0D383_PARTE/180-477YK..............................................................................
A2E4I7_TRIVA/2634-2943D...............................................................................
Q019K0_OSTTA/1236-1531KL..............................................................................
A2DBI7_TRIVA/375-665D...............................................................................
A2G1R0_TRIVA/764-1050GH..............................................................................
A4VD17_TETTS/793-1095SE..............................................................................
A8BYQ3_GIAIC/636-950NGD.............................................................................
PUB2_SCHPO/367-671H...............................................................................
Q00WR0_OSTTA/203-456................................................................................
A2FG81_TRIVA/782-1072TEGG............................................................................

PF09814

A4D9F3_ASPFU/21-420---------------LSLEE----VRLP...EYVY-EAVERDL----------EARNEMLPASAR..AFRE........W
UBE3D_HUMAN/13-385---------------ISVHP----LTLP...SATC-LELLLIL----------SKSNANLPSSLR..RVNS........F
A5DDI0_PICGU/5-350---------------MPTEE----IRVP...GVVL-DDCITRL----------QEINSQLPLGHR..SAAVAG....KNL
Q6BMI9_DEBHA/5-363---------------ESIES----VVLQ...DDVF-NDFSKQL----------SKINNFIPNLKK..TMTLKLDEEVKIF
Q0TZD4_PHANO/225-279---------------.....----...........-.......----------........DFAR....AV........W
Q29GF2_DROPS/8-386---------------QDVSQ----FEIS...PKMF-MELRQRL----------DRNAEYQPMEWRRSAMEE.......NL
Q6CWI5_KLULA/6-349---------------QNIAE----LKVE..ENSAL-INFIQHL----------ESVNRQLPEELR..LLNE........W
A1CJR3_ASPCL/19-424---------------LSVEE----VRVP...VDVM-RELRGVL----------EERNAMLPGSAR..EFRE........W
Q9VWP0_DROME/9-390---------------QTLPQ----MDVS...PNMF-LKIQKRL----------ETNGHLIPDALS...TNCAE....EHL
UBE3D_PONAB/13-385---------------ISVHS----LTLP...SATC-LELLLIL----------SKSNANLPSSLR..HMNS........F
Q6FK88_CANGA/6-347---------------SSMED----IQLS...DDLL-DSFLQQL----------TKIHELIPENLK..MFNG........W
Q7SDG7_NEUCR/13-382---------------GDAQE----VNLP...TEAI-KEVVERL----------DRSNCLLPTTER..VFKE........W
Q4P6X1_USTMA/1030-1417---------------QVTDT----IHLP...PAVF-GWLMQAM----------HECSASLPNQLA.KVLPD........W
YHFA_SCHPO/4-322---------------EDWMD----IPVS...SHAF-DEISHVL----------EKGNLSFPVSAQ..KFGP........W
A7TPW1_VANPO/6-340---------------VNIEN----ISVM...ELPY-NDFIENI----------KNVNKSIPEDAR..SLNG........W
Q75DV5_ASHGO/6-339---------------QHIES----MTMP...DACF-DDFVKRL----------ETTNATLPLRCG..KMGN........W
YJ9I_YEAST/7-342---------------QVVEE----LDFQ...ETSF-NAFYSAL----------QHTNALLPSSMK..KIGE........W