Sequence alignment for CL0552

PF00632

Q9BL11_CAEEL/717-1019ILVMRK.........IL.QSDY..GMF........SE.DEESHLVWFSGLPSE...........................
UBR5_MOUSE/2479-2792SVVDMDLEDTDDGDDNA.......PLF....................YQPGKRGFY........................
A0EFC1_PARTE/672-969RLMMEK.........LI.SPDY..GMF........IP.KNNGTMYWFNPQSF............................
Q54GG5_DICDI/425-720QLIVRK.........IF.DPEY..GMF........KY.NTTTNCFWFNPDS.............................
Q2GSX9_CHAGB/694-1033TSVTTE.........AF.TPNE..GLF........I..ANSKNSYYPNPCSIDQSKNALQE...................
Q4WHR7_ASPFU/967-1337RVLMAE.........AL.NPSY..GMF...........TMDARTRISWFQ..............................
Q5KIA2_CRYNJ/1499-1843ALASKE.........FA.RRNL..HVWRD...EDPS...........IAGNYVHHPHGLF....................
Q5CW92_CRYPI/1231-1561TSISKE.........LC.SESF..GLFKSCKDNTIIPREYDSLIEISNKFKDLLIDEP......................
A2E5Q8_TRIVA/658-966SEVSLD.........LR.NPNC..GFVCPTPNSISQVGYYRDKFIFVPTN..............................
A0BRI8_PARTE/1050-1354QLLTKQ.........IV.DPNN..KLF.........VPTSNKLFYQINRESYQ...........................
HUL5_YEAST/607-910TTVSDE.........GFKDPKH..ELF........R..TNDRYELYPSVVYD............................
A7SML1_NEMVE/1229-1585ALVSKE.........FQ.RSSM..EMWRGTEVAPPVTEDADGGI...KYVYSESGLFPIPI...................
Q38D88_TRYB2/1472-1912TLIARE.........LT.KCRL..RLWNNSSRSSTTHESGDS.....CGNRQLRSKSNSGTFDDEQRVESRPEGLFPCSS
Q00WM5_OSTTA/458-763SILARE.........VF.NPNI..ALF.........ELSHDKGCYQPNPNSVV...........................
Q6BGB8_PARTE/609-908TRVVNQ.........AL.DPTF..GLF........I..ETPEKTMIPNPAFM............................
A2FIB4_TRIVA/386-683FKLTEI.........AF.SPDY..GMF........RY.V.NSKYYWFVPESK............................
L9KS41_TUPCH/1283-1677FLLSQE.........LF.NPYY..GLF........EYSANDTYTVQISPMSAFVENHLECGRFQAKHHLKKSMENYGHCV
A2DAL9_TRIVA/1571-1869TSFAEE.........MV.KPER..GLF.........IPSINNCSYTINP...............................
A4VDG4_TETTS/3915-4210.LIFNQ.........LL.DPNF..GLF.........VQSKKNYTYMPNPFSFL...........................
A2FLN6_TRIVA/2545-2849TEACME.........IM.DPSM..QLFIQTPNKRRKIATAQDYLIPNPSP..............................
A4IBT8_LEIIN/1017-1343LILVKK..................ALVCAASEEAGAASPHSAGSPVSSGTAAASASASNEPGIR................
A4IC88_LEIIN/3812-4131SEMCRE.........LM.SGRL..PFFVPTANHVHNTGSHREAYVPAASA..............................
F6U235_XENTR/611-908.LVVEE.........IF.NPDI..GMF........TY.DESTKHSWFNPSSF............................
A0D2G1_PARTE/170-483TSILQQ.........LVDQ.....GYL........QKTDTKELTYKFNPNV.............................
A4HF82_LEIBR/3619-3949QLCSHS..................TIFTVVPNMSALYASEAAADGVES................................
Q8SS57_ENCCU/454-746QLLSQE.........IKEDE....RLF.........EHTENRIWIRPH................................
AREL1_MOUSE/512-823ELICKA.........LF.DTTS..QLF.......ARFTDSNQALVHPNPNRP............................
Q4E2E5_TRYCC/2646-2975TMMCDELNYREEDDGRRVDPLL..PFFRLTGHTTMAGVVPNMDFYRENPE..............................
A7SQ93_NEMVE/299-612LLLVRK.........IF.KPEY..GMF........SC.NDKSRLYWFNKECL............................
TOM1_YEAST/2962-3268QVLSRQ.........MF.NPDY..ALF........LPVPSDKTTFHPNRTSGI...........................
Q6C901_YARLI/697-1001LLLKTA.........LF.NPAR..NLF........VE.DEESHYCWFNPGCKA...........................
Q9W0H2_DROME/761-1058MLLLKD.........LL.DPKY..GMF........KE.YEQSRLLWFADLTF............................
A0BRN4_PARTE/3724-4023SLIGNELK.....GENLKSEQY..GYF....................SMLAPGYYY........................
NEDD4_HUMAN/1013-1318FLISKE.........MF.NPYY..GLF........EYSATDNYTLQINPNSGLC..........................
O17736_CAEEL/692-1001SELLKT.........AF.NVER..GFF........T..FTESKLLYPNPTAPFL..........................
A2FPQ0_TRIVA/408-705YLITAE.........LF.NPDH..GMF........TL.I.DNSFYWFNISSI............................
A2FR71_TRIVA/373-670YLLVNA.........VF.SPDY..GMF........RI.I.NQNTYWFVHSDF............................
Q7PSQ3_ANOGA/541-897YLLSHE.........ML.NPQY..GLF........QYSRDDHYSLQINPDSYLKQRKTIHFF..................
Q247X9_TETTS/2308-2606TFLNNK..................ELF.........TFTPNQMSVYPNKD..............................
A0DNI8_PARTE/201-510NLIMKE.........IV.HPES..GMF........QLADCEDVSYKINCEA.............................
A5K4K7_PLAVS/1441-1991ILLCRE.........IL.HAKF..FLF........D..YVHNGTLYPKRFHS............................
A2DQ34_TRIVA/412-708YLLTSQ.........IF.SPDY..GMF........TT.I..NGYYWFSITPF............................
Q5KBV2_CRYNJ/2952-3249.VLAQQ.........IF.DPNF..ALF........EPCAADQQTYQPNKTSWI...........................
A2FXS6_TRIVA/392-692HLICQT.........LF.SSDY..GMF........EL.Y.GNHYLWFTPLASS...........................
A4VD17_TETTS/789-1090.DLSKI.........VF.DPNY..GMF.........RLVENNQKLCPNQDSLEF..........................
A2F7U9_TRIVA/2273-2579TECATS.........IF.EKTS..CLCFPVPNARHHRGQFKDLFVPYDE...............................
Q9W196_DROME/819-1122SELIKT.........AF.DPNR..GFF........M..VTTDNKLYPNPNVADL..........................
A2DYB1_TRIVA/1674-1977TSLIHQ.........LF.NPNY..VLF.........APSANGRSFQPNPASNIN..........................
A2EDQ8_TRIVA/2183-2490TEAAAS.........IF.EPTT..LLAISTPNMRNHTGQYKDVYIPFDK...............................
A4S7N1_OSTLU/131-443SQVTEQ.........GL.DPNR..GLF........QSNATG..LIYPSPRAGD...........................
A2EM50_TRIVA/2501-2807SELAKD.........IC.DPNI..GLFVSTPNFVNHRGSFRECIVPNPIS..............................
Q0UNY9_PHANO/908-1229RVVLSE.........AF.KPDH..GMF...........TLDPQTRMTWFQ..............................
A2EQW9_TRIVA/2209-2511NEIAIS.........IF.QSQS..KLFILSPNGRNHSGGMRDVYIPFSSL..............................
HUL4_ASHGO/526-839LLLTRD.........LF.NPNN..GLF........VY.VPESRLCWFSIMESIEHEL.......................
Q7QE66_ANOGA/554-863YLLSRQ.........LF.SPYR..NMF........EYSANDIYTVQIAPERPTD..........................
A2E4I7_TRIVA/2634-2943LDAINE.........SI.IPSI..GLFIQCPNSKFPNSENFDCLIPVPDP..............................
A5K5J0_PLAVS/8258-8564SILAKE.........IF.NPNY..ALF........CREGKKSEFNHPNPLSYI...........................
Q54QF1_DICDI/778-1120....EE.........LANTPLNGYHLF.........QEYSNSNKYHPSPFSNL...........................
UPL7_ARATH/828-1142TDITKA.........AF.ATEY..GLF........SQTPTSDRLLVPSPSARH...........................
Q8SR14_ENCCU/2104-2410VLLAKD.........LL.DPNF..ALF........EFATEDKTTVVPCKNSYV...........................
MUG30_SCHPO/482-807LLLTRK.........VF.SPEF..GLF........VNCEESSNYLWFNYSHR............................
A3FPU7_CRYPI/497-797QLLVQE.........IF.NIDF..GMF........IY.YEDTRLFWFNMASL............................
Q38A01_TRYB2/1526-1868NLLARK.........FQ.DVQL..HMWRTEEFTDESAKTARRVQLPLFPSL.............................
A1CTM1_ASPCL/1468-1817STVSKE.........FS.KKKL..KIWRENDCNNDE...........EFAFGRRGLFPA.....................
A2DAJ9_TRIVA/133-438IELANS.........IF.QPTS..HLFIQSPNGRNHCGSFRDAYVPSTT...............................
Q7PSA4_ANOGA/2506-2929ALVAAE.........LQ.RSDL..GMWLCDDEEPKLIEDEIDLGEGSKPVGYYVRRSTGL....................
UPL3_ARATH/1518-1888TLLSHD.........LQ.KASL..GMWRSSSGDKVSMQIGRDEIEDGKPSAANRDIVLAPLGLF................
C8VT87_EMENI/782-1089.LLVRE.........VF.DPHH..GLF........IY.DEDSRYCYFNPYCL............................
Q22F29_TETTS/3359-3651...LND.........IL.DPQK..GLF.........KLSSNGVTMQPSPTSFL...........................
Q4UD92_THEAN/251-554ITLCTL.........IF.DPTY..GIF........E.EVPEERSYYPCPNSGII..........................
Q580G4_TRYB2/3999-4304QLIAEE.........MV.NDNY..ALF.........IHSREGMTYQPNPLSGV...........................
Q4PHJ7_USTMA/908-1208TSLVRE.........AF.DTNR..GLW..........KATDAQELYPNPHTYAT..........................
A3LSX3_PICST/660-977TSVVRE.........GF.DPSNELELF........K.ETISDNQIYPNDDIHKSITVG......................
A2DBI7_TRIVA/375-665YILTNE.........LI.KPDL..KLF........QE.TKTG..YWFVPGG.............................
A0DLU6_PARTE/3989-4284NKVGE..........LMKSQSN..GFF.........RLNAKSQTYFFSPKF.............................
HACE1_MOUSE/602-909DILSNE.........IV.NPDY..ALF.........TQSADGTTFQPNSNSYV...........................
UBE3B_HUMAN/736-1068EEIIKR.........VF.DPAL..NLF........K.TTSGDERLYPSPTSYI...........................
Q00Y47_OSTTA/1123-1477TLLSKQ.........FK.RRKL..QLWRDSGIANEE...........DLVVAPHGLFPA.....................
A4IAG7_LEIIN/1064-1369FWFVTEDDGGADPVTLPFPTTK..ALF.....................................................
A7SNF7_NEMVE/430-737SLHSSS.........VAGNPEDQEKTWMKC..EEWNPETNVSVALRLK................................
A2ERB6_TRIVA/1571-1861SSFISS.........IF.DEKD..SYFYLNERGRHEPKKIIDESLIDD................................
A3GHK0_PICST/646-950LLLTRA.........LF.NPQA..GMV........YN.IEDSNYLWFNLVPI............................
A7AV31_BABBO/1338-1643DKFTFD.........MFRRASKGTSSYNSAGQSAIITASCQKDTFTIR................................
Q4Q7L2_LEIMA/1091-1400VSLCKE.........GF.AAEY..GLF........R..QTPDGYVYPNSFSAVAT.........................
A8BYQ3_GIAIC/636-950NLICDE.........MF.SKAL..DLF.........EENQETHSFYFNRKNGTVAEG.......................
PUB2_SCHPO/367-671YILSHA.........IF.NPGY..SLF........EYATDDNYGLQISPLSSV...........................
Q54KP2_DICDI/1482-1898TLVSKE.........LQ.RKDL..NLWYTDNNDQIPDEDDDKMKIDSTISTTSTIPPISPIISTTTISSTTTTTTTTTPP
A5DS31_LODEL/333-694ATVSKE.........FI.RKKL..KLWRDQSLSNFGSKKGLE.....LNDPYIINSNGLFP...................
A2DQ30_TRIVA/383-682GLISQQ.........MI.DPSF..SMF........T..VVNGSYHWFNIMFK............................
A4HPV4_LEIBR/2168-2551ELIAEE.........LL.NPQH..GLWRTEPIPIDELTDSPTLKTTHSPDRSISLSTHSGAAV.................
A4IBF5_LEIIN/1897-2310YDLSKA........AFLVDRNV..GLM....................RDYV.............................

PF09814

E3QET8_COLGM/12-396ELLANI-------------RQL--SVAVS....LPSPAGS.H.....TRGL..---------------------------
G1XBI8_ARTOA/9-371ELLPNI-------------KQV--SVSIE....SKDGETPTS...........---------------------------
B0WGJ1_CULQU/12-440ELRPRL-------------QSA--NFFICFSRRFVEIKSTK............---------------------------
N1JPA0_BLUG1/11-395ELLSNI-------------KQV--SILAS....LTYPCDE.N.....TKVE..---------------------------
E2C3X0_HARSA/7-363ELRPRL-------------QSC--NAFIAMRKDLD..LKDVQ...........---------------------------
F6PJX9_CIOIN/15-512EVYDRI-------------HAV--DLVLR....GSDHPDSIE...........---------------------------
V5G5H4_BYSSN/14-444ELLPNI-------------RQL--TLYVS....LPSDSDTKNEDGDRLKPE..---------------------------
C0NUQ4_AJECG/14-505ELLPNI-------------RQI--TLHVS....LPASSRLAQ.....SSITSD---------------------------
J3NIY5_GAGT3/10-441ELLSNI-------------RQV--SVVAS....LPSARNA.S.....TKAM..---------------------------
K1WUW9_MARBU/11-367ELLSNI-------------RQI--SVIVA....LEGVCES.A.....TKAE..---------------------------
F2SJ85_TRIRC/16-423ELLANI-------------RQI--RFYVT....TKDAVRNDS......RPV..---------------------------
Q7SDG7_NEUCR/13-420ELLSNI-------------RQI--SLAIS....LGSASDA.S.....TRVV..---------------------------
G3Y5B6_ASPNA/22-417ELLPNI-------------RQL--TLYIS....VPPKTPRSN.....LQ....---------------------------
N1QJ23_SPHMS/6-367EHLFNI-------------HAI--SIQAV....LPSPSNK.E.....TCAT..---------------------------
W5NKD6_LEPOC/13-376ELRTRL-------------QSG--LLVLS..KDLAKDLSEVQ.....LLCG..---------------------------
F7E020_XENTR/11-384EIRKHM-------------QTA--SLILG.SGLDG.FPVDVS.....LG....---------------------------
A1CJR3_ASPCL/19-424ELLPNI-------------RHI--TLYIS....LPSHLNTNN.....TSPT..---------------------------
Q59X25_CANAL/5-333EYLPRL-------------NSI--SVALD........................---------------------------
M2R8N7_COCSN/64-446ELLLHI-------------RTV--TLFAS....LRTNHSR.Q.....TDAK..---------------------------
A7TPW1_VANPO/6-340EELPRV-------------DSL--NILVD....G...RVPVR.....VVSL..---------------------------
G8BQA7_TETPH/7-357EYLPRI-------------GNI--SIIIE....S..............SQG..---------------------------
H2L971_ORYLA/17-387ELRKRL-------------LSG--LLIVR..KEVAGAADDVL.....VT.G..---------------------------
B4JWU6_DROGR/9-387EFRPNL-------------CCG--QICLQFDEPIRN.CKNTR...........---------------------------
A7USM4_ANOGA/14-434ELRPRL-------------QCA--NFFISFPRKFVDIESTT............---------------------------
H3AB66_LATCH/13-373EIRKRM-------------QSG--HLVIR.K...GPSAMDIS.....VK....---------------------------
H2RRY7_TAKRU/13-391ELRKRL-------------QTG--LIIVGYRKEVTTHPGDVA.....VT.G..---------------------------
G8ZSN1_TORDC/12-350.HLPRI-------------GTT--SIDIC....A.VGQPVIV.....SRGP..---------------------------
F2UGQ3_SALR5/7-362EARPSV-------------CSG--HLFVR........................---------------------------
N1QC82_MYCFI/8-372EHLVNI-------------RAL--SLQAA....LSTVSNQ.Q.....TRAT..---------------------------
H0ZQP0_TAEGU/10-365EIRRET-------------QSA--LLVIR.AAELPSAPAEVS.....VC....---------------------------
I3ITZ6_ORENI/17-396ELRKRL-------------QSG--LLIVG..KDVAQTPADVA.....VT.S..---------------------------
J4G0K5_FIBRA/670-1050EYHENL-------------QHI--IVFLS....VSGIIAGVN.....LEAEVV---------------------------
S7Z7X2_PENO1/19-452ELLPNI-------------RQV--TLYVT....LPRLPALEG.....VQPQ..---------------------------
G2Y6Z9_BOTF4/11-391ELLSNI-------------RQI--SILAF....LDTPSDS.S.....TKAE..---------------------------
M1WB37_CLAP2/12-388ELLANL-------------GQV--SVAAT....LPKPPEKGD.....TRVN..---------------------------
N4UQV1_COLOR/12-396ELLANI-------------RQL--SVAVS....LPSPSDGRS.....SQGT..---------------------------
B2WD68_PYRTR/65-449ELLLHI-------------RTV--TLFAS....LRANNSK.Q.....TDAK..---------------------------
B3MZV3_DROAN/9-389ELRPNL-------------RSG--VVFLQFDHDIGT.CNQTR...........---------------------------
K0KTK1_WICCF/8-359ELLSRI-------------RSL--SIVLE....EEDSSKTPE.....IITI..---------------------------
G1TSQ5_RABIT/13-383EVRRRL-------------PSA--LLIVG.EPREG.LPMDIS.....IT....---------------------------
F4X8J5_ACREC/7-361ELRPRL-------------QSC--NVFISMRKDLC..LKNVR...........---------------------------
Q29GF2_DROPS/8-375EIRPYL-------------NCG--QVYIQLHR...NDASNMR...........---------------------------
G0VL18_NAUCC/6-337EYLPRI-------------KKI--TVILD....E.CVEPRLV.....QVKP..---------------------------
U4LVT7_PYROM/7-365ELLPNI-------------KSI--SLLIS....LPTPANA.S.....TRAT..---------------------------
S3CHW0_OPHP1/592-1021ELLVNI-------------RHV--SVSVT....LPTPGND.T.....TVVE..---------------------------
Q6BMI9_DEBHA/5-350EYLPRI-------------NSI--SVIVE......NNDPIGNLIDIRLSSR..---------------------------
I2H589_TETBL/10-369EYLPRI-------------GCI--SIVVE....G.LEDLCVQ.....KLQF..---------------------------
N1PZE3_MYCP1/9-376.HLVHI-------------RAL--SIQAS....LCTVSNQ.A.....TRAT..---------------------------
E7LWJ6_YEASV/7-342EWLPRI-------------QSI--SVVVE....G.WKQVEIK.....NLKD..---------------------------
L8FLW5_PSED2/12-403ELLPNI-------------RQI--SVLAA....LPTPSDG.T.....TRVS..---------------------------
B6QVW6_PENMQ/12-422ELLPNI-------------RQL--TLHVS....LLKSASEID....LREST..---------------------------
A5DWX9_LODEL/10-359EYLSKL-------------GQM--SVTVQ....VQTDLKLQQVLDIKLISI..---------------------------
UBE3D_PONAB/13-385EVRGQL-------------QSA--LLILG.EPKEGGMPMNIS.....IM....---------------------------
K7JNW4_NASVI/31-384ELRPRL-------------RSL--SAYISLVKNID..TSTVN...........---------------------------
C8VJ15_EMENI/28-443EYLPNI-------------RQV--SLQIS....AAGALYA........YPE..---------------------------
C5DFR9_LACTC/6-347EYLPRI-------------RTV--VITIE....S.PKEVHVK.....GLEP..---------------------------
C1FZL9_PARBD/14-476ELLPNI-------------RQI--MLHVS....LADSLFSSE.....SSGIPG---------------------------
G9NH43_HYPAI/14-393ELLSNI-------------RQV--SVRAT....LSSSSDL.T.....TKAE..---------------------------
M3ZXU8_XIPMA/13-392ELRKRL-------------QSG--LLVVG..TNVAAGPADVA.....VSRG..---------------------------
U7PMZ7_SPOS1/17-441ELLVNI-------------RQV--SVSVS....FAGPIEARQ.....TTAE..---------------------------
M7PCP3_PNEMU/15-354EALSHI-------------RVI--NLVLE....FSENIYQPS...........---------------------------
R0KID0_SETT2/64-442ELLLHI-------------RTV--TLFAS....LRTNHSR.Q.....TDVK..---------------------------
R7YJ95_CONA1/9-376EHLLNI-------------HTV--SLTAT....LQTLSNK.E.....TKAS..---------------------------
G2QZ38_THITE/12-402ELLANI-------------RQI--SLAAS....LSSPSDA.S.....TRVS..---------------------------
B4MTF5_DROWI/9-367ELRPNL-------------RCG--NAYLQFNRQLREDGRKTR...........---------------------------
W5LC11_ASTMX/13-385ELRQRL-------------QSG--LLLIR..RDAFESSTEVK.....V.SG..---------------------------
E9CUF8_COCPS/14-450EFLPNI-------------SQI--AVYVT....LADLPNSSE.....TQNI..---------------------------
J7RHU2_KAZNA/6-350ESLPRI-------------GSV--GVYVD....D.VEELVLK.....ELGP..---------------------------
J4KRH2_BEAB2/17-390ELLTNI-------------RQV--TIKAS....LPTPADH.T.....TTAE..---------------------------
Q4P6X1_USTMA/1031-1415.YIGTV-------------HDD--IVLVCGSCESESESASKS.....ESSG..---------------------------
Q9VWP0_DROME/9-380ELRPNL-------------RSG--VVFLRFDQQVSQ.SQKTR...........---------------------------
S0DNZ8_GIBF5/11-388ELLSNI-------------RQI--SVTVS....LLTSVDS.S.....TKAE..---------------------------
G0WHB4_NAUDC/6-346EYLPRI-------------GSV--NIIIE....N.VEDLIVR.....ISSE..---------------------------
E4UYL0_ARTGP/16-475ELLANI-------------RQI--RLFVT....TKGPTENDS......RPV..---------------------------
S3DDS5_GLAL2/11-450ELLSNI-------------RQV--SVIAA....LNTPSDS.S.....TRVE..---------------------------
E9IFT1_SOLIN/7-361ELRPRL-------------QSC--NVFISVKKDLC..LKDVQ...........---------------------------
G3JK97_CORMM/17-391ELLTNI-------------RQI--TVKVS....LPTPADQ.T.....TAAE..---------------------------
F1Q7U1_DANRE/13-384ELRQKL-------------QSG--LLFIR..SDVIGGGADVK.....IESK..---------------------------
Q75DV5_ASHGO/6-339EYLPRI-------------GVM--LIVVA....GEAGEVELG.....KLGG..---------------------------
B4L5I9_DROMO/9-377ELRPNL-------------SSG--HVFLQFDQEIRG.RKKTR...........---------------------------
A4D9F3_ASPFU/21-420ELLPNI-------------RHI--TFYIS....IPANLGSQN.....IQPL..---------------------------
H9KRH4_APIME/8-350ELRPRL-------------QVC--NAFIHLSKKVN..LTEIK...........---------------------------
T5AMN1_OPHSC/15-387ELLPNI-------------RQV--SVGAA....LPSPPDA.T.....TFAE..---------------------------
E9EVP5_METAR/11-386ELLSNI-------------RQV--SIAAS....LPSPPGP.R.....TVAK..---------------------------
Q6CWI5_KLULA/6-349EYHHWI-------------GAV--QLWVE....N.DGQPIAT.....EIPH..---------------------------
S8AD65_DACHA/9-377ELLSNI-------------KQV--SVSID....SPDGHSQPS.....S.....---------------------------
B4M301_DROVI/9-376ELRPNL-------------SSG--HVFLQFDQEIRD.RQKTR...........---------------------------
F8PKW0_SERL3/430-815..HETL-------------QHV--LVFVS....VGGLASNTD.....LSAEVL---------------------------
G3NNB4_GASAC/18-378ELRKRL-------------QTG--LLIVG..KNVASSPADVV.....VT.G..---------------------------
C5DRI9_ZYGRC/22-358EFLPRI-------------GTT--SVVLD....G.IKEPSLK.....YSDS..---------------------------
U1HL67_ENDPU/9-361EVLANI-------------RQA--NLYAS....LETHKNE.H.....TKID..---------------------------
H6C728_EXODN/11-373EALTHI-------------RQL--TLYAS....LETAKNE.H.....TKIL..---------------------------
G2Q453_THIHA/11-367ELLANI-------------RQI--SLAVT....LPSPCDS.S.....TRVA..---------------------------
UBE3D_MOUSE/13-364EVRRRL-------------QSA--LLILG.GPDEGGMHLDIS.....IT....---------------------------
Q16XY0_AEDAE/12-444ELRPRL-------------QSA--NFFICFSRRFAEIKTTK............---------------------------
UBE3D_BOVIN/13-385EVRRRL-------------QSA--LLILG.DSKEGGLPMAVS.....VT....---------------------------
G8YFE7_PICSO/20-360EF.SNL-------------NSI--SISIE....NDQITPSCAIKSIRTKSR..---------------------------
H2AW44_KAZAF/6-348EYLPRI-------------GII--SVVLE....G.VYSVKVE.....SVAE..---------------------------
F1NWJ5_CHICK/86-460EIRRGT-------------QSA--LLVIR.EASLRNLPADIS.....VA....---------------------------
Q6FK88_CANGA/6-347EELENV-------------GVT--LIAVE....A..............LNN..---------------------------
M4G6J5_MAGP6/10-440ELLSNI-------------RQV--SVVAS....LPSARNA.S.....TKAI..---------------------------
K5W0X4_PHACS/481-861EYHENL-------------QHI--LIFLT....VSGLQAGVE.....LEAEVV---------------------------
L9L4K4_TUPCH/13-384EVRRGL-------------QSA--LLILG.ETEEGNMSMDVS.....IM....---------------------------
F6W3S4_MONDO/6-379EIRKRL-------------QSA--LLIIR.EPKQGSLPMDVS.....LT....---------------------------

PF00632

Q9BL11_CAEEL/717-1019..........................................................FCDREQ----------------
UBR5_MOUSE/2479-2792.......................................................TPRPGKNTE----------------
A0EFC1_PARTE/672-969...........................................................EIPIY----------------
Q54GG5_DICDI/425-720...........................................................VDYTE----------------
Q2GSX9_CHAGB/694-1033.................................................AQIPENSEEWAETIT----------------
Q4WHR7_ASPFU/967-1337............................................................PCSL----------------
Q5KIA2_CRYNJ/1499-1843...................................................PSPLPRASAELVA----------------
Q5CW92_CRYPI/1231-1561....................................................LSLKKSNNILYL----------------
A2E5Q8_TRIVA/658-966............................................................NELR----------------
A0BRI8_PARTE/1050-1354.........................................................DPDHLKK----------------
HUL5_YEAST/607-910..........................................................ATKLKY----------------
A7SML1_NEMVE/1229-1585..................................................PRNARVAMVSRLKS----------------
Q38D88_TRYB2/1472-1912VP..........................KVLQRFSTDLSLSSCRDTKALTERFLCMNDFFEVDE----------------
Q00WM5_OSTTA/458-763.........................................................HPEYLSY----------------
Q6BGB8_PARTE/609-908..........................................................QEEKQK----------------
A2FIB4_TRIVA/386-683...........................................................SENSL----------------
L9KS41_TUPCH/1283-1677LPPNASLCLQHVKYTCSTCDKTKMKRQDLGIWHCGFCIKIVAGGAWTYTTTLAVTVKSAIRRLK----------------
A2DAL9_TRIVA/1571-1869..............................................................SC----------------
A4VDG4_TETTS/3915-4210.........................................................VPDHLIY----------------
A2FLN6_TRIVA/2545-2849.............................................................LTP----------------
A4IBT8_LEIIN/1017-1343...............................................SVLFSTVPYLPAPDADG----------------
A4IC88_LEIIN/3812-4131.............................................................RSA----------------
F6U235_XENTR/611-908...........................................................ETEGQ----------------
A0D2G1_PARTE/170-483...........................................................QSNTI----------------
A4HF82_LEIBR/3619-3949...............................................................S----------------
Q8SS57_ENCCU/454-746...............................................................E----------------
AREL1_MOUSE/512-823...........................................................AHLRL----------------
Q4E2E5_TRYCC/2646-2975.............................................................HRL----------------
A7SQ93_NEMVE/299-612...........................................................DQDEE----------------
TOM1_YEAST/2962-3268.........................................................NPEHLSF----------------
Q6C901_YARLI/697-1001.........................................................QDGDLRE----------------
Q9W0H2_DROME/761-1058...........................................................ETENM----------------
A0BRN4_PARTE/3724-4023.......................................................IDPKFLNIP----------------
NEDD4_HUMAN/1013-1318.........................................................NEDHLSY----------------
O17736_CAEEL/692-1001........................................................LGVDCLAH----------------
A2FPQ0_TRIVA/408-705...........................................................EQTYL----------------
A2FR71_TRIVA/373-670...........................................................SEPMK----------------
Q7PSQ3_ANOGA/541-897.................................................PVLFLAAINPEHLSY----------------
Q247X9_TETTS/2308-2606............................................................AISK----------------
A0DNI8_PARTE/201-510............................................................DTDE----------------
A5K4K7_PLAVS/1441-1991..........................................................NDNLNL----------------
A2DQ34_TRIVA/412-708...........................................................EDYSA----------------
Q5KBV2_CRYNJ/2952-3249.........................................................NDVHLSY----------------
A2FXS6_TRIVA/392-692..........................................................IEDDHL----------------
A4VD17_TETTS/789-1090........................................................LGPEHLEI----------------
A2F7U9_TRIVA/2273-2579.............................................................TNG----------------
Q9W196_DROME/819-1122.........................................................FEDYEKH----------------
A2DYB1_TRIVA/1674-1977.........................................................YMEHKQY----------------
A2EDQ8_TRIVA/2183-2490..............................................................TM----------------
A4S7N1_OSTLU/131-443.........................................................THEGILL----------------
A2EM50_TRIVA/2501-2807.............................................................EWG----------------
Q0UNY9_PHANO/908-1229............................................................PGTL----------------
A2EQW9_TRIVA/2209-2511.............................................................RPF----------------
HUL4_ASHGO/526-839......................................................LQGEGSSSEL----------------
Q7QE66_ANOGA/554-863.........................................................RDDILEW----------------
A2E4I7_TRIVA/2634-2943.............................................................NNM----------------
A5K5J0_PLAVS/8258-8564.........................................................NPDHLHF----------------
Q54QF1_DICDI/778-1120.........................................................IPDYRSI----------------
UPL7_ARATH/828-1142.........................................................LENGIQM----------------
Q8SR14_ENCCU/2104-2410.........................................................NPEHLSY----------------
MUG30_SCHPO/482-807..........................................................SKEIDY----------------
A3FPU7_CRYPI/497-797...........................................................ESNGE----------------
Q38A01_TRYB2/1526-1868............................................................FQDD----------------
A1CTM1_ASPCL/1468-1817...................................................PMSEEQAASESGK----------------
A2DAJ9_TRIVA/133-438.............................................................LGK----------------
Q7PSA4_ANOGA/2506-2929...................................................FPAPLPQDSDISE----------------
UPL3_ARATH/1518-1888...............................................PRPWPSTADISEGGQFH----------------
C8VT87_EMENI/782-1089...........................................................ESSEQ----------------
Q22F29_TETTS/3359-3651.........................................................VPNHLTH----------------
Q4UD92_THEAN/251-554.........................................................HENHLEL----------------
Q580G4_TRYB2/3999-4304.........................................................NPLHLQY----------------
Q4PHJ7_USTMA/908-1208.........................................................SSDQLEW----------------
A3LSX3_PICST/660-977....................................................DDPQLQQKKLSY----------------
A2DBI7_TRIVA/375-665............................................................DQKL----------------
A0DLU6_PARTE/3989-4284............................................................QPDK----------------
HACE1_MOUSE/602-909.........................................................NPDHLNY----------------
UBE3B_HUMAN/736-1068.........................................................HENYLQL----------------
Q00Y47_OSTTA/1123-1477...................................................PMAAPRMSGKTHA----------------
A4IAG7_LEIIN/1064-1369................................................................----------------
A7SNF7_NEMVE/430-737................................................................----------------
A2ERB6_TRIVA/1571-1861................................................................----------------
A3GHK0_PICST/646-950...........................................................ENFEM----------------
A7AV31_BABBO/1338-1643................................................................----------------
Q4Q7L2_LEIMA/1091-1400........................................................SDPQHLLK----------------
A8BYQ3_GIAIC/636-950......................................................SEQWIKLSKN----------------
PUB2_SCHPO/367-671.........................................................NPDFRSY----------------
Q54KP2_DICDI/1482-1898PPTSLSS.................NTTTTITTPIIEQLTIIHQYIYSSGGLFPKPINPNITIEK----------------
A5DS31_LODEL/333-694..................................................APMDRTQILSDNGK----------------
A2DQ30_TRIVA/383-682...........................................................GDPGY----------------
A4HPV4_LEIBR/2168-2551................................................RRRPCMPLFPAAKQTP----------------
A4IBF5_LEIIN/1897-2310............................................................LEQR----------------

PF09814

E3QET8_COLGM/12-396-----------------------------------------...........ITP..DGATLQL................
G1XBI8_ARTOA/9-371-----------------------------------------...........VGLHPSKRALTV................
B0WGJ1_CULQU/12-440-----------------------------------------...........IDLAPDRITIST................
N1JPA0_BLUG1/11-395-----------------------------------------...........LSD..DGQKLTL................
E2C3X0_HARSA/7-363-----------------------------------------...........VKLSESNIALVL................
F6PJX9_CIOIN/15-512-----------------------------------------...............ISPSKIQT................
V5G5H4_BYSSN/14-444-----------------------------------------...........ISLSESRRAVTV................
C0NUQ4_AJECG/14-505-----------------------------------------TPGDLVRGNFSLSLLPSRDAVSL................
J3NIY5_GAGT3/10-441-----------------------------------------...........LLN..GGSRIHI................
K1WUW9_MARBU/11-367-----------------------------------------...........LSA..DGWQFIF................
F2SJ85_TRIRC/16-423-----------------------------------------...........VTLDSSRSLVTV................
Q7SDG7_NEUCR/13-420-----------------------------------------...........VAA..DGENVEL................
G3Y5B6_ASPNA/22-417-----------------------------------------...........ITLSDSRRAVTV................
N1QJ23_SPHMS/6-367-----------------------------------------...........IST..DGSSLTL................
W5NKD6_LEPOC/13-376-----------------------------------------................PSS.LEI................
F7E020_XENTR/11-384-----------------------------------------.................PSYLQI................
A1CJR3_ASPCL/19-424-----------------------------------------...........ITLSESRQAVTV................
Q59X25_CANAL/5-333-----------------------------------------................VQSGFNI................
M2R8N7_COCSN/64-446-----------------------------------------...........LSA..DGSYITV................
A7TPW1_VANPO/6-340-----------------------------------------................SGVKIE.................
G8BQA7_TETPH/7-357-----------------------------------------................KKIHIDA................
H2L971_ORYLA/17-387-----------------------------------------................GGSSLVV................
B4JWU6_DROGR/9-387-----------------------------------------...........LIINNGDMFFLE................
A7USM4_ANOGA/14-434-----------------------------------------...........IELATDRITIVM................
H3AB66_LATCH/13-373-----------------------------------------.................PSSLQL................
H2RRY7_TAKRU/13-391-----------------------------------------................EDSCLNI................
G8ZSN1_TORDC/12-350-----------------------------------------................GKLCVE.................
F2UGQ3_SALR5/7-362-----------------------------------------................GPSHLNV................
N1QC82_MYCFI/8-372-----------------------------------------...........LSA..DGDTLSL................
H0ZQP0_TAEGU/10-365-----------------------------------------.................ADSLEV................
I3ITZ6_ORENI/17-396-----------------------------------------................GDSSLHI................
J4G0K5_FIBRA/670-1050-----------------------------------------.P..SSGVPGKTNDATDYLLLKC................
S7Z7X2_PENO1/19-452-----------------------------------------...........IQLSESCKSVTV................
G2Y6Z9_BOTF4/11-391-----------------------------------------...........LSA..DGTLLAL................
M1WB37_CLAP2/12-388-----------------------------------------...........ITD..DGQRLFL................
N4UQV1_COLOR/12-396-----------------------------------------...........ISA..DGASLTV................
B2WD68_PYRTR/65-449-----------------------------------------...........LSA..DGSFITV................
B3MZV3_DROAN/9-389-----------------------------------------...........LVIREHNVYISEGPVKTSTPRSDSDSEE
K0KTK1_WICCF/8-359-----------------------------------------................SQVDSKL................
G1TSQ5_RABIT/13-383-----------------------------------------.................PSSLQM................
F4X8J5_ACREC/7-361-----------------------------------------...........IKLLESTIVLIV................
Q29GF2_DROPS/8-375-----------------------------------------...........VVILEQRIYIDD...............A
G0VL18_NAUCC/6-337-----------------------------------------................LEVHIR.................
U4LVT7_PYROM/7-365-----------------------------------------...........VDP..GSTTAVL................
S3CHW0_OPHP1/592-1021-----------------------------------------...........LLSQQDAVNGHA................
Q6BMI9_DEBHA/5-350-----------------------------------------................DQVLIKF................
I2H589_TETBL/10-369-----------------------------------------................NDTTSI.................
N1PZE3_MYCP1/9-376-----------------------------------------...........LSA..DGSALSL................
E7LWJ6_YEASV/7-342-----------------------------------------................TLMSIS.................
L8FLW5_PSED2/12-403-----------------------------------------...........LSG..DRALLTL................
B6QVW6_PENMQ/12-422-----------------------------------------...........ITLTESCRAVTV................
A5DWX9_LODEL/10-359-----------------------------------------................DTMSINI................
UBE3D_PONAB/13-385-----------------------------------------.................PSSLQM................
K7JNW4_NASVI/31-384-----------------------------------------...........IKILEDAIEIHI................
C8VJ15_EMENI/28-443-----------------------------------------...........ISLSESRRAVTV................
C5DFR9_LACTC/6-347-----------------------------------------................ESVELA.................
C1FZL9_PARBD/14-476-----------------------------------------IPVDPLDNKFSLTLQPSRRSVCL................
G9NH43_HYPAI/14-393-----------------------------------------...........ILD..DGRRIQV................
M3ZXU8_XIPMA/13-392-----------------------------------------................GDSSLLV................
U7PMZ7_SPOS1/17-441-----------------------------------------...........VLP..DGVTLRV................
M7PCP3_PNEMU/15-354-----------------------------------------...........SLKLFNTHSIYI................
R0KID0_SETT2/64-442-----------------------------------------...........LSA..DGCYITV................
R7YJ95_CONA1/9-376-----------------------------------------...........LSA..DGETISL................
G2QZ38_THITE/12-402-----------------------------------------...........ISA..DCRTVEL................
B4MTF5_DROWI/9-367-----------------------------------------...........IILKEHNVHIME................
W5LC11_ASTMX/13-385-----------------------------------------................GDSALKI................
E9CUF8_COCPS/14-450-----------------------------------------...........LEVVPSRDELLL................
J7RHU2_KAZNA/6-350-----------------------------------------................KALTVSY................
J4KRH2_BEAB2/17-390-----------------------------------------...........ILD..EGRKFRI................
Q4P6X1_USTMA/1031-1415-----------------------------------------................SGGERKR................
Q9VWP0_DROME/9-380-----------------------------------------...........VVVRDYNVYISEKPKNQAI...DLDSSS
S0DNZ8_GIBF5/11-388-----------------------------------------...........ISP..DGRQLSV................
G0WHB4_NAUDC/6-346-----------------------------------------................TEVGISY................
E4UYL0_ARTGP/16-475-----------------------------------------...........LSLDSSRSVVTV................
S3DDS5_GLAL2/11-450-----------------------------------------...........VLD..GGRQILV................
E9IFT1_SOLIN/7-361-----------------------------------------...........IKLLESNIVLIL................
G3JK97_CORMM/17-391-----------------------------------------...........ILD..DGRKFRV................
F1Q7U1_DANRE/13-384-----------------------------------------................PDSILNV................
Q75DV5_ASHGO/6-339-----------------------------------------................HRLTVT.................
B4L5I9_DROMO/9-377-----------------------------------------...........LIIKEHDVHIVE................
A4D9F3_ASPFU/21-420-----------------------------------------...........ITLSESRRSVSV................
H9KRH4_APIME/8-350-----------------------------------------...........IKLSKESIEITI................
T5AMN1_OPHSC/15-387-----------------------------------------...........VVD..QGRRLRI................
E9EVP5_METAR/11-386-----------------------------------------...........VFD..GGRRLCI................
Q6CWI5_KLULA/6-349-----------------------------------------................DRRHIN.................
S8AD65_DACHA/9-377-----------------------------------------...........VHLHASRRALTV................
B4M301_DROVI/9-376-----------------------------------------...........LIIKEHDVHIVE................
F8PKW0_SERL3/430-815-----------------------------------------PTVESGTEGDLLIIRND......................
G3NNB4_GASAC/18-378-----------------------------------------................GESSLHI................
C5DRI9_ZYGRC/22-358-----------------------------------------................GKITVQ.................
U1HL67_ENDPU/9-361-----------------------------------------...........IAS..DKKTITV................
H6C728_EXODN/11-373-----------------------------------------...........LSS..DKKVITA................
G2Q453_THIHA/11-367-----------------------------------------...........VSA..DCQTVEL................
UBE3D_MOUSE/13-364-----------------------------------------.................PTSLLV................
Q16XY0_AEDAE/12-444-----------------------------------------...........IDLGSDRITIST................
UBE3D_BOVIN/13-385-----------------------------------------.................PSSLRM................
G8YFE7_PICSO/20-360-----------------------------------------................GSIQVLI................
H2AW44_KAZAF/6-348-----------------------------------------................RELTLQV................
F1NWJ5_CHICK/86-460-----------------------------------------.................PGRLEV................
Q6FK88_CANGA/6-347-----------------------------------------................VSYSIS.................
M4G6J5_MAGP6/10-440-----------------------------------------...........LLD..GGSRIHV................
K5W0X4_PHACS/481-861-----------------------------------------SP..ESG....PDSHHAQLLLRC................
L9L4K4_TUPCH/13-384-----------------------------------------.................PSSVQM................
F6W3S4_MONDO/6-379-----------------------------------------.................PSVLKM................

PF00632

Q9BL11_CAEEL/717-1019---.....FHQLGRLVGLSIYN.......HSIVPFPFP-----------------------------------------L
UBR5_MOUSE/2479-2792---ARLNCFRNIGRILGLCLLQ.......NELCPITLN-----------------------------------------R
A0EFC1_PARTE/672-969---.....YSLIGKLLGLALYN.......QVLLDVRFP-----------------------------------------T
Q54GG5_DICDI/425-720---.....FELIGIIIGLALYN.......NIILDVHFP-----------------------------------------L
Q2GSX9_CHAGB/694-1033---SRLRQYEFLGRVIGKCLYE.......GILIDVSFA-----------------------------------------G
Q4WHR7_ASPFU/967-1337---EPLYKFELLGLLMSLAIYN.......GLTLPVNFP-----------------------------------------V
Q5KIA2_CRYNJ/1499-1843---SRLKWFKTLGQFIGRSMLD.......SRIIDISFN-----------------------------------------K
Q5CW92_CRYPI/1231-1561---.....FEFLGKIVGKAIYE.......KILLEIEFN-----------------------------------------P
A2E5Q8_TRIVA/658-966---SNKKLYKSIGGLLLLIIRT.......GLVQEFDFA-----------------------------------------P
A0BRI8_PARTE/1050-1354---.....FKFVGMIFAIATAN.......GVKVFGRFP-----------------------------------------I
HUL5_YEAST/607-910---.....IWFLGKVVGKCLYE.......HVLIDVSFA-----------------------------------------D
A7SML1_NEMVE/1229-1585---K....FRFLGRFLGRALLD.......FRMVDIPFS-----------------------------------------C
Q38D88_TRYB2/1472-1912---ERAQLYYLVGTVLGRAFTD.......AVVFPLDIS-----------------------------------------P
Q00WM5_OSTTA/458-763---.....FRFVGRLVGKALVD.......DILLNAYFT-----------------------------------------R
Q6BGB8_PARTE/609-908---.....YAFIGKIIGKAIYE.......GVLIEKVLN-----------------------------------------Q
A2FIB4_TRIVA/386-683---.....FRLLGLVIGLGAVN.......KVPLPVRFP-----------------------------------------L
L9KS41_TUPCH/1283-1677---ELKDQFRFSGRILGLALIH.......QYLLDAFFT-----------------------------------------R
A2DAL9_TRIVA/1571-1869---TDYSKFEGIGRFIGIVVLH.......GEILGYQLA-----------------------------------------H
A4VDG4_TETTS/3915-4210---.....FKFLGILLGKAFLE.......NYPVQANFA-----------------------------------------K
A2FLN6_TRIVA/2545-2849---QSRDFFFYAGVLMTICYTS.......RLPEPFKFA-----------------------------------------R
A4IBT8_LEIIN/1017-1343---IAPDLFVLLGKVLLKSIIE.......NRQIPLQLS-----------------------------------------S
A4IC88_LEIIN/3812-4131---YDLEAFAFIGKLMGGALRS.......EDPLDLFLP-----------------------------------------P
F6U235_XENTR/611-908---.....FTLIGIVLGLAIYN.......NCILDVHFP-----------------------------------------M
A0D2G1_PARTE/170-483---DKRQLFSFLGIIVGKCLFE.......RIPLSSFLD-----------------------------------------R
A4HF82_LEIBR/3619-3949---VLRRMFEWLGKIMGNMVLC......GTLKASFDFP-----------------------------------------Q
Q8SS57_ENCCU/454-746---GDGEGYEAIGRIIAIALYN.......NVVLNIPFP-----------------------------------------S
AREL1_MOUSE/512-823---...KMYEFAGRLVGKCLYESSLGGAYKQLVRARFT-----------------------------------------R
Q4E2E5_TRYCC/2646-2975---LFVEVFTWLGKLIGNATMS......GYLMFSFTFP-----------------------------------------R
A7SQ93_NEMVE/299-612---.....FNLVGVLMGLAVYN.......SIILDIHFP-----------------------------------------S
TOM1_YEAST/2962-3268---.....FKFIGMIIGKAIRD.......QCFLDCHFS-----------------------------------------R
Q6C901_YARLI/697-1001---.....YRLAGVITGLALYN.......SSMLDLPLP-----------------------------------------P
Q9W0H2_DROME/761-1058---.....YFLIGVLCGLAIYN.......FTIINLPFP-----------------------------------------L
A0BRN4_PARTE/3724-4023---KKNDYAYVFGKFVANSIFN.......NHQIGIQFQ-----------------------------------------P
NEDD4_HUMAN/1013-1318---.....FKFIGRVAGMAVYH.......GKLLDGFFI-----------------------------------------R
O17736_CAEEL/692-1001---.....FQFIGRMIGKLIYE.......RQLQEVRFA-----------------------------------------E
A2FPQ0_TRIVA/408-705---.....FNLLGTIIGLAIYN.......GVILPIKFP-----------------------------------------C
A2FR71_TRIVA/373-670---.....FNVLGTVVALAIAN.......SVILPIRFP-----------------------------------------I
Q7PSQ3_ANOGA/541-897---.....FHFVGRILGIAVFH.......NHVLDGGFT-----------------------------------------L
Q247X9_TETTS/2308-2606---KALEQIELLGKFVGKSMME.......DWSLMLSFA-----------------------------------------P
A0DNI8_PARTE/201-510---HIIDCFKLLGIVVGKCIFE.......RIPLNIYFD-----------------------------------------R
A5K4K7_PLAVS/1441-1991---.....YTFAGKVIGKAIYE.......RILIESVFN-----------------------------------------D
A2DQ34_TRIVA/412-708---.....YMMLGTAVSLAIYN.......NVVLPIRFP-----------------------------------------T
Q5KBV2_CRYNJ/2952-3249---.....FKFVGRVIGGRL............LDAYFN-----------------------------------------R
A2FXS6_TRIVA/392-692---.....FTLYGLIIGLAIYN.......EILLPVHFP-----------------------------------------R
A4VD17_TETTS/789-1090---.....FHFLGSVVGRAIYD.......QIQIQPIFS-----------------------------------------V
A2F7U9_TRIVA/2273-2579---EYSDIYRGIGIYIGMVVRT.......GFVQDMPFV-----------------------------------------P
Q9W196_DROME/819-1122---.....YYFIGRILGKSIYE.......NLLVELPLA-----------------------------------------E
A2DYB1_TRIVA/1674-1977---.....FKFAGRIMAKAIIE.......EQYLDAHLT-----------------------------------------M
A2EDQ8_TRIVA/2183-2490---SRLQDYYTIGVLLGIIIRT.......GLQQDLPFA-----------------------------------------P
A4S7N1_OSTLU/131-443---.....LEMIGMMIGKGMYE.......GILQDINMA-----------------------------------------P
A2EM50_TRIVA/2501-2807---RTSHIYESVGCLIAISIRT.......GMVQPFTFP-----------------------------------------P
Q0UNY9_PHANO/908-1229---EPVWKFEMLGMIFSLAVYN.......GITLPVTFP-----------------------------------------H
A2EQW9_TRIVA/2209-2511---TSRSLFYAVGVFIGIVIRN.......GYFQDFPFA-----------------------------------------P
HUL4_ASHGO/526-839---.....YYLFGVVLGLAIYN.......STILDLKFP-----------------------------------------R
Q7QE66_ANOGA/554-863---.....YRFAGRVLGLALVH.......QYLLDAFFT-----------------------------------------R
A2E4I7_TRIVA/2634-2943---HSEDMYKMLGVLFGISTRC.......GLTKPLPFP-----------------------------------------D
A5K5J0_PLAVS/8258-8564---.....FKFVGKFIAKAIYD.......GQVIDAYFC-----------------------------------------R
Q54QF1_DICDI/778-1120---.....FKTLGRITGKSIIDSI..TKADRHFSLRFT-----------------------------------------P
UPL7_ARATH/828-1142---.....IEFLGRIVGKALYE.......GILLDYSFS-----------------------------------------H
Q8SR14_ENCCU/2104-2410---.....FKFVGRIIAKAIMD.......GNFINLHLS-----------------------------------------K
MUG30_SCHPO/482-807---.....YHMSGILMGIAIHN.......SINLDVQMP-----------------------------------------R
A3FPU7_CRYPI/497-797---.....FELIGIVLALAIYN.......GIILDVHFP-----------------------------------------L
Q38A01_TRYB2/1526-1868---ESLSNFELLGMLVGRVLME.......ERVVDLPLS-----------------------------------------E
A1CTM1_ASPCL/1468-1817---RQLSLFKTLGKFVARSMLD.......SRIIDISFN-----------------------------------------P
A2DAJ9_TRIVA/133-438---DSYDQYKAIGTFLGIIIRN.......GFPQDIPFA-----------------------------------------P
Q7PSA4_ANOGA/2506-2929---DVSGYFWFLGVFLAKVLQD.......NRLVDLPLS-----------------------------------------N
UPL3_ARATH/1518-1888---KVIEYFRLLGRVMAKALQD.......GRLLDVPLS-----------------------------------------T
C8VT87_EMENI/782-1089---.....FFLVGVVLGLAIYN.......SIILDIALP-----------------------------------------P
Q22F29_TETTS/3359-3651---.....FRFAGRLIAKGLIE.......KLDFEVDFT-----------------------------------------K
Q4UD92_THEAN/251-554---.....FCFIGKIVGKALYE.......QILIEPVLS-----------------------------------------R
Q580G4_TRYB2/3999-4304---.....FRFAGIVVGMAVAH.......RVAIDVHFT-----------------------------------------R
Q4PHJ7_USTMA/908-1208---.....YEFLGRVIGKALYE.......GILVDAKFA-----------------------------------------G
A3LSX3_PICST/660-977---.....LKFLGSIVGKCLYE.......NVLIDVSFA-----------------------------------------P
A2DBI7_TRIVA/375-665---.....LKLFGIIVGLAITN.......QLILPVRFP-----------------------------------------K
A0DLU6_PARTE/3989-4284---EKEQYAIAFGKLIANSILN.......KEIIGVPFA-----------------------------------------H
HACE1_MOUSE/602-909---.....FRFAGQILGLALNH.......RQLVNIYFT-----------------------------------------R
UBE3B_HUMAN/736-1068---.....FEFVGKMLGKAVYE.......GIVVDVPFA-----------------------------------------S
Q00Y47_OSTTA/1123-1477---SRIKNFKLLGQAIGKVLQD.......GRMLDLPLA-----------------------------------------P
A4IAG7_LEIIN/1064-1369---..LKEFFALGAACARAFID.......EYRMDMDLL-----------------------------------------P
A7SNF7_NEMVE/430-737---..LRQLRLIGRLIGAAICD.......DLLLSLHLS-----------------------------------------K
A2ERB6_TRIVA/1571-1861---.YDDLLMVYGMILGRALIE.......DIPINRRME-----------------------------------------S
A3GHK0_PICST/646-950---.....YYLLGAVLGLAIYN.......STILDLHFP-----------------------------------------M
A7AV31_BABBO/1338-1643---.VFRTFKLLGQLVALALID.......HKLLDLRLN-----------------------------------------P
Q4Q7L2_LEIMA/1091-1400---.....IRFLGAMVGRALRD.......GVLQDVPFA-----------------------------------------L
A8BYQ3_GIAIC/636-950---.....YCFAGMILGMCLLN.......RVNITNHFP-----------------------------------------R
PUB2_SCHPO/367-671---.....FRFVGRVMGLAIYH.......RRYLDVQFV-----------------------------------------L
Q54KP2_DICDI/1482-1898---KTLEYFKFLGMFIAKAFFD.......QRLIDLPLS-----------------------------------------K
A5DS31_LODEL/333-694---KILYFCSSLGKFVARALLD.......SRIIDFNFN-----------------------------------------P
A2DQ30_TRIVA/383-682---.....FKFVGTIVGLAAVN.......SYNLNVQFP-----------------------------------------S
A4HPV4_LEIBR/2168-2551---TTLHYWKLLGVLLGRLLVI.......GTTTSLNFH-----------------------------------------P
A4IBF5_LEIIN/1897-2310---ERAKAYYVIGAALGRAFVD.......EQVFPLPLS-----------------------------------------R

PF09814

E3QET8_COLGM/12-396...Q....HAG..........A-------HTS..FALP..GRVQTRGAALPAPPQASR.....................T
G1XBI8_ARTOA/9-371...K....YGA..........R-------TSH..IMLP..TPIDSPSITLIP...........................A
B0WGJ1_CULQU/12-440...ENNDEQYEIRLGDFFKLHT-------QTLSSLLIK.......................................NNY
N1JPA0_BLUG1/11-395...I....HRG..........Q-------VHA..LSLP..HKVYPKFNFQVPSKIGSQ.....................E
E2C3X0_HARSA/7-363......KDHNMDFSLPFIKIVP-------TSLSMLSIR.......................................NNW
F6PJX9_CIOIN/15-512...KKGDGTVE...........-------......TYP..LVVNIEPTSCTSIQKHMNE....................G
V5G5H4_BYSSN/14-444...S....VGE..........E-------MET..MKLP..ARVSESSRSNLRF........PEQASSGHTGTTSDLTRIE
C0NUQ4_AJECG/14-505...Y....SSH..........T-------VHT..LPLP..ACVSESAHTILSTKLTPNPPGAGHG..............E
J3NIY5_GAGT3/10-441...S....HDG..........D-------TRE..LDLP..AVVHTGGGAGSGPVVLPPTKPAAAAAAGAGAAAG...R.Q
K1WUW9_MARBU/11-367...Y....HEG..........Q-------KTV..LGLP..GQAVANFQLQKPILGNK......................E
F2SJ85_TRIRC/16-423...S....HSD..........K-------TLT..LKLP..LSISARAREHLATSQATSHGGEN................E
Q7SDG7_NEUCR/13-420...T....HHG..........Q-------SHT..LHLP..AKVALGGAILPIQRPGAS.....................A
G3Y5B6_ASPNA/22-417...T....SSLPNTNQDDPTST-------SET..IKLP..ARVSESSRRILQQRPPSTQGES.................E
N1QJ23_SPHMS/6-367...A....HNG..........H-------VAS..IKLP..AAVPKGRTTAALPIPE.APC.................E.R
W5NKD6_LEPOC/13-376...KTPGCLVD...........-------.....LQLP..AGVTIIQDSCREVP..SAAGD..................G
F7E020_XENTR/11-384...QTSEQCER...........-------.....FCIP..AEVKLLPSSCRLVQ..QIAGE..................G
A1CJR3_ASPCL/19-424...S....LPGPFSH......V-------SDT..IKLP..ARVNEASRHTLNT........SRQAPTQPA.NDSHSARQE
Q59X25_CANAL/5-333...DEINRISIAGELLSIELKN-------SPPIDVHLP..CKASQASIT...............................
M2R8N7_COCSN/64-446...S....HEG..........E-------SAT..IRLP..INVKGA.GDAALELPSRPPS.................K.E
A7TPW1_VANPO/6-340.....LEVVDE..........V-------GKLEVVDIL..FPNEIKLRG........SELRF..VQNGLC.Y........
G8BQA7_TETPH/7-357...IDLDGIHA..........K-------VGGEPIRIP..FAAKVTLIY........NKEEE..ETLCSQEFNE.....V
H2L971_ORYLA/17-387...RTPRGQLE...........-------.....LALP..AGVSFTEGSCIPTP.GESSAE..................E
B4JWU6_DROGR/9-387.....NGNSEFVLRHDSWDMDI-------TQLSLFNAS.......................................GCH
A7USM4_ANOGA/14-434...KGERERYEIRTGDYFQLHT-------QTLSSLVIK.......................................NRY
H3AB66_LATCH/13-373...KVAESCEH...........-------.....IELP..AGVRIVPSSCRGLQ..YVNGD..................G
H2RRY7_TAKRU/13-391...RTSSGETS...........-------.....LALP..KGVAFEQGSCIPTPAGESC.E..................E
G8ZSN1_TORDC/12-350.......DTEE..........N-------KAT..ILLP..CEEFVGEQA........KFTTV..SPG...CY........
F2UGQ3_SALR5/7-362...NVVSQDGRLAVVDTQAERQ-------LAT..IALP..PHVRPSGLERTHQDEHTN.....................T
N1QC82_MYCFI/8-372...E....HEG..........E-------SAS..IRLP..FQVPGAHSDATLTIPA.APT.................K.D
H0ZQP0_TAEGU/10-365...RSGGSCHA...........-------.....AALP..AGVSLAPSSCRGLR..HLRGD..................G
I3ITZ6_ORENI/17-396...RTPRGVLY...........-------.....LTLP..AGVAFEQGSCIPTPAGESCGE..................E
J4G0K5_FIBRA/670-1050...G.................L-------STSPFLRLP..ARVAPG.KQTVMVSGQ.......................H
S7Z7X2_PENO1/19-452...S....LPEPWNH......V-------SET..LKLP..ARVASATRQNTNL.....RMSTPSTPAQPADSGL.....E
G2Y6Z9_BOTF4/11-391...R....HAE..........Q-------DIL..LTLP..GQVVSNSKLREFPLGSL......................E
M1WB37_CLAP2/12-388...D....CTG..........F-------VTT..MLLP..APVATT.SLKIADGASR......................Y
N4UQV1_COLOR/12-396...R....HRD..........A-------RAS..LALP..CKVAVKSALLPAPAPGSR.....................T
B2WD68_PYRTR/65-449...S....HEG..........A-------SAK..IRLP..INVKGG.GDAALELPSQPPN.................K.E
B3MZV3_DROAN/9-389EYHEEDEENSLVIRHDCFGMDI-------GCISVFVVT.......................................GSH
K0KTK1_WICCF/8-359...IKL.LMKD..........Y-------DSPFYIPLP..SDVP................QIPNITQCILKRGN.....I
G1TSQ5_RABIT/13-383...RTSDGCTD...........-------.....IELP..AEVRLVPSSCRGLH..YVPGE..................G
F4X8J5_ACREC/7-361......EDCSTSFSLPSVKVIP-------TSLSMLNIM.......................................NNW
Q29GF2_DROPS/8-375DRGTGKSIDTEIMRVNEFDMDL-------SSLSGFLLS.......................................GKN
G0VL18_NAUCC/6-337........ENN..........S-------ISI..IKLP..YEVE..LQD........SLQL...TEGTQGEY........
U4LVT7_PYROM/7-365...Y....HNG..........E-------TTP..LILP..AQANPGPRQLVLTTVLGE...................K.T
S3CHW0_OPHP1/592-1021...RVRARHNG..........A-------VQE..MTLP..GRVALAARPVRLPLPQPKKPGDLLP............S.Y
Q6BMI9_DEBHA/5-350.....................H-------DNEISVNLP....................................VKIKRD
I2H589_TETBL/10-369.....LEVSNN..........S-------GTIYHIKLP..YIADATMDI........SSIKY..QKNGPNEY........
N1PZE3_MYCP1/9-376...A....HEG..........E-------VAT..ICLPVRVHVPGAHNDVPLTMPS.APT.................K.D
E7LWJ6_YEASV/7-342.......GDEE..........Q-------VED..ILLP..VEVEEKVDA........SYKFK..NRGKDLEW........
L8FLW5_PSED2/12-403...V....HNG..........A-------TAS..LQLP..GTIAPTYTAT.QPHPSL....................A.Q
B6QVW6_PENMQ/12-422...S....THHQGVE......L-------VET..LKLP..VKVTDASRRNLSFAGHRVDIGGAEPEAQTA.........E
A5DWX9_LODEL/10-359.....................N-------DDGNNIKSP..........................................
UBE3D_PONAB/13-385...KTPEGCTE...........-------.....IQLP..AEVRLVPSSCRGLQ..FVAGD..................G
K7JNW4_NASVI/31-384......EAKVFKLPLSNVKLLP-------SSLSSLGIT.......................................NRW
C8VJ15_EMENI/28-443...S....LTLPESQE....AV-------MET..IKLP..AKVTEGSRRLLSN........ATQSAGQGKGTITGTER.E
C5DFR9_LACTC/6-347.........ND..........Q-------GARYVIELP..HRVVIDS.................SQNSFQSYKD.....Y
C1FZL9_PARBD/14-476...S....GPW..........G-------ERT..FDLP..ARVSVSAYTTLATRPIRIYWGVVKHNE....HN......E
G9NH43_HYPAI/14-393...H....HRG..........E-------VRA..LDLP..ARVSVRSAIPIPENSSL......................D
M3ZXU8_XIPMA/13-392...QTPRGDLS...........-------.....LALP..AGVAFETGSCIHTPVDEPGGE..................E
U7PMZ7_SPOS1/17-441...RRRGKDDG..........D-------QQTAVLTLP..GRVAVTAAGAQLPVPGPA....LAS............G.Y
M7PCP3_PNEMU/15-354...K....SNE..........I-------SEI..IFLP........................DETEKDVSIQVNQQLN.T
R0KID0_SETT2/64-442...S....HEG..........Q-------TAT..IRLP..INVKGA.GDAALELPSKPPG.................K.E
R7YJ95_CONA1/9-376...T....HAG..........E-------TTT..IRLP..TKLSGG.SDAALTLPA.APA.................K.E
G2QZ38_THITE/12-402...R....HRG..........V-------VSQ..LQLP..AKASLGGTLLPIQDRQRGTT...................T
B4MTF5_DROWI/9-367....DDDENNLVIRYNCFGMDI-------QGISIFTVS.......................................GNH
W5LC11_ASTMX/13-385...RVPNEEYQ...........-------.....VKLT..PGVSLLEGSCQKSP..EVNDD..................G
E9CUF8_COCPS/14-450...S....VGD..........Q-------KRS..LRLP..ARVAPSAPSYFPLQP.........GSASNIDQR......E
J7RHU2_KAZNA/6-350...RGKHM..S..........L-------VVKKTISLP..VNISLSQNG........VPTSF..KYNEQGTF........
J4KRH2_BEAB2/17-390...S....HNG..........T-------SGE..AVLP..ATAPVKGTLPLSHKGST......................E
Q4P6X1_USTMA/1031-1415...KQDAHHVS..........S-------ARGVRMSLPDRAKAQSGRVTLERSGA........................V
Q9VWP0_DROME/9-380ESDSEDSDKLMLIRHAQYGMDI-------VCLSTFLVS.......................................GRN
S0DNZ8_GIBF5/11-388...T....HHG..........H-------TEH..ITLP..AQTSAIGSLPVAQIGRS......................N
G0WHB4_NAUDC/6-346...RENDMPSS..........S-------IVK....LP..CEVSIDQ...........PVNLVKRTGNEAAF........
E4UYL0_ARTGP/16-475...S....HFE..........K-------TLT..LKLP..CHISTRARDYLTASPATSHGGEN................E
S3DDS5_GLAL2/11-450...S....HQD..........L-------SSV..LILP..GQVTLYSQLQQPVSGQK......................E
E9IFT1_SOLIN/7-361......ENCSMNFLLPSVRVIP-------TSLSTLNII.......................................SNW
G3JK97_CORMM/17-391...N....HNG..........V-------TVE..ASLP..TSAPLKGPLPVSHKGSL......................E
F1Q7U1_DANRE/13-384...QTPDSSFQ...........-------.....VTLT..PGVSLVETQKQKSP..ANSEQ..................G
Q75DV5_ASHGO/6-339..........V..........N-------GAAEVIELP..CEVDPLARP........R......IRHSEGAF........
B4L5I9_DROMO/9-377.NGQNSGGSQLVLRHDTFGMDI-------QRISVFIAN.......................................GCH
A4D9F3_ASPFU/21-420...S....LPAPFDH......V-------ADT..IKLP..ARVNEASRRVLAT........SRQGDAATADNDSGVRRRE
H9KRH4_APIME/8-350......ENNTVTFLTKFVKLIP-------DSLSTLNIT.......................................KNW
T5AMN1_OPHSC/15-387...H....HKG..........C-------SEV..VDLP..APVTKSAALAVPKAAGS......................E
E9EVP5_METAR/11-386...E....HDG..........Q-------TEA..LDLP..GTVFGNTTLQVSQSASR......................E
Q6CWI5_KLULA/6-349.......VTIG..........N-------KRVITINLP..CVVDVNTKG...................EVQRGK.....L
S8AD65_DACHA/9-377...S....FGP..........D-------ISH..VILP..VPIDYPSRVLAT...........................S
B4M301_DROVI/9-376.NGTDSTESELVLRHDSFGMDI-------QRISVFIVN.......................................GCH
F8PKW0_SERL3/430-815.....................A-------VSSPPLTLP..ARIASGVQDIKLRND........................Y
G3NNB4_GASAC/18-378...KTPKGELS...........-------.....LTLP..AGVTFEQGSCTPTPAGDFCEE..................E
C5DRI9_ZYGRC/22-358.......DGRG..........E-------RLD..IALP..YNPGKVNSK........RLVKV..GGSDRDEY........
U1HL67_ENDPU/9-361...S....HDG..........E-------SAS..IYLP..TEIGGTAEVSIPVDRGK......................E
H6C728_EXODN/11-373...I....HDE..........E-------SSS..IYLP..TQISGTANVTFPTDKRT......................E
G2Q453_THIHA/11-367...R....HRS..........S-------TCV..LRLP..GKASLGGVVLPIQNKQCGST...................S
UBE3D_MOUSE/13-364...RTPDGCTE...........-------.....IRLP..AGVRLVPSSCGGLQ..YISGD..................G
Q16XY0_AEDAE/12-444...ENNDERYEIRLGDYFKLHT-------QTLSSLLIK.......................................NNY
UBE3D_BOVIN/13-385...QSPGGCTE...........-------.....LRLP..AGVRLAPSTCRGLQ..HVPGD..................G
G8YFE7_PICSO/20-360.....................N-------EYMEDVTLP....................................IDLKEG
H2AW44_KAZAF/6-348...VDEGTEDA..........H-------MTK..IELP..DKAI..YNE........SVSQF..KKGSQAEF........
F1NWJ5_CHICK/86-460...RSGAACEA...........-------.....AALP..PGVSLAPSSCRGLR..RLPGD..................G
Q6FK88_CANGA/6-347.......TNRS..........T-------LELRVINDS..YKTSIRLKGLNLDNLYDEKNGHIHLSETSCGY........
M4G6J5_MAGP6/10-440...S....HEG..........D-------SRV..LNLP..AAVHIGSGAGSGPVVLPPAKP.TTASAGAAARDGSRER.Q
K5W0X4_PHACS/481-861...G.................A-------STSQRLALP..APVAVGPAQVNVVGGR.......................H
L9L4K4_TUPCH/13-384...KTPTGCTE...........-------.....IQLP..AEVRLVPASCRGLQ..YVPGD..................G
F6W3S4_MONDO/6-379...KTLEQCRE...........-------.....IKFP..AEVRLVPSSLRGLQ..YISGD..................G

PF00632

Q9BL11_CAEEL/717-1019ALYKYLLD...............T.......PPDL.....ED.................................LCEL.
UBR5_MOUSE/2479-2792HVIKVLLG......................RKVNW.....HD.................................FAFF.
A0EFC1_PARTE/672-969VLFKKLQN...............E.......KVTE.....ED.................................LKEL.
Q54GG5_DICDI/425-720VIFKKLLN...............L.......DLTM.....ED.................................IESL.
Q2GSX9_CHAGB/694-1033FFLLKWAT...............SAGASDTYRANI.....ND.................................LREL.
Q4WHR7_ASPFU/967-1337AFYRKLLG........................LKV.....KH.................................LEHI.
Q5KIA2_CRYNJ/1499-1843VFLKLLLD...............KP...IKKNLST........................................LRAV.
Q5CW92_CRYPI/1231-1561VFLNSVFE......................QNNDF.....TD.................................LLNL.
A2E5Q8_TRIVA/658-966VVWRFLVS......................NKVSI.....ED.................................IYEI.
A0BRI8_PARTE/1050-1354SFFKHIIG...............Q.......KLSI.....FD.................................ISYH.
HUL5_YEAST/607-910FFLKKLLN...............YSNGFLSSFSD.........................................LGSY.
A7SML1_NEMVE/1229-1585AFYKWMLG...............F.....EATFDY.....RD.................................LFDI.
Q38D88_TRYB2/1472-1912ALALFLCRGIPPSRIVLRCTEKEEQPWEPERPIDFMSLGIEE.................................VEMM.
Q00WM5_OSTTA/458-763PIYKHLLG...............Q.......ALTY.....ED.................................MEGV.
Q6BGB8_PARTE/609-908VFLNQVLG...............I.....TNTIN.......D.................................FRFY.
A2FIB4_TRIVA/386-683LMYKKILN...............K.......TITL.....ND.................................LAEI.
L9KS41_TUPCH/1283-1677PFYKALLR...............L.......PCDL.....SD.................................LEYL.
A2DAL9_TRIVA/1571-1869HLIKAMIG......................RNVNA.....SD.................................LADY.
A4VDG4_TETTS/3915-4210PFLKLFLK...............K.......KIVI.....SD.................................IEEI.
A2FLN6_TRIVA/2545-2849FVWNSLTQ......................RPVTL.....DD.................................IYEI.
A4IBT8_LEIIN/1017-1343AVLKFLSG......................AEPSF.....VD.................................LEEY.
A4IC88_LEIIN/3812-4131LVWRYLCA......................YPITE.....AE.................................VEQV.
F6U235_XENTR/611-908VVYRKLMG...............K.......KGTF.....RD.................................LADS.
A0D2G1_PARTE/170-483TIIKHILR......................QKIVL.....ED.................................IKYF.
A4HF82_LEIBR/3619-3949MLWKTLTF...............Q.....EDTITL.....AD................................YAHDI.
Q8SS57_ENCCU/454-746LFFKKLLD......................RRPTL.....DD.................................LREI.
AREL1_MOUSE/512-823SFLAQIIG...............L.......RMHY.....KY.................................FETD.
Q4E2E5_TRYCC/2646-2975LLWKFLTF......................DNLTI.....ED................................YHADI.
A7SQ93_NEMVE/299-612CCYKKLLSPAVVPFHNPNARVGLA.......NLGL.....ED.................................LAEV.
TOM1_YEAST/2962-3268EVYKNILG...............R.......PVSL.....KD.................................MESL.
Q6C901_YARLI/697-1001VVFKKLLG...............C.......PVGL.....ED.................................FTVV.
Q9W0H2_DROME/761-1058ALFKKLLG...............K.......PVDL.....SD.................................LRQL.
A0BRN4_PARTE/3724-4023QFWKVIFS......................EKIQF.....KD.................................LNGF.
NEDD4_HUMAN/1013-1318PFYKMMLH...............K.......PITL.....HD.................................MESV.
O17736_CAEEL/692-1001FFIAQIFE...............TD...KNKDVDL.....QH.................................MKSF.
A2FPQ0_TRIVA/408-705VMYKKLQE...............L.......ATSV.....ED.................................LKEI.
A2FR71_TRIVA/373-670ALYKKLLG...............M.......KMTL.....ED.................................LNQI.
Q7PSQ3_ANOGA/541-897PFYKQLLN...............K.......PITL.....SD.................................IEDV.
Q247X9_TETTS/2308-2606FFIKSVLK......................RDLSI.....GD.................................FYSY.
A0DNI8_PARTE/201-510SIIKHIIG......................QSIFL.....ED.................................IYYY.
A5K4K7_PLAVS/1441-1991VFLSFLLC...............DDL.DLDVDVAI.....ND.................................LYFI.
A2DQ34_TRIVA/412-708LLYKKILG...............K.......PITL.....TD.................................IGEI.
Q5KBV2_CRYNJ/2952-3249AFYKQILG...............R.......TVDM.....RD.................................LESI.
A2FXS6_TRIVA/392-692ALFKSILN..............FS.......NFTL.....ND.................................LEQI.
A4VD17_TETTS/789-1090FFLRQMIG......................KQNNL.....VE.................................LENF.
A2F7U9_TRIVA/2273-2579FVWKFIAG......................GELSS.....ND.................................ILMV.
Q9W196_DROME/819-1122FFLTKLAG...............K.....YSDVDI.....HQ.................................LASL.
A2DYB1_TRIVA/1674-1977SILKAILG...............I.......PVTL.....RD.................................LEDV.
A2EDQ8_TRIVA/2183-2490IVWKFIAN......................EHVGI.....DD.................................VTAI.
A4S7N1_OSTLU/131-443FFAAHVLG...............T.....ARTID.......D.................................IPSL.
A2EM50_TRIVA/2501-2807FFWTCLVT......................GEITI.....DD.................................VFSI.
Q0UNY9_PHANO/908-1229AFYQFLLH...............GVA..PLRATNL.....HN.................................IRDCL
A2EQW9_TRIVA/2209-2511FVWKYLAN......................EPLDK.....ND.................................ILCL.
HUL4_ASHGO/526-839AFYKKICG...............E.......VLSV.....ND.................................FLEL.
Q7QE66_ANOGA/554-863PFYKALLR...............L.......PVSL.....SD.................................LESL.
A2E4I7_TRIVA/2634-2943FFWKYIAQ......................GILTI.....ED.................................IYSI.
A5K5J0_PLAVS/8258-8564SFYKHMLG...............R.......KILP.....AD.................................AESV.
Q54QF1_DICDI/778-1120IFYKMILG...............E.......KITL.....DD.................................LELI.
UPL7_ARATH/828-1142VFIQKLLG...............R.....YSFID.......E.................................LSGL.
Q8SR14_ENCCU/2104-2410FIYQYILG...............K.......SCDL.....QD.................................LESA.
MUG30_SCHPO/482-807AFYKKLLQ...............L.......PLSF.....ND.................................LDDF.
A3FPU7_CRYPI/497-797AVYKKLLG...............Y.......KVDI.....GD.................................LYEI.
Q38A01_TRYB2/1526-1868CFLRGILG.........................DL.....DDT..............................NRLPYI.
A1CTM1_ASPCL/1468-1817AFFRI...................................ADSGSSV......................APSLGTVKAV.
A2DAJ9_TRIVA/133-438FIWKHLAG......................ELLQE.....ND.................................IMMV.
Q7PSA4_ANOGA/2506-2929SFLQLLSHSRSMARGATSQTGSLLGKSGVSDDIMMSSILSEDSDRDRDLLVDSYQSKMAMASDGAWYDGILTQENLQEI.
UPL3_ARATH/1518-1888AFYKLILG......................QELDL.....HD.................................IVLF.
C8VT87_EMENI/782-1089FAFKKLLAGAPQ.......TTGPQ.......PLTT.....QD.................................LAEY.
Q22F29_TETTS/3359-3651SFLKHILH...............K.......TLFI.....SD.................................LEDI.
Q4UD92_THEAN/251-554LLLNLILK...............R.....RNTLD.......D.................................LKLF.
Q580G4_TRYB2/3999-4304AVYRHMIG...............I.......QPTF.....GD.................................LKSV.
Q4PHJ7_USTMA/908-1208FFLSKMLG......................KQSYL.....DD.................................LGSID
A3LSX3_PICST/660-977FFLNKWCN...............DNM..KNSIND.........................................LNYL.
A2DBI7_TRIVA/375-665IFYKKFAR...............T.......QVTI.....ND.................................FEQY.
A0DLU6_PARTE/3989-4284QFWKLIFN......................KPIVF.....ED.................................LEGI.
HACE1_MOUSE/602-909SFYKHILG...............I.......PVNY.....QD.................................VASI.
UBE3B_HUMAN/736-1068FFLSQLLG...............HHHSVFYSSVD.......E.................................LPSL.
Q00Y47_OSTTA/1123-1477AFYRALLG......................RCLGL.....QD.................................LIEI.
A4IAG7_LEIIN/1064-1369QAWPLLMLPSLGLPVGQKAGARSSPCASTLAALT......NL.................................LEVL.
A7SNF7_NEMVE/430-737PFVKQILG...............I......PLSHP.....DD.................................LSSF.
A2ERB6_TRIVA/1571-1861YFYKFLKD......................RKPTI.....RD.................................VKAI.
A3GHK0_PICST/646-950ALYKILLD...............K.......PVGL.....DD.................................YKQL.
A7AV31_BABBO/1338-1643LFWHLCQH...............PS...MVNNCSL.....SV.................................LSSV.
Q4Q7L2_LEIMA/1091-1400HFRNAILG...............R.....RN..TL.....SN.................................LKSF.
A8BYQ3_GIAIC/636-950VLYRKLLG...............Y.......KGVF.....ED.................................LENY.
PUB2_SCHPO/367-671PFYKRILQ...............K.......PLCL.....ED.................................VKDV.
Q54KP2_DICDI/1482-1898PMYKYMID......................QELNF.....DD.................................LRQL.
A5DS31_LODEL/333-694IFLKLIQFLNRK......TLQAHTTPKQSRKFATL.....SN.................................LHLV.
A2DQ30_TRIVA/383-682LLFKKLVG...............K.......KLIL.....DD.................................LAEI.
A4HPV4_LEIBR/2168-2551LLLRRLRGESLNS.....TAGEAS................RN.................................MSQV.
A4IBF5_LEIIN/1897-2310AVAYFIRRGVPAYQ..CVVSDVTHIDPPPEYPIDL.....FE.................................LPLTA

PF09814

E3QET8_COLGM/12-396ISWRLPLAVDA....................SATS----------------------------------------PLTTR
G1XBI8_ARTOA/9-371QTYRLSASQTYLG...........SDEYES.....----------------------------------------.....
B0WGJ1_CULQU/12-440ICFRINTNENKFH...........SEVLEINEYNA----------------------------------------CTDLK
N1JPA0_BLUG1/11-395LSWRLPLIDQS.......................S----------------------------------------QQARQ
E2C3X0_HARSA/7-363ICFRLQMMPLNSV...........FGSFS......----------------------------------------VEVLT
F6PJX9_CIOIN/15-512IGMRLQLRDSNPE...........PQTSLLSTTVK----------------------------------------RVSNE
V5G5H4_BYSSN/14-444FSFRMQVDK....................DEMPGL----------------------------------------TKDEF
C0NUQ4_AJECG/14-505LLFRLPVDVEA..............GLPGASQPAN----------------------------------------GQPGH
J3NIY5_GAGT3/10-441CAWRLPLPPSR...............QAP....PQ----------------------------------------AAASP
K1WUW9_MARBU/11-367LSWRLPLAGQA.......................S----------------------------------------RASIE
F2SJ85_TRIRC/16-423YSFRLPIDEASS.......................----------------------------------------AVDVT
Q7SDG7_NEUCR/13-420LSWRLPLG..........................Q----------------------------------------GTYTD
G3Y5B6_ASPNA/22-417YSFRMQVDDNDTS...........L..........----------------------------------------HKDET
N1QJ23_SPHMS/6-367MSFRVQLQQAT....................LADG----------------------------------------SQEVE
W5NKD6_LEPOC/13-376LHIRMQLH.ADQD...........T....EAPPSL----------------------------------------IESLK
F7E020_XENTR/11-384LHMRLKVE.AAND...........T....DMPLLL----------------------------------------KEILK
A1CJR3_ASPCL/19-424YSFRMRIDSED..................DALP..----------------------------------------RTEA.
Q59X25_CANAL/5-333.GLKLANNTVSFG................VKIHEK----------------------------------------RLDST
M2R8N7_COCSN/64-446LTLRLQMEEKE...............GSD..LL.G----------------------------------------ALQRQ
A7TPW1_VANPO/6-340.SSRLRYFG...................DRVNVLS----------------------------------------MAMDL
G8BQA7_TETPH/7-357AHFKLQYSDLST................NKNSISL----------------------------------------MNDDL
H2L971_ORYLA/17-387LHFRLRIT.VEQS...........SHK..EASDCV----------------------------------------TESLR
B4JWU6_DROGR/9-387ITFRFNYT...........................----------------------------------------KIDLI
A7USM4_ANOGA/14-434ICFRVNTNESVFG...........SERLSTGQEMP----------------------------------------GSDQH
H3AB66_LATCH/13-373LHMNLEIH.TDFS...........S....VPASYF----------------------------------------SIISH
H2RRY7_TAKRU/13-391LHFRLRIT.VSKS...........MDPVIEASDSA----------------------------------------KETLR
G8ZSN1_TORDC/12-350.RLRLKSREEVVN...........AFNCNNKAQNV----------------------------------------FMSLP
F2UGQ3_SALR5/7-362STFRLVLHPSDTP...........FHRKPSSVSTS----------------------------------------ETRSS
N1QC82_MYCFI/8-372LSFRVSLQENP...............ESNGLLTNT----------------------------------------AIDSE
H0ZQP0_TAEGU/10-365LHLRVRLRRPPPA...........A....DVVFAL----------------------------------------RESLK
I3ITZ6_ORENI/17-396LHFRLRIS.VERS...........TDE..DSSASM----------------------------------------MKTLR
J4G0K5_FIBRA/670-1050YEIKLAV...SSP...........MVSSDNTLA..----------------------------------------.....
S7Z7X2_PENO1/19-452YSLRMMIHPSD..............VA........----------------------------------------TATPD
G2Y6Z9_BOTF4/11-391LSWRLPLAGDF.......................Q----------------------------------------RADVD
M1WB37_CLAP2/12-388LTWRLPLS.......................RDAP----------------------------------------SHPPF
N4UQV1_COLOR/12-396ITWRLPL........................HDSS----------------------------------------APSPR
B2WD68_PYRTR/65-449LTLRLQVEEQE...............GSD..LL.G----------------------------------------ALRRQ
B3MZV3_DROAN/9-389ISFRFNYS...........................----------------------------------------QIDLD
K0KTK1_WICCF/8-359ISIRLPLADIKL................DRSTNQS----------------------------------------MTMST
G1TSQ5_RABIT/13-383LHLRLQAW.AEFS...........T....KQISLF----------------------------------------NQRSH
F4X8J5_ACREC/7-361ICFRLQTVPLEST...........FGSFS......----------------------------------------TEVMT
Q29GF2_DROPS/8-375MSFRFSFN...........................----------------------------------------RIAVA
G0VL18_NAUCC/6-337.LLRLRTLASPL................EKMND..----------------------------------------VMSVP
U4LVT7_PYROM/7-365LSSRLPLAAPS...............TTAS.....----------------------------------------.....
S3CHW0_OPHP1/592-1021MIWRLPVVGLP........................----------------------------------------TPARG
Q6BMI9_DEBHA/5-350DKIRIANANQTADYLQLTIAL...TPHDSNDVSEK----------------------------------------TESFM
I2H589_TETBL/10-369.VLRLPINSIEK...............LKRVNLLE----------------------------------------MDDEL
N1PZE3_MYCP1/9-376LSFRVSLPNKS...............HSTGLLTDT----------------------------------------SLESR
E7LWJ6_YEASV/7-342.MTKLRSKSS...................KIYDSS----------------------------------------IMSLP
L8FLW5_PSED2/12-403LSWRIPL.....................AA.TPSQ----------------------------------------Q...R
B6QVW6_PENMQ/12-422YSFRLQVDPND..................TGLT..----------------------------------------IPNQV
A5DWX9_LODEL/10-359LQIRLPVCISQFSIKSARVVGRNLALSLSVQTIEK----------------------------------------CDENE
UBE3D_PONAB/13-385LHLRLQAH.AELG...........T....KLISMF----------------------------------------NQSLQ
K7JNW4_NASVI/31-384ISFRILTQP.NSL...........YGTFE......----------------------------------------TEIIN
C8VJ15_EMENI/28-443FSYRMQVDDTE..............FVVRDAV...----------------------------------------..EEH
C5DFR9_LACTC/6-347KTLRLRAVEDKGD...........RDLYKNRSLNF----------------------------------------MMQVV
C1FZL9_PARBD/14-476LTYRLQVDETS..............PSVGPRLP.D----------------------------------------GGASF
G9NH43_HYPAI/14-393LAWRLPVP.......................ATET----------------------------------------GLPRF
M3ZXU8_XIPMA/13-392LHFRLRIM.IERS...........ER...EGPTSM----------------------------------------METLK
U7PMZ7_SPOS1/17-441VAWRLPLQG....................P.TTQN----------------------------------------G...Q
M7PCP3_PNEMU/15-354LSIRLPLSNFSIK...........SLKEIS.....----------------------------------------.....
R0KID0_SETT2/64-442LTLRLQLEEKE...............GSD..LL.G----------------------------------------ALGRE
R7YJ95_CONA1/9-376LTLRLQLKDTS...............PGR..LRSG----------------------------------------SFQGS
G2QZ38_THITE/12-402LSWRLPLD.........................AS----------------------------------------SSPSP
B4MTF5_DROWI/9-367LTFRFNYT...........................----------------------------------------KIDMD
W5LC11_ASTMX/13-385LHIKLRLK.VDEY...........S....EASDSV----------------------------------------IERLK
E9CUF8_COCPS/14-450FSFRLQVDEGNQC...........FPSRDASTP..----------------------------------------.....
J7RHU2_KAZNA/6-350.TLRLRVRSE...................SVNATD----------------------------------------SLAPS
J4KRH2_BEAB2/17-390VTWRFPLK.......................PARV----------------------------------------PERQF
Q4P6X1_USTMA/1031-1415ARVKLIMSEAEQR......................----------------------------------------AAALE
Q9VWP0_DROME/9-380ISFRFNYN...........................----------------------------------------QIDLA
S0DNZ8_GIBF5/11-388LSWRLPVS.......................PTEA----------------------------------------RPSRF
G0WHB4_NAUDC/6-346.TLRLKASSS...................RISEAN----------------------------------------VYSDF
E4UYL0_ARTGP/16-475YSFRLPIDEAGT.......................----------------------------------------TTHGV
S3DDS5_GLAL2/11-450VSWRLPLASAP......................SS----------------------------------------GRVVA
E9IFT1_SOLIN/7-361ICFRLQTAPLEST...........FGSFS......----------------------------------------REVIT
G3JK97_CORMM/17-391LTWRLPLQ.......................AARV----------------------------------------PERQF
F1Q7U1_DANRE/13-384SHYRLRLK.VEQP...........T....ESPCSV----------------------------------------IGQLR
Q75DV5_ASHGO/6-339.EVRLKAVNGTE.................GRGADF----------------------------------------TMLAA
B4L5I9_DROMO/9-377ISFRFNYT...........................----------------------------------------TLDVE
A4D9F3_ASPFU/21-420FSFRMQIDEPD..................DSLP..----------------------------------------SKDPL
H9KRH4_APIME/8-350ICFRAQIVP.DPI...........LGSSK......----------------------------------------TQVIT
T5AMN1_OPHSC/15-387LGWRLPVS.......................IAEA----------------------------------------SALRS
E9EVP5_METAR/11-386LTWRLPLS.......................SEGT----------------------------------------PFPHF
Q6CWI5_KLULA/6-349FNVRLNELKSGK...............TFDRSSNH----------------------------------------IMEKL
S8AD65_DACHA/9-377TTHRLPASQAFLS...........STSFDA.....----------------------------------------.....
B4M301_DROVI/9-376ISFRFNYT...........................----------------------------------------TIDLE
F8PKW0_SERL3/430-815YELKLSVVSTSRS...........QSYDDRTSAPL----------------------------------------.....
G3NNB4_GASAC/18-378LHFRLRIC.VTRS...........PDE..EASDSA----------------------------------------METLR
C5DRI9_ZYGRC/22-358.LLTLKSEDVPM.................DKSRND----------------------------------------VLMMP
U1HL67_ENDPU/9-361MSVRLELADIM.......................N----------------------------------------MPCVG
H6C728_EXODN/11-373ISARLQIDDVD........................----------------------------------------QLKPA
G2Q453_THIHA/11-367LEWRLPLD.........................AP----------------------------------------SLPS.
UBE3D_MOUSE/13-364LHLRLRVQ.AESS...........P....QPISVF----------------------------------------NQSLQ
Q16XY0_AEDAE/12-444ICFRINTNENKFH...........SEVLEINEYNA----------------------------------------CTDLK
UBE3D_BOVIN/13-385LHLRLHAR.AESR...........P....ELISVF----------------------------------------NQSSQ
G8YFE7_PICSO/20-360NEIRIKNLSRGQNSLTFSIH....TINGTQKVDES----------------------------------------TMSFM
H2AW44_KAZAF/6-348.VLRLNAKAADY................TDKYDAL----------------------------------------IAS.S
F1NWJ5_CHICK/86-460LHLRLQLRDAPSA...........P....ELAYNV----------------------------------------RESLK
Q6FK88_CANGA/6-347..VRLKRKTQAL..................TNRIS----------------------------------------LVDLP
M4G6J5_MAGP6/10-440CTWRLPLAPSA...............QAPQ.AAAA----------------------------------------AAASP
K5W0X4_PHACS/481-861FQVKLAVIPPASP...........QSQAFDTDA..----------------------------------------.....
L9L4K4_TUPCH/13-384LHLRLQAQ.TEFS...........T....KPISVF----------------------------------------NQNSQ
F6W3S4_MONDO/6-379IHMRLLVQ.ADLN...........K....KLVTAL----------------------------------------NQSLQ

PF00632

Q9BL11_CAEEL/717-1019....S....PSEGKG.L....KMLLSY.EEDDV.............................EDVF.......GL...NF
UBR5_MOUSE/2479-2792....D....PVMYES.L....RQLILASQSSDAD..........................AVFSAM.......DL...AF
A0EFC1_PARTE/672-969....D....MEIYTG.F....QYLREQ.TDSNL.............................IQSL.......TL...NF
Q54GG5_DICDI/425-720....D....PEVYQS.F....IKIKTTEED................................VSDW.......SL...YF
Q2GSX9_CHAGB/694-1033....D....EELYQG.M....LRLK..NYPGN..............................VGDL.......SL...DF
Q4WHR7_ASPFU/967-1337...RDG..WPELTKG.L....ELLLSWQDGD...............................VGDV.......FMRTYEF
Q5KIA2_CRYNJ/1499-1843....D....PSLARS.L....ERLQGYYCVRKEIEALPIPASSRR.....TKLAALTVGDAKLADL.......AL...DF
Q5CW92_CRYPI/1231-1561....D....EELYKS.L....NYIKSLENYQE..............................VKNL.......CL...TF
A2E5Q8_TRIVA/658-966....D....VNYKNT.I....ESLKDAINSRISEDE......................FNKQF..........NL...YF
A0BRI8_PARTE/1050-1354....D....EGLYQQ.F....YSLYYSKSNAD..............................FEQY........F...LY
HUL5_YEAST/607-910....D....SVLYNN.L....IKLL..NMTTDE.............................IKSL.......DL...TF
A7SML1_NEMVE/1229-1585....D....PVLAKS.I....SQLQGLVRQKHRLEKDSSLTPESL....QLAVENLTLDGASVEDL.......GL...DF
Q38D88_TRYB2/1472-1912....D....KQVASS.L....RSLLSMSSKE...............................LSSL.......DL...PF
Q00WM5_OSTTA/458-763....D....PDYYKS.L....KWML..ENSIDG.............................V..M.......EY...TF
Q6BGB8_PARTE/609-908....D....SDQYHR.I....CNLK..NQ..D..............................VTDF.......GL...TF
A2FIB4_TRIVA/386-683....D....PHFVTS.V....SQMREMKEKGEN.............................IEDI.......GL...YF
L9KS41_TUPCH/1283-1677....D....EEFHQS.L....QWMK..DNNITD.............................I..L.......DL...TF
A2DAL9_TRIVA/1571-1869....S....PVVYDT.I....TWIQDTKND................................PADL.......CL...DF
A4VDG4_TETTS/3915-4210....D....PELYKN.L....NWLL..KNQINA.............................DE.I.......DI...NF
A2FLN6_TRIVA/2545-2849....D....SNFKQF.I....LSIENSSSMSPQDF........................HSTY..........ML...NF
A4IBT8_LEIIN/1017-1343....D....PNIAST.L....KRLRLLSAAD...............................LEDA.......GL...DF
A4IC88_LEIIN/3812-4131....DVICVQCVREFRVLSATHAAAAVADADESGG.........................TET..........ELFEDVF
F6U235_XENTR/611-908....H....PVLYQS.L....KELLEY.EGNVE..............................EDM.......MM...TF
A0D2G1_PARTE/170-483....D....EDLFYS.W....QYLLNNNSDQL.........................................DL...YF
A4HF82_LEIBR/3619-3949....DDNIIAALEDEEF........................................................VLSEGFF
Q8SS57_ENCCU/454-746....S....SGIATS.L....RNLRRLSRDE...............................VDSL.......DL...RF
AREL1_MOUSE/512-823....D....PEFYKSKV....CFIL..NNDMSE................................M.......EL...VF
Q4E2E5_TRYCC/2646-2975....DDTVRGALNDDEF........................................................ILNDEFF
A7SQ93_NEMVE/299-612....M....PELARG.L....KELLSY.EGDVE..............................NDL.......CQ...TF
TOM1_YEAST/2962-3268....D....PDYYKS.L....VWIL..ENDITD.............................I..I.......EE...TF
Q6C901_YARLI/697-1001....N....PTVGRS.L....SQLLKF.TESEV.............................ESL........NL...SY
Q9W0H2_DROME/761-1058....S....PPEANS.M....QSLLDY.QGDDF.............................KEVF.......DL...TF
A0BRN4_PARTE/3724-4023...LD....PITFQN.Y....EMMLSYDEKT...............................LESL.......GI...NF
NEDD4_HUMAN/1013-1318....D....SEYYNS.L....RWIL..ENDPTE................................L.......DL...RF
O17736_CAEEL/692-1001....D....PIIFKH.L....KALQ..KMNNRE.............................LDEL.......QL...DF
A2FPQ0_TRIVA/408-705....M....PQEYQS.L....MSLKELVAAGED.............................IEDC.......CL...TF
A2FR71_TRIVA/373-670....E....PDIVKG.I....KEMRQMVQEGKD.............................VKDL.......YL...TF
Q7PSQ3_ANOGA/541-897....D....PDLHRS.L....TWIL..ENNIT.........................................GIIDSTF
Q247X9_TETTS/2308-2606....D....FNSAQQ.H....QWLLENDIN................................GLDL.......GI...TF
A0DNI8_PARTE/201-510....D....RQLYQS.W....DFLVNNKFEADD.............................ISEF.............F
A5K4K7_PLAVS/1441-1991....D....QHVFNS.L....LYIQ....NTPH.............................VESL.......AL...TF
A2DQ34_TRIVA/412-708....D....PDFMKS.A....LDMINMRTKKED.............................VSEL.......CL...TF
Q5KBV2_CRYNJ/2952-3249....D....PEYHKS.L....QWML..DNDITG.............................V..I.......DQ...EF
A2FXS6_TRIVA/392-692....E....PDVAKS.L....REILLMPENGEN.............................VADL.......CL...TF
A4VD17_TETTS/789-1090....D....KELYKN.L....KFLKEYKGD................................TKDL.......CL...TF
A2F7U9_TRIVA/2273-2579....D....KMLSDQ.F....AQLRQAEADKDFQRCAVPWK.............IEQWNGQQA..........ML.....
Q9W196_DROME/819-1122....D....PELYRN.L....LYLK..DYSGD..............................VSEL.......NL...DF
A2DYB1_TRIVA/1674-1977....D....EQLHNS.L....QWIL..ENDIED.............................AC.L.......DL...NF
A2EDQ8_TRIVA/2183-2490....D....SGLLEH.F....NHIRSVSNDADFAQHYAFQW............KVDDWDGTKV..........SL.....
A4S7N1_OSTLU/131-443....D....EDLARS.I....VQIL..EYEGD..............................VADL.......CL...DF
A2EM50_TRIVA/2501-2807....D....NEYKDF.V....TNLEKDSKEKTPQQFQEL................YGNNHNKI.................
Q0UNY9_PHANO/908-1229DLVADG..WPELAKS.F....GQLLSFEGD................................VADI.......FMREYVF
A2EQW9_TRIVA/2209-2511....D....EHFANM.A....NSLVTINEHDFNKTYANMK...............WAVTDWDD.................
HUL4_ASHGO/526-839....Y....PETGTN.M....LKMLEY.DGEDF.............................EDIF.......AL...TF
Q7QE66_ANOGA/554-863....D....SSFHQS.L....LWIR..DNNMDN.............................CGEL.......GL...NF
A2E4I7_TRIVA/2634-2943....D....TPYKEL.MISLENNIQNITDEKVFSSRFSLFFV...........VKDSLGQERP.................
A5K5J0_PLAVS/8258-8564....D....PEFYNS.L....IKIA..EYKLED.............................LN.L.......EI...NF
Q54QF1_DICDI/778-1120....D....PELYNNKV....KLILNTPMNQ...............................VNEIL....GEPL...CF
UPL7_ARATH/828-1142....D....PELYRN.L....MYVK..HYDGD..............................LKEL.......CL...DF
Q8SR14_ENCCU/2104-2410....D....PEFHKS.L....VWIR..DNPVDK.............................S..L.......GI...TF
MUG30_SCHPO/482-807....Q....PSLYRG.L....KELLLF..EGDV.............................KNTY.......GL...NF
A3FPU7_CRYPI/497-797....Q....PEVANS.L....LSLLSI.KSDSE.............................MEQL.......CL...TF
Q38A01_TRYB2/1526-1868....D....PQLDKQ.L....DSLLKLTANE...............................LEEC.......EL...MF
A1CTM1_ASPCL/1468-1817....D....RDLANS.L....LLLKRFASVKKTIEGDKSLSKAQK....SQALQNVEVDGVKVEDL.......SL...DF
A2DAJ9_TRIVA/133-438....D....EQVKTL.F....DRLRQSKNDLDFTSRFQQKW............TYISWTGEIV..........NL.....
Q7PSA4_ANOGA/2506-2929....D....PIRYQF.L....RELQELVQQKQAIEQNDALSSEEKLQQISELKLNTKTGCVALEDL.......AL...TF
UPL3_ARATH/1518-1888....D....AELGKT.L....QELRVVVARKHYLEGVGGDNSS........TISDLCLRGCRIEDL.......SL...EF
C8VT87_EMENI/782-1089....R....PVLARG.L....RALLEF.EGDVA..............................ETF.......CH...TF
Q22F29_TETTS/3359-3651....D....PDEANN.L....LWIL..DHDVT...............................D.L.......CL...TH
Q4UD92_THEAN/251-554....D....SALYRN.I....TMLR..GMSESE.............................IEDL.......GL...TF
Q580G4_TRYB2/3999-4304....D....PELYEN.L....KWLL..VNDVSD................................L.......GL...FF
Q4PHJ7_USTMA/908-1208..SLD....KELYKG.L....ISLK..NYQGN..............................VEDL.......SL...NF
A3LSX3_PICST/660-977....D....HELFMG.L....MKLV..KMPEQE.............................LDSL.......DL...NF
A2DBI7_TRIVA/375-665....D....PSIAQS.F....KMLRNIAKSGGD.............................VKDA.......EI...NF
A0DLU6_PARTE/3989-4284...MD....DVEFKN.I....KSLRQMTKED...............................IDSL.......CI...TF
HACE1_MOUSE/602-909....D....PEYAKN.L....QWIL..DNDISD.............................LG.L.......EL...TF
UBE3B_HUMAN/736-1068....D....SEFYKN.L....TSIK..RYDGD..............................ITDL.......GL...TL
Q00Y47_OSTTA/1123-1477....D....PGLGNT.L....RRLDAAANEIENMKRQGLPEST.........WKQVTVDGANIEDL.......CL...TF
A4IAG7_LEIIN/1064-1369....D....PSLHRS.F....AQLRRISEAE...............................LAAVGLEMDDGTL.....
A7SNF7_NEMVE/430-737....D....HELHSNQI....TWVQ.....ENS.............................VDDL.......GF...TF
A2ERB6_TRIVA/1571-1861....D....EQIYDS.L....MYIKEND..................................VTDL.......CL...TF
A3GHK0_PICST/646-950....F....PVSYGN.L....MKLKKY.STEEL.............................LAL........DL...TF
A7AV31_BABBO/1338-1643....D....PTLARS.L....GNLLVADD.................................IDSA.......GL...VF
Q4Q7L2_LEIMA/1091-1400....D....AELYHQ.L....MSLT..QLSEEE.............................LEAV.......GL...TF
A8BYQ3_GIAIC/636-950....D....LTIYKG.L....CNLYNYAAQLRE.............................GSNLPSIKDTFCL...TF
PUB2_SCHPO/367-671....D....EVYYES.L....KWIK..NNDVDE.............................S..L.......CL...NF
Q54KP2_DICDI/1482-1898....A....PTYASS.L....NRLYSLVTSIKQIQARSDLDGAAK....KEEVGKLRVDGAVIEDL.......CL...DF
A5DS31_LODEL/333-694....D....PELARS.L....EHLQKYIKVYERTPELQKR..............DLRIDDATIEDL.......SL...YF
A2DQ30_TRIVA/383-682....D....PAFVQQ.V....KTF......DGD.............................WAEW.......GL...SF
A4HPV4_LEIBR/2168-2551....D....AALELT.L....HRLEMMDAGS...............................LAAC.......EL...FF
A4IBF5_LEIIN/1897-2310ASWVD....QGIADS.L....ACLSTMDSST...............................LAAL.......DL...RF

PF09814

E3QET8_COLGM/12-396SPHDEPV..PWTALD-L----AP.........G----------------------------------------.S---AV
G1XBI8_ARTOA/9-371..LSGPVQDPWDASS-V----SP.........E----------------------------------------.C---SL
B0WGJ1_CULQU/12-440LECRLEK.....GVN-.----............----------------------------------------.Y---TV
N1JPA0_BLUG1/11-395DTLSSEA..PWSAKA-L----ESR.........----------------------------------------.T---EL
E2C3X0_HARSA/7-363DSNKSAQL.TCSQPI-L----EDIK..LLFKAS----------------------------------------EC---IV
F6PJX9_CIOIN/15-512ISRLERG........-.----............----------------------------------------.S---SQ
V5G5H4_BYSSN/14-444V..DDIT..PWMAED-M----ST.........S----------------------------------------.T---LV
C0NUQ4_AJECG/14-505GSNEVQV..PWTAKD-M----CA.........E----------------------------------------.S---RV
J3NIY5_GAGT3/10-441AARGAAV..PWEAVR-I----AP.........A----------------------------------------AT---SV
K1WUW9_MARBU/11-367DAQSNEA..PWSAKD-I----SE.........D----------------------------------------.A---EF
F2SJ85_TRIRC/16-423SSHDYTSMSPWPAKN-M----TA.........Q----------------------------------------.T---CI
Q7SDG7_NEUCR/13-420ASSAESS..TWTATD-L----KA.........G----------------------------------------.S---EV
G3Y5B6_ASPNA/22-417TLNDGFI..PWTATD-M----SA.........H----------------------------------------.T---RL
N1QJ23_SPHMS/6-367....SIV..PWTAAA-L----NA.........D----------------------------------------.T---EL
W5NKD6_LEPOC/13-376AQKS...........-.----............----------------------------------------.Y---CL
F7E020_XENTR/11-384TQKS...........-.----............----------------------------------------.Y---TF
A1CJR3_ASPCL/19-424V..DDFV..PWTAAD-M----GP.........S----------------------------------------.S---KL
Q59X25_CANAL/5-333VPFTDQAIEKWSCKD-L----SQTPKIGRNHK.----------------------------------------.F---IF
M2R8N7_COCSN/64-446DRQANIV..PWDGAS-L----NGA.......ED----------------------------------------.A---EI
A7TPW1_VANPO/6-340EEK.......WSKKW-L----LSM.......GH----------------------------------------.I---SF
G8BQA7_TETPH/7-357NWK.......WSKKE-L----LAM.......KN----------------------------------------.F---SF
H2L971_ORYLA/17-387AKET...........-.----............----------------------------------------.Y---CF
B4JWU6_DROGR/9-387KLF.KIGSGPKVSHL-M----PLELSFVEKKDH----------------------------------------.L---TL
A7USM4_ANOGA/14-434EENFRLACNVQPGQR-.----............----------------------------------------.Y---RV
H3AB66_LATCH/13-373GVLC...........-.----............----------------------------------------.C---VF
H2RRY7_TAKRU/13-391AKRT...........-.----............----------------------------------------.Y---CF
G8ZSN1_TORDC/12-350EGK.......WSKKE-L----IES.......KG----------------------------------------.F---RI
F2UGQ3_SALR5/7-362QQK............-.----............----------------------------------------.A---CV
N1QC82_MYCFI/8-372....NVV..PWAADA-L----TA.........D----------------------------------------.T---EI
H0ZQP0_TAEGU/10-365PNKN...........-.----............----------------------------------------.Y---IF
I3ITZ6_ORENI/17-396AKKA...........-.----............----------------------------------------.Y---CF
J4G0K5_FIBRA/670-1050.........LLDGDR-L----QTLRP.......----------------------------------------.T---SY
S7Z7X2_PENO1/19-452VVSDEYV..PWTAAD-M----TP.........L----------------------------------------.T---RM
G2Y6Z9_BOTF4/11-391ITQTIEA..PWSAKD-M----VP.........G----------------------------------------.E---QL
M1WB37_CLAP2/12-388SPENQAV..PWAAPD-L----EA.........G----------------------------------------.S---AV
N4UQV1_COLOR/12-396SPPDDPA..PWAAPS-L----VP.........L----------------------------------------.S---AV
B2WD68_PYRTR/65-449DRQANIV..PWDGAS-L----NDT.......KD----------------------------------------.V---EI
B3MZV3_DROAN/9-389ALDAGSVQVAME...-.----PLLLSCRED..D----------------------------------------PF---AL
K0KTK1_WICCF/8-359NYK.......WNSTY-L----KRKI......GK----------------------------------------.Y---SF
G1TSQ5_RABIT/13-383VQGC...........-.----............----------------------------------------.C---TF
F4X8J5_ACREC/7-361NLNKLVQSNTHSQSI-V----NDIK..LLFETS----------------------------------------KC---TI
Q29GF2_DROPS/8-375VLDKRTVRVPMQ...-.----PLLLSCCEN..E----------------------------------------SL---AI
G0VL18_NAUCC/6-337AGK.......WTKKD-L----NLE.......NG----------------------------------------.F---EL
U4LVT7_PYROM/7-365YDNENYA..PWSALQ-L----SSK.......ES----------------------------------------.V---SY
S3CHW0_OPHP1/592-1021SSDDELA..PWSAPD-L----QP.........R----------------------------------------.S---KV
Q6BMI9_DEBHA/5-350DFSSSNLVQKWSCKD-L----KTKTPQTDNKNN----------------------------------------.F---KL
I2H589_TETBL/10-369EGL.......WSKKQ-L----LSL.......SD----------------------------------------.F---NF
N1PZE3_MYCP1/9-376....NVV..PWSAPS-M----TA.........D----------------------------------------.T---AI
E7LWJ6_YEASV/7-342DGR.......WTKEE-L----RSD.......SD----------------------------------------.F---SI
L8FLW5_PSED2/12-403AAPSLPA..PWSAGA-L----AN.........T----------------------------------------.S---SF
B6QVW6_PENMQ/12-422LQDDDYV..PWTASD-V----ST.........C----------------------------------------.V---AL
A5DWX9_LODEL/10-359KASNEIVDDLWSCKW-L----KSETPTIDKKNV----------------------------------------.F---QF
UBE3D_PONAB/13-385AQEC...........-.----............----------------------------------------.C---TF
K7JNW4_NASVI/31-384TENSLT...SSFSSY-S----NKVE..FPPKNT----------------------------------------AC---KF
C8VJ15_EMENI/28-443M..DSFV..PWSAGD-M----LP.........T----------------------------------------.T---KL
C5DFR9_LACTC/6-347PQR.......WMKRD-L----LGE.......E.----------------------------------------.F---QL
C1FZL9_PARBD/14-476VNNGLQV..PWTSKD-M----NS.........E----------------------------------------.S---RI
G9NH43_HYPAI/14-393SAENQSV..PWSSTD-I----KA.........G----------------------------------------.S---RV
M3ZXU8_XIPMA/13-392AKET...........-.----............----------------------------------------.Y---SF
U7PMZ7_SPOS1/17-441TDDTDLA..PWSAPD-L----SL.........G----------------------------------------.S---SV
M7PCP3_PNEMU/15-354.........PWSAVY-I----DP.........N----------------------------------------.S---DF
R0KID0_SETT2/64-442DRQANVV..PWDGAS-L----NDA.......KD----------------------------------------.V---EV
R7YJ95_CONA1/9-376E...NHV..PWSAGA-L----NG........RH----------------------------------------.V---RV
G2QZ38_THITE/12-402SRQGDDV..PWSATD-L----VP.........G----------------------------------------.S---VV
B4MTF5_DROWI/9-367ALEQNTVQVDMQ...-.----PLVMACREN..E----------------------------------------EF---SL
W5LC11_ASTMX/13-385VQEK...........-.----............----------------------------------------.Y---CF
E9CUF8_COCPS/14-450.....QI..PWSAKH-M----SA.........E----------------------------------------.T---RI
J7RHU2_KAZNA/6-350SEKF.....LWDKTQ-L----NEM.......GA----------------------------------------.F---CF
J4KRH2_BEAB2/17-390LPENQPL..PWPASV-I----KP.........G----------------------------------------.S---PI
Q4P6X1_USTMA/1031-1415CRSENIVEFPLSAAC-L----SS..........----------------------------------------.T---RL
Q9VWP0_DROME/9-380SVDGSAVDVPLA...-.----PLLLSCQEN..E----------------------------------------PI---TI
S0DNZ8_GIBF5/11-388SLESQAV..PWTSVD-I----AT.........G----------------------------------------.S---SV
G0WHB4_NAUDC/6-346QGK.......WSKNQ-L----LQS.......SK----------------------------------------.F---KL
E4UYL0_ARTGP/16-475SSRDYTSMSPWPAKS-M----TS.........Q----------------------------------------.T---CI
S3DDS5_GLAL2/11-450NLQENET..PWSARD-L----GE.........D----------------------------------------.A---EF
E9IFT1_SOLIN/7-361NSNRSIRSSTYSQPI-L----NDIK..LLFETS----------------------------------------KC---II
G3JK97_CORMM/17-391LPENQPL..PWSAVD-I----KP.........L----------------------------------------.S---PV
F1Q7U1_DANRE/13-384VDES...........-.----............----------------------------------------.Y---SV
Q75DV5_ASHGO/6-339EDG.......WGRKD-L----ARA.......E.----------------------------------------..---.L
B4L5I9_DROMO/9-377ALE.NSIAVPMKAQ.-.----PLVLGFEEHSEQ----------------------------------------LV---AL
A4D9F3_ASPFU/21-420I..DDFV..PWTAAD-M----SP.........S----------------------------------------.T---RL
H9KRH4_APIME/8-350NST......INNNSL-K----NSVKNTELFNAN----------------------------------------KC---NI
T5AMN1_OPHSC/15-387APESQAV..PWSSVD-L----KT.........G----------------------------------------.S---PI
E9EVP5_METAR/11-386SPETQAV..PWVASD-L----EH.........G----------------------------------------.S---VI
Q6CWI5_KLULA/6-349VAK.......WMRKD-L----VK........HP----------------------------------------.F---VF
S8AD65_DACHA/9-377IADSPPV..PWDAST-L----TA.........E----------------------------------------.A---SI
B4M301_DROVI/9-376ALE.NCVGLPMAPQ.-.----PLLLSFAERTQT----------------------------------------.V---SL
F8PKW0_SERL3/430-815..........MDATQ-L----SSLKP.......----------------------------------------.T---NF
G3NNB4_GASAC/18-378AKET...........-.----............----------------------------------------.Y---CF
C5DRI9_ZYGRC/22-358QMK.......WSKRQ-L----NGL.......KN----------------------------------------.F---KL
U1HL67_ENDPU/9-361NTTGDEA..PWAAND-L----SP.........N----------------------------------------.T---QL
H6C728_EXODN/11-373DDDAGSIEVPWSAGD-L----TT.........N----------------------------------------.T---SV
G2Q453_THIHA/11-367ANQADYT..PWSATD-L----DA.........G----------------------------------------.S---GV
UBE3D_MOUSE/13-364AQEC...........-.----............----------------------------------------.C---TF
Q16XY0_AEDAE/12-444LECGLQA.....GKG-.----............----------------------------------------.Y---RL
UBE3D_BOVIN/13-385DQEC...........-.----............----------------------------------------.C---TF
G8YFE7_PICSO/20-360DGIYNSGTQRWSCKD-L----QQKTPKRGNKND----------------------------------------.F---KF
H2AW44_KAZAF/6-348VEK.......WSKKD-L----LQY.......SG----------------------------------------.F---SL
F1NWJ5_CHICK/86-460PQKN...........-.----............----------------------------------------.Y---VF
Q6FK88_CANGA/6-347DDK.......WNIER-F----KKM.......QG----------------------------------------.F---QI
M4G6J5_MAGP6/10-440AARGVAV..PWEAVR-I----AP.........A----------------------------------------VT---SV
K5W0X4_PHACS/481-861.........ELDATH-F----QHIQP.......----------------------------------------.T---SF
L9L4K4_TUPCH/13-384AGGR...........-.----............----------------------------------------.C---TF
F6W3S4_MONDO/6-379AQKC...........-.----............----------------------------------------.Y---VF

PF00632

Q9BL11_CAEEL/717-1019C.I--SF.........................................................................
UBR5_MOUSE/2479-2792A.I--DL.........................................................................
A0EFC1_PARTE/672-969N.A--SY.........................................................................
Q54GG5_DICDI/425-720C.A--TY.........................................................................
Q2GSX9_CHAGB/694-1033T.I--TD.........................................................................
Q4WHR7_ASPFU/967-1337T..--.FEVFGAVETVDMEKVGRDAVWPLRARDRSK............................................
Q5KIA2_CRYNJ/1499-1843T.L--P..........................................................................
Q5CW92_CRYPI/1231-1561S..--...........................................................................
A2E5Q8_TRIVA/658-966V..--...........................................................................
A0BRI8_PARTE/1050-1354TIV--NN.........................................................................
HUL5_YEAST/607-910E.I--DE.........................................................................
A7SML1_NEMVE/1229-1585V.L--P..........................................................................
Q38D88_TRYB2/1472-1912T.M--P..........................................................................
Q00WM5_OSTTA/458-763S.E--TT.........................................................................
Q6BGB8_PARTE/609-908S.I--TQ.........................................................................
A2FIB4_TRIVA/386-683T.T--SY.........................................................................
L9KS41_TUPCH/1283-1677T.V--NE.........................................................................
A2DAL9_TRIVA/1571-1869T.V--DS.........................................................................
A4VDG4_TETTS/3915-4210A.Y--DK.........................................................................
A2FLN6_TRIVA/2545-2849T..--...........................................................................
A4IBT8_LEIIN/1017-1343SYF--TH.........................................................................
A4IC88_LEIIN/3812-4131...--...........................................................................
F6U235_XENTR/611-908Q.I--SQ.........................................................................
A0D2G1_PARTE/170-483Q..--...........................................................................
A4HF82_LEIBR/3619-3949ASL--P..........................................................................
Q8SS57_ENCCU/454-746V..--...........................................................................
AREL1_MOUSE/512-823A.E--EK.........................................................................
Q4E2E5_TRYCC/2646-2975YSI--P..........................................................................
A7SQ93_NEMVE/299-612Q.V--SF.........................................................................
TOM1_YEAST/2962-3268S.V--ET.........................................................................
Q6C901_YARLI/697-1001N.V--II.........................................................................
Q9W0H2_DROME/761-1058E.I--SR.........................................................................
A0BRN4_PARTE/3724-4023T..--...........................................................................
NEDD4_HUMAN/1013-1318I.I--DE.........................................................................
O17736_CAEEL/692-1001S.V--VT.........................................................................
A2FPQ0_TRIVA/408-705S.V--TY.........................................................................
A2FR71_TRIVA/373-670E.A--TV.........................................................................
Q7PSQ3_ANOGA/541-897S.V--EN.........................................................................
Q247X9_TETTS/2308-2606S..--...........................................................................
A0DNI8_PARTE/201-510V..--...........................................................................
A5K4K7_PLAVS/1441-1991C.I--YERKKPGVRDVRKYEDIISYFQALGRKLSGGSGSMGGSGGVGGSGGVGGARWVGGSGGISGMGGTGWVGGTGWVG
A2DQ34_TRIVA/412-708T.T--TI.........................................................................
Q5KBV2_CRYNJ/2952-3249T.I--ED.........................................................................
A2FXS6_TRIVA/392-692S.S--VV.........................................................................
A4VD17_TETTS/789-1090SIG--DQ.........................................................................
A2F7U9_TRIVA/2273-2579...--...........................................................................
Q9W196_DROME/819-1122T.V--AS.........................................................................
A2DYB1_TRIVA/1674-1977T.Y--NY.........................................................................
A2EDQ8_TRIVA/2183-2490...--...........................................................................
A4S7N1_OSTLU/131-443T.C--SE.........................................................................
A2EM50_TRIVA/2501-2807...--...........................................................................
Q0UNY9_PHANO/908-1229SYD--VF.........................................................................
A2EQW9_TRIVA/2209-2511...--...........................................................................
HUL4_ASHGO/526-839E.T--CF.........................................................................
Q7QE66_ANOGA/554-863T.V--TE.........................................................................
A2E4I7_TRIVA/2634-2943...--...........................................................................
A5K5J0_PLAVS/8258-8564S.T--EI.........................................................................
Q54QF1_DICDI/778-1120V..--.CDIYNQNELLKRSLNNN.........................................................
UPL7_ARATH/828-1142T.V--TE.........................................................................
Q8SR14_ENCCU/2104-2410S.F--DD.........................................................................
MUG30_SCHPO/482-807T.I--NL.........................................................................
A3FPU7_CRYPI/497-797S.A--TI.........................................................................
Q38A01_TRYB2/1526-1868V..--...........................................................................
A1CTM1_ASPCL/1468-1817T.L--P..........................................................................
A2DAJ9_TRIVA/133-438...--...........................................................................
Q7PSA4_ANOGA/2506-2929TYL--PSS........................................................................
UPL3_ARATH/1518-1888T.L--P..........................................................................
C8VT87_EMENI/782-1089V.A--DV.........................................................................
Q22F29_TETTS/3359-3651S.I--DR.........................................................................
Q4UD92_THEAN/251-554T.C--TT.........................................................................
Q580G4_TRYB2/3999-4304T.V--SC.........................................................................
Q4PHJ7_USTMA/908-1208TVT--DE.........................................................................
A3LSX3_PICST/660-977T.V--NE.........................................................................
A2DBI7_TRIVA/375-665V..--...........................................................................
A0DLU6_PARTE/3989-4284T.H--SQ.........................................................................
HACE1_MOUSE/602-909S.V--ET.........................................................................
UBE3B_HUMAN/736-1068S.Y--DE.........................................................................
Q00Y47_OSTTA/1123-1477V.V--P..........................................................................
A4IAG7_LEIIN/1064-1369...--...........................................................................
A7SNF7_NEMVE/430-737S.I--DA.........................................................................
A2ERB6_TRIVA/1571-1861S.L--SI.........................................................................
A3GHK0_PICST/646-950E.V--SY.........................................................................
A7AV31_BABBO/1338-1643T..--...........................................................................
Q4Q7L2_LEIMA/1091-1400V.Y--TV.........................................................................
A8BYQ3_GIAIC/636-950T.A--L..........................................................................
PUB2_SCHPO/367-671S.V--EE.........................................................................
Q54KP2_DICDI/1482-1898T.L--P..........................................................................
A5DS31_LODEL/333-694V.L--P..........................................................................
A2DQ30_TRIVA/383-682E.V--SV.........................................................................
A4HPV4_LEIBR/2168-2551T.I--PV.........................................................................
A4IBF5_LEIIN/1897-2310T.L--P..........................................................................

PF09814

E3QET8_COLGM/12-396.AC..RA-------------------------------------------------------------------------
G1XBI8_ARTOA/9-371.RC..IA-------------------------------------------------------------------------
B0WGJ1_CULQU/12-440.TC..SN-------------------------------------------------------------------------
N1JPA0_BLUG1/11-395.RC..RS-------------------------------------------------------------------------
E2C3X0_HARSA/7-363.LC..AC-------------------------------------------------------------------------
F6PJX9_CIOIN/15-512CGC..KT-------------------------------------------------------------------------
V5G5H4_BYSSN/14-444.RC..RT-------------------------------------------------------------------------
C0NUQ4_AJECG/14-505.RC..QR-------------------------------------------------------------------------
J3NIY5_GAGT3/10-441.RC..RS-------------------------------------------------------------------------
K1WUW9_MARBU/11-367.AC..RE-------------------------------------------------------------------------
F2SJ85_TRIRC/16-423.CC..RC-------------------------------------------------------------------------
Q7SDG7_NEUCR/13-420.VC..RQ-------------------------------------------------------------------------
G3Y5B6_ASPNA/22-417.RC..VK-------------------------------------------------------------------------
N1QJ23_SPHMS/6-367.SC..MH-------------------------------------------------------------------------
W5NKD6_LEPOC/13-376V.C..QS-------------------------------------------------------------------------
F7E020_XENTR/11-384Y.C..QS-------------------------------------------------------------------------
A1CJR3_ASPCL/19-424.RC..RR-------------------------------------------------------------------------
Q59X25_CANAL/5-333.VC..KN-------------------------------------------------------------------------
M2R8N7_COCSN/64-446.LC..KR-------------------------------------------------------------------------
A7TPW1_VANPO/6-340.SC..IG-------------------------------------------------------------------------
G8BQA7_TETPH/7-357.GC..ID-------------------------------------------------------------------------
H2L971_ORYLA/17-387Y.C..QG-------------------------------------------------------------------------
B4JWU6_DROGR/9-387.HC..NK-------------------------------------------------------------------------
A7USM4_ANOGA/14-434.LC..SN-------------------------------------------------------------------------
H3AB66_LATCH/13-373QTC..NV-------------------------------------------------------------------------
H2RRY7_TAKRU/13-391Y.C..QS-------------------------------------------------------------------------
G8ZSN1_TORDC/12-350.LC..LT-------------------------------------------------------------------------
F2UGQ3_SALR5/7-362.KC..TT-------------------------------------------------------------------------
N1QC82_MYCFI/8-372.RC..VH-------------------------------------------------------------------------
H0ZQP0_TAEGU/10-365Y.C..QS-------------------------------------------------------------------------
I3ITZ6_ORENI/17-396Y.C..QG-------------------------------------------------------------------------
J4G0K5_FIBRA/670-1050.LC..AS-------------------------------------------------------------------------
S7Z7X2_PENO1/19-452.RC..RG-------------------------------------------------------------------------
G2Y6Z9_BOTF4/11-391FEC..RR-------------------------------------------------------------------------
M1WB37_CLAP2/12-388.TC..ER-------------------------------------------------------------------------
N4UQV1_COLOR/12-396.TC..RR-------------------------------------------------------------------------
B2WD68_PYRTR/65-449.VC..KS-------------------------------------------------------------------------
B3MZV3_DROAN/9-389.TC..RN-------------------------------------------------------------------------
K0KTK1_WICCF/8-359.NC..IK-------------------------------------------------------------------------
G1TSQ5_RABIT/13-383H.C..QS-------------------------------------------------------------------------
F4X8J5_ACREC/7-361.LC..TC-------------------------------------------------------------------------
Q29GF2_DROPS/8-375.QC..VG-------------------------------------------------------------------------
G0VL18_NAUCC/6-337.NC..LK-------------------------------------------------------------------------
U4LVT7_PYROM/7-365.CC..RA-------------------------------------------------------------------------
S3CHW0_OPHP1/592-1021.SC..RA-------------------------------------------------------------------------
Q6BMI9_DEBHA/5-350.TC..LK-------------------------------------------------------------------------
I2H589_TETBL/10-369.CC..IK-------------------------------------------------------------------------
N1PZE3_MYCP1/9-376.AC..RG-------------------------------------------------------------------------
E7LWJ6_YEASV/7-342.EC..LN-------------------------------------------------------------------------
L8FLW5_PSED2/12-403.SC..RR-------------------------------------------------------------------------
B6QVW6_PENMQ/12-422.HC..RF-------------------------------------------------------------------------
A5DWX9_LODEL/10-359.VC..FK-------------------------------------------------------------------------
UBE3D_PONAB/13-385Y.C..QS-------------------------------------------------------------------------
K7JNW4_NASVI/31-384.YC..KC-------------------------------------------------------------------------
C8VJ15_EMENI/28-443.RC..VK-------------------------------------------------------------------------
C5DFR9_LACTC/6-347.RC..KD-------------------------------------------------------------------------
C1FZL9_PARBD/14-476.RC..RQ-------------------------------------------------------------------------
G9NH43_HYPAI/14-393.CC..RH-------------------------------------------------------------------------
M3ZXU8_XIPMA/13-392H.C..QG-------------------------------------------------------------------------
U7PMZ7_SPOS1/17-441.CC..RG-------------------------------------------------------------------------
M7PCP3_PNEMU/15-354.CC..GF-------------------------------------------------------------------------
R0KID0_SETT2/64-442.VC..KN-------------------------------------------------------------------------
R7YJ95_CONA1/9-376.YCASKG-------------------------------------------------------------------------
G2QZ38_THITE/12-402.SC..RA-------------------------------------------------------------------------
B4MTF5_DROWI/9-367.IC..HN-------------------------------------------------------------------------
W5LC11_ASTMX/13-385Q.C..QS-------------------------------------------------------------------------
E9CUF8_COCPS/14-450.KC..RA-------------------------------------------------------------------------
J7RHU2_KAZNA/6-350.RC..LH-------------------------------------------------------------------------
J4KRH2_BEAB2/17-390.SC..RA-------------------------------------------------------------------------
Q4P6X1_USTMA/1031-1415.GC..AV-------------------------------------------------------------------------
Q9VWP0_DROME/9-380.NC..RD-------------------------------------------------------------------------
S0DNZ8_GIBF5/11-388.AC..RS-------------------------------------------------------------------------
G0WHB4_NAUDC/6-346.KC..FN-------------------------------------------------------------------------
E4UYL0_ARTGP/16-475.CC..RD-------------------------------------------------------------------------
S3DDS5_GLAL2/11-450.SC..RE-------------------------------------------------------------------------
E9IFT1_SOLIN/7-361.LC..AC-------------------------------------------------------------------------
G3JK97_CORMM/17-391.SC..RA-------------------------------------------------------------------------
F1Q7U1_DANRE/13-384L.C..QS-------------------------------------------------------------------------
Q75DV5_ASHGO/6-339.RC..AA-------------------------------------------------------------------------
B4L5I9_DROMO/9-377.HC..NN-------------------------------------------------------------------------
A4D9F3_ASPFU/21-420.RC..SG-------------------------------------------------------------------------
H9KRH4_APIME/8-350.MC..SC-------------------------------------------------------------------------
T5AMN1_OPHSC/15-387.IC..RE-------------------------------------------------------------------------
E9EVP5_METAR/11-386.YC..RS-------------------------------------------------------------------------
Q6CWI5_KLULA/6-349.YC..LD-------------------------------------------------------------------------
S8AD65_DACHA/9-377.HC..TT-------------------------------------------------------------------------
B4M301_DROVI/9-376.HC..SN-------------------------------------------------------------------------
F8PKW0_SERL3/430-815.IC..TS-------------------------------------------------------------------------
G3NNB4_GASAC/18-378H.C..QG-------------------------------------------------------------------------
C5DRI9_ZYGRC/22-358.CC..IQ-------------------------------------------------------------------------
U1HL67_ENDPU/9-361.RC..RD-------------------------------------------------------------------------
H6C728_EXODN/11-373.RC..KS-------------------------------------------------------------------------
G2Q453_THIHA/11-367.DC..RQ-------------------------------------------------------------------------
UBE3D_MOUSE/13-364Y.C..QS-------------------------------------------------------------------------
Q16XY0_AEDAE/12-444.MC..SN-------------------------------------------------------------------------
UBE3D_BOVIN/13-385Y.C..QS-------------------------------------------------------------------------
G8YFE7_PICSO/20-360.CC..IK-------------------------------------------------------------------------
H2AW44_KAZAF/6-348.RC..KK-------------------------------------------------------------------------
F1NWJ5_CHICK/86-460Y.C..QS-------------------------------------------------------------------------
Q6FK88_CANGA/6-347.AC..NN-------------------------------------------------------------------------
M4G6J5_MAGP6/10-440.RC..RS-------------------------------------------------------------------------
K5W0X4_PHACS/481-861.IC..AS-------------------------------------------------------------------------
L9L4K4_TUPCH/13-384Y.C..QS-------------------------------------------------------------------------
F6W3S4_MONDO/6-379H.C..QT-------------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019................................................................................
UBR5_MOUSE/2479-2792................................................................................
A0EFC1_PARTE/672-969................................................................................
Q54GG5_DICDI/425-720................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q4WHR7_ASPFU/967-1337................................................................................
Q5KIA2_CRYNJ/1499-1843................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
HUL5_YEAST/607-910................................................................................
A7SML1_NEMVE/1229-1585................................................................................
Q38D88_TRYB2/1472-1912................................................................................
Q00WM5_OSTTA/458-763................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FIB4_TRIVA/386-683................................................................................
L9KS41_TUPCH/1283-1677................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A4VDG4_TETTS/3915-4210................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A4IC88_LEIIN/3812-4131................................................................................
F6U235_XENTR/611-908................................................................................
A0D2G1_PARTE/170-483................................................................................
A4HF82_LEIBR/3619-3949................................................................................
Q8SS57_ENCCU/454-746................................................................................
AREL1_MOUSE/512-823................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A7SQ93_NEMVE/299-612................................................................................
TOM1_YEAST/2962-3268................................................................................
Q6C901_YARLI/697-1001................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
NEDD4_HUMAN/1013-1318................................................................................
O17736_CAEEL/692-1001................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2FR71_TRIVA/373-670................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q247X9_TETTS/2308-2606................................................................................
A0DNI8_PARTE/201-510................................................................................
A5K4K7_PLAVS/1441-1991GSGGMGNARAIRGNVVRRVFAQSRGAAPDAENANNINSFFNIIDNLDALIHTLDRNLSSLSPGPLEEHVPEVNATERYRG
A2DQ34_TRIVA/412-708................................................................................
Q5KBV2_CRYNJ/2952-3249................................................................................
A2FXS6_TRIVA/392-692................................................................................
A4VD17_TETTS/789-1090................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
Q9W196_DROME/819-1122................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2EM50_TRIVA/2501-2807................................................................................
Q0UNY9_PHANO/908-1229................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
HUL4_ASHGO/526-839................................................................................
Q7QE66_ANOGA/554-863................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
Q54QF1_DICDI/778-1120................................................................................
UPL7_ARATH/828-1142................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
MUG30_SCHPO/482-807................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
UPL3_ARATH/1518-1888................................................................................
C8VT87_EMENI/782-1089................................................................................
Q22F29_TETTS/3359-3651................................................................................
Q4UD92_THEAN/251-554................................................................................
Q580G4_TRYB2/3999-4304................................................................................
Q4PHJ7_USTMA/908-1208................................................................................
A3LSX3_PICST/660-977................................................................................
A2DBI7_TRIVA/375-665................................................................................
A0DLU6_PARTE/3989-4284................................................................................
HACE1_MOUSE/602-909................................................................................
UBE3B_HUMAN/736-1068................................................................................
Q00Y47_OSTTA/1123-1477................................................................................
A4IAG7_LEIIN/1064-1369................................................................................
A7SNF7_NEMVE/430-737................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
A3GHK0_PICST/646-950................................................................................
A7AV31_BABBO/1338-1643................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4IBF5_LEIIN/1897-2310................................................................................

PF09814

E3QET8_COLGM/12-396--------------------------------------------------------------------------------
G1XBI8_ARTOA/9-371--------------------------------------------------------------------------------
B0WGJ1_CULQU/12-440--------------------------------------------------------------------------------
N1JPA0_BLUG1/11-395--------------------------------------------------------------------------------
E2C3X0_HARSA/7-363--------------------------------------------------------------------------------
F6PJX9_CIOIN/15-512--------------------------------------------------------------------------------
V5G5H4_BYSSN/14-444--------------------------------------------------------------------------------
C0NUQ4_AJECG/14-505--------------------------------------------------------------------------------
J3NIY5_GAGT3/10-441--------------------------------------------------------------------------------
K1WUW9_MARBU/11-367--------------------------------------------------------------------------------
F2SJ85_TRIRC/16-423--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-420--------------------------------------------------------------------------------
G3Y5B6_ASPNA/22-417--------------------------------------------------------------------------------
N1QJ23_SPHMS/6-367--------------------------------------------------------------------------------
W5NKD6_LEPOC/13-376--------------------------------------------------------------------------------
F7E020_XENTR/11-384--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-424--------------------------------------------------------------------------------
Q59X25_CANAL/5-333--------------------------------------------------------------------------------
M2R8N7_COCSN/64-446--------------------------------------------------------------------------------
A7TPW1_VANPO/6-340--------------------------------------------------------------------------------
G8BQA7_TETPH/7-357--------------------------------------------------------------------------------
H2L971_ORYLA/17-387--------------------------------------------------------------------------------
B4JWU6_DROGR/9-387--------------------------------------------------------------------------------
A7USM4_ANOGA/14-434--------------------------------------------------------------------------------
H3AB66_LATCH/13-373--------------------------------------------------------------------------------
H2RRY7_TAKRU/13-391--------------------------------------------------------------------------------
G8ZSN1_TORDC/12-350--------------------------------------------------------------------------------
F2UGQ3_SALR5/7-362--------------------------------------------------------------------------------
N1QC82_MYCFI/8-372--------------------------------------------------------------------------------
H0ZQP0_TAEGU/10-365--------------------------------------------------------------------------------
I3ITZ6_ORENI/17-396--------------------------------------------------------------------------------
J4G0K5_FIBRA/670-1050--------------------------------------------------------------------------------
S7Z7X2_PENO1/19-452--------------------------------------------------------------------------------
G2Y6Z9_BOTF4/11-391--------------------------------------------------------------------------------
M1WB37_CLAP2/12-388--------------------------------------------------------------------------------
N4UQV1_COLOR/12-396--------------------------------------------------------------------------------
B2WD68_PYRTR/65-449--------------------------------------------------------------------------------
B3MZV3_DROAN/9-389--------------------------------------------------------------------------------
K0KTK1_WICCF/8-359--------------------------------------------------------------------------------
G1TSQ5_RABIT/13-383--------------------------------------------------------------------------------
F4X8J5_ACREC/7-361--------------------------------------------------------------------------------
Q29GF2_DROPS/8-375--------------------------------------------------------------------------------
G0VL18_NAUCC/6-337--------------------------------------------------------------------------------
U4LVT7_PYROM/7-365--------------------------------------------------------------------------------
S3CHW0_OPHP1/592-1021--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-350--------------------------------------------------------------------------------
I2H589_TETBL/10-369--------------------------------------------------------------------------------
N1PZE3_MYCP1/9-376--------------------------------------------------------------------------------
E7LWJ6_YEASV/7-342--------------------------------------------------------------------------------
L8FLW5_PSED2/12-403--------------------------------------------------------------------------------
B6QVW6_PENMQ/12-422--------------------------------------------------------------------------------
A5DWX9_LODEL/10-359--------------------------------------------------------------------------------
UBE3D_PONAB/13-385--------------------------------------------------------------------------------
K7JNW4_NASVI/31-384--------------------------------------------------------------------------------
C8VJ15_EMENI/28-443--------------------------------------------------------------------------------
C5DFR9_LACTC/6-347--------------------------------------------------------------------------------
C1FZL9_PARBD/14-476--------------------------------------------------------------------------------
G9NH43_HYPAI/14-393--------------------------------------------------------------------------------
M3ZXU8_XIPMA/13-392--------------------------------------------------------------------------------
U7PMZ7_SPOS1/17-441--------------------------------------------------------------------------------
M7PCP3_PNEMU/15-354--------------------------------------------------------------------------------
R0KID0_SETT2/64-442--------------------------------------------------------------------------------
R7YJ95_CONA1/9-376--------------------------------------------------------------------------------
G2QZ38_THITE/12-402--------------------------------------------------------------------------------
B4MTF5_DROWI/9-367--------------------------------------------------------------------------------
W5LC11_ASTMX/13-385--------------------------------------------------------------------------------
E9CUF8_COCPS/14-450--------------------------------------------------------------------------------
J7RHU2_KAZNA/6-350--------------------------------------------------------------------------------
J4KRH2_BEAB2/17-390--------------------------------------------------------------------------------
Q4P6X1_USTMA/1031-1415--------------------------------------------------------------------------------
Q9VWP0_DROME/9-380--------------------------------------------------------------------------------
S0DNZ8_GIBF5/11-388--------------------------------------------------------------------------------
G0WHB4_NAUDC/6-346--------------------------------------------------------------------------------
E4UYL0_ARTGP/16-475--------------------------------------------------------------------------------
S3DDS5_GLAL2/11-450--------------------------------------------------------------------------------
E9IFT1_SOLIN/7-361--------------------------------------------------------------------------------
G3JK97_CORMM/17-391--------------------------------------------------------------------------------
F1Q7U1_DANRE/13-384--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-339--------------------------------------------------------------------------------
B4L5I9_DROMO/9-377--------------------------------------------------------------------------------
A4D9F3_ASPFU/21-420--------------------------------------------------------------------------------
H9KRH4_APIME/8-350--------------------------------------------------------------------------------
T5AMN1_OPHSC/15-387--------------------------------------------------------------------------------
E9EVP5_METAR/11-386--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-349--------------------------------------------------------------------------------
S8AD65_DACHA/9-377--------------------------------------------------------------------------------
B4M301_DROVI/9-376--------------------------------------------------------------------------------
F8PKW0_SERL3/430-815--------------------------------------------------------------------------------
G3NNB4_GASAC/18-378--------------------------------------------------------------------------------
C5DRI9_ZYGRC/22-358--------------------------------------------------------------------------------
U1HL67_ENDPU/9-361--------------------------------------------------------------------------------
H6C728_EXODN/11-373--------------------------------------------------------------------------------
G2Q453_THIHA/11-367--------------------------------------------------------------------------------
UBE3D_MOUSE/13-364--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-444--------------------------------------------------------------------------------
UBE3D_BOVIN/13-385--------------------------------------------------------------------------------
G8YFE7_PICSO/20-360--------------------------------------------------------------------------------
H2AW44_KAZAF/6-348--------------------------------------------------------------------------------
F1NWJ5_CHICK/86-460--------------------------------------------------------------------------------
Q6FK88_CANGA/6-347--------------------------------------------------------------------------------
M4G6J5_MAGP6/10-440--------------------------------------------------------------------------------
K5W0X4_PHACS/481-861--------------------------------------------------------------------------------
L9L4K4_TUPCH/13-384--------------------------------------------------------------------------------
F6W3S4_MONDO/6-379--------------------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019................................................................................
UBR5_MOUSE/2479-2792................................................................................
A0EFC1_PARTE/672-969................................................................................
Q54GG5_DICDI/425-720................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q4WHR7_ASPFU/967-1337............................................................SSELATNWSELSQHADPADL
Q5KIA2_CRYNJ/1499-1843................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
HUL5_YEAST/607-910................................................................................
A7SML1_NEMVE/1229-1585................................................................................
Q38D88_TRYB2/1472-1912................................................................................
Q00WM5_OSTTA/458-763................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FIB4_TRIVA/386-683................................................................................
L9KS41_TUPCH/1283-1677................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A4VDG4_TETTS/3915-4210................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A4IC88_LEIIN/3812-4131................................................................................
F6U235_XENTR/611-908................................................................................
A0D2G1_PARTE/170-483................................................................................
A4HF82_LEIBR/3619-3949................................................................................
Q8SS57_ENCCU/454-746................................................................................
AREL1_MOUSE/512-823................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A7SQ93_NEMVE/299-612................................................................................
TOM1_YEAST/2962-3268................................................................................
Q6C901_YARLI/697-1001................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
NEDD4_HUMAN/1013-1318................................................................................
O17736_CAEEL/692-1001................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2FR71_TRIVA/373-670................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q247X9_TETTS/2308-2606................................................................................
A0DNI8_PARTE/201-510................................................................................
A5K4K7_PLAVS/1441-1991ATYHLDAPLVQLLLRHNEVDLDPAPNGVLLGEDGEVLRYPLRSGDFDSEEGPEAARGGDPPEGGRGSLAVASIDHPDAAN
A2DQ34_TRIVA/412-708................................................................................
Q5KBV2_CRYNJ/2952-3249................................................................................
A2FXS6_TRIVA/392-692................................................................................
A4VD17_TETTS/789-1090................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
Q9W196_DROME/819-1122................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2EM50_TRIVA/2501-2807................................................................................
Q0UNY9_PHANO/908-1229................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
HUL4_ASHGO/526-839................................................................................
Q7QE66_ANOGA/554-863................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
Q54QF1_DICDI/778-1120.........................................................................NNNDEDN
UPL7_ARATH/828-1142................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
MUG30_SCHPO/482-807................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
UPL3_ARATH/1518-1888................................................................................
C8VT87_EMENI/782-1089................................................................................
Q22F29_TETTS/3359-3651................................................................................
Q4UD92_THEAN/251-554................................................................................
Q580G4_TRYB2/3999-4304................................................................................
Q4PHJ7_USTMA/908-1208................................................................................
A3LSX3_PICST/660-977................................................................................
A2DBI7_TRIVA/375-665................................................................................
A0DLU6_PARTE/3989-4284................................................................................
HACE1_MOUSE/602-909................................................................................
UBE3B_HUMAN/736-1068................................................................................
Q00Y47_OSTTA/1123-1477................................................................................
A4IAG7_LEIIN/1064-1369................................................................................
A7SNF7_NEMVE/430-737................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
A3GHK0_PICST/646-950................................................................................
A7AV31_BABBO/1338-1643................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4IBF5_LEIIN/1897-2310................................................................................

PF09814

E3QET8_COLGM/12-396--------------------------------------------------------------------------------
G1XBI8_ARTOA/9-371--------------------------------------------------------------------------------
B0WGJ1_CULQU/12-440--------------------------------------------------------------------------------
N1JPA0_BLUG1/11-395--------------------------------------------------------------------------------
E2C3X0_HARSA/7-363--------------------------------------------------------------------------------
F6PJX9_CIOIN/15-512--------------------------------------------------------------------------------
V5G5H4_BYSSN/14-444--------------------------------------------------------------------------------
C0NUQ4_AJECG/14-505--------------------------------------------------------------------------------
J3NIY5_GAGT3/10-441--------------------------------------------------------------------------------
K1WUW9_MARBU/11-367--------------------------------------------------------------------------------
F2SJ85_TRIRC/16-423--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-420--------------------------------------------------------------------------------
G3Y5B6_ASPNA/22-417--------------------------------------------------------------------------------
N1QJ23_SPHMS/6-367--------------------------------------------------------------------------------
W5NKD6_LEPOC/13-376--------------------------------------------------------------------------------
F7E020_XENTR/11-384--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-424--------------------------------------------------------------------------------
Q59X25_CANAL/5-333--------------------------------------------------------------------------------
M2R8N7_COCSN/64-446--------------------------------------------------------------------------------
A7TPW1_VANPO/6-340--------------------------------------------------------------------------------
G8BQA7_TETPH/7-357--------------------------------------------------------------------------------
H2L971_ORYLA/17-387--------------------------------------------------------------------------------
B4JWU6_DROGR/9-387--------------------------------------------------------------------------------
A7USM4_ANOGA/14-434--------------------------------------------------------------------------------
H3AB66_LATCH/13-373--------------------------------------------------------------------------------
H2RRY7_TAKRU/13-391--------------------------------------------------------------------------------
G8ZSN1_TORDC/12-350--------------------------------------------------------------------------------
F2UGQ3_SALR5/7-362--------------------------------------------------------------------------------
N1QC82_MYCFI/8-372--------------------------------------------------------------------------------
H0ZQP0_TAEGU/10-365--------------------------------------------------------------------------------
I3ITZ6_ORENI/17-396--------------------------------------------------------------------------------
J4G0K5_FIBRA/670-1050--------------------------------------------------------------------------------
S7Z7X2_PENO1/19-452--------------------------------------------------------------------------------
G2Y6Z9_BOTF4/11-391--------------------------------------------------------------------------------
M1WB37_CLAP2/12-388--------------------------------------------------------------------------------
N4UQV1_COLOR/12-396--------------------------------------------------------------------------------
B2WD68_PYRTR/65-449--------------------------------------------------------------------------------
B3MZV3_DROAN/9-389--------------------------------------------------------------------------------
K0KTK1_WICCF/8-359--------------------------------------------------------------------------------
G1TSQ5_RABIT/13-383--------------------------------------------------------------------------------
F4X8J5_ACREC/7-361--------------------------------------------------------------------------------
Q29GF2_DROPS/8-375--------------------------------------------------------------------------------
G0VL18_NAUCC/6-337--------------------------------------------------------------------------------
U4LVT7_PYROM/7-365--------------------------------------------------------------------------------
S3CHW0_OPHP1/592-1021--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-350--------------------------------------------------------------------------------
I2H589_TETBL/10-369--------------------------------------------------------------------------------
N1PZE3_MYCP1/9-376--------------------------------------------------------------------------------
E7LWJ6_YEASV/7-342--------------------------------------------------------------------------------
L8FLW5_PSED2/12-403--------------------------------------------------------------------------------
B6QVW6_PENMQ/12-422--------------------------------------------------------------------------------
A5DWX9_LODEL/10-359--------------------------------------------------------------------------------
UBE3D_PONAB/13-385--------------------------------------------------------------------------------
K7JNW4_NASVI/31-384--------------------------------------------------------------------------------
C8VJ15_EMENI/28-443--------------------------------------------------------------------------------
C5DFR9_LACTC/6-347--------------------------------------------------------------------------------
C1FZL9_PARBD/14-476--------------------------------------------------------------------------------
G9NH43_HYPAI/14-393--------------------------------------------------------------------------------
M3ZXU8_XIPMA/13-392--------------------------------------------------------------------------------
U7PMZ7_SPOS1/17-441--------------------------------------------------------------------------------
M7PCP3_PNEMU/15-354--------------------------------------------------------------------------------
R0KID0_SETT2/64-442--------------------------------------------------------------------------------
R7YJ95_CONA1/9-376--------------------------------------------------------------------------------
G2QZ38_THITE/12-402--------------------------------------------------------------------------------
B4MTF5_DROWI/9-367--------------------------------------------------------------------------------
W5LC11_ASTMX/13-385--------------------------------------------------------------------------------
E9CUF8_COCPS/14-450--------------------------------------------------------------------------------
J7RHU2_KAZNA/6-350--------------------------------------------------------------------------------
J4KRH2_BEAB2/17-390--------------------------------------------------------------------------------
Q4P6X1_USTMA/1031-1415--------------------------------------------------------------------------------
Q9VWP0_DROME/9-380--------------------------------------------------------------------------------
S0DNZ8_GIBF5/11-388--------------------------------------------------------------------------------
G0WHB4_NAUDC/6-346--------------------------------------------------------------------------------
E4UYL0_ARTGP/16-475--------------------------------------------------------------------------------
S3DDS5_GLAL2/11-450--------------------------------------------------------------------------------
E9IFT1_SOLIN/7-361--------------------------------------------------------------------------------
G3JK97_CORMM/17-391--------------------------------------------------------------------------------
F1Q7U1_DANRE/13-384--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-339--------------------------------------------------------------------------------
B4L5I9_DROMO/9-377--------------------------------------------------------------------------------
A4D9F3_ASPFU/21-420--------------------------------------------------------------------------------
H9KRH4_APIME/8-350--------------------------------------------------------------------------------
T5AMN1_OPHSC/15-387--------------------------------------------------------------------------------
E9EVP5_METAR/11-386--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-349--------------------------------------------------------------------------------
S8AD65_DACHA/9-377--------------------------------------------------------------------------------
B4M301_DROVI/9-376--------------------------------------------------------------------------------
F8PKW0_SERL3/430-815--------------------------------------------------------------------------------
G3NNB4_GASAC/18-378--------------------------------------------------------------------------------
C5DRI9_ZYGRC/22-358--------------------------------------------------------------------------------
U1HL67_ENDPU/9-361--------------------------------------------------------------------------------
H6C728_EXODN/11-373--------------------------------------------------------------------------------
G2Q453_THIHA/11-367--------------------------------------------------------------------------------
UBE3D_MOUSE/13-364--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-444--------------------------------------------------------------------------------
UBE3D_BOVIN/13-385--------------------------------------------------------------------------------
G8YFE7_PICSO/20-360--------------------------------------------------------------------------------
H2AW44_KAZAF/6-348--------------------------------------------------------------------------------
F1NWJ5_CHICK/86-460--------------------------------------------------------------------------------
Q6FK88_CANGA/6-347--------------------------------------------------------------------------------
M4G6J5_MAGP6/10-440--------------------------------------------------------------------------------
K5W0X4_PHACS/481-861--------------------------------------------------------------------------------
L9L4K4_TUPCH/13-384--------------------------------------------------------------------------------
F6W3S4_MONDO/6-379--------------------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019..........N.IL..GET.H........TT-E...........L----L.--------S--------------G..GTE
UBR5_MOUSE/2479-2792..........CKEEGGGQV............-E...........L----I.--------P--------------N..GVN
A0EFC1_PARTE/672-969..........V.VW..GEA.Y........FD-D...........L----K.--------P--------------N..GFQ
Q54GG5_DICDI/425-720..........ESIY..GQT.K........VH-N...........L----K.--------Q--------------G..GDD
Q2GSX9_CHAGB/694-1033..........Q......IS.LPGEPFRTTTR-D...........L----V.--------P--------------N..GEN
Q4WHR7_ASPFU/967-1337SPPCSMSADHVDFLECGSSHRSKSERLDYCV-.............----..--------P--------------T....P
Q5KIA2_CRYNJ/1499-1843................GY...........DI-E...........L----K.--------P--------------G..GAH
Q5CW92_CRYPI/1231-1561..........L.TLDLGSLTDVGNNNKHLEI-D...........L----I.--------P--------------N..GRN
A2E5Q8_TRIVA/658-966...............................-VKDSL..GQDHSL----N.--------Q--------------N..GTS
A0BRI8_PARTE/1050-1354................GIP.E........DL-E...........L----K.--------Q--------------G..GGD
HUL5_YEAST/607-910..........P..E..SSA.K........VV-D...........L----I.--------P--------------N..GSK
A7SML1_NEMVE/1229-1585................GYT..........NI-E...........L----K.--------K--------------N..GRN
Q38D88_TRYB2/1472-1912................GDD..........RF-E...........M----I.--------D--------------K..GQS
Q00WM5_OSTTA/458-763..........S.YF..GET.Q........VY-D...........L----V.--------E--------------N..GRH
Q6BGB8_PARTE/609-908..........E.FY..GQI.V........EF-D...........L----I.--------P--------------N..GRQ
A2FIB4_TRIVA/386-683..........E.AY..GEM.M........ET-P...........L----V.--------P--------------D..GDK
L9KS41_TUPCH/1283-1677..........E.VF..GQV.T........ER-E...........L----K.--------S--------------G..GAN
A2DAL9_TRIVA/1571-1869................GNDSP........GI-E...........L----C.--------E--------------G..GRD
A4VDG4_TETTS/3915-4210..........F.YA..GQK.Y........EI-E...........L----K.--------K--------------N..GRN
A2FLN6_TRIVA/2545-2849....................AENS..LGSIV-E...........L----I.--------P--------------G..GSL
A4IBT8_LEIIN/1017-1343.............................EF-............L----K.--------T--------------QTDGRY
A4IC88_LEIIN/3812-4131................GEEFFVTQLSDHSTK-E...........L----I.--------E--------------G..GAQ
F6U235_XENTR/611-908..........TDLF..GNP.L........MH-D...........L----K.--------E--------------N..GDK
A0D2G1_PARTE/170-483....................LEY...FGKTI-N...........L----K.--------E--------------N..GCE
A4HF82_LEIBR/3619-3949...............................-EHVRASPVFLRSL----Q.--------G--------------G..GTG
Q8SS57_ENCCU/454-746..............................V-EHSVDGIPRSYPL----V.--------K--------------N..GED
AREL1_MOUSE/512-823..........YNKS..GQLDK........IV-E...........L----M.--------T--------------G..GAQ
Q4E2E5_TRYCC/2646-2975.............................GI-EWSGESVTDTMGM----V.--------R--------------STRGYP
A7SQ93_NEMVE/299-612..........T.SY..GEV.V........TH-N...........L----K.--------P--------------K..GDT
TOM1_YEAST/2962-3268..........D.DY..GEH.K........VI-N...........L----I.--------E--------------G..GKD
Q6C901_YARLI/697-1001..........D..S.EGVK.K........SC-D...........L----I.--------S--------------N..GSH
Q9W0H2_DROME/761-1058..........D.VF..GEA.E........TK-C...........L----K.--------P--------------N..GNE
A0BRN4_PARTE/3724-4023....................YQK...KKELI-Q...........L----I.--------P--------------D..GQN
NEDD4_HUMAN/1013-1318..........E.LF..GQT.H........QH-E...........L----K.--------N--------------G..GSE
O17736_CAEEL/692-1001..........S.DM..GLV.R........NV-N...........L----K.--------P--------------N..GSK
A2FPQ0_TRIVA/408-705..........N.KF..DAQ.V........TE-D...........L----I.--------T--------------D..GRN
A2FR71_TRIVA/373-670..........T.MF..GDP.I........VV-E...........F----I.--------P--------------G..GSQ
Q7PSQ3_ANOGA/541-897..........N.SF..GVL.K........VH-E...........L----K.--------P--------------N..GAS
Q247X9_TETTS/2308-2606..........YISYSNGAS.K........VI-E...........L----K.--------N--------------D..GQN
A0DNI8_PARTE/201-510.............................IY-RKSKG...DYYEL----K.--------K--------------G..GQT
A5K4K7_PLAVS/1441-1991RDNIAAANRDN.LA..GAS.AED....LECI-D...........L----I.--------E--------------N..GRN
A2DQ34_TRIVA/412-708..........E.QF..GER.I........EI-P...........L----V.--------Q--------------N..GSN
Q5KBV2_CRYNJ/2952-3249..........D.QF..GEK.K........TV-E...........L----K.--------E--------------N..GAN
A2FXS6_TRIVA/392-692..........D.IF..GHQ.E........TV-D...........F----I.--------K--------------N..GST
A4VD17_TETTS/789-1090................NQK..........EI-S...........L----V.--------P--------------N..GKN
A2F7U9_TRIVA/2273-2579...............................-.............----..--------P--------------GHSADS
Q9W196_DROME/819-1122..........S.SL..GQT.Q........IV-E...........L----K.--------P--------------Q..GQS
A2DYB1_TRIVA/1674-1977..........D.YL..GRV.K........AA-N...........L----K.--------P--------------D..GAK
A2EDQ8_TRIVA/2183-2490...............................-.............----..--------P--------------GHDKGD
A4S7N1_OSTLU/131-443..........E.IY..GEL.V........TR-E...........L----V.--------A--------------G..GRD
A2EM50_TRIVA/2501-2807...............................-.............----..--------K--------------NIRGEE
Q0UNY9_PHANO/908-1229................GHR.VDHDMDEPYTQ-.............----..--------P--------------GSPPLT
A2EQW9_TRIVA/2209-2511...............................-.............----..--------.--------------...STN
HUL4_ASHGO/526-839..........PDRFDESKI.H........YR-Q...........L----C.--------P--------------D..GST
Q7QE66_ANOGA/554-863..........ERSD..GTS.I........DI-E...........L----K.--------P--------------N..GRN
A2E4I7_TRIVA/2634-2943...............................-.............----..--------L--------------SEYGRT
A5K5J0_PLAVS/8258-8564..........D.EF..GKT.K........VI-D...........L----I.--------P--------------N..GRN
Q54QF1_DICDI/778-1120NKIENNNNNNNSEFKIQIM.K........TI-N...........L----K.--------P--------------F..GNL
UPL7_ARATH/828-1142..........E.FC..GKM.S........II-E...........L----K.--------P--------------G..GKD
Q8SR14_ENCCU/2104-2410..........V.SF..GVH.R........TV-E...........L----V.--------E--------------G..GAH
MUG30_SCHPO/482-807..........K.AV..EGF.R........TV-E...........L----K.--------E--------------G..GSE
A3FPU7_CRYPI/497-797..........N.NF..GVM.A........EV-P...........I----A.--------P--------------GEFDPS
Q38A01_TRYB2/1526-1868.............................IQ-HGDAEHNGGIVEL----C.--------P--------------N..GAT
A1CTM1_ASPCL/1468-1817................GYP..........SI-E...........L----I.--------D--------------N..GSN
A2DAJ9_TRIVA/133-438...............................-.............----..--------P--------------SQHHTD
Q7PSA4_ANOGA/2506-2929........RNY.....GYA..........SA-D...........L----L.--------P--------------N..GAN
UPL3_ARATH/1518-1888................GYPEY..........-............I----L.--------R--------------S..GDE
C8VT87_EMENI/782-1089..........D.RY..GEV.V........SV-P...........L----C.--------P--------------G..GEK
Q22F29_TETTS/3359-3651..........V.VL..GQN.Y........TL-D...........L----I.--------P--------------N..GRN
Q4UD92_THEAN/251-554..........Q.CF..GSS.I........QE-N...........L----I.--------P--------------N..GHN
Q580G4_TRYB2/3999-4304..........E.KF..GVT.E........EV-E...........L----I.--------P--------------N..GSQ
Q4PHJ7_USTMA/908-1208..........E..F..GVS.M........TR-E...........L----V.--------P--------------G..GAN
A3LSX3_PICST/660-977..........T.LK..GKN.Y........VF-D...........L----LP--------P--------------N..GEN
A2DBI7_TRIVA/375-665.............FTKSDK.G........EV-E...........L----K.--------E--------------G..GSN
A0DLU6_PARTE/3989-4284................GTH..........II-N...........L----I.--------P--------------N..GYK
HACE1_MOUSE/602-909..........D.VF..GAM.E........EV-P...........L----K.--------P--------------G..GGS
UBE3B_HUMAN/736-1068..........D.VM..GQL.V........CH-E...........L----I.--------P--------------G..GKT
Q00Y47_OSTTA/1123-1477................GS...........SV-D...........L----I.--------K--------------G..GSD
A4IAG7_LEIIN/1064-1369...............................-............L----R.--------.--------------......
A7SNF7_NEMVE/430-737..........TNPW.TGRP.V........TI-D...........L----S.--------E--------------N...PD
A2ERB6_TRIVA/1571-1861................DNK..........TI-K...........L----I.--------E--------------N..GEN
A3GHK0_PICST/646-950..........QDLF..GKT.Y........SA-E...........L----I.--------K--------------D..GRK
A7AV31_BABBO/1338-1643....................Y.......GNI-P...........L----V.--------P--------------G..GES
Q4Q7L2_LEIMA/1091-1400..........N.AL..GIT.R........EV-E...........L----V.--------P--------------D..GAQ
A8BYQ3_GIAIC/636-950................GPNGE........DV-P...........L----I.--------E--------------G..GQE
PUB2_SCHPO/367-671..........N.RF..GES.V........TV-D...........L----I.--------P--------------N..GRN
Q54KP2_DICDI/1482-1898................GFA..........GW-E...........L----K.--------P--------------N..GEQ
A5DS31_LODEL/333-694................GYP..........NY-E...........L----I.--------P--------------N..GRE
A2DQ30_TRIVA/383-682..........QDID..GTL.K........SI-E...........L----K.--------K--------------G..GSD
A4HPV4_LEIBR/2168-2551................SEA............-DGYVPGEVEVLPL----I.--------P--------------G..GAN
A4IBF5_LEIIN/1897-2310................GDD..........SV-E...........L----C.--------P--------------D..GAQ

PF09814

E3QET8_COLGM/12-396-----------------------------CA.A-----------P....LV........P..............P--.GR
G1XBI8_ARTOA/9-371-----------------------------CT.T-----------T....II........P..............G--.GR
B0WGJ1_CULQU/12-440-----------------------------CG.N-----------D....LH........E..............Q--PVA
N1JPA0_BLUG1/11-395-----------------------------CD.E-----------V....IM........K..............K--.GK
E2C3X0_HARSA/7-363-----------------------------CK.N-----------V....IS........K..............P--.TT
F6PJX9_CIOIN/15-512-----------------------------CGLT-----------L....FV........K..............N--.VK
V5G5H4_BYSSN/14-444-----------------------------CS.K-----------V....IL........DS.............T--.KH
C0NUQ4_AJECG/14-505-----------------------------CK.N-----------T....LF........T..............P--.SD
J3NIY5_GAGT3/10-441-----------------------------CR.A-----------I....VV........P..............G--.KR
K1WUW9_MARBU/11-367-----------------------------CK.A-----------V....IL........E..............K--.GT
F2SJ85_TRIRC/16-423-----------------------------CA.N-----------I....LF........S..............P--.RE
Q7SDG7_NEUCR/13-420-----------------------------CQ.A-----------V....VV.......................K--RDV
G3Y5B6_ASPNA/22-417-----------------------------CH.N-----------P....IM........E...............--...
N1QJ23_SPHMS/6-367-----------------------------CQ.Q-----------I....VL........A..............R--.GK
W5NKD6_LEPOC/13-376-----------------------------CG.E-----------Q....VL........M..............E--.RV
F7E020_XENTR/11-384-----------------------------CG.E-----------L....II........R..............K--.QQ
A1CJR3_ASPCL/19-424-----------------------------CA.G-----------L....IL........DAPGLDSA...DSQMS--.DA
Q59X25_CANAL/5-333-----------------------------CN.S-----------E....LI........D..............S--.SQ
M2R8N7_COCSN/64-446-----------------------------CE.G-----------V....VM........P..............K--.GK
A7TPW1_VANPO/6-340-----------------------------CK.K-----------V....LL........Q..............K--GDN
G8BQA7_TETPH/7-357-----------------------------CG.N-----------V....IF........E..............S--DDN
H2L971_ORYLA/17-387-----------------------------CM.T-----------R....LL........E..............D--.RV
B4JWU6_DROGR/9-387-----------------------------CL.Y-----------E....LA........P..............G--.CN
A7USM4_ANOGA/14-434-----------------------------CA.G-----------P....LQQSADPAGDP..............D--.TS
H3AB66_LATCH/13-373-----------------------------IS.S-----------V....NQ........E..............V--.KS
H2RRY7_TAKRU/13-391-----------------------------CM.T-----------R....LL........E..............D--.RE
G8ZSN1_TORDC/12-350-----------------------------CR.T-----------D....II........N..............E--.QN
F2UGQ3_SALR5/7-362-----------------------------CK.A-----------AVSPPLQ........P...............--...
N1QC82_MYCFI/8-372-----------------------------CS.S-----------V....LV........Q..............R--.HS
H0ZQP0_TAEGU/10-365-----------------------------CG.D-----------I....VV........S..............D--.RK
I3ITZ6_ORENI/17-396-----------------------------CM.T-----------R....LL........E..............D--.RV
J4G0K5_FIBRA/670-1050-----------------------------CS.L-----------P....LV........Q..............C--.SQ
S7Z7X2_PENO1/19-452-----------------------------CG.T-----------P....FM........KDGGSEES..VNGELP--.SV
G2Y6Z9_BOTF4/11-391-----------------------------CS.T-----------T....IV........E..............P--.DR
M1WB37_CLAP2/12-388-----------------------------CH.S-----------T....II........P..............D--.GK
N4UQV1_COLOR/12-396-----------------------------CE.G-----------A....VV........P..............E--.GK
B2WD68_PYRTR/65-449-----------------------------CQ.G-----------V....LV........P..............K--.GK
B3MZV3_DROAN/9-389-----------------------------CS.A-----------E....LV........E..............N--.RG
K0KTK1_WICCF/8-359-----------------------------CD.Y-----------K....LL........N..............S--.ND
G1TSQ5_RABIT/13-383-----------------------------CG.E-----------A....II........K..............D--.RK
F4X8J5_ACREC/7-361-----------------------------CK.N-----------V....IS........K..............L--.IS
Q29GF2_DROPS/8-375-----------------------------CQ.A-----------E....VA........P..............R--.RI
G0VL18_NAUCC/6-337-----------------------------CN.T-----------P....VI........S..............T--.SN
U4LVT7_PYROM/7-365-----------------------------CK.A-----------V....VL........P..............S--.GR
S3CHW0_OPHP1/592-1021-----------------------------CS.A-----------V....IV........P..............A--.GR
Q6BMI9_DEBHA/5-350-----------------------------CS.H-----------A....II........D..............S--.KE
I2H589_TETBL/10-369-----------------------------CQ.N-----------I....II........S..............K--.SN
N1PZE3_MYCP1/9-376-----------------------------CR.S-----------E....VV........S..............R--.GQ
E7LWJ6_YEASV/7-342-----------------------------CK.Q-----------K....II........S..............K--.DN
L8FLW5_PSED2/12-403-----------------------------CG.Q-----------V....IL........S..............P--.RR
B6QVW6_PENMQ/12-422-----------------------------CK.Q-----------T....IV........DT..........TSKA--.DT
A5DWX9_LODEL/10-359-----------------------------CK.H-----------L....LI........N..............S--QNH
UBE3D_PONAB/13-385-----------------------------CG.E-----------V....II........N..............D--.RK
K7JNW4_NASVI/31-384-----------------------------CK.N-----------E....IT........K..............T--.VC
C8VJ15_EMENI/28-443-----------------------------CE.Q-----------V....IL........DKPSNTAAPTLSDENS--.TS
C5DFR9_LACTC/6-347-----------------------------CE.S-----------C....VL........A..............K--.KD
C1FZL9_PARBD/14-476-----------------------------CK.N-----------I....LF........N..............P--.SE
G9NH43_HYPAI/14-393-----------------------------CD.H-----------V....IV........Q..............P--.ER
M3ZXU8_XIPMA/13-392-----------------------------CT.T-----------R....LL........E..............D--.RM
U7PMZ7_SPOS1/17-441-----------------------------CS.A-----------E....LV........A..............A--.HR
M7PCP3_PNEMU/15-354-----------------------------CL.C-----------F....LL........N..............K--.DQ
R0KID0_SETT2/64-442-----------------------------CA.S-----------P....II........P..............K--.GK
R7YJ95_CONA1/9-376-----------------------------CG.Q-----------E....LV........K..............R--.GT
G2QZ38_THITE/12-402-----------------------------CT.A-----------A....VV........P..............A--.GA
B4MTF5_DROWI/9-367-----------------------------CG.N-----------E....LA........E..............S--.TV
W5LC11_ASTMX/13-385-----------------------------CR.A-----------T....LL........K..............D--.RV
E9CUF8_COCPS/14-450-----------------------------CG.N-----------I....LL........E..............P--.QG
J7RHU2_KAZNA/6-350-----------------------------CD.A-----------P....VL........D..............S--VTN
J4KRH2_BEAB2/17-390-----------------------------CG.Q-----------I....FI........N..............S--.AT
Q4P6X1_USTMA/1031-1415-----------------------------CSKA-----------APKGEVV........K..............G--LLG
Q9VWP0_DROME/9-380-----------------------------CR.A-----------E....LV........A..............G--.RS
S0DNZ8_GIBF5/11-388-----------------------------CG.S-----------E....FV........A..............Q--.SI
G0WHB4_NAUDC/6-346-----------------------------CN.S-----------D....II........D..............E--.QN
E4UYL0_ARTGP/16-475-----------------------------CL.N-----------I....LF........D..............P--.RE
S3DDS5_GLAL2/11-450-----------------------------CS.A-----------I....II.......................K--NGS
E9IFT1_SOLIN/7-361-----------------------------CK.N-----------V....IS........K..............S--.IS
G3JK97_CORMM/17-391-----------------------------CG.A-----------Q....FI........K..............N--.EA
F1Q7U1_DANRE/13-384-----------------------------CG.S-----------R....VL........Q..............H--.RS
Q75DV5_ASHGO/6-339-----------------------------CD.G-----------L....LV........T..............G--.EA
B4L5I9_DROMO/9-377-----------------------------CR.S-----------E....LV........P..............G--.CS
A4D9F3_ASPFU/21-420-----------------------------CE.N-----------V....IL........NNP..RCA...DGSGD--.TS
H9KRH4_APIME/8-350-----------------------------CK.N-----------I....LS........E..............D--.IH
T5AMN1_OPHSC/15-387-----------------------------CG.S-----------G....LV........R..............S--.GQ
E9EVP5_METAR/11-386-----------------------------CN.S-----------I....VI........P..............K--.DT
Q6CWI5_KLULA/6-349-----------------------------CD.T-----------P....VI........S..............S--.IN
S8AD65_DACHA/9-377-----------------------------CT.S-----------R....II........P..............S--.LR
B4M301_DROVI/9-376-----------------------------CH.N-----------Q....LV........P..............G--.CS
F8PKW0_SERL3/430-815-----------------------------CS.L-----------P....LV........H..............S--.SA
G3NNB4_GASAC/18-378-----------------------------CM.T-----------R....LL........E..............D--.RE
C5DRI9_ZYGRC/22-358-----------------------------CD.M-----------D....II........D..............H--.DN
U1HL67_ENDPU/9-361-----------------------------CK.T-----------E....IL........................--.TN
H6C728_EXODN/11-373-----------------------------CG.A-----------D....IL.......................S--AGK
G2Q453_THIHA/11-367-----------------------------CA.T-----------N....LV........R..............P--.GS
UBE3D_MOUSE/13-364-----------------------------CG.E-----------V....TI........K..............D--.RK
Q16XY0_AEDAE/12-444-----------------------------CG.N-----------P....LK........D..............E--TVS
UBE3D_BOVIN/13-385-----------------------------CG.E-----------V....II........R..............D--.RM
G8YFE7_PICSO/20-360-----------------------------CL.S-----------P....IV........D..............S--.SN
H2AW44_KAZAF/6-348-----------------------------CK.H-----------P....VI........D..............N--.SN
F1NWJ5_CHICK/86-460-----------------------------CG.N-----------V....IV........K..............E--.RK
Q6FK88_CANGA/6-347-----------------------------CK.L-----------V....VL........D..............S--EVN
M4G6J5_MAGP6/10-440-----------------------------CR.A-----------V....VV........P..............G--.RH
K5W0X4_PHACS/481-861-----------------------------CS.L-----------P....LV........R..............G--.SA
L9L4K4_TUPCH/13-384-----------------------------CG.E-----------V....VI........R..............D--.RK
F6W3S4_MONDO/6-379-----------------------------CG.E-----------I....IV........K..............E--.RK

PF00632

Q9BL11_CAEEL/717-1019......KPV........TNANRDEYV..................................RLYV..--------------
UBR5_MOUSE/2479-2792......IPV........TPQNVYEYV..................................RKYAEH--------------
A0EFC1_PARTE/672-969......INV........TKDNREEYI..................................ELYTDW--------------
Q54GG5_DICDI/425-720......IQV........TNENRNEYL..................................DLYKDY--------------
Q2GSX9_CHAGB/694-1033......VVV........TNENRLLYI..................................SYVARH--------------
Q4WHR7_ASPFU/967-1337PV.EEASLV........TNDNRAQFV..................................KDYIFW--------------
Q5KIA2_CRYNJ/1499-1843......IEV........DDSNLGEYL..................................EKVLDW--------------
Q5CW92_CRYPI/1231-1561......IPV........NNENKIVYI..................................KLLTHY--------------
A2E5Q8_TRIVA/658-966......CKV........SISNANEYI..................................ALSNEF--------------
A0BRI8_PARTE/1050-1354......ILV........TQQNKKEFI..................................KMYCDQ--------------
HUL5_YEAST/607-910......TYV........TKDNVLLYV..................................TKVTDY--------------
A7SML1_NEMVE/1229-1585......IPV........TIHNLEKYI..................................KLVVHW--------------
Q38D88_TRYB2/1472-1912......TCV........NSTNVSAYI..................................RRAASA--------------
Q00WM5_OSTTA/458-763......ITV........TDENKFEYV..................................NLVTAY--------------
Q6BGB8_PARTE/609-908......INV........TNENKISYI..................................NLYCHF--------------
A2FIB4_TRIVA/386-683......IPV........TNDNFEQFV..................................VMYLDW--------------
L9KS41_TUPCH/1283-1677......TQV........TEKNKKEYI..................................ERMVKW--------------
A2DAL9_TRIVA/1571-1869......KML........TRENADEYV..................................ELLTQY--------------
A4VDG4_TETTS/3915-4210......MQV........CNQNKKEYV..................................KSICHA--------------
A2FLN6_TRIVA/2545-2849......VPV........TFDRRLEFL..................................AKIKKF--------------
A4IBT8_LEIIN/1017-1343T...TDSPL........TPESVSDYI..................................NLREKF--------------
A4IC88_LEIIN/3812-4131......TRV........TLARSSEYA..................................EALLQA--------------
F6U235_XENTR/611-908......IPI........TNENRKEFV..................................SLYTDY--------------
A0D2G1_PARTE/170-483......IKV........TNSNAQEYI..................................NLNIFY--------------
A4HF82_LEIBR/3619-3949VMDGAVAPL........VARPLRPYACMTPEMSMQDMSHLVLEELEEMAASVEAAEVDRRRALAQE--------------
Q8SS57_ENCCU/454-746......IKL........TSENMRLFI..................................EKYVEF--------------
AREL1_MOUSE/512-823......TPV........TNANKIFYL..................................NLLAQY--------------
Q4E2E5_TRYCC/2646-2975......VVT........PTRSTADMASIFPTDGH.................EESVTVAQRRKEAER--------------
A7SQ93_NEMVE/299-612......IPV........TNTNRQEYV..................................QLYVDY--------------
TOM1_YEAST/2962-3268......IIV........TEANKQDYV..................................KKVVEY--------------
Q6C901_YARLI/697-1001......VSV........TTRNRRDYV..................................SRLVKF--------------
Q9W0H2_DROME/761-1058......IAV........TLENRQEFV..................................DLYVDF--------------
A0BRN4_PARTE/3724-4023......VTV........NKENCSVYL..................................DKVAEY--------------
NEDD4_HUMAN/1013-1318......IVV........TNKNKKEYI..................................YLVIQW--------------
O17736_CAEEL/692-1001......FRV........TVENVHEYV..................................RLYVNY--------------
A2FPQ0_TRIVA/408-705......IPV........TSENFDNYV..................................KLYVDW--------------
A2FR71_TRIVA/373-670......KDV........TNENLEEYI..................................QMSIDF--------------
Q7PSQ3_ANOGA/541-897......IAV........TEDNKREYV..................................KLYVNY--------------
Q247X9_TETTS/2308-2606......IEV........NDQNKKEYI..................................QLYCKA--------------
A0DNI8_PARTE/201-510......IQL........DMDNCQEYV..................................NLCIDY--------------
A5K4K7_PLAVS/1441-1991......IPV........DDSNKKLYI..................................KLYINY--------------
A2DQ34_TRIVA/412-708......IDV........TNDNLDAFI..................................ASYINW--------------
Q5KBV2_CRYNJ/2952-3249......IPV........TEGNKEEYV..................................RLVVSY--------------
A2FXS6_TRIVA/392-692......IDV........TNENVEQYV..................................EQYIKY--------------
A4VD17_TETTS/789-1090......IPV........DNSNILRYI..................................YLVADY--------------
A2F7U9_TRIVA/2273-2579.......TV........GPGEVENFI..................................IECINF--------------
Q9W196_DROME/819-1122......IPV........TNSNRIEYL..................................QLIADY--------------
A2DYB1_TRIVA/1674-1977......IAV........DNKNKEEYV..................................NLMVQY--------------
A2EDQ8_TRIVA/2183-2490.......IL........NKEDVEQYI..................................KECVDY--------------
A4S7N1_OSTLU/131-443......VEV........TAANKLFYV..................................FSLADY--------------
A2EM50_TRIVA/2501-2807......VSVFSFSSKSLNQGSAGRFI..................................SSANSL--------------
Q0UNY9_PHANO/908-1229STPKEPKMV........TNKNRAQFI..................................WDYLNH--------------
A2EQW9_TRIVA/2209-2511WLKSKDQIV........GYNDIKNYL..................................NMCVGA--------------
HUL4_ASHGO/526-839......QAV........TRENKHEYF..................................RLWMDF--------------
Q7QE66_ANOGA/554-863......ITV........SERNKRDYL..................................DRIIKW--------------
A2E4I7_TRIVA/2634-2943......RPV........TLQNVREYI..................................SLSKDF--------------
A5K5J0_PLAVS/8258-8564......IPV........TDENKHKYI..................................ELLCEM--------------
Q54QF1_DICDI/778-1120......IRV........TDDNKLEYL..................................ELWVNS--------------
UPL7_ARATH/828-1142......TSV........TNENKMQYI..................................HAMADY--------------
Q8SR14_ENCCU/2104-2410......VFV........DDSNKAEYV..................................KLATQY--------------
MUG30_SCHPO/482-807......LSV........DNENRKEYV..................................LRYVDY--------------
A3FPU7_CRYPI/497-797......EPV........TICNVHRYV..................................ELYLDW--------------
Q38A01_TRYB2/1526-1868......TQV........SAMNVNEYV..................................QEVRRY--------------
A1CTM1_ASPCL/1468-1817......IPV........TTDNVDQYV..................................DRVVDM--------------
A2DAJ9_TRIVA/133-438.......YV........TGESVEQFI..................................DEFVQA--------------
Q7PSA4_ANOGA/2506-2929......IDV........TINNVEEYC..................................NLTVAF--------------
UPL3_ARATH/1518-1888.......IV........DITNLEEYI..................................SLVVDA--------------
C8VT87_EMENI/782-1089......KPV........TNANRREFV..................................DLFVHY--------------
Q22F29_TETTS/3359-3651......IEV........TEQNKKEYV..................................KQIAHF--------------
Q4UD92_THEAN/251-554......TRV........TKQNVESFI..................................HQFSNF--------------
Q580G4_TRYB2/3999-4304......VAV........TNANKSQYV..................................RLRCEF--------------
Q4PHJ7_USTMA/908-1208......IPV........TNLNRMEYI..................................FRISHY--------------
A3LSX3_PICST/660-977......TKL........NSSNKLSYI..................................HQISNF--------------
A2DBI7_TRIVA/375-665......IVV........DNDSVEEYI..................................RLYIDY--------------
A0DLU6_PARTE/3989-4284......IQV........TIHNTERYL..................................QKLADY--------------
HACE1_MOUSE/602-909......ILV........TQNNKAEYV..................................QLVTEL--------------
UBE3B_HUMAN/736-1068......IPV........TNENKISYI..................................HLMAHF--------------
Q00Y47_OSTTA/1123-1477......IVV........NEVNLREYV..................................DAVVEA--------------
A4IAG7_LEIIN/1064-1369.................THADLEQHL..................................QLTVVT--------------
A7SNF7_NEMVE/430-737......EEL........TDSNKSEYV..................................KLVSQF--------------
A2ERB6_TRIVA/1571-1861......VDV........TNENKEKYI..................................ELYINQ--------------
A3GHK0_PICST/646-950......IFV........TAETRKSYI..................................EKYTQF--------------
A7AV31_BABBO/1338-1643......MKV........TSSNLHEYV..................................RAVIRM--------------
Q4Q7L2_LEIMA/1091-1400......MHV........TPRNCLFYV..................................HLVADF--------------
A8BYQ3_GIAIC/636-950......IYV........DEHNVEGYI..................................KAYANY--------------
PUB2_SCHPO/367-671......IAV........NNQNKMNYL..................................KALTEH--------------
Q54KP2_DICDI/1482-1898......INV........TLDNIEEYL..................................NLIVKN--------------
A5DS31_LODEL/333-694......VQV........DHTNLEAYI..................................HKVVDA--------------
A2DQ30_TRIVA/383-682......IAL........TNDNYKEYI..................................QLYMEY--------------
A4HPV4_LEIBR/2168-2551......RRV........TVDNVQEYT..................................RCLRTY--------------
A4IBF5_LEIIN/1897-2310......IPV........TKKNLRLYQ..................................RRVVGA--------------

PF09814

E3QET8_COLGM/12-396ARE..WKDL--------PSENWAEMM----------------------------------DFWHCH..............
G1XBI8_ARTOA/9-371IQK..WKNL--------PSEHWADMM----------------------------------DLWHCH..............
B0WGJ1_CULQU/12-440FKR..ILEL--------PSDHMDS..----------------------------------NEWYCH..............
N1JPA0_BLUG1/11-395IHT..WKDL--------PSENWAEMM----------------------------------DFWHCH..............
E2C3X0_HARSA/7-363FKR..ALPL--------PDIQCSP..----------------------------------DEWFCC..............
F6PJX9_CIOIN/15-512FNR..VLPL--------PSQSWRDLF----------------------------------NNWSCC..............
V5G5H4_BYSSN/14-444TEGWTWKNL--------PSGNWAEMM----------------------------------DFWHCH..............
C0NUQ4_AJECG/14-505KGKVTWKDL--------PSTDWAEMM----------------------------------DLWHCH..............
J3NIY5_GAGT3/10-441IAR..WKDL--------PSADWAEMM----------------------------------EFWHCH..............
K1WUW9_MARBU/11-367VRV..WKDL--------PSENWAEMM----------------------------------DYWHCH..............
F2SJ85_TRIRC/16-423AQNIIWKDL--------PSADWAEMM----------------------------------DLWHCH..............
Q7SDG7_NEUCR/13-420VKV..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
G3Y5B6_ASPNA/22-417.GGKVWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
N1QJ23_SPHMS/6-367VLT..WKNL--------PSENWAEMM----------------------------------DFWHCH..............
W5NKD6_LEPOC/13-376FNR..VLPL--------PNGNWNALV----------------------------------DDWCCH..............
F7E020_XENTR/11-384FCR..VLPL--------PSENWSSLV----------------------------------EEWCCH..............
A1CJR3_ASPCL/19-424SDGWVWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
Q59X25_CANAL/5-333YD...FKDM--------PSEQWYEMM----------------------------------DFWHCH..............
M2R8N7_COCSN/64-446VQQ..WKDL--------PNENWAEMM----------------------------------DFWHCH..............
A7TPW1_VANPO/6-340VTK..LNSL--------PSEFWMELM----------------------------------DYWHCH..............
G8BQA7_TETPH/7-357CRK..LNIM--------PSEFWAELM----------------------------------DNWHCH..............
H2L971_ORYLA/17-387FKR..VLPL--------PNGSWNAIV----------------------------------DDWCCH..............
B4JWU6_DROGR/9-387YNR..LREL--------PSGLFDA..----------------------------------SEFFCH..............
A7USM4_ANOGA/14-434FQR..VLEL--------PSEQLDT..----------------------------------DDWFCH..............
H3AB66_LATCH/13-373FRR..VLPL--------PSGNWSALV----------------------------------EEWCCH..............
H2RRY7_TAKRU/13-391FKR..VLPL--------PNGNWSALV----------------------------------DDWCCH..............
G8ZSN1_TORDC/12-350CFK..INEM--------PSEFWMELM----------------------------------DYWHCH..............
F2UGQ3_SALR5/7-362......YRL--------PSLRWHEIQ----------------------------------DFVNCC..............
N1QC82_MYCFI/8-372VAI..WKNL--------PSENWAEMM----------------------------------DFWHCH..............
H0ZQP0_TAEGU/10-365FLR..VLPL--------PSENWSDLV----------------------------------EEWCCH..............
I3ITZ6_ORENI/17-396FNR..VLPL--------PNGNWNAIV----------------------------------DDWCCH..............
J4G0K5_FIBRA/670-1050LRD..YRDL--------PSEHWEELV----------------------------------DAWMCH..............
S7Z7X2_PENO1/19-452RSEWLWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
G2Y6Z9_BOTF4/11-391INE..WRDL--------PSEGWAEMM----------------------------------DFWHCH..............
M1WB37_CLAP2/12-388LKV..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
N4UQV1_COLOR/12-396AAE..WKDL--------PSENWAEMM----------------------------------DFWHCH..............
B2WD68_PYRTR/65-449IQQ..WKDL--------PNENWAEMM----------------------------------DFWHCH..............
B3MZV3_DROAN/9-389YRR..LREF--------PSCVVDP..----------------------------------GEFFCH..............
K0KTK1_WICCF/8-359IET..VLDM--------PSSLWAEMM----------------------------------DFWHCH..............
G1TSQ5_RABIT/13-383LLR..ILPL--------PSENWGALV----------------------------------GEWCCH..............
F4X8J5_ACREC/7-361FKR..FLPL--------PDAEYDP..----------------------------------DEWFCC..............
Q29GF2_DROPS/8-375YTR..LREF--------PNCIVDP..----------------------------------NEFFCH..............
G0VL18_NAUCC/6-337INK..INEL--------PSEFWMELM----------------------------------DYWHCH..............
U4LVT7_PYROM/7-365IQK..WKNL--------PSGNWADMM----------------------------------DFWHCH..............
S3CHW0_OPHP1/592-1021IAA..WKDL--------PSDNWAEMM----------------------------------EFWHCH..............
Q6BMI9_DEBHA/5-350YDR..FFDM--------PSELWSEMM----------------------------------EFWHCH..............
I2H589_TETBL/10-369SFK..INQM--------PSEYWMELM----------------------------------DYWHCH..............
N1PZE3_MYCP1/9-376IRA..WKDL--------PSENWAEMM----------------------------------DFWHCH..............
E7LWJ6_YEASV/7-342CQV..LNDM--------PSEFWFELM----------------------------------DYWHCH..............
L8FLW5_PSED2/12-403VTT..WRDL--------PSENWAEMM----------------------------------EFWHCH..............
B6QVW6_PENMQ/12-422SSPWQWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
A5DWX9_LODEL/10-359V....FKDM--------PNEYWYELM----------------------------------DFWHCH..............
UBE3D_PONAB/13-385LLR..VLPL--------PSENWGALV----------------------------------GEWCCH..............
K7JNW4_NASVI/31-384FQR..ILPL--------PSSDCDP..----------------------------------QEWFCC..............
C8VJ15_EMENI/28-443HAGWLWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
C5DFR9_LACTC/6-347CVQ..INEM--------PSEFWAELM----------------------------------DYWHCH..............
C1FZL9_PARBD/14-476KGGIIWKDL--------PSSDWAEMM----------------------------------DLWHCH..............
G9NH43_HYPAI/14-393IKS..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
M3ZXU8_XIPMA/13-392FSR..VLPL--------PNGNWNAIV----------------------------------DDWCCH..............
U7PMZ7_SPOS1/17-441IQA..WKDL--------PSDNWAEMM----------------------------------EFWHCH..............
M7PCP3_PNEMU/15-354IKH..WRNL--------PSDNWVDMM----------------------------------DYWVCC..............
R0KID0_SETT2/64-442IQQ..WRDL--------PNENWAEMM----------------------------------DFWHCH..............
R7YJ95_CONA1/9-376VGDGGWKDL--------PNENWAEMM----------------------------------DFWHCH..............
G2QZ38_THITE/12-402VKA..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
B4MTF5_DROWI/9-367YKR..LREF--------PSCIVDP..----------------------------------SDFFCH..............
W5LC11_ASTMX/13-385FKR..VLPL--------PNGNWNTLV----------------------------------DDWCCH..............
E9CUF8_COCPS/14-450GNRMVWKDL--------PSANWAELM----------------------------------DIWHCH..............
J7RHU2_KAZNA/6-350CLK..LNNM--------PSEYWAELM----------------------------------DYWHCH..............
J4KRH2_BEAB2/17-390VTT..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
Q4P6X1_USTMA/1031-1415SNEVVWKAL--------PSEGWEELV----------------------------------DAWMCHADQELNASLTQTAV
Q9VWP0_DROME/9-380YRR..LREF--------PSLLVDP..----------------------------------TEFFCH..............
S0DNZ8_GIBF5/11-388INA..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
G0WHB4_NAUDC/6-346YRK..LNDM--------PSEYWAELM----------------------------------DYWHCH..............
E4UYL0_ARTGP/16-475GQDIVWKDL--------PSADWAEMM----------------------------------DLWHCH..............
S3DDS5_GLAL2/11-450IKD..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
E9IFT1_SOLIN/7-361FKR..FLPL--------PDTEYDP..----------------------------------DEWFCC..............
G3JK97_CORMM/17-391VET..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
F1Q7U1_DANRE/13-384FGR..VLPL--------PNGNWNALV----------------------------------DDWCCH..............
Q75DV5_ASHGO/6-339CRR..VSAM--------PSEFWTELM----------------------------------DYWHCH..............
B4L5I9_DROMO/9-377YNR..LREC--------PSGLIDP..----------------------------------SEFFCH..............
A4D9F3_ASPFU/21-420PAGWTWKDL--------PSGNWAEMM----------------------------------DFWHCH..............
H9KRH4_APIME/8-350IKR..ILPV--------PNMNYDP..----------------------------------DEWFCC..............
T5AMN1_OPHSC/15-387IKS..WQDL--------PSENWAEMM----------------------------------EFWHCH..............
E9EVP5_METAR/11-386IQS..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
Q6CWI5_KLULA/6-349CKR..IRDM--------PSEFWADFM----------------------------------DYWHCH..............
S8AD65_DACHA/9-377IRK..WKNL--------PSEHWADLM----------------------------------DLWHCH..............
B4M301_DROVI/9-376YSR..LREF--------PSGIIDP..----------------------------------SEFFCH..............
F8PKW0_SERL3/430-815IVE..YKDL--------PSEHWEELV----------------------------------DAWMCH..............
G3NNB4_GASAC/18-378FKR..VLPL--------PNCNWNAIV----------------------------------DDWCCH..............
C5DRI9_ZYGRC/22-358CFR..LNEM--------PSEFWMELM----------------------------------DYWHCH..............
U1HL67_ENDPU/9-361ELPLQFKAL--------PSEHWAEMM----------------------------------DIWHCH..............
H6C728_EXODN/11-373VTV..WKDL--------PSTHWAELM----------------------------------DFWFCH..............
G2Q453_THIHA/11-367VKV..WKDL--------PSENWAEMM----------------------------------EFWHCH..............
UBE3D_MOUSE/13-364LLR..VLPL--------PSENWSALV----------------------------------GEWCCH..............
Q16XY0_AEDAE/12-444FRR..ILEL--------PSDHMDS..----------------------------------NEWYCH..............
UBE3D_BOVIN/13-385LLR..VLPL--------PGDNWGALV----------------------------------DEWCCH..............
G8YFE7_PICSO/20-360ISM..FYDM--------PSEFWSEMM----------------------------------EFWHCH..............
H2AW44_KAZAF/6-348CKK..LNEM--------PSEFWMEFM----------------------------------DYWHCH..............
F1NWJ5_CHICK/86-460FLR..VLPL--------PSENWSALV----------------------------------EEWCCH..............
Q6FK88_CANGA/6-347IKK..ISEM--------PSEFWAEFM----------------------------------DYWHCH..............
M4G6J5_MAGP6/10-440ITC..WKDL--------PSADWAEMM----------------------------------EFWHCH..............
K5W0X4_PHACS/481-861LHR..YRDL--------PSEHWAELV----------------------------------DAWMCH..............
L9L4K4_TUPCH/13-384LLR..VLPL--------PSENWGALV----------------------------------EEWCCH..............
F6W3S4_MONDO/6-379LLR..VLPL--------PSENWNALV----------------------------------EEWCCH..............

PF00632

Q9BL11_CAEEL/717-1019.----------.HHRLELGY--------------------------------------------NGEIAQQALLFRKGFS
UBR5_MOUSE/2479-2792R----------MLVVAEQPL--------------------------------------------HA........MRKGLL
A0EFC1_PARTE/672-969Y----------LNKLVKHQF--------------------------------------------DL........LYSGFK
Q54GG5_DICDI/425-720L----------LNKSISKQF--------------------------------------------AP........FFKGFR
Q2GSX9_CHAGB/694-1033R----------LIIQPYAQT--------------------------------------------RA........FLRGLG
Q4WHR7_ASPFU/967-1337L----------TDKSIRPQF--------------------------------------------EA........FARGFY
Q5KIA2_CRYNJ/1499-1843T----------LGSGVAEQV--------------------------------------------KA........FQDGFS
Q5CW92_CRYPI/1231-1561K----------LITSIKLQA--------------------------------------------EA........FLRGLS
A2E5Q8_TRIVA/658-966R----------I.KELQKYL--------------------------------------------NW........VRIGFL
A0BRI8_PARTE/1050-1354I----------MAKNVENQM--------------------------------------------KA........FLEGFY
HUL5_YEAST/607-910K----------LNKRCFKPV--------------------------------------------SA........FHGGLS
A7SML1_NEMVE/1229-1585T----------LVEGVERQM--------------------------------------------QA........FQEGFD
Q38D88_TRYB2/1472-1912L----------LYESVVMPI--------------------------------------------RF........ITYGFR
Q00WM5_OSTTA/458-763R----------MTNAVKDQL--------------------------------------------AA........FVKGFE
Q6BGB8_PARTE/609-908R----------LNKQIKEQS--------------------------------------------QI........FRAGLE
A2FIB4_TRIVA/386-683H----------TSESFRSKF--------------------------------------------ES........LAEGFR
L9KS41_TUPCH/1283-1677R----------VERGVVQQT--------------------------------------------EA........LVRGFY
A2DAL9_TRIVA/1571-1869Y----------LYKETDKQI--------------------------------------------DA........LKKGFQ
A4VDG4_TETTS/3915-4210K----------LIREIYYQA--------------------------------------------HA........ITSGFK
A2FLN6_TRIVA/2545-2849R----------V.KEFNESL--------------------------------------------EQ........LRRGFN
A4IBT8_LEIIN/1017-1343D----------LVERRRTAL--------------------------------------------EA........MRKGFY
A4IC88_LEIIN/3812-4131R----------L.HEFDLQL--------------------------------------------HK........MREGLL
F6U235_XENTR/611-908I----------LNKSVEKQF--------------------------------------------KA........FRRGFH
A0D2G1_PARTE/170-483Y----------TSQFLEPYL--------------------------------------------SD........FLTGFY
A4HF82_LEIBR/3619-3949A----------LLHQYDPAF--------------------------------------------LA........IRAGLT
Q8SS57_ENCCU/454-746H----------TDALIKPQF--------------------------------------------ES........IKRGFY
AREL1_MOUSE/512-823R----------LASQVKEEV--------------------------------------------EH........FLKGLN
Q4E2E5_TRYCC/2646-2975A----------LLHQYDELL--------------------------------------------LA........MLSGIT
A7SQ93_NEMVE/299-612L----------LNSSIYKQF--------------------------------------------EA........FYHGFH
TOM1_YEAST/2962-3268K----------LQTSVKEQM--------------------------------------------DN........FLVGFY
Q6C901_YARLI/697-1001F----------LETSISTTF--------------------------------------------AE........YKKGFH
Q9W0H2_DROME/761-1058V----------FNKSVELHY--------------------------------------------NA........FHKGFM
A0BRN4_PARTE/3724-4023V----------IQTQYQDIY--------------------------------------------TP........FISGFQ
NEDD4_HUMAN/1013-1318R----------FVNRIQKQM--------------------------------------------AA........FKEGFF
O17736_CAEEL/692-1001H----------LKQRIASMV--------------------------------------------DA........VRKGIS
A2FPQ0_TRIVA/408-705Y----------LNKSVDKMF--------------------------------------------DA........FKKGFD
A2FR71_TRIVA/373-670Y----------LNKHIANEF--------------------------------------------SA........FQRGFK
Q7PSQ3_ANOGA/541-897R----------FMRGIEQQF--------------------------------------------LA........LSKGFG
Q247X9_TETTS/2308-2606K----------MQDEIALQT--------------------------------------------QY........FQKGLF
A0DNI8_PARTE/201-510Y----------TNISVKPFL--------------------------------------------TA........FLSTLY
A5K4K7_PLAVS/1441-1991K----------FKKMVQKKT--------------------------------------------QA........FLKGLS
A2DQ34_TRIVA/412-708W----------ANISIAKQY--------------------------------------------EA........FLSGFM
Q5KBV2_CRYNJ/2952-3249R----------LDNSIRDQI--------------------------------------------KS........FLEGFY
A2FXS6_TRIVA/392-692K----------FIKSIQFPM--------------------------------------------NY........LRKGFS
A4VD17_TETTS/789-1090K----------MNKCIENQT--------------------------------------------KA........FMNGLT
A2F7U9_TRIVA/2273-2579R----------I.NSIKPTL--------------------------------------------QL........IRQGFI
Q9W196_DROME/819-1122K----------LNVQIRRHC--------------------------------------------NA........FRKGLS
A2DYB1_TRIVA/1674-1977R----------LRGQISTQV--------------------------------------------DS........FLEGFH
A2EDQ8_TRIVA/2183-2490R----------L.NSILPLL--------------------------------------------RE........MKAAFR
A4S7N1_OSTLU/131-443H----------LNRRIATPM--------------------------------------------LA........FMRGLT
A2EM50_TRIVA/2501-2807R----------IQKLLTPLL--------------------------------------------L.........IRNGFW
Q0UNY9_PHANO/908-1229L----------TYLSVQPQL--------------------------------------------HA........FKQGFY
A2EQW9_TRIVA/2209-2511R----------I.NSVKANL--------------------------------------------EN........MKRGFY
HUL4_ASHGO/526-839Y----------LNRSIAPGF--------------------------------------------ES........FRNGFF
Q7QE66_ANOGA/554-863R----------LERGVLEQT--------------------------------------------EW........LVRGFN
A2E4I7_TRIVA/2634-2943R----------I.KELKSNL--------------------------------------------DI........IRQGYW
A5K5J0_PLAVS/8258-8564K----------VTNSIKEQL--------------------------------------------EA........FMDGFK
Q54QF1_DICDI/778-1120L----------FYNGVKTQI--------------------------------------------EE........YREGLF
UPL7_ARATH/828-1142K----------LNRQIVPFS--------------------------------------------NA........FYRGLT
Q8SR14_ENCCU/2104-2410R----------LFNGIELQL--------------------------------------------SA........LKSGLF
MUG30_SCHPO/482-807L----------LNTTVKKQF--------------------------------------------SA........FFDGFM
A3FPU7_CRYPI/497-797F----------LNKSIESQF--------------------------------------------RA........FYNGFQ
Q38A01_TRYB2/1526-1868Y----------SKTALARPV--------------------------------------------SH........FIQGLR
A1CTM1_ASPCL/1468-1817T----------LGRGVQHQV--------------------------------------------DA........FRAGFS
A2DAJ9_TRIVA/133-438R----------I.NEISQYL--------------------------------------------DL........IRSGFA
Q7PSA4_ANOGA/2506-2929C----------LQEGIAKQL--------------------------------------------AA........FHRGFC
UPL3_ARATH/1518-1888T----------VKRGVTRQI--------------------------------------------EA........FRSGFN
C8VT87_EMENI/782-1089H----------LDTAVARQF--------------------------------------------EP........FRRGFF
Q22F29_TETTS/3359-3651K----------MTEEIKEQI--------------------------------------------QS........FLKGFY
Q4UD92_THEAN/251-554K----------CNRMIESQC--------------------------------------------SA........FLQGLS
Q580G4_TRYB2/3999-4304C----------MTRQIEEQL--------------------------------------------QE........FLKGFY
Q4PHJ7_USTMA/908-1208R----------LSTQIQHQC--------------------------------------------TA........FFNGLA
A3LSX3_PICST/660-977K----------LNQSLHIQT--------------------------------------------KY........FIEGLF
A2DBI7_TRIVA/375-665V----------ANKSIEKEF--------------------------------------------EA........FFSGYN
A0DLU6_PARTE/3989-4284L----------IVGKFQAIT--------------------------------------------QN........IIEGFD
HACE1_MOUSE/602-909R----------MTRAIQPQI--------------------------------------------NA........FLQGFH
UBE3B_HUMAN/736-1068R----------MHTQIKNQT--------------------------------------------AA........LISGFR
Q00Y47_OSTTA/1123-1477C----------VGSGVASYF--------------------------------------------ES........IQAGLE
A4IAG7_LEIIN/1064-1369R----------FEVALENLR--------------------------------------------H.........FQWGLL
A7SNF7_NEMVE/430-737K----------LQDSIAAEV--------------------------------------------KE........LAGGLN
A2ERB6_TRIVA/1571-1861F----------ILRDHEREY--------------------------------------------KI........IRDGFY
A3GHK0_PICST/646-950F----------LQEGIKKQI--------------------------------------------TA........FSSGFK
A7AV31_BABBO/1338-1643R----------LYDGIRLPI--------------------------------------------WA........FRMGFA
Q4Q7L2_LEIMA/1091-1400K----------LNREAAEQT--------------------------------------------RA........FCAGLH
A8BYQ3_GIAIC/636-950I----------LNDSVSRQF--------------------------------------------ED........FADGFH
PUB2_SCHPO/367-671K----------LVTSTEEQF--------------------------------------------NA........LKGGLN
Q54KP2_DICDI/1482-1898F----------LYDGVIRQI--------------------------------------------TS........FKEGFN
A5DS31_LODEL/333-694T----------LFTGVISQI--------------------------------------------KA........FMEGFS
A2DQ30_TRIVA/383-682Y----------MITSIEIPY--------------------------------------------QY........FERGFK
A4HPV4_LEIBR/2168-2551Y----------LHTVLDLAL--------------------------------------------LH........LRQGLQ
A4IBF5_LEIIN/1897-2310L----------LYESVAVPL--------------------------------------------YF........LTMGCR

PF09814

E3QET8_COLGM/12-396K..........PTDHEHGQH......................DHLATRRGYGA.NSSIAAQPG.VG--------MVDLTS
G1XBI8_ARTOA/9-371K..........PHNKDGNSE...........................GSRYSG.VGRIVAEST.VG--------LVDPMY
B0WGJ1_CULQU/12-440R..........HDTPETHTE....................GECSSKSSSAASPHPNSFTPAET.DL--------FYGPFY
N1JPA0_BLUG1/11-395K..........PDNTQSHHI.......PDDDCSGSQENRTSTHSKMTERGYGA.NNSISAQHG.VG--------FVDIST
E2C3X0_HARSA/7-363K..........HSSNDIV......................................NIETQKS.DY--------LYGSYF
F6PJX9_CIOIN/15-512...........SHSHKQKES......................NKEKVTTPAFVTNGVLKPREN.DC--------LISDFH
V5G5H4_BYSSN/14-444K..........PDPHEGHDH.............GSHDDKQIEDPNAVLKGYGA.ANQISASSG.TI--------LVDVAS
C0NUQ4_AJECG/14-505K..........PDTHADDHG...........DAAVGTVLHTHDENETVKGYGA.SNQVVCTSG.TV--------LIDVLS
J3NIY5_GAGT3/10-441K..........PDDHADGRDGGEHEHSHNHDLEHRQDGGKANGQTLAGRGYGA.NSRIQGQKG.VG--------LVDLAM
K1WUW9_MARBU/11-367K..........PDAPVALSE..........ANGSSGQESRDFSGVAASKGYGA.NTRFLARSG.IG--------LINITT
F2SJ85_TRIRC/16-423K..........PDPIPSKDG.................DTDFTSLNGDTKGYGA.SNRVVCKPG.TV--------FVNITS
Q7SDG7_NEUCR/13-420K..........PGDHDHDHH....HHDKSNGVDANGQSDRADDMSLAARGYGA.SSAISAQQG.VG--------FVDLTT
G3Y5B6_ASPNA/22-417K..........PDPPEEERN..................KEGEDPNAVVKGYGA.GNQLVAVEG.TV--------LVDVTS
N1QJ23_SPHMS/6-367R..........PHVAHDHDR........................DPPTKGYSV.DSTLALNPG.IG--------MVDPVD
W5NKD6_LEPOC/13-376...........PDPFAKK......................................KLLPRKE.DC--------LLGDTF
F7E020_XENTR/11-384...........PDPFANR......................................NCLPKVN.DC--------FLGDTF
A1CJR3_ASPCL/19-424K..........PDPEDHGHG...................DGEDGNAQTKGYGA.ANQVVARRG.TV--------LVDVVS
Q59X25_CANAL/5-333K..........PENYEKHK.............................KEYKG...ILKPDNK.TI--------IIGSYY
M2R8N7_COCSN/64-446K..........PDEHHLHNH....................THEHAIGQKGYAA.ANRLQAKEG.VG--------FVDLAS
A7TPW1_VANPO/6-340K..........PHVEGQAVV.........................DYSKKYN....SLQPSQG.EL--------LLGPSV
G8BQA7_TETPH/7-357K..........PSENNDSEG.....................NNLNASFLKYS....QLKPNNF.EI--------LIGNSF
H2L971_ORYLA/17-387...........PDPFANK......................................KLLPRAE.DC--------LLGDTF
B4JWU6_DROGR/9-387S..........HGTSGQEQP...............TSS..................VLVPRAT.QI--------YYGLNY
A7USM4_ANOGA/14-434R..........HDHQPSEGA...............PEPCHGRQQGEPSSQLST...KFEPQPG.DL--------FYGTFY
H3AB66_LATCH/13-373...........PDPFANR......................................KLRPLKD.DC--------FLGDTF
H2RRY7_TAKRU/13-391...........ADPFANR......................................KLLPRVD.DC--------LLGDTF
G8ZSN1_TORDC/12-350K..........PHDISKENE..........................YSVRYN....SLKPLKG.EI--------LLGSAF
F2UGQ3_SALR5/7-362E..........DDHHTHVDL....................................SVRIGEH.SV--------LFDDEQ
N1QC82_MYCFI/8-372R..........PHVPHSHDH........................EAPAKGYGA.DSTLRIQSG.LG--------LVDPID
H0ZQP0_TAEGU/10-365...........PDPFARR......................................TLHPQHG.DC--------FVGDTF
I3ITZ6_ORENI/17-396...........PDPFANK......................................KLLPRAE.DC--------LMGDSF
J4G0K5_FIBRA/670-1050S..........DQKLHEHVS...............................KHSNEGFWPTRS.RA--------LVGGSY
S7Z7X2_PENO1/19-452K..........PDPHEHDPK............SEADAALKLEGETAQMKGFGA.ASRVEAIPG.TV--------LIDVAS
G2Y6Z9_BOTF4/11-391K..........PSDHADHNH....................ENENLASTKGYGA.NTKFNAQPR.IG--------FMDHST
M1WB37_CLAP2/12-388K..........PHDRDQQEN.......................KDLADKGYGANNNVISAQSG.VG--------FVDIIS
N4UQV1_COLOR/12-396K..........PTAEDDGHG...................GAEHEHLAKRGYGA.NSSIAARSG.TG--------LVDLTS
B2WD68_PYRTR/65-449K..........PDEHHLHDH....................THEHAVGQKGYAA.GNRLQATQG.IG--------FVDLAS
B3MZV3_DROAN/9-389N..........HGSGCDSKP...................................PSLVPAET.DL--------FYGLNY
K0KTK1_WICCF/8-359K..........PETDDSPLV...........................LDKFK....QFKPKQN.GI--------LTGPFY
G1TSQ5_RABIT/13-383...........PDPFANK......................................PLHPREN.DC--------LIGDSF
F4X8J5_ACREC/7-361K..........HSCNSVLN.....................................SVQPQES.DY--------LYGSCF
Q29GF2_DROPS/8-375G..........HGHDHGHGH...............GQDRPQ...............SLLPGEK.DL--------FYGLNN
G0VL18_NAUCC/6-337K..........PQVGDNELL.............................DYSVGRNTLIPLTG.EL--------LVGNSF
U4LVT7_PYROM/7-365K..........PHDHVKEKT..................NKESKEPTGGGRYSTFGQGFAVEQG.VG--------LVDRGY
S3CHW0_OPHP1/592-1021K..........PEHKHDHGH..........DKTQPAKDGQATEDALAGRGYGA.NSVISADAG.IG--------FVDLIT
Q6BMI9_DEBHA/5-350K..........PAEDPNEKD..........................SHRNYNG...NLKPGDN.DV--------IIGSSY
I2H589_TETBL/10-369K..........PDDKSVAGQ.........................RYSVKYN....GLQPNIN.EL--------LVGGSF
N1PZE3_MYCP1/9-376R..........PDVPHDCDH........................KVAVKGYGA.DSKLALQSG.VG--------MVDPTD
E7LWJ6_YEASV/7-342K..........PDVKEDKSS...........................YTRFE....TLKPSKN.EI--------LIGSSY
L8FLW5_PSED2/12-403K..........PDVPVGEKG...................DEEGGDNTTKGYGA.NTRMMAQKG.VG--------KVDLTY
B6QVW6_PENMQ/12-422K..........PDVHPDEKE................DQKNIEAQNASVKGYGA.SNRVVATPR.TG--------LVDVAS
A5DWX9_LODEL/10-359K..........PETGEFND.............................KNFN....TLKPSDNATV--------LIGSYY
UBE3D_PONAB/13-385...........PDPFANK......................................PLHPQEN.DC--------FIGDSF
K7JNW4_NASVI/31-384K..........HSGEESF......................................SLDPKET.DL--------FYSINY
C8VJ15_EMENI/28-443K..........PDPHEGQDA.............DGAAKQTIEDENSKVKGYGA.SNQVLATPG.TV--------LVDVAT
C5DFR9_LACTC/6-347K..........PASSDGMRV............................DRYA....KLSPLPG.EL--------LVGNSF
C1FZL9_PARBD/14-476K..........PDAHEDGHG...........DATNYTGPHVNDENETIKGYGA.ANQIVCAPG.TV--------LIDILS
G9NH43_HYPAI/14-393K..........PHEHEHHDG.......................EALSKRGYGA.DSSITAQPE.SG--------FVDLTS
M3ZXU8_XIPMA/13-392...........PDPFANK......................................KLLPRAE.DC--------LLGDTF
U7PMZ7_SPOS1/17-441K..........PDVKETETA.........GGPGAAAKNGVDTGTGLANRGYGA.NSTISADAD.VG--------FVDLTT
M7PCP3_PNEMU/15-354K.........................................EKYNAFGNYGMLQKIKSLSDSGII--------FVGLSY
R0KID0_SETT2/64-442K..........PDEHHLHNH....................THEHAMGQKGYAA.GNRLQATQG.VG--------FVDLTS
R7YJ95_CONA1/9-376K..........PDHRHGHGA.......................RDGEGKGYAA.ANRLVARRG.TG--------FVDLGG
G2QZ38_THITE/12-402K..........PHHHHGRGH...........NHEGEEGGKADEQSLAARGYGA.SSAISAQEG.VG--------FIDLTA
B4MTF5_DROWI/9-367N..........HGSAAESHQ...................................DVLVPPER.DL--------FYGLNF
W5LC11_ASTMX/13-385...........PDPFANK......................................KLHPKQE.DC--------LLGDTY
E9CUF8_COCPS/14-450K..........PDSHEDGDH.........KDKVTHNGPMSTHNESAASKGYGA.GNHTVCQAD.TV--------LVDVMN
J7RHU2_KAZNA/6-350K..........PDSRDPNIS............................AKYG....ALKPLLN.EL--------LIGESF
J4KRH2_BEAB2/17-390K..........PIDHDTAED.......................GDLQHRGYGA.ASAITAQPG.VG--------FVDITS
Q4P6X1_USTMA/1031-1415RFASRISDTSTPAERHQQMP............................................TG--------WVGDTY
Q9VWP0_DROME/9-380N..........HGPAGKTQP...................................ISLVPAET.DL--------FYGLNY
S0DNZ8_GIBF5/11-388K..........PHDHDHQDP.......................ESLATKGYGA.NHAISAQQG.VG--------FVDLTS
G0WHB4_NAUDC/6-346K..........PDIHNGSTQ.......................VYNTGNAYA....SLKPLDG.EI--------LIGGSY
E4UYL0_ARTGP/16-475K..........PDPIPANNG.................GVDSTDPNGHTKGYGA.SNRVVCNPG.TI--------FVNVTS
S3DDS5_GLAL2/11-450K..........PDVPKHEQN........GPNNGSSDHKHHSHTDSNANRGYGA.NSKFIARKS.TG--------FVDPTT
E9IFT1_SOLIN/7-361K..........HNCNAVSN.....................................NVQPQES.DY--------LYGSCF
G3JK97_CORMM/17-391K..........PVEHHQPED.......................GHLEHRGYGA.ASAITAQPG.VG--------FVDITS
F1Q7U1_DANRE/13-384...........PDPFANR......................................KLLPRAG.DC--------LLGDTF
Q75DV5_ASHGO/6-339K..........PADESAGAQ.........................QYLTKYN....ALLPADG.EL--------LVGDTF
B4L5I9_DROMO/9-377N..........HGPADKPAA....................................TLVPGPK.DL--------YYGLNY
A4D9F3_ASPFU/21-420K..........PDPPEGHRH....................VEDPNAQTKGYGA.ANQVVATAG.TV--------LVDVAT
H9KRH4_APIME/8-350K..........HNHKNIVH.....................................NLIPLQS.DI--------FYGSLF
T5AMN1_OPHSC/15-387K..........PHDHGSPED.......................ERLANRGYGA.NSTITARPG.VG--------FVDITL
E9EVP5_METAR/11-386K..........PHDHSEHQQ.......................ESLADRGYGA.NSVITAQPG.TG--------FVDITS
Q6CWI5_KLULA/6-349K..........PDMEPHQKG..................HHVAASETLLHRYNN...PLNPAVG.EI--------MLSDSF
S8AD65_DACHA/9-377K..........PHDEKGHAD...........................GGKYAG.VGRILAEPS.LG--------LVDPMY
B4M301_DROVI/9-376N..........HGTVTKPA.....................................TLVPRRD.DL--------YYGLNH
F8PKW0_SERL3/430-815T..........DQTLHEQIT................................KHGRGFWPEQG.QA--------LVGGSY
G3NNB4_GASAC/18-378...........PDPFANR......................................KLLPRAE.DC--------LLGDTF
C5DRI9_ZYGRC/22-358K..........PQDKTSEF...............................YSLQKNSLSPCLN.EI--------LIGDSF
U1HL67_ENDPU/9-361R..........PQDIEPSQG...................EDARQAADSKGYGA.STKLKAAAG.IA--------FVDTAS
H6C728_EXODN/11-373K..........PHDDPSNEQ.......................HAAESKGFAP.TSKFTASPG.AG--------LVDTVS
G2Q453_THIHA/11-367K..........PDHGHHHHH.........HNQNHDGKTGKAGDESLAARGYGA.SSSISAQKG.VG--------FVDLTT
UBE3D_MOUSE/13-364...........PDPFANR......................................PLHPREN.DC--------FIGDSF
Q16XY0_AEDAE/12-444Q..........HPHGEGKTD...............DTHAHAECSSSSTKA..PHPNKFSPTEV.DL--------FYGPFY
UBE3D_BOVIN/13-385...........PDPFANK......................................PLHPREN.DC--------FTGDCF
G8YFE7_PICSO/20-360K..........PDIHKNEFS............................KNYNG...NLKPKGN.DA--------IIGSYY
H2AW44_KAZAF/6-348K..........PTINDDKGN........................GVLLGKYN....SLAPLKY.EI--------LVGGSY
F1NWJ5_CHICK/86-460...........PNPFARS......................................TLLPQHG.DC--------FLGDTF
Q6FK88_CANGA/6-347K..........PTIGESKTD........................AKPYDYYK....ELKPRLN.EV--------LVGNTY
M4G6J5_MAGP6/10-440K..........PDDHADGSGGGEHGHDHDRD......GGKADDQTLTGRGYGA.NSRIQAQKG.VG--------FVDLAT
K5W0X4_PHACS/481-861A..........DQKLHEHVQ...............................KGSKEGFWPADN.EA--------LVGGSY
L9L4K4_TUPCH/13-384...........PDPFANK......................................PLHPQEN.DC--------FIGDTF
F6W3S4_MONDO/6-379...........PDPFANK......................................PLHPGEN.DC--------FIGDTH

PF00632

Q9BL11_CAEEL/717-1019ESL.H......SRTL-----------------------------------------------------------------
UBR5_MOUSE/2479-2792DVL.P......KNSL-----------------------------------------------------------------
A0EFC1_PARTE/672-969SVV.D......GDGI-----------------------------------------------------------------
Q54GG5_DICDI/425-720MVC.D......SPIL-----------------------------------------------------------------
Q2GSX9_CHAGB/694-1033MII.D......PSWL-----------------------------------------------------------------
Q4WHR7_ASPFU/967-1337TCL.D......RAAL-----------------------------------------------------------------
Q5KIA2_CRYNJ/1499-1843SIF.P......IKSI-----------------------------------------------------------------
Q5CW92_CRYPI/1231-1561TVI.P......NESL-----------------------------------------------------------------
A2E5Q8_TRIVA/658-966KNI.K......EGIP-----------------------------------------------------------------
A0BRI8_PARTE/1050-1354SVI.P......RQYI-----------------------------------------------------------------
HUL5_YEAST/607-910VII.A......PHWM-----------------------------------------------------------------
A7SML1_NEMVE/1229-1585SVF.P......LTNL-----------------------------------------------------------------
Q38D88_TRYB2/1472-1912DVV.P......CEAL-----------------------------------------------------------------
Q00WM5_OSTTA/458-763EVV.P......RETI-----------------------------------------------------------------
Q6BGB8_PARTE/609-908QVI.D......PEKF-----------------------------------------------------------------
A2FIB4_TRIVA/386-683AVI.T......PELI-----------------------------------------------------------------
L9KS41_TUPCH/1283-1677EVV.D......SRLV-----------------------------------------------------------------
A2DAL9_TRIVA/1571-1869FVL.K......PSLF-----------------------------------------------------------------
A4VDG4_TETTS/3915-4210EIV.C......EDLL-----------------------------------------------------------------
A2FLN6_TRIVA/2545-2849FFF.P......APAA-----------------------------------------------------------------
A4IBT8_LEIIN/1017-1343CEPSL......EHHL-----------------------------------------------------------------
A4IC88_LEIIN/3812-4131SVV.P......EVAV-----------------------------------------------------------------
F6U235_XENTR/611-908MVTNE......SPLK-----------------------------------------------------------------
A0D2G1_PARTE/170-483QVI.P......KTLL-----------------------------------------------------------------
A4HF82_LEIBR/3619-3949SVV.P......ATSL-----------------------------------------------------------------
Q8SS57_ENCCU/454-746SII.D......KDKL-----------------------------------------------------------------
AREL1_MOUSE/512-823ELV.P......ENLL-----------------------------------------------------------------
Q4E2E5_TRYCC/2646-2975FVL.P......ASSL-----------------------------------------------------------------
A7SQ93_NEMVE/299-612SVC.A......SNAL-----------------------------------------------------------------
TOM1_YEAST/2962-3268ALI.S......KDLI-----------------------------------------------------------------
Q6C901_YARLI/697-1001SVV.G......GNAL-----------------------------------------------------------------
Q9W0H2_DROME/761-1058KVC.S......GRVI-----------------------------------------------------------------
A0BRN4_PARTE/3724-4023SVLEI......KDLK-----------------------------------------------------------------
NEDD4_HUMAN/1013-1318ELI.P......QDLI-----------------------------------------------------------------
O17736_CAEEL/692-1001EII.S......IEWM-----------------------------------------------------------------
A2FPQ0_TRIVA/408-705KLC.H......RPEF-----------------------------------------------------------------
A2FR71_TRIVA/373-670KLE.S......LHIL-----------------------------------------------------------------
Q7PSQ3_ANOGA/541-897ELI.L......SHLL-----------------------------------------------------------------
Q247X9_TETTS/2308-2606SII.P......EDAL-----------------------------------------------------------------
A0DNI8_PARTE/201-510SII.P......KQLL-----------------------------------------------------------------
A5K4K7_PLAVS/1441-1991ELI.P......TKWL-----------------------------------------------------------------
A2DQ34_TRIVA/412-708KIS.I......SKLY-----------------------------------------------------------------
Q5KBV2_CRYNJ/2952-3249DII.P......QELI-----------------------------------------------------------------
A2FXS6_TRIVA/392-692LVC.K......AGMY-----------------------------------------------------------------
A4VD17_TETTS/789-1090KVI.P......KNWL-----------------------------------------------------------------
A2F7U9_TRIVA/2273-2579DNT.K......IDSH-----------------------------------------------------------------
Q9W196_DROME/819-1122NVL.P......IEWL-----------------------------------------------------------------
A2DYB1_TRIVA/1674-1977SLI.P......QKDL-----------------------------------------------------------------
A2EDQ8_TRIVA/2183-2490RNT.G......FKHN-----------------------------------------------------------------
A4S7N1_OSTLU/131-443KII.N......QRWL-----------------------------------------------------------------
A2EM50_TRIVA/2501-2807KAL.D......LAPP-----------------------------------------------------------------
Q0UNY9_PHANO/908-1229ACL.N......TKAI-----------------------------------------------------------------
A2EQW9_TRIVA/2209-2511DNL.G......FSNP-----------------------------------------------------------------
HUL4_ASHGO/526-839HVI.E......GNSF-----------------------------------------------------------------
Q7QE66_ANOGA/554-863EVV.D......HRLV-----------------------------------------------------------------
A2E4I7_TRIVA/2634-2943ENL.G......LKPP-----------------------------------------------------------------
A5K5J0_PLAVS/8258-8564ELI.Q......PKLI-----------------------------------------------------------------
Q54QF1_DICDI/778-1120QMI.P......HSIL-----------------------------------------------------------------
UPL7_ARATH/828-1142DLI.S......PAWL-----------------------------------------------------------------
Q8SR14_ENCCU/2104-2410EIL.G......SKAL-----------------------------------------------------------------
MUG30_SCHPO/482-807KVC.G......GNAI-----------------------------------------------------------------
A3FPU7_CRYPI/497-797SVC.G......GRTL-----------------------------------------------------------------
Q38A01_TRYB2/1526-1868YTLIP.......YHL-----------------------------------------------------------------
A1CTM1_ASPCL/1468-1817QVF.P......YSAL-----------------------------------------------------------------
A2DAJ9_TRIVA/133-438INI.G......FETH-----------------------------------------------------------------
Q7PSA4_ANOGA/2506-2929EVF.A......LNKL-----------------------------------------------------------------
UPL3_ARATH/1518-1888QVF.D......ITSL-----------------------------------------------------------------
C8VT87_EMENI/782-1089SVC.G......GNAL-----------------------------------------------------------------
Q22F29_TETTS/3359-3651EIL.P......QRSL-----------------------------------------------------------------
Q4UD92_THEAN/251-554SII.P......LEWL-----------------------------------------------------------------
Q580G4_TRYB2/3999-4304AVI.P......RKEI-----------------------------------------------------------------
Q4PHJ7_USTMA/908-1208DIV.N......PRWL-----------------------------------------------------------------
A3LSX3_PICST/660-977GLI.S......SSWL-----------------------------------------------------------------
A2DBI7_TRIVA/375-665DVC.D......IPIV-----------------------------------------------------------------
A0DLU6_PARTE/3989-4284TVLNR......QLLM-----------------------------------------------------------------
HACE1_MOUSE/602-909MFI.P......PSLI-----------------------------------------------------------------
UBE3B_HUMAN/736-1068SII.K......PEWI-----------------------------------------------------------------
Q00Y47_OSTTA/1123-1477EVC.P......VARL-----------------------------------------------------------------
A4IAG7_LEIIN/1064-1369SVM.E......VEAL-----------------------------------------------------------------
A7SNF7_NEMVE/430-737EVV.P......QDLL-----------------------------------------------------------------
A2ERB6_TRIVA/1571-1861SVI.S......KEEL-----------------------------------------------------------------
A3GHK0_PICST/646-950NVI.G......GNGL-----------------------------------------------------------------
A7AV31_BABBO/1338-1643TIV.P......LSCL-----------------------------------------------------------------
Q4Q7L2_LEIMA/1091-1400SVI.D......TNRL-----------------------------------------------------------------
A8BYQ3_GIAIC/636-950LLV.R......SRSL-----------------------------------------------------------------
PUB2_SCHPO/367-671ELI.P......DSVL-----------------------------------------------------------------
Q54KP2_DICDI/1482-1898QTF.P......ISSL-----------------------------------------------------------------
A5DS31_LODEL/333-694KVF.P......INSL-----------------------------------------------------------------
A2DQ30_TRIVA/383-682EVVENNDKMKASETL-----------------------------------------------------------------
A4HPV4_LEIBR/2168-2551HTVNP.......LYL-----------------------------------------------------------------
A4IBF5_LEIIN/1897-2310DVV.P......HEAL-----------------------------------------------------------------

PF09814

E3QET8_COLGM/12-396FLF-S------ESDC......TGLEFS.................................................SSPS
G1XBI8_ARTOA/9-371FLL-R------KEDC.................................................................
B0WGJ1_CULQU/12-440AVL-N------CQHL.................................................................
N1JPA0_BLUG1/11-395FLL-T------EDDC.................................................................
E2C3X0_HARSA/7-363ALL-H------KNIF.................................................................
F6PJX9_CIOIN/15-512IMV-H------TKTV.................................................................
V5G5H4_BYSSN/14-444LLV-A------ETDC......NGLRKS.....................................................
C0NUQ4_AJECG/14-505FVM-A------EGDC......QGLQKSKIAGNPRKGFRASDYLVLSPTAAQSIMMKEARKWENRGPNQMSGSSIRSEILP
J3NIY5_GAGT3/10-441FLF-A------EEDC......EGIMFS.....................................................
K1WUW9_MARBU/11-367FLL-A------SVDC.................................................................
F2SJ85_TRIRC/16-423FVM-T------QGDC......QGAKMT.....................................................
Q7SDG7_NEUCR/13-420LLF-V------EQDC......SNITYS...................................................LS
G3Y5B6_ASPNA/22-417FLV-K------GVDC.................................................................
N1QJ23_SPHMS/6-367FVL-A------SKDC......GNLKIT.....................................................
W5NKD6_LEPOC/13-376ILL-S------WERD..........................................................NNGTLTQ
F7E020_XENTR/11-384LLL-N------KRNH..........................................................YWSQRVQ
A1CJR3_ASPCL/19-424FLV-A------EEDC......RGVKKV.....................................................
Q59X25_CANAL/5-333LLE-K------SNRN.................................................................
M2R8N7_COCSN/64-446FLL-A------DSDC......EGAQLS.....................................................
A7TPW1_VANPO/6-340LCC-S------QLTL.................................................................
G8BQA7_TETPH/7-357FIC-N------SATL.................................................................
H2L971_ORYLA/17-387VLL-A------RDSS..........................................................CTQTLTE
B4JWU6_DROGR/9-387IVL-N------MCVV.................................................................
A7USM4_ANOGA/14-434ALL-H------RNVL.................................................................
H3AB66_LATCH/13-373ILV-N------SASV.................................................................
H2RRY7_TAKRU/13-391FLL-N------RDGS..........................................................CDQTLTE
G8ZSN1_TORDC/12-350FLA-Q------QDTF.................................................................
F2UGQ3_SALR5/7-362LLL-Q------RDQL.................................................................
N1QC82_MYCFI/8-372FVL-A------PENC......SSLKIS.....................................................
H0ZQP0_TAEGU/10-365FLL-N------STNE..........................................................SHLP...
I3ITZ6_ORENI/17-396VLL-A------RDGS..........................................................CEQTLTE
J4G0K5_FIBRA/670-1050ILF-E------QSVV.................................................................
S7Z7X2_PENO1/19-452FLL-S------EADCTNLNRYIGTTRH.................................................T...
G2Y6Z9_BOTF4/11-391FLL-A------ETDCTLPPGGNEIKRT.....................................................
M1WB37_CLAP2/12-388FMF-D------ERDC......QNLLFS.....................................................
N4UQV1_COLOR/12-396LLF-S------EVDC......AGLVFS..................................................TSS
B2WD68_PYRTR/65-449FLL-V------EADC......EGAQLS.....................................................
B3MZV3_DROAN/9-389VVV-S------LSQT.................................................................
K0KTK1_WICCF/8-359IAI-N------FEDD.................................................................
G1TSQ5_RABIT/13-383FLV-K------LRSD..........................................................RWQVRPK
F4X8J5_ACREC/7-361SVL-H------KSIF.................................................................
Q29GF2_DROPS/8-375VII-R------MVNL.................................................................
G0VL18_NAUCC/6-337FLL-L------PSTL.................................................................
U4LVT7_PYROM/7-365FLF-S------SKDC......DSVQIV.....................................................
S3CHW0_OPHP1/592-1021LLF-A------ESDC......QGLKFS....................................ASTYEHASDRESILAAD
Q6BMI9_DEBHA/5-350FLI-N------KSKQ.................................................................
I2H589_TETBL/10-369FLG-Q------SNVF.................................................................
N1PZE3_MYCP1/9-376FVL-V------SEDC......SNLKVS.....................................................
E7LWJ6_YEASV/7-342FQG-T------PATF.................................................................
L8FLW5_PSED2/12-403FLL-D------SEDC......SGLETN.....................................................
B6QVW6_PENMQ/12-422FLV-A------ESDC......HGIKVL.....................................................
A5DWX9_LODEL/10-359LLQ-L------HNEY.................................................................
UBE3D_PONAB/13-385FLV-N------LRTS..........................................................LWQQRPE
K7JNW4_NASVI/31-384SVL-N------KRLF.................................................................
C8VJ15_EMENI/28-443FLV-A------AIEC......KGLKKV.....................................................
C5DFR9_LACTC/6-347FLI-S------SSWP.................................................................
C1FZL9_PARBD/14-476FVM-A------EDDC......QGLEKS..................................PEMYSVAKLEILQKPS...
G9NH43_HYPAI/14-393FMF-S------ESDC......DGLLFS.....................................................
M3ZXU8_XIPMA/13-392VLL-A------RDAG..........................................................CDHTLTQ
U7PMZ7_SPOS1/17-441LLV-S------EVDC......HGVLFS......................................ESTVDKASSRLDEVL
M7PCP3_PNEMU/15-354FLI-S------EKNL.................................................................
R0KID0_SETT2/64-442FLL-K------EADC......EGAQLN.....................................................
R7YJ95_CONA1/9-376LLL-K------EEDC.................................................................
G2QZ38_THITE/12-402LMF-A------ESDC......RGVTFS..................................................LST
B4MTF5_DROWI/9-367IVV-N------IFKI.................................................................
W5LC11_ASTMX/13-385ILL-T------RDRS..........................................................CDQSLTQ
E9CUF8_COCPS/14-450FYV-T------ETNA......IGVESM...............................................VPPLDE
J7RHU2_KAZNA/6-350LET-S------PATV.................................................................
J4KRH2_BEAB2/17-390LLF-A------EEDC......GSIKFS.....................................................
Q4P6X1_USTMA/1031-1415LLV-G------RDML.................................................................
Q9VWP0_DROME/9-380VVI-N------FNEE.................................................................
S0DNZ8_GIBF5/11-388FLF-S------ESDC......RGLQYS.....................................................
G0WHB4_NAUDC/6-346FMM-T------EKTL.................................................................
E4UYL0_ARTGP/16-475FIM-T------ESDC......RGAKIM....ARGVKFRRYRSSRRIPCIELSQRPVGQFEIRSKIHGCKTALTVVMVANY
S3DDS5_GLAL2/11-450FLL-A------SADCSNIQGLQKSELS.....................................................
E9IFT1_SOLIN/7-361SVL-H------ENIF.................................................................
G3JK97_CORMM/17-391FLF-A------ESDC......SSIKFY.....................................................
F1Q7U1_DANRE/13-384ILL-L------RDDG..........................................................CDESLTR
Q75DV5_ASHGO/6-339VTV-G------EGLL.................................................................
B4L5I9_DROMO/9-377IVL-N------MSVL.................................................................
A4D9F3_ASPFU/21-420FLV-S------EADC......GGLKKV.....................................................
H9KRH4_APIME/8-350FII-H------RSLF.................................................................
T5AMN1_OPHSC/15-387FML-S------ESDC......NNLLFS.....................................................
E9EVP5_METAR/11-386FMF-D------ETNC......QNLLFS.....................................................
Q6CWI5_KLULA/6-349IYI-N------KDWI.................................................................
S8AD65_DACHA/9-377FLL-S------RDDC.................................................................
B4M301_DROVI/9-376VVL-N------MTAV.................................................................
F8PKW0_SERL3/430-815VLF-E------DTSV...........................................................VKSTIT
G3NNB4_GASAC/18-378LLL-A------KDGG..........................................................CAETLTE
C5DRI9_ZYGRC/22-358FQA-L------EDTF.................................................................
U1HL67_ENDPU/9-361FLF-A------EQSC.................................................................
H6C728_EXODN/11-373FLL-H------EKDC......QNLKLF.....................................................
G2Q453_THIHA/11-367LLF-D------ETDC......QPLT.......................................................
UBE3D_MOUSE/13-364FLV-N------LKSD.................................................................
Q16XY0_AEDAE/12-444ALL-D------RKHL.................................................................
UBE3D_BOVIN/13-385YLV-N------LKSD..........................................................LWQPRPE
G8YFE7_PICSO/20-360VLV-N------SST..................................................................
H2AW44_KAZAF/6-348FLG-V------AETF.................................................................
F1NWJ5_CHICK/86-460LLL-N------SRNQ..........................................................SYVPESP
Q6FK88_CANGA/6-347FQT-I------GSTI.................................................................
M4G6J5_MAGP6/10-440FLF-A------EEDC......QNIMFS.....................................................
K5W0X4_PHACS/481-861LLL-R------ENAV.................................................................
L9L4K4_TUPCH/13-384FLV-N------LRSN..........................................................LRQPRPE
F6W3S4_MONDO/6-379LLV-N------VRSD..........................................................SCIPGPE

PF00632

Q9BL11_CAEEL/717-1019------------------RFFQP--CELKEM-----IVGNE....N..----------------YDWNEFRDILMY...R
UBR5_MOUSE/2479-2792------------------EDLTA--EDFRLL-----VNGCG....E..----------------VNVQMLISFTSFNDES
A0EFC1_PARTE/672-969------------------KLFSG--EELQAL-----IIGLP....H..----------------FDLKDLELVTKY....
Q54GG5_DICDI/425-720------------------KILKP--EELGNL-----VCGVE....D..----------------LNFIELERGTNY...E
Q2GSX9_CHAGB/694-1033------------------SMFNQ--NELQRL-----VGGDS....S.E----------------IDVEDLRKHTAY...S
Q4WHR7_ASPFU/967-1337------------------SIFTP--EAFKTV-----VEGIQ....E..----------------IDLGELERHARY...E
Q5KIA2_CRYNJ/1499-1843------------------KIFSL--DELYLL-----F.GNA....DED----------------WSRETLEVAIKA...D
Q5CW92_CRYPI/1231-1561------------------RLFSP--YELQSL-----ISGVY....Q.K----------------LDVNNLRLNTCY...T
A2E5Q8_TRIVA/658-966------------------NSLDP--DTLEFS-----CCGDPECSYENL----------------VKIVRFEEISE.....
A0BRI8_PARTE/1050-1354------------------SIFDS--IQLEQL-----LCGQT......Y----------------IDVDDLISNLQY...V
HUL5_YEAST/607-910------------------EMFNS--IELQML-----ISGER....D.N----------------IDLDDLKSNTEY...G
A7SML1_NEMVE/1229-1585------------------KVYYA--VNMDQL-----LCGSV....GQK----------------WEVKELVESCRP...D
Q38D88_TRYB2/1472-1912------------------AALDA--SEAMSL-----LCGNRIRDSEPL----------------WTAAEIKSIIVP...D
Q00WM5_OSTTA/458-763------------------SLFNA--AELELM-----ISGTP....D..----------------IDVEDLYANTEY...T
Q6BGB8_PARTE/609-908------------------KLFTN--QELQLL-----ISG.Q....P.V----------------IDIQDLISNTKY...Q
A2FIB4_TRIVA/386-683------------------NIFSP--QDLDQI-----VSGSP....Q..----------------YDWPALKKATRY...V
L9KS41_TUPCH/1283-1677------------------SVFDA--RELELV-----IAGTA....E..----------------IDLNDWRNNTEY...R
A2DAL9_TRIVA/1571-1869------------------TLFTS--SEIGSI-----ICGEQ......K----------------TDVEELIKNFEILPPL
A4VDG4_TETTS/3915-4210------------------QILDE--QMLSFI-----FSGNP....E..----------------ISIPELKETIQL...Q
A2FLN6_TRIVA/2545-2849------------------SILAP--WELELI-----ICGDN......E----------------CPIEDMKRNCSF...P
A4IBT8_LEIIN/1017-1343------------------KLLSP--SDLLLL-----LCGQLHVSAQVI----------------VDALEFQGFG......
A4IC88_LEIIN/3812-4131------------------LLLTP--EELELR-----VCGQA......D----------------YTPEELRKGASYEGLT
F6U235_XENTR/611-908------------------YLFRP--EEIELL-----ICGSR....N..----------------LDFQALKDTTEY...D
A0D2G1_PARTE/170-483------------------RIFKP--QELEMI-----LFGLP......F----------------IDLQDWSKYTIYKDCS
A4HF82_LEIBR/3619-3949------------------RSVRW--EDLRAR-----VCGTAPASSEHV----------------IAELDMSPLSP.....
Q8SS57_ENCCU/454-746------------------AYLDP--KELEKI-----MMGSN......T----------------FDIKAIRSTTTY...S
AREL1_MOUSE/512-823------------------AIFDE--NELELL-----MCGTG....D..----------------INVSDFKAHAVV...V
Q4E2E5_TRYCC/2646-2975------------------QLIRW--DDLQQR-----VCGNSCATAEDV----------------ISSLDLSLLSE.....
A7SQ93_NEMVE/299-612------------------IMLRP--EEVEML-----VCGNP....E..----------------LDMEALKKVTVY...D
TOM1_YEAST/2962-3268------------------TIFDE--QELELL-----ISGLP....D..----------------IDVDDWKNNTTY...V
Q6C901_YARLI/697-1001------------------SLFRP--EELEAL-----VKGSS....E.P----------------LDIGTLKTVTRY...Q
Q9W0H2_DROME/761-1058------------------HIFQP--EELMAV-----VVGNE....D..----------------YDWQALQDNCEY...R
A0BRN4_PARTE/3724-4023------------------KFFKP--NDMGLI-----TLGVQDIKPEQI----------------LNILSFKGGQDY....
NEDD4_HUMAN/1013-1318------------------KIFDE--NELELL-----MCGLG....D..----------------VDVNDWREHTKY...K
O17736_CAEEL/692-1001------------------RMFAP--HELQIM-----IAGYE....E.V----------------FTAKELRKFCELRFAA
A2FPQ0_TRIVA/408-705------------------KIFTP--DELQVL-----VSGED....V..----------------FDWDALRLGTKY...I
A2FR71_TRIVA/373-670------------------DYVLP--DELDIL-----VSGLP....T..----------------RDWNIFKKGVKY...E
Q7PSQ3_ANOGA/541-897------------------RPFDE--RELELL-----ISGIS....K..----------------IDVNDWKANTRL...K
Q247X9_TETTS/2308-2606------------------EALEP--DDFISF-----YQGVQ....E..----------------IDIQYLKKKMKY...E
A0DNI8_PARTE/201-510------------------SLLEP--LELEMI-----LYGTP......F----------------IDINDWKDNTDY...K
A5K4K7_PLAVS/1441-1991------------------KLFNA--HELKTL-----ISGND....K.C----------------FDVDDLRRNVVY...G
A2DQ34_TRIVA/412-708------------------KLFGA--DELDIL-----VSGEA....V..----------------LDWAALKKNAKY...I
Q5KBV2_CRYNJ/2952-3249------------------QIFEP--DQLELL-----ISGIT....T..----------------VDVDELKNATQL...N
A2FXS6_TRIVA/392-692------------------QKLTP--DELDLC-----MSGEE....K..----------------IDWDFIKRNTEY....
A4VD17_TETTS/789-1090------------------QMFNE--NEVQML-----ISGQE....K.G----------------IDIENLKSNTKY...E
A2F7U9_TRIVA/2273-2579------------------PLLTG--ARLSHM-----AQGSN......V----------------ITTQQLRSITQVNDYK
Q9W196_DROME/819-1122------------------YMFSN--KELQIL-----ISGAE....I.P----------------IDLEDLKKHCEY...G
A2DYB1_TRIVA/1674-1977------------------SMFSP--NELDLL-----ICGVP....E..----------------VDVDDMEKNCVI...T
A2EDQ8_TRIVA/2183-2490------------------ALLTG--ALLSRM-----AQGSG......D----------------ISVQHLKQITHVSDFE
A4S7N1_OSTLU/131-443------------------RLFNV--TELSLL-----LSGGE....S.A----------------IDVDDWELHTRY...S
A2EM50_TRIVA/2501-2807------------------PFVTP--QLLEFL-----ACGDR......T----------------ISVSKLRALTEFQGAP
Q0UNY9_PHANO/908-1229------------------ALFTP--YTLRHL-----VEGEQ......H----------------ISIPALRRCARY...E
A2EQW9_TRIVA/2209-2511------------------SIFNS--NLISYL-----AQGSR......T----------------VTTQAFKSITSMLAPT
HUL4_ASHGO/526-839------------------RLFGS--EELEQL-----VCGSN....EQS----------------LDVSMLRSVTRY...Q
Q7QE66_ANOGA/554-863------------------AVFDA--SELELV-----ISGTV....E..----------------IDVHDWRANTEY...R
A2E4I7_TRIVA/2634-2943------------------PFVTG--DIIRSC-----CSPPNELTAEAI----------------LSVTEFDHGLPK....
A5K5J0_PLAVS/8258-8564------------------SIFDD--KELELL-----ISGIP....T..----------------IDLNDLKENVEY...H
Q54QF1_DICDI/778-1120------------------SIFNW--KELEML-----ICGRE....R..----------------INLDDLKQHSSF...T
UPL7_ARATH/828-1142------------------KLFNA--HEFNQL-----LSGGN....H.D----------------IDVDDLRRNTKY...T
Q8SR14_ENCCU/2104-2410------------------EMFDE--SELELL-----ICGIP....D..----------------IDVDDWKNNTLY...Y
MUG30_SCHPO/482-807------------------SLFQD--NEISKL-----IRGSE....E.V----------------IDWELLKNVCVY....
A3FPU7_CRYPI/497-797------------------ELFSP--EELVLV-----ICGSS....D..----------------FNIDSLIEASQY...Q
Q38A01_TRYB2/1526-1868------------------RLFDA--RELQLV-----ISGPE...GKIW----------------ESAGDLLTVITT...N
A1CTM1_ASPCL/1468-1817------------------RTFTP--SELVML-----F.GRA....EED----------------WTIETLMDSIKA...D
A2DAJ9_TRIVA/133-438------------------PMMNA--TLIALL-----VQGSN......V----------------ITTAQLRQITTFDGFN
Q7PSA4_ANOGA/2506-2929------------------AAFTP--DEIRKM-----LCGEQ....NPE----------------WTREDIMTYTEP...K
UPL3_ARATH/1518-1888------------------QIFTP--SELDYL-----LCGRR....E.L----------------WEVETLAEHIKF...D
C8VT87_EMENI/782-1089------------------SLFRP--EEIELL-----VRGSD....E.Q----------------LDVKSLRAVATY..LN
Q22F29_TETTS/3359-3651------------------KYMNE--QELGLL-----LSGVK....K..----------------IDVDDMKKHMRY...Y
Q4UD92_THEAN/251-554------------------QMFSP--SELELL-----ISGSS....E.V----------------IDISDLRKNTIY...A
Q580G4_TRYB2/3999-4304------------------RNFSA--QELELV-----ICGMP....D..----------------IDVEDLRLNTTY...D
Q4PHJ7_USTMA/908-1208------------------RNFNR--EELSIL-----ISGTE....D.P----------------VDIDDLRKHTVL...G
A3LSX3_PICST/660-977------------------SMFDS--FELQML-----ISGGQ....N.D----------------INILDWKNNVEY...G
A2DBI7_TRIVA/375-665------------------SLLSS--RDLELC-----VSGEE....T..----------------YNWIELQQSAGY....
A0DLU6_PARTE/3989-4284------------------DCFDA--TEMHTL-----TVGSS....E..----------------IKPEKVLELMIY....
HACE1_MOUSE/602-909------------------QLFDE--YELELL-----LSGMP....E..----------------IDVNDWIKNTEY...T
UBE3B_HUMAN/736-1068------------------RMFST--PELQRL-----ISGDN....A.E----------------IDLEDLKKHTVY...Y
Q00Y47_OSTTA/1123-1477------------------RMFDE--AELDTL-----ICGQG....E.A----------------WTPELLTDCITF...D
A4IAG7_LEIIN/1064-1369------------------WCLSD--EERSML-----ICGSDAKADGPL----------------FTEEELRAQTTM...G
A7SNF7_NEMVE/430-737------------------SFFTA--DEFSLL-----INGVS....K..----------------IDVQDWRANTLY...R
A2ERB6_TRIVA/1571-1861------------------NCFTP--LEVELA-----ICGYS......V----------------IDVEDFIKCCSY...E
A3GHK0_PICST/646-950------------------SLFLP--EEIQLL-----LCGSE....EGG----------------IDVDVLKSVTKY...V
A7AV31_BABBO/1338-1643------------------SLFTP--LELSSQ-----MFSVVD..QDCF----------------WTVDHLEMYLIP...D
Q4Q7L2_LEIMA/1091-1400------------------RLFDS--NEVGKL-----FGGDE....TGQ----------------IDLEDWKANTVYDKPE
A8BYQ3_GIAIC/636-950------------------TLFTP--ADLEIA-----LCGEP....N..----------------LDFIALKNNTKY...D
PUB2_SCHPO/367-671------------------QIFNE--NELDTL-----LNGKR....D..----------------IDVQDWKRFTDY...R
Q54KP2_DICDI/1482-1898------------------KPFTI--SEVESL-----LCGSLT.GSESD----------------WTLDSLMDSTKA...D
A5DS31_LODEL/333-694------------------IIFSY--KELVEL-----F.GNA....EED----------------WSFDALSSAINA...N
A2DQ30_TRIVA/383-682------------------KCLSY--DELQEL-----VCGSQ....K..----------------FDWSEFKRNVKY...S
A4HPV4_LEIBR/2168-2551------------------QLFNV--GELGRL-----LGSPLD..VKVW----------------ETREQFARNVEA...A
A4IBF5_LEIIN/1897-2310------------------TVMDV--KELIGV-----LCGEDKNPSDPL----------------WTTEEIRSVLVG...D

PF09814

E3QET8_COLGM/12-396RGASSDTTSSAVLAGGPDPPPRM..LHAFCA.....GCGAQVGFFNVAIAS.............VVLLKWQVSCQ...TA
G1XBI8_ARTOA/9-371..........ENITFKQTGSNEA..ETTICQ.....VCDIPLGIVDEKADG.............IRLMKWSLSLGLGSFK
B0WGJ1_CULQU/12-440...............QRVHLRAD..RFLYCK.....CCLQFLGVAKRNGS..............VKLWYENLKFLKPDEH
N1JPA0_BLUG1/11-395...........................INIK.....VLKNEVGTYHSELNG.............IKLWKWKLRLV...SP
E2C3X0_HARSA/7-363...............INNLRIDN..KTLTCD.....KCFLHIGALYSCNL..............LKLWNCCVDYK...PQ
F6PJX9_CIOIN/15-512..ERKNILLRKLDYLPKEGALTS..REMKCS.....RCRAVLGEAVGYEKSTIEA.........YKLNKNSIEVL.....
V5G5H4_BYSSN/14-444.........QNEGISQTGNPSSR..VYLECE.....SCGATIGTEDIAANG.............WKLFKACIAVQ...RH
C0NUQ4_AJECG/14-505LSSTSRHIGNGNQPANETKFQPV..VDLSCS.....RCSAVVGEEHKAFSG.............LRLYKANVSLL...RK
J3NIY5_GAGT3/10-441PSSPGDFLESPSLDVLAGAPARH..LGASCS.....LCESTIGYYSFGTSA.............VTLLKWRVLIQEEPEV
K1WUW9_MARBU/11-367..............................K.....NLKGLLGLVDSQAGG.............IRIYKWRLTLL.....
F2SJ85_TRIRC/16-423...IAKGDSSFDQGINSFPPHSV..PNLCCK.....SCGSTVGEMQNSLQG.............IELFKASVSIS...HQ
Q7SDG7_NEUCR/13-420TPEHGSPDRQVVASDESSNQVRS..LNVFCS.....SCQSQLGFYNFRTAA.............VTLLKWQISCD...SV
G3Y5B6_ASPNA/22-417.....LDSTSTQPDPNKETETEP..TILTCT.....TCTTQLGLPDPIANG.............YRLFKTSLSAN...TT
N1QJ23_SPHMS/6-367.............SSHNSQNKEA..GQLECV.....SCSTVLGHVH.TSGG.............YKLRKLHLAAT...SA
W5NKD6_LEPOC/13-376EPETL.............KPKEN..VKVICK.....NCRAVLGEEISPDT..............LKLYITEVTVR...QL
F7E020_XENTR/11-384WIASEMAIKMGTSNICNLKSKEN..TKVICK.....RCKAMLGEKVSSDA..............IKYYITEIMIQ...PS
A1CJR3_ASPCL/19-424...........QTLASGETPKDS..SSLACD.....TCDSLLGTEDPVAQG.............WRLFKTSLSAT.....
Q59X25_CANAL/5-333..................IVKIQ..DSITCN.....KCGQLLGEMFQGT...............LKIFKWCVELQFESGN
M2R8N7_COCSN/64-446.............VEENKEEERP..QSILCK.....NCTQPLGIQDPLTNG.............WRIHKWCLTLTSKLSN
A7TPW1_VANPO/6-340..............DSSRITIAE..GSVVCV.....SCDSLLGVVENDGL..............LKLNKWCLLLN.....
G8BQA7_TETPH/7-357...............NSKVIIDSKLNIVGCK.....NCNSIIGEINQDKL..............CQIFKWKLLLN...GE
H2L971_ORYLA/17-387E................KACRRV..TFISCA.....SCSSVLGEAVSPEA..............LKLYITQVVVE...PA
B4JWU6_DROGR/9-387...............QNRISNIS..GNLYCK.....RCMRMLGSSIESGAA.............AKLWADALRWL...PL
A7USM4_ANOGA/14-434...............QRVHVRND..RFVYCK.....RCLQYLGSTRKNRTS.............VKLWYENVRFQ...PS
H3AB66_LATCH/13-373............SSSVAWEPKPT..TALLCLESGGIKCSFTLGSMQNF.T..............NQFFFFEVHKQ...PY
H2RRY7_TAKRU/13-391EVKPA...GSEDVQDPKKTCRRL..ALVSCK.....SCSSGVGEAVSPET..............LKLYITQVVVE...PA
G8ZSN1_TORDC/12-350...............AGRVKTEN..GFLQCA.....KCSASLGEETQDHL..............FKIYKWQVLLK...KS
F2UGQ3_SALR5/7-362........ITHDRQPLDTSTLSD..EVVRCE.....RCLASIGACAVFQGQPC...........VSLHRHAVHMD...GG
N1QC82_MYCFI/8-372...............SIASSDHD..EILRCS.....TCNTIVGHVH.TSGG.............YKVRKQHLSLS...SS
H0ZQP0_TAEGU/10-365..................KSKEN..TRVICK.....RCKVMLGETVSSGT..............IKYYVTEVIIQ...SD
I3ITZ6_ORENI/17-396EVSPV...GTEDSQDPKKPCRRL..ALISCA.....SCSSVLGEAVTPET..............LKLYVTQVVVE...PA
J4G0K5_FIBRA/670-1050...VSGNLARVEELIERKHVDDW..QRVRCI......CGAIVGRCQQHRPAKMPPSVV......YRLAKYAIRPL...SP
S7Z7X2_PENO1/19-452DLVIAWQACIEGSETGNATSPLE..RSLQCT.....KCEGIVGMDDPSARG.............WRLLKAHLSLS...HD
G2Y6Z9_BOTF4/11-391...........................IKCE.....VCLATIGTSDPQNEG.............IRLFKWSLRMR...TL
M1WB37_CLAP2/12-388ASNAAQASGSSSEALANASLESY..LHVFCS.....QCKAEVGSYSIKTDS.............VLLLKPHVSCR...TI
N4UQV1_COLOR/12-396YDTGSGSSAAVLLGTAAEPVPRM..LYVFCK.....SCESHVGFFNVAIAS.............VVLLKWRVSCR...TT
B2WD68_PYRTR/65-449...............PAEEGTQS..ASVVCK.....HCNHTIGTRDPTTDG.............WRIRKWTVGITSTATD
B3MZV3_DROAN/9-389...............NPNILIRE..DHLYCR.....RCMRFLGLAIFNGAA.............ARLWADAVSWL...PS
K0KTK1_WICCF/8-359...............NHKLIKDE..FKLKCK.....NCETFIGESCEDPKNKENL.........DRLFYWNLKLS...HN
G1TSQ5_RABIT/13-383LVPVG.RFYISFENHFKLEPKAN..TKVICK.....RCKVILGETMSSET..............TKFYKTEIIIQ...PS
F4X8J5_ACREC/7-361...............ASNVCTDN..KTLSCN.....KCLLHIGTFHAYNL..............FKIWNCCIDYK...PE
Q29GF2_DROPS/8-375................AKIVRRG..EHLHCQ.....RCMRFLGMAIFNGEA.............ARLWADTVRWL...PS
G0VL18_NAUCC/6-337...............QRQAAMKH..EELTCL.....KCNSILGDRTTEGL..............CRLYKWKLYLR...KN
U4LVT7_PYROM/7-365......................D..EKVTCS.....SCNSILGAPDRGVSSEDSPL........WRLNKWNLSLN.....
S3CHW0_OPHP1/592-1021STLQTQTQIQAQAQTNQTKAMRG..LNVFCA.....SCGAQIGYYGLRIAA.............ANLFKWQVDCA...SV
Q6BMI9_DEBHA/5-350..................LEISD..QDVKCG.....LCKYNLGILDNST...............LKLFKWNLALK...YK
I2H589_TETBL/10-369................HNIKMDR..NIIRCK.....TCNTLIGEKTTNDL..............AKIHKWKLQLL...AR
N1PZE3_MYCP1/9-376..............SSASSTSAD..DQLLCC.....NCDTCIGHVHFSTGG.............YKLRKAYTSLS...TA
E7LWJ6_YEASV/7-342..............ENVATTKEN..DNVLCI.....KCSAVLGQVTAGSL..............YKLHKWKLQLI...RS
L8FLW5_PSED2/12-403....................PSS..LSLACT.....SCAALIGTSTP..AG.............YQLYKWSLSLSAPLTT
B6QVW6_PENMQ/12-422....EQRPTSNSVKSTLYGGKNP..MNLGCS.....RCSAIIGTEDSVAEG.............LRLYKNNISVQ.....
A5DWX9_LODEL/10-359...............LEISKLDP..SVYICR.....NCGNEIGEKYQNI...............VRLLKWHISLQ.....
UBE3D_PONAB/13-385LSPVE.MCCVSSDNHCKLEPKAN..TKVICK.....RCKVMLGETVSSET..............TKFYMTEIIIQ...SS
K7JNW4_NASVI/31-384...............VENLKFKN..SIIHCN.....RCLSILGSFDGHETKS............LKIWNCCVEYK...GS
C8VJ15_EMENI/28-443.........SKGHPKSINVPLSE..QELQCE.....NCGTLIGVEDTIARG.............WRLFKASLAAE...GR
C5DFR9_LACTC/6-347...............GNQLSFEG..DNTACS.....KCSSVLGCLSTDNL..............YKINKWNLGLV...RN
C1FZL9_PARBD/14-476LSSSSAYDTYNGDQQSASKTHPV..VSLSCS.....WCGAIVGEEDTSFPS.............LRLYKTNVSVL...QK
G9NH43_HYPAI/14-393HPASDASFDSVKEAIDEADPVKP..LRVSCK.....ACKAEIGMFNALASS.............ITLFKWQVTCE...TI
M3ZXU8_XIPMA/13-392EVTSV...GSADGQDPKKPCHRL..ALVSCA.....SCSSVLGEAIAPGT..............LKLYITQVVVQ...PA
U7PMZ7_SPOS1/17-441STVQTAATNAAATTANTVAAPRG..LSVFCA.....ACRAQVGYFTLRQQS.............IHLFKWQVQVA...TA
M7PCP3_PNEMU/15-354................QNIKVEK..NKALCN.....FCHMNIGILIEDG...............IKLYKWKLAEK.....
R0KID0_SETT2/64-442.................VKEEGS..SSIMCK.....HCQSMIGTQDATADG.............WRIRKWGISIASSLPG
R7YJ95_CONA1/9-376.........CVKRNTSDHERSKL..QQLLCL.....GCGGLVGTIDDRVEG.............FKLWKWAVALSFGDEP
G2QZ38_THITE/12-402FEQGSSDRQSVPLTDPPTSPTRN..LNIFCS.....SCRAQLGLFNFRTAA.............VTLLKWQISCQ...ST
B4MTF5_DROWI/9-367................KGVMNRG..GQLYCQ.....RCLGLVGNTVLNDKA.............AKLWADAVRYL...PT
W5LC11_ASTMX/13-385EVDLS......HQQSEKTPGHKT..VGVLCK.....KCSAVLGEAVTTDV..............IKFYITEIVVK...QS
E9CUF8_COCPS/14-450SKNAADAERQRRQEKEETSRCSH..LPVRCT.....KCLGIVGQMQPSING.............LVLFKSDLMASRPLQN
J7RHU2_KAZNA/6-350...............AGSTEVND..LRVNCS.....KCGTKLGELTKDGL..............YKFYKWQLKLY...DN
J4KRH2_BEAB2/17-390SSNPLEKFDSSQDAIQATKEEKF..LTISCS.....NCATEVGTFSVLAST.............VAFYKWQISCE...IS
Q4P6X1_USTMA/1031-1415.........NFDAVAFEKNLDDY..KVLCCT.....KCRSQLGETSTLT......GTGADEPNTVRLNKYMLERY.....
Q9VWP0_DROME/9-380...............SSCMLNRD..DHLYCQ.....RCMRYLGLTMFDGAA.............ARIWADAVRWR...PA
S0DNZ8_GIBF5/11-388SSTPDARFDLSSLALNDDESKKF..LHIYCR.....ECTTEVGLYNIAALS.............VTLFKWKITCQ...TK
G0WHB4_NAUDC/6-346...........KERICIDDNEDN..SSLYCG.....QCSCKLGERSTNNL..............LKIYKWQLTLE...TL
E4UYL0_ARTGP/16-475SLYNANPGAPCDHGTDSSSVLPV..SNLCCK.....SCGSTIGEVQKHLQG.............VELFKASVSVS...HE
S3DDS5_GLAL2/11-450.................NKQLDY..QPLSCL.....GCNQYLGIVDPQAEG.............VRLYKWRLLCN...SR
E9IFT1_SOLIN/7-361...............RNNTCIDN..KTLTCN.....KCLLHIGTFHAYNL..............FKIWNCCVDYK...PQ
G3JK97_CORMM/17-391SSKSAARFHDSDSAIKATLEEKF..LSISCS.....NCAADIGTYSVLAST.............VAFFKWQISCE...VL
F1Q7U1_DANRE/13-384A.................AAEKR..VLVSCR.....RCSTALGEEITAEV..............LKLYITEISVK...PS
Q75DV5_ASHGO/6-339...............SEKLAMSG..TAVLCK.....ACRAPLGAVTREKL..............LRLHKWNLVQV...RS
B4L5I9_DROMO/9-377...............QDRIMNRA..DHLYCK.....RCMWMLGLSTQAGAA.............AKLWADALRWL...PQ
A4D9F3_ASPFU/21-420..........QQPTPEESAQKKE..ISLNCA.....NCNASIGIEDAVAQG.............WRLFKTSLSAS.....
H9KRH4_APIME/8-350...............NHHLKIKE..NTVICN.....RCLQYIGKIHSNTS..............FKLWSCAVDYN...LL
T5AMN1_OPHSC/15-387.PSTRATFNTSAQAMGDELPRKH..VHILCS.....GCNSEVGLYSQSALS.............VTLFKWQVSCE...TV
E9EVP5_METAR/11-386MSTLAKAARNSSDALADAAPPKF..LHIFCG.....ACEAEIGLFNVKIGS.............VNLFKWQVKCN...TT
Q6CWI5_KLULA/6-349...............PEKFIYDE..ELVRSR.....SCNTVIGSFTKEGS..............VRIGKWNLRAE.....
S8AD65_DACHA/9-377.........ENIACEKHVGTNEA..DTITCQ.....TCEAPLGIVDAKSDG.............IRLMKWSLLLGCGQES
B4M301_DROVI/9-376...............EAQVINRS..EHLYCK.....RCMWMLGLTIESGSA.............AKLWADALRWL...PS
F8PKW0_SERL3/430-815TTERPKSISVDTKRPISTTAEDW..RLVRCM......CGAMVGRCQERHEDGGVITM.......YRLLKYAIRPV...SP
G3NNB4_GASAC/18-378E................KPCRRL..ALISCK.....SCSLVLGEAVAPET..............LKLYITQVVVE...PA
C5DRI9_ZYGRC/22-358..............AGRTTVVDE..NIAMCS.....NCKKPLGRRTSDRM..............LRIPKWQLRLK...SD
U1HL67_ENDPU/9-361................KDVQTHN..SELHCA.....TCKALLGAIDVSAEG.............WRLYKSSLSLR...PS
H6C728_EXODN/11-373...............KHASRAGA..YVVKCF.....GCGTTIGSSQENEDS.............RRLVKSRLQVV...PD
G2Q453_THIHA/11-367.........................................LGFFNFRTSA.............VTLLKWQVSCK...SA
UBE3D_MOUSE/13-364...............LEQEPKAN..TKVICK.....RCKVTLGETMSSET..............TKFYMTEVIIR...PS
Q16XY0_AEDAE/12-444...............ERVHLRAE..RFLYCK.....RCLQFLGTMKRNGS..............AKLWYENVRFKSVGED
UBE3D_BOVIN/13-385GAPVE.THHLSSENHLKLKPKAN..TKVICK.....RCKVMLGETVSSET..............TKFYMTEIIIL...PS
G8YFE7_PICSO/20-360..................GNVKD..GQVVCG.....QCNHVLGSLMENT...............QRLLKWNLKLS...AD
H2AW44_KAZAF/6-348...............QDRVEYDS..DNLVCA.....TCHNNLGQVTFEKL..............LRLHKWELLLE...TS
F1NWJ5_CHICK/86-460KCSSE.TEHHASQNDSTLKSKEN..TRVICE.....RCKSTLGETVSSDT..............VKYYVTEVIIW...PS
Q6FK88_CANGA/6-347..............DRKVVVQTD..GSVDCS.....NCRSTLGYKEGSEI..............LVLEKQNLQLQDTFKE
M4G6J5_MAGP6/10-440PSPAGDLLKSPPLDIPAATPVRH..LSASCA.....SCQSTIGYYSFGPSA.............VALLKWQVLIQEEPEA
K5W0X4_PHACS/481-861....VKVNLCGVQGLDANKVDDW..SRVRCI......CGAVVGRSQEHKPKYGESTIV......YRLAKYAIRPV...SP
L9L4K4_TUPCH/13-384LAPVE.MHCLSSENHFKSVPKAN..TKVICE.....RCKVILGETMSSET..............TKFYMTEIIIQ...PS
F6W3S4_MONDO/6-379IAQAE..THQLSESHLESKPKAN..TKIICK.....RCKAMLGETDSSGT..............TKFYITEIIIQ...PS

PF00632

Q9BL11_CAEEL/717-1019GE....YS.....SSH..........................PTIQAFWKA.............................
UBR5_MOUSE/2479-2792GENAEKLL..................................QFKRWFWSI.............................
A0EFC1_PARTE/672-969DG....FD.....DKS..........................EYIRYFWSC.............................
Q54GG5_DICDI/425-720GG....YT.....QDD..........................TTIKNFWKV.............................
Q2GSX9_CHAGB/694-1033GV....YEIGDDGQEH..........................PTVKLFWEV.............................
Q4WHR7_ASPFU/967-1337GG....FG.....PHH..........................RVIQDFWSI.............................
Q5KIA2_CRYNJ/1499-1843HG....YN.....QDS..........................RAVQNLIEV.............................
Q5CW92_CRYPI/1231-1561G.....YT.....ETS..........................QQIIWLWDI.............................
A2E5Q8_TRIVA/658-966..........................................DQQSIFFKV.............................
A0BRI8_PARTE/1050-1354D.....YA.....PQD..........................QVIIWLQNT.............................
HUL5_YEAST/607-910G.....YK.....EED..........................QTIVDFWEV.............................
A7SML1_NEMVE/1229-1585HG....YS.....HDS..........................RAIKCLFEI.............................
Q38D88_TRYB2/1472-1912HG....YN.....SES..........................PQITMLQNI.............................
Q00WM5_OSTTA/458-763G.....FN.....VGS..........................RQIRWFWDI.............................
Q6BGB8_PARTE/609-908G.....YQ.....PYD..........................KTIEDFWSV.............................
A2FIB4_TRIVA/386-683.G....YQ.....MNS..........................RAIKNFWSI.............................
L9KS41_TUPCH/1283-1677GG....YH.....DGH..........................LVIRWFWAA.............................
A2DAL9_TRIVA/1571-1869S............QEH..........................PIVQMFFKI.............................
A4VDG4_TETTS/3915-4210G.....YT.....KND..........................KQIKWLFEI.............................
A2FLN6_TRIVA/2545-2849.............AND..........................PSSTMLWDA.............................
A4IBT8_LEIIN/1017-1343.............RNS..........................NTPKYLKEV.............................
A4IC88_LEIIN/3812-4131.............SED..........................RRVQLLWKA.............................
F6U235_XENTR/611-908GG....YT.....RDS..........................NIIKEFWEI.............................
A0D2G1_PARTE/170-483.............AED..........................YFIIWFWQI.............................
A4HF82_LEIBR/3619-3949..........................................SMRAILTDV.............................
Q8SS57_ENCCU/454-746G.....FR.....EDS..........................PIIVYFWEI.............................
AREL1_MOUSE/512-823GG...SWH.....FRE..........................KVMRWFWAV.............................
Q4E2E5_TRYCC/2646-2975..........................................ELCHMLKEV.............................
A7SQ93_NEMVE/299-612.G....YS.....KND..........................NTIRYFWDT.............................
TOM1_YEAST/2962-3268N.....YT.....ATC..........................KEVSYFWRA.............................
Q6C901_YARLI/697-1001NF.....T.....TEDPE.....