Sequence alignment for CL0552

PF00632

Q9BL11_CAEEL/717-1019ILVMRK.........IL.QSDY..GMF...----------------------------------.....SE.DEES----
UBR5_MOUSE/2479-2792SVVDMDLEDTDDGDDNA.......PLF...----------------------------------............----
A0EFC1_PARTE/672-969RLMMEK.........LI.SPDY..GMF...----------------------------------.....IP.KNNG----
Q54GG5_DICDI/425-720QLIVRK.........IF.DPEY..GMF...----------------------------------.....KY.NTTT----
Q2GSX9_CHAGB/694-1033TSVTTE.........AF.TPNE..GLF...----------------------------------.....I..ANSK----
Q4WHR7_ASPFU/967-1337RVLMAE.........AL.NPSY..GMF...----------------------------------........TMDA----
Q5KIA2_CRYNJ/1499-1843ALASKE.........FA.RRNL..HVWRD.----------------------------------..EDPS......----
Q5CW92_CRYPI/1231-1561TSISKE.........LC.SESF..GLFKSC----------------------------------KDNTIIPREYDS----
A2E5Q8_TRIVA/658-966SEVSLD.........LR.NPNC..GFVCPT----------------------------------PNSISQVGYYRD----
A0BRI8_PARTE/1050-1354QLLTKQ.........IV.DPNN..KLF...----------------------------------......VPTSNK----
HUL5_YEAST/607-910TTVSDE.........GFKDPKH..ELF...----------------------------------.....R..TNDR----
A7SML1_NEMVE/1229-1585ALVSKE.........FQ.RSSM..EMWRGT----------------------------------EVAPPVTEDADG----
Q38D88_TRYB2/1472-1912TLIARE.........LT.KCRL..RLWNNS----------------------------------SRSSTTHESGDS----
Q6BGB8_PARTE/609-908TRVVNQ.........AL.DPTF..GLF...----------------------------------.....I..ETPE----
A2FIB4_TRIVA/386-683FKLTEI.........AF.SPDY..GMF...----------------------------------.....RY.V.NS----
L9KS41_TUPCH/1283-1677FLLSQE.........LF.NPYY..GLF...----------------------------------.....EYSANDT----
A2DAL9_TRIVA/1571-1869TSFAEE.........MV.KPER..GLF...----------------------------------......IPSINN----
A4VDG4_TETTS/3915-4210.LIFNQ.........LL.DPNF..GLF...----------------------------------......VQSKKN----
A2FLN6_TRIVA/2545-2849TEACME.........IM.DPSM..QLFIQT----------------------------------PNKRRKIATAQD----
A4IBT8_LEIIN/1017-1343LILVKK..................ALVCAA----------------------------------SEEAGAASPHSA----
A4IC88_LEIIN/3812-4131SEMCRE.........LM.SGRL..PFFVPT----------------------------------ANHVHNTGSHRE----
F6U235_XENTR/611-908.LVVEE.........IF.NPDI..GMF...----------------------------------.....TY.DEST----
A0D2G1_PARTE/170-483TSILQQ.........LVDQ.....GYL...----------------------------------.....QKTDTKE----
A4HF82_LEIBR/3619-3949QLCSHS..................TIFTVV----------------------------------PNMSALYASEAA----
Q8SS57_ENCCU/454-746QLLSQE.........IKEDE....RLF...----------------------------------......EHTENR----
AREL1_MOUSE/512-823ELICKA.........LF.DTTS..QLF...----------------------------------....ARFTDSNQ----
Q4E2E5_TRYCC/2646-2975TMMCDELNYREEDDGRRVDPLL..PFFRLT----------------------------------GHTTMAGVVPNM----
A7SQ93_NEMVE/299-612LLLVRK.........IF.KPEY..GMF...----------------------------------.....SC.NDKS----
TOM1_YEAST/2962-3268QVLSRQ.........MF.NPDY..ALF...----------------------------------.....LPVPSDK----
Q6C901_YARLI/697-1001LLLKTA.........LF.NPAR..NLF...----------------------------------.....VE.DEES----
Q9W0H2_DROME/761-1058MLLLKD.........LL.DPKY..GMF...----------------------------------.....KE.YEQS----
A0BRN4_PARTE/3724-4023SLIGNELK.....GENLKSEQY..GYF...----------------------------------............----
NEDD4_HUMAN/1013-1318FLISKE.........MF.NPYY..GLF...----------------------------------.....EYSATDN----
O17736_CAEEL/692-1001SELLKT.........AF.NVER..GFF...----------------------------------.....T..FTES----
A2FPQ0_TRIVA/408-705YLITAE.........LF.NPDH..GMF...----------------------------------.....TL.I.DN----
A2FR71_TRIVA/373-670YLLVNA.........VF.SPDY..GMF...----------------------------------.....RI.I.NQ----
Q7PSQ3_ANOGA/541-897YLLSHE.........ML.NPQY..GLF...----------------------------------.....QYSRDDH----
Q247X9_TETTS/2308-2606TFLNNK..................ELF...----------------------------------......TFTPNQ----
A0DNI8_PARTE/201-510NLIMKE.........IV.HPES..GMF...----------------------------------.....QLADCED----
A5K4K7_PLAVS/1441-1991ILLCRE.........IL.HAKF..FLF...----------------------------------.....D..YVHN----
A2DQ34_TRIVA/412-708YLLTSQ.........IF.SPDY..GMF...----------------------------------.....TT.I..N----
Q5KBV2_CRYNJ/2952-3249.VLAQQ.........IF.DPNF..ALF...----------------------------------.....EPCAADQ----
A2FXS6_TRIVA/392-692HLICQT.........LF.SSDY..GMF...----------------------------------.....EL.Y.GN----
A4VD17_TETTS/789-1090.DLSKI.........VF.DPNY..GMF...----------------------------------......RLVENN----
A2F7U9_TRIVA/2273-2579TECATS.........IF.EKTS..CLCFPV----------------------------------PNARHHRGQFKD----
Q9W196_DROME/819-1122SELIKT.........AF.DPNR..GFF...----------------------------------.....M..VTTD----
A2DYB1_TRIVA/1674-1977TSLIHQ.........LF.NPNY..VLF...----------------------------------......APSANG----
A2EDQ8_TRIVA/2183-2490TEAAAS.........IF.EPTT..LLAIST----------------------------------PNMRNHTGQYKD----
A4S7N1_OSTLU/131-443SQVTEQ.........GL.DPNR..GLF...----------------------------------.....QSNATG.----
A2EM50_TRIVA/2501-2807SELAKD.........IC.DPNI..GLFVST----------------------------------PNFVNHRGSFRE----
Q0UNY9_PHANO/908-1229RVVLSE.........AF.KPDH..GMF...----------------------------------........TLDP----
A2EQW9_TRIVA/2209-2511NEIAIS.........IF.QSQS..KLFILS----------------------------------PNGRNHSGGMRD----
HUL4_ASHGO/526-839LLLTRD.........LF.NPNN..GLF...----------------------------------.....VY.VPES----
Q7QE66_ANOGA/554-863YLLSRQ.........LF.SPYR..NMF...----------------------------------.....EYSANDI----
A2E4I7_TRIVA/2634-2943LDAINE.........SI.IPSI..GLFIQC----------------------------------PNSKFPNSENFD----
A5K5J0_PLAVS/8258-8564SILAKE.........IF.NPNY..ALF...----------------------------------.....CREGKKS----
Q54QF1_DICDI/778-1120....EE.........LANTPLNGYHLF...----------------------------------......QEYSNS----
UPL7_ARATH/828-1142TDITKA.........AF.ATEY..GLF...----------------------------------.....SQTPTSD----
Q8SR14_ENCCU/2104-2410VLLAKD.........LL.DPNF..ALF...----------------------------------.....EFATEDK----
MUG30_SCHPO/482-807LLLTRK.........VF.SPEF..GLF...----------------------------------.....VNCEESS----
A3FPU7_CRYPI/497-797QLLVQE.........IF.NIDF..GMF...----------------------------------.....IY.YEDT----
Q38A01_TRYB2/1526-1868NLLARK.........FQ.DVQL..HMWRTE----------------------------------EFTDESAKTARR----
A1CTM1_ASPCL/1468-1817STVSKE.........FS.KKKL..KIWREN----------------------------------DCNNDE......----
A2DAJ9_TRIVA/133-438IELANS.........IF.QPTS..HLFIQS----------------------------------PNGRNHCGSFRD----
Q7PSA4_ANOGA/2506-2929ALVAAE.........LQ.RSDL..GMWLCD----------------------------------DEEPKLIEDEID----
UPL3_ARATH/1518-1888TLLSHD.........LQ.KASL..GMWRSS----------------------------------SGDKVSMQIGRD----
C8VT87_EMENI/782-1089.LLVRE.........VF.DPHH..GLF...----------------------------------.....IY.DEDS----
Q22F29_TETTS/3359-3651...LND.........IL.DPQK..GLF...----------------------------------......KLSSNG----
Q4UD92_THEAN/251-554ITLCTL.........IF.DPTY..GIF...----------------------------------.....E.EVPEE----
Q580G4_TRYB2/3999-4304QLIAEE.........MV.NDNY..ALF...----------------------------------......IHSREG----
A3LSX3_PICST/660-977TSVVRE.........GF.DPSNELELF...----------------------------------.....K.ETISD----
A2DBI7_TRIVA/375-665YILTNE.........LI.KPDL..KLF...----------------------------------.....QE.TKTG----
A0DLU6_PARTE/3989-4284NKVGE..........LMKSQSN..GFF...----------------------------------......RLNAKS----
HACE1_MOUSE/602-909DILSNE.........IV.NPDY..ALF...----------------------------------......TQSADG----
UBE3B_HUMAN/736-1068EEIIKR.........VF.DPAL..NLF...----------------------------------.....K.TTSGD----
A4IAG7_LEIIN/1064-1369FWFVTEDDGGADPVTLPFPTTK..ALF...----------------------------------............----
A7SNF7_NEMVE/430-737SLHSSS.........VAGNPEDQEKTWMKC----------------------------------..EEWNPETNVS----
A2ERB6_TRIVA/1571-1861SSFISS.........IF.DEKD..SYFYLN----------------------------------ERGRHEPKKIID----
A3GHK0_PICST/646-950LLLTRA.........LF.NPQA..GMV...----------------------------------.....YN.IEDS----
A7AV31_BABBO/1338-1643DKFTFD.........MFRRASKGTSSYNSA----------------------------------GQSAIITASCQK----
Q4Q7L2_LEIMA/1091-1400VSLCKE.........GF.AAEY..GLF...----------------------------------.....R..QTPD----
A8BYQ3_GIAIC/636-950NLICDE.........MF.SKAL..DLF...----------------------------------......EENQET----
PUB2_SCHPO/367-671YILSHA.........IF.NPGY..SLF...----------------------------------.....EYATDDN----
Q54KP2_DICDI/1482-1898TLVSKE.........LQ.RKDL..NLWYTD----------------------------------NNDQIPDEDDDK----
A5DS31_LODEL/333-694ATVSKE.........FI.RKKL..KLWRDQ----------------------------------SLSNFGSKKGLE----
A2DQ30_TRIVA/383-682GLISQQ.........MI.DPSF..SMF...----------------------------------.....T..VVNG----
A4HPV4_LEIBR/2168-2551ELIAEE.........LL.NPQH..GLWRTE----------------------------------PIPIDELTDSPT----
A4IBF5_LEIIN/1897-2310YDLSKA........AFLVDRNV..GLM...----------------------------------............----

PF09814

C1FZL9_PARBD/14-464ELLPNI---------RQIMLHV--SLADSLFSSE.....SSGIPGIPVDPLDNKFSLTLQP..SRRSVCLSGPW......
F6W3S4_MONDO/6-378EIRKRL---------QSALLII--R.EPKQGSLP...............................MDVSLT...PS....
I3ITZ6_ORENI/17-395ELRKRL---------QSGLLIV--G..KDVAQTP...............................ADVAVT.SGDS....
N4UQV1_COLOR/12-395ELLANI---------RQLSVAV--SLPSPS.................................DGRSSQGTISADG....
E9EVP5_METRA/11-385ELLSNI---------RQVSIAA--SLPSPP..................................GPRTVAKVFDGG....
M1WB37_CLAP2/12-387ELLANL---------GQVSVAA--TLPKPP.................................EKGDTRVNITDDG....
E4UYL0_ARTGP/16-474ELLANI---------RQIRLFV--TTKGPTENDS...................RPVLSLDS..SRSVVTVSHFE......
A1CJR3_ASPCL/19-423ELLPNI---------RHITLYI--SLPSHLNTNN.....TSPT.............ITLSE..SRQAVTVSLPGPF....
C8VJ15_EMENI/28-442EYLPNI---------RQVSLQI--SAAGALYAYP.....................EISLSE..SRRAVTVSLTLPE....
H2L971_ORYLA/17-387ELRKRL---------LSGLLIV--R..KEVAGAA...............................DDVLVT.GGGS....
G3NNB4_GASAC/18-377ELRKRL---------QTGLLIV--G..KNVASSP...............................ADVVVT.GGES....
A0A0C4E6U2_MAGP6/10-439ELLSNI---------RQVSVVA--SLPSAR..................................NASTKAILLDGG....
S8AD65_DACHA/9-378ELLSNI---------KQVSVSI--DSPDGH..................................SQPSSVHLHASR....
N1QJ23_SPHMS/6-366EHLFNI---------HAISIQA--VLPSPS..................................NKETCATISTDG....
G0WHB4_NAUDC/6-345EYLPRI---------GSVNIII--ENVEDL............................IVRISSETEVGISYREND....
M7PCP3_PNEMU/15-353EALSHI---------RVINLVL--EFSENIYQPS.....S................LKLF...NTHSIYIKSNE......
F2SJ85_TRIRC/16-422ELLANI---------RQIRFYV--TTKDAVRNDS...................RPVVTLDS..SRSLVTVSHSD......
E9CUF8_COCPS/14-449EFLPNI---------SQIAVYV--TLADLPNSSE.....TQNI.............LEVVP..SRDELLLSVGD......
Q6BMI9_DEBHA/5-350EYLPRI---------NSISVIV--ENNDPI..................................GNLIDIRLSSRD....
G8BQA7_TETPH/7-356EYLPRI---------GNISIII--ESSQGK.............................................K....
W5LC11_ASTMX/13-384ELRQRL---------QSGLLLI--R..RDAFESS...............................TEVKVS.GGDS....
E9IFT1_SOLIN/7-367ELRPRL---------QSCNVFI--SVKKDLCL.................................KDVQIKLLESN....
F2UGQ3_SALR5/7-364EARPSV---------CSGHLFV--RGPSHL....................................NVNVVSQDGR....
W5NKD6_LEPOC/13-376ELRTRL---------QSGLLVL--S..KDLAKDL...............................SEVQLL.CGPS....
J4KRH2_BEAB2/17-389ELLTNI---------RQVTIKA--SLPTPA..................................DHTTTAEILDEG....
R7YJ95_CONA1/9-375EHLLNI---------HTVSLTA--TLQTLS..................................NKETKASLSADG....
S0DNZ8_GIBF5/11-387ELLSNI---------RQISVTV--SLLTSV..................................DSSTKAEISPDG....
UBE3D_MOUSE/13-363EVRRRL---------QSALLIL--G.GPDEGGMH...............................LDISIT...PT....
J3NIY5_GAGT3/10-440ELLSNI---------RQVSVVA--SLPSAR..................................NASTKAMLLNGG....
Q59X25_CANAL/5-335EYLPRL---------NSISVAL--DVQSGFNIDE................................INRISIAGEL....
S7Z7X2_PENO1/19-451ELLPNI---------RQVTLYV--TLPRLPALEG.....VQPQ.............IQLSE..SCKSVTVSLPEPW....
N1JPA0_BLUG1/11-394ELLSNI---------KQVSILA--SLTYPC..................................DENTKVELSDDG....
A7USM4_ANOGA/14-433ELRPRL---------QCANFFI--SFPRKFVDI................................ESTTIELATDR....
L8FLW5_PSED2/12-402ELLPNI---------RQISVLA--ALPTPS..................................DGTTRVSLSGDR....
K1WUW9_MARBU/11-366ELLSNI---------RQISVIV--ALEGVC..................................ESATKAELSADG....
G3JK97_CORMM/17-390ELLTNI---------RQITVKV--SLPTPA..................................DQTTAAEILDDG....
M3ZXU8_XIPMA/13-391ELRKRL---------QSGLLVV--G..TNVAAGP...............................ADVAVSRGGDS....
A7TPW1_VANPO/6-339EELPRV---------DSLNILV--DGRVPV.....................................RVVSLSGVK....
B4MTF5_DROWI/9-373ELRPNL---------RCGNAYL--QFNRQLREDG...............................RKTRIILKEHN....
G9NH43_HYPAI/14-392ELLSNI---------RQVSVRA--TLSSSS..................................DLTTKAEILDDG....
H3AB66_LATCH/13-372EIRKRM---------QSGHLVI--RKGPSA...................................MDISVK...PS....
B6QVW6_PENMQ/12-421ELLPNI---------RQLTLHV--SLLKSASEID....LREST.............ITLTE..SCRAVTVSTHHQG....
G3Y5B6_ASPNA/22-416ELLPNI---------RQLTLYI--SVPPKTPRSN.....LQ...............ITLSD..SRRAVTVTSSLPN....
G2Q453_THIHA/11-366ELLANI---------RQISLAV--TLPSPC..................................DSSTRVAVSADC....
T5AMN1_OPHSC/15-387ELLPNI---------RQVSVGA--ALPSPP..................................DATTFAEVVDQG....
G1TSQ5_RABIT/13-382EVRRRL---------PSALLIV--G.EPRE.GLP...............................MDISIT...PS....
S3CHW0_OPHP1/592-1020ELLVNI---------RHVSVSV--TLPTPG..................................NDTTVVELLSQQDAVN
Q75DV5_ASHGO/6-338EYLPRI---------GVMLIVV--AGEAGE.....................................VELGKLGGH....
H0ZQP0_TAEGU/10-364EIRRET---------QSALLVI--R.AAELPSAP...............................AEVSVC...AD....
G0VL18_NAUCC/6-338EYLPRI---------KKITVIL--DECVEP.....................................RLVQVKPLE....
F8PKW0_SERL3/428-814EHHETL---------QHVLVFV--SVGGLASNTDLSAEVLP.........................TVESGTEGDL....
F1Q7U1_DANRE/13-383ELRQKL---------QSGLLFI--R..SDVIGGG...............................ADVKIESKPDS....
A4D9F3_ASPFU/21-419ELLPNI---------RHITFYI--SIPANLGSQN.....IQPL.............ITLSE..SRRSVSVSLPAPF....
J4G0K5_FIBRA/670-1049EYHENL---------QHIIVFL--SVSGIIAGVNLEAEVVPS.....................SGVPGKTNDATDY....
K0KTK1_WICCF/8-359ELLSRI---------RSLSIVL--EEEDSS................................KTPEIITISQVDSK....
U1HL67_ENDPU/9-360EVLANI---------RQANLYA--SLETHK..................................NEHTKIDIASDK....
B4JWU6_DROGR/9-392EFRPNL---------CCGQICL--QFDEPIRNC................................KNTRLIINNGD....
J7RHU2_KAZNA/6-349ESLPRI---------GSVGVYV--DDVEEL............................VLKELGPKALTVSYRGKH....
C5DRI9_ZYGRC/22-357EFLPRI---------GTTSVVL--DGIKEP.....................................SLKYSDSGK....
N1PZE3_DOTSN/8-375EHLVHI---------RALSIQA--SLCTVS..................................NQATRATLSADG....
B2WD68_PYRTR/65-448ELLLHI---------RTVTLFA--SLRANN..................................SKQTDAKLSADG....
B3MZV3_DROAN/9-395ELRPNL---------RSGVVFL--QFDHDIGTC................................NQTRLVIREHN....
S3DDS5_GLAL2/11-449ELLSNI---------RQVSVIA--ALNTPS..................................DSSTRVEVLDGG....
G8ZSN1_TORDC/11-349EHLPRI---------GTTSIDI--CAVGQP.....................................VIVSRGPGK....
F1NWJ5_CHICK/86-460EIRRGT---------QSALLVI--R.EASLRNLP...............................ADISVA...PG....
G2Y6Z9_BOTF4/11-390ELLSNI---------RQISILA--FLDTPS..................................DSSTKAELSADG....
E3QET8_COLGM/12-395ELLANI---------RQLSVAV--SLPSPA..................................GSHTRGLITPDG....
H2RRY7_TAKRU/13-391ELRKRL---------QTGLIIV--GYRKEVTTHP...............................GDVAVT.GEDS....
B4L5I9_DROMO/9-382ELRPNL---------SSGHVFL--QFDQEIRGR................................KKTRLIIKEHD....
I2H589_TETBL/10-368EYLPRI---------GCISIVV--EGLEDL...................................CVQKLQFNDTT....
Q6CWI5_KLULA/6-348EYHHWI---------GAVQLWV--ENDGQP...................................IATEIPHDRRH....
C0NUQ4_AJECG/14-503ELLPNI---------RQITLHV--SLPASSRLAQ.....SSITSDTPGDLVRGNFSLSLLP..SRDAVSLYSSH......
UBE3D_PONAB/13-384EVRGQL---------QSALLIL--G.EPKEGGMP...............................MNISIM...PS....
B4M301_DROVI/9-382ELRPNL---------SSGHVFL--QFDQEIRDR................................QKTRLIIKEHD....
C5DFR9_LACTC/6-346EYLPRI---------RTVVITI--ESPKEV.....................................HVKGLEPES....
V5G5H4_BYSSN/14-443ELLPNI---------RQLTLYV--SLPSDSDTKNEDGDRLKPE.............ISLSE..SRRAVTVSVGE......
A0A088AUY8_APIME/8-357ELRPRL---------QVCNAFI--HLSKKVNL.................................TEIKIKLSKES....
UBE3D_BOVIN/13-384EVRRRL---------QSALLIL--G.DSKEGGLP...............................MAVSVT...PS....
N1QC82_PSEFD/8-371EHLVNI---------RALSLQA--ALSTVS..................................NQQTRATLSADG....
E7LWJ6_YEASV/7-341EWLPRI---------QSISVVV--EGWKQV.....................................EIKNLKDTL....
K7JNW4_NASVI/31-384ELRPRL---------RSLSAYI--SLVKNIDT.................................STVNIKILEDA....
B0WGJ1_CULQU/12-439ELRPRL---------QSANFFI--CFSRRFVEI................................KSTKIDLAPDR....
F4X8J5_ACREC/7-368ELRPRL---------QSCNVFI--SMRKDLCL.................................KNVRIKLLEST....
U4LVT7_PYROM/7-364ELLPNI---------KSISLLI--SLPTPA..................................NASTRATVDPGS....
M2R8N7_COCSN/64-445ELLLHI---------RTVTLFA--SLRTNH..................................SRQTDAKLSADG....
Q7SDG7_NEUCR/13-419ELLSNI---------RQISLAI--SLGSAS..................................DASTRVVVAADG....
H6C728_EXODN/11-372EALTHI---------RQLTLYA--SLETAK..................................NEHTKILLSSDK....
E2C3X0_HARSA/7-364ELRPRL---------QSCNAFI--AMRKDLDL.................................KDVQVKLSESN....
A5DWX9_LODEL/10-362EYLSKL---------GQMSVTV--QVQTDLKLQQ......................VLDIKLISIDTMSININDDG....
Q9VWP0_DROME/9-387ELRPNL---------RSGVVFL--RFDQQVSQS................................QKTRVVVRDYN....
H2AW44_KAZAF/6-347EYLPRI---------GIISVVL--EGVYSV.....................................KVESVAERE....
F7E020_XENTR/11-384EIRKHM---------QTASLIL--G..SGLDGFP...............................VDVSLG...PS....
G1XBI8_ARTOA/9-373ELLPNI---------KQVSVSI--ESKDGE...................................TPTSVGLHPSK....
Q16XY0_AEDAE/12-443ELRPRL---------QSANFFI--CFSRRFAEI................................KTTKIDLGSDR....
Q29GF2_DROPS/8-383EIRPYL---------NCGQVYI--QLHRN..................................DASNMRVVILEQR....
G8YFE7_PICSO/19-368EEFSNL---------NSISISI--ENDQITPSCA................................IKSIRTKSRG....
Q6FK88_CANGA/6-346EELENV---------GVTLIAV--EALNNV....................................SYSISTNRST....
U7PMZ7_SPOS1/17-440ELLVNI---------RQVSVSV--SFAGPI.................................EARQTTAEVLPDG....
L9L4K4_TUPCH/13-384EVRRGL---------QSALLIL--G.ETEEGNMS...............................MDVSIM...PS....
G2QZ38_THITE/12-401ELLANI---------RQISLAA--SLSSPS..................................DASTRVSISADC....
K5W0X4_PHACS/481-860EYHENL---------QHILIFL--TVSGLQAGVELEAEVVS........................PESGPDSHHAQ....
R0KID0_SETT2/64-441ELLLHI---------RTVTLFA--SLRTNH..................................SRQTDVKLSADG....

PF00632

Q9BL11_CAEEL/717-1019--HLVWFSGLPS....................................................................
UBR5_MOUSE/2479-2792--.....YQPGKRGF.................................................................
A0EFC1_PARTE/672-969--TMYWFNPQSF....................................................................
Q54GG5_DICDI/425-720--NCFWFNPDS.....................................................................
Q2GSX9_CHAGB/694-1033--NSYYPNPCSIDQSKNALQE...........................................................
Q4WHR7_ASPFU/967-1337--RTRISWFQ......................................................................
Q5KIA2_CRYNJ/1499-1843--.....IAGNYVHHPHGL.............................................................
Q5CW92_CRYPI/1231-1561--LIEISNKFKDLLIDEP..............................................................
A2E5Q8_TRIVA/658-966--KFIFVPTN......................................................................
A0BRI8_PARTE/1050-1354--LFYQINRESYQ...................................................................
HUL5_YEAST/607-910--YELYPSVVYD....................................................................
A7SML1_NEMVE/1229-1585--GI...KYVYSESGLFPIP............................................................
Q38D88_TRYB2/1472-1912--.....CGNRQLRSKSNSGTFDDEQRVESRPEGLFPCSSVP..........................KVLQRFSTDLSL
Q6BGB8_PARTE/609-908--KTMIPNPAFM....................................................................
A2FIB4_TRIVA/386-683--KYYWFVPESK....................................................................
L9KS41_TUPCH/1283-1677--YTVQISPMSAFVENHLECGRFQAKHHLKKSMENYGHCVLPPNASLCLQHVKYTCSTCDKTKMKRQDLGIWHCGFCIKI
A2DAL9_TRIVA/1571-1869--CSYTINP.......................................................................
A4VDG4_TETTS/3915-4210--YTYMPNPFSFL...................................................................
A2FLN6_TRIVA/2545-2849--YLIPNPSP......................................................................
A4IBT8_LEIIN/1017-1343--GSPVSSGTAAASASASNEPGI.........................................................
A4IC88_LEIIN/3812-4131--AYVPAASA......................................................................
F6U235_XENTR/611-908--KHSWFNPSSF....................................................................
A0D2G1_PARTE/170-483--LTYKFNPNV.....................................................................
A4HF82_LEIBR/3619-3949--ADGVES........................................................................
Q8SS57_ENCCU/454-746--IWIRPH........................................................................
AREL1_MOUSE/512-823--ALVHPNPNRP....................................................................
Q4E2E5_TRYCC/2646-2975--DFYRENPE......................................................................
A7SQ93_NEMVE/299-612--RLYWFNKECL....................................................................
TOM1_YEAST/2962-3268--TTFHPNRTSGI...................................................................
Q6C901_YARLI/697-1001--HYCWFNPGCKA...................................................................
Q9W0H2_DROME/761-1058--RLLWFADLTF....................................................................
A0BRN4_PARTE/3724-4023--.....SMLAPGYY.................................................................
NEDD4_HUMAN/1013-1318--YTLQINPNSGL...................................................................
O17736_CAEEL/692-1001--KLLYPNPTAPFL..................................................................
A2FPQ0_TRIVA/408-705--SFYWFNISSI....................................................................
A2FR71_TRIVA/373-670--NTYWFVHSDF....................................................................
Q7PSQ3_ANOGA/541-897--YSLQINPDSYLKQRKTIHF...........................................................
Q247X9_TETTS/2308-2606--MSVYPNKD......................................................................
A0DNI8_PARTE/201-510--VSYKINCEA.....................................................................
A5K4K7_PLAVS/1441-1991--GTLYPKRFHS....................................................................
A2DQ34_TRIVA/412-708--GYYWFSITPF....................................................................
Q5KBV2_CRYNJ/2952-3249--QTYQPNKTSWI...................................................................
A2FXS6_TRIVA/392-692--HYLWFTPLAS....................................................................
A4VD17_TETTS/789-1090--QKLCPNQDSLEF..................................................................
A2F7U9_TRIVA/2273-2579--LFVPYDE.......................................................................
Q9W196_DROME/819-1122--NKLYPNPNVAD...................................................................
A2DYB1_TRIVA/1674-1977--RSFQPNPASNI...................................................................
A2EDQ8_TRIVA/2183-2490--VYIPFDK.......................................................................
A4S7N1_OSTLU/131-443--.LIYPSPRAGD...................................................................
A2EM50_TRIVA/2501-2807--CIVPNPIS......................................................................
Q0UNY9_PHANO/908-1229--QTRMTWFQ......................................................................
A2EQW9_TRIVA/2209-2511--VYIPFSSL......................................................................
HUL4_ASHGO/526-839--RLCWFSIMESIEHE................................................................
Q7QE66_ANOGA/554-863--YTVQIAPERPT...................................................................
A2E4I7_TRIVA/2634-2943--CLIPVPDP......................................................................
A5K5J0_PLAVS/8258-8564--EFNHPNPLSYI...................................................................
Q54QF1_DICDI/778-1120--NKYHPSPFSNL...................................................................
UPL7_ARATH/828-1142--RLLVPSPSARH...................................................................
Q8SR14_ENCCU/2104-2410--TTVVPCKNSYV...................................................................
MUG30_SCHPO/482-807--NYLWFNYSHR....................................................................
A3FPU7_CRYPI/497-797--RLFWFNMASL....................................................................
Q38A01_TRYB2/1526-1868--VQLPLFPSL.....................................................................
A1CTM1_ASPCL/1468-1817--.....EFAFGRRGLFPA.............................................................
A2DAJ9_TRIVA/133-438--AYVPSTT.......................................................................
Q7PSA4_ANOGA/2506-2929--LGEGSKPVGYYVRRSTG.............................................................
UPL3_ARATH/1518-1888--EIEDGKPSAANRDIVLAPLGL.........................................................
C8VT87_EMENI/782-1089--RYCYFNPYCL....................................................................
Q22F29_TETTS/3359-3651--VTMQPSPTSFL...................................................................
Q4UD92_THEAN/251-554--RSYYPCPNSGI...................................................................
Q580G4_TRYB2/3999-4304--MTYQPNPLSGV...................................................................
A3LSX3_PICST/660-977--NQIYPNDDIHKSITVG..............................................................
A2DBI7_TRIVA/375-665--..YWFVPGG.....................................................................
A0DLU6_PARTE/3989-4284--QTYFFSPKF.....................................................................
HACE1_MOUSE/602-909--TTFQPNSNSYV...................................................................
UBE3B_HUMAN/736-1068--ERLYPSPTSYI...................................................................
A4IAG7_LEIIN/1064-1369--..............................................................................
A7SNF7_NEMVE/430-737--VALRLK........................................................................
A2ERB6_TRIVA/1571-1861--ESLIDD........................................................................
A3GHK0_PICST/646-950--NYLWFNLVPI....................................................................
A7AV31_BABBO/1338-1643--DTFTIR........................................................................
Q4Q7L2_LEIMA/1091-1400--GYVYPNSFSAVA..................................................................
A8BYQ3_GIAIC/636-950--HSFYFNRKNGTVAE................................................................
PUB2_SCHPO/367-671--YGLQISPLSSV...................................................................
Q54KP2_DICDI/1482-1898--MKIDSTISTTSTIPPISPIISTTTISSTTTTTTTTTPPPPTSLS.................SNTTTTITTPIIEQLTI
A5DS31_LODEL/333-694--.....LNDPYIINSNGLF............................................................
A2DQ30_TRIVA/383-682--SYHWFNIMFK....................................................................
A4HPV4_LEIBR/2168-2551--LKTTHSPDRSISLSTHSGAA..........................................................
A4IBF5_LEIIN/1897-2310--.....RDYV.....................................................................

PF09814

C1FZL9_PARBD/14-464............--------------------------------------------------------------------
F6W3S4_MONDO/6-378..VLKMKTLE..--------------------------------------------------------------------
I3ITZ6_ORENI/17-395..SLHIRTPR..--------------------------------------------------------------------
N4UQV1_COLOR/12-395..ASLTVRHRD.--------------------------------------------------------------------
E9EVP5_METRA/11-385..RRLCIEHDG.--------------------------------------------------------------------
M1WB37_CLAP2/12-387..QRLFLDCTG.--------------------------------------------------------------------
E4UYL0_ARTGP/16-474............--------------------------------------------------------------------
A1CJR3_ASPCL/19-423..SH........--------------------------------------------------------------------
C8VJ15_EMENI/28-442..SQEA......--------------------------------------------------------------------
H2L971_ORYLA/17-387..SLVVRTPR..--------------------------------------------------------------------
G3NNB4_GASAC/18-377..SLHIKTPK..--------------------------------------------------------------------
A0A0C4E6U2_MAGP6/10-439..SRIHVSHEG.--------------------------------------------------------------------
S8AD65_DACHA/9-378..RALTVSFGP.--------------------------------------------------------------------
N1QJ23_SPHMS/6-366..SSLTLAHNG.--------------------------------------------------------------------
G0WHB4_NAUDC/6-345..MP........--------------------------------------------------------------------
M7PCP3_PNEMU/15-353............--------------------------------------------------------------------
F2SJ85_TRIRC/16-422............--------------------------------------------------------------------
E9CUF8_COCPS/14-449............--------------------------------------------------------------------
Q6BMI9_DEBHA/5-350..QVLIKFHD..--------------------------------------------------------------------
G8BQA7_TETPH/7-356..IHIDAIDLDG--------------------------------------------------------------------
W5LC11_ASTMX/13-384..ALKIRVPN..--------------------------------------------------------------------
E9IFT1_SOLIN/7-367..IVLIL.....--------------------------------------------------------------------
F2UGQ3_SALR5/7-364..LAVVDTQAER--------------------------------------------------------------------
W5NKD6_LEPOC/13-376..SLEIKTPG..--------------------------------------------------------------------
J4KRH2_BEAB2/17-389..RKFRISHNG.--------------------------------------------------------------------
R7YJ95_CONA1/9-375..ETISLTHAG.--------------------------------------------------------------------
S0DNZ8_GIBF5/11-387..RQLSVTHHG.--------------------------------------------------------------------
UBE3D_MOUSE/13-363..SLLVRTPD..--------------------------------------------------------------------
J3NIY5_GAGT3/10-440..SRIHISHDG.--------------------------------------------------------------------
Q59X25_CANAL/5-335..LSIELKNS..--------------------------------------------------------------------
S7Z7X2_PENO1/19-451..NH........--------------------------------------------------------------------
N1JPA0_BLUG1/11-394..QKLTLIHRG.--------------------------------------------------------------------
A7USM4_ANOGA/14-433..ITIVM.....--------------------------------------------------------------------
L8FLW5_PSED2/12-402..ALLTLVHNG.--------------------------------------------------------------------
K1WUW9_MARBU/11-366..WQFIFYHEG.--------------------------------------------------------------------
G3JK97_CORMM/17-390..RKFRVNHNG.--------------------------------------------------------------------
M3ZXU8_XIPMA/13-391..SLLVQTPR..--------------------------------------------------------------------
A7TPW1_VANPO/6-339..IELEVVDEVG--------------------------------------------------------------------
B4MTF5_DROWI/9-373..VHIME.....--------------------------------------------------------------------
G9NH43_HYPAI/14-392..RRIQVHHRG.--------------------------------------------------------------------
H3AB66_LATCH/13-372..SLQLKVAE..--------------------------------------------------------------------
B6QVW6_PENMQ/12-421..VE........--------------------------------------------------------------------
G3Y5B6_ASPNA/22-416..TNQDDPTS..--------------------------------------------------------------------
G2Q453_THIHA/11-366..QTVELRHRS.--------------------------------------------------------------------
T5AMN1_OPHSC/15-387..RRLRIHHKG.--------------------------------------------------------------------
G1TSQ5_RABIT/13-382..SLQMRTSD..--------------------------------------------------------------------
S3CHW0_OPHP1/592-1020GHARVRARHNG.--------------------------------------------------------------------
Q75DV5_ASHGO/6-338..RLTVTVNG..--------------------------------------------------------------------
H0ZQP0_TAEGU/10-364..SLEVRSGG..--------------------------------------------------------------------
G0VL18_NAUCC/6-338..VHIRENN...--------------------------------------------------------------------
F8PKW0_SERL3/428-814..LIIRNDAV..--------------------------------------------------------------------
F1Q7U1_DANRE/13-383..ILNVQTPD..--------------------------------------------------------------------
A4D9F3_ASPFU/21-419..DH........--------------------------------------------------------------------
J4G0K5_FIBRA/670-1049..LLLKCGLS..--------------------------------------------------------------------
K0KTK1_WICCF/8-359..LIKLLMKDYD--------------------------------------------------------------------
U1HL67_ENDPU/9-360..KTITVSHDG.--------------------------------------------------------------------
B4JWU6_DROGR/9-392..MFFLE.....--------------------------------------------------------------------
J7RHU2_KAZNA/6-349..MSLV......--------------------------------------------------------------------
C5DRI9_ZYGRC/22-357..ITVQDGRG..--------------------------------------------------------------------
N1PZE3_DOTSN/8-375..SALSLAHEG.--------------------------------------------------------------------
B2WD68_PYRTR/65-448..SFITVSHEG.--------------------------------------------------------------------
B3MZV3_DROAN/9-395..VYISEGPV..--------------------------------------------------------------------
S3DDS5_GLAL2/11-449..RQILVSHQD.--------------------------------------------------------------------
G8ZSN1_TORDC/11-349..LCVEDTEE..--------------------------------------------------------------------
F1NWJ5_CHICK/86-460..RLEVRSGA..--------------------------------------------------------------------
G2Y6Z9_BOTF4/11-390..TLLALRHAE.--------------------------------------------------------------------
E3QET8_COLGM/12-395..ATLQLQHAG.--------------------------------------------------------------------
H2RRY7_TAKRU/13-391..CLNIRTSS..--------------------------------------------------------------------
B4L5I9_DROMO/9-382..VHIVE.....--------------------------------------------------------------------
I2H589_TETBL/10-368..SILEVSNNSG--------------------------------------------------------------------
Q6CWI5_KLULA/6-348..INVTIGNK..--------------------------------------------------------------------
C0NUQ4_AJECG/14-503............--------------------------------------------------------------------
UBE3D_PONAB/13-384..SLQMKTPE..--------------------------------------------------------------------
B4M301_DROVI/9-382..VHIVE.....--------------------------------------------------------------------
C5DFR9_LACTC/6-346..VELANDQG..--------------------------------------------------------------------
V5G5H4_BYSSN/14-443............--------------------------------------------------------------------
A0A088AUY8_APIME/8-357..IEITI.....--------------------------------------------------------------------
UBE3D_BOVIN/13-384..SLRMQSPG..--------------------------------------------------------------------
N1QC82_PSEFD/8-371..DTLSLEHEG.--------------------------------------------------------------------
E7LWJ6_YEASV/7-341..MSISGDEE..--------------------------------------------------------------------
K7JNW4_NASVI/31-384..IEIHI.....--------------------------------------------------------------------
B0WGJ1_CULQU/12-439..ITIST.....--------------------------------------------------------------------
F4X8J5_ACREC/7-368..IVLIV.....--------------------------------------------------------------------
U4LVT7_PYROM/7-364..TTAVLYHNG.--------------------------------------------------------------------
M2R8N7_COCSN/64-445..SYITVSHEG.--------------------------------------------------------------------
Q7SDG7_NEUCR/13-419..ENVELTHHG.--------------------------------------------------------------------
H6C728_EXODN/11-372..KVITAIHDE.--------------------------------------------------------------------
E2C3X0_HARSA/7-364..IALVL.....--------------------------------------------------------------------
A5DWX9_LODEL/10-362..NNIK......--------------------------------------------------------------------
Q9VWP0_DROME/9-387..VYISE.....--------------------------------------------------------------------
H2AW44_KAZAF/6-347..LTLQVVDEGT--------------------------------------------------------------------
F7E020_XENTR/11-384..YLQIQTSE..--------------------------------------------------------------------
G1XBI8_ARTOA/9-373..RALTVKYGA.--------------------------------------------------------------------
Q16XY0_AEDAE/12-443..ITIST.....--------------------------------------------------------------------
Q29GF2_DROPS/8-383..IYIDD.....--------------------------------------------------------------------
G8YFE7_PICSO/19-368..SIQVLINE..--------------------------------------------------------------------
Q6FK88_CANGA/6-346..LELRVINDS.--------------------------------------------------------------------
U7PMZ7_SPOS1/17-440..VTLRVRRRGK--------------------------------------------------------------------
L9L4K4_TUPCH/13-384..SVQMKTPT..--------------------------------------------------------------------
G2QZ38_THITE/12-401..RTVELRHRG.--------------------------------------------------------------------
K5W0X4_PHACS/481-860..LLLRCGAS..--------------------------------------------------------------------
R0KID0_SETT2/64-441..CYITVSHEG.--------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019.................EFCDREQ.....FHQLGRLVGLSIYN.......HSIVPFPFPLALYKYLLD............
UBR5_MOUSE/2479-2792..............YTPRPGKNTEARLNCFRNIGRILGLCLLQ.......NELCPITLNRHVIKVLLG............
A0EFC1_PARTE/672-969...................EIPIY.....YSLIGKLLGLALYN.......QVLLDVRFPTVLFKKLQN............
Q54GG5_DICDI/425-720...................VDYTE.....FELIGIIIGLALYN.......NIILDVHFPLVIFKKLLN............
Q2GSX9_CHAGB/694-1033.........AQIPENSEEWAETITSRLRQYEFLGRVIGKCLYE.......GILIDVSFAGFFLLKWAT............
Q4WHR7_ASPFU/967-1337....................PCSLEPLYKFELLGLLMSLAIYN.......GLTLPVNFPVAFYRKLLG............
Q5KIA2_CRYNJ/1499-1843..........FPSPLPRASAELVASRLKWFKTLGQFIGRSMLD.......SRIIDISFNKVFLKLLLD............
Q5CW92_CRYPI/1231-1561............LSLKKSNNILYL.....FEFLGKIVGKAIYE.......KILLEIEFNPVFLNSVFE............
A2E5Q8_TRIVA/658-966....................NELRSNKKLYKSIGGLLLLIIRT.......GLVQEFDFAPVVWRFLVS............
A0BRI8_PARTE/1050-1354.................DPDHLKK.....FKFVGMIFAIATAN.......GVKVFGRFPISFFKHIIG............
HUL5_YEAST/607-910..................ATKLKY.....IWFLGKVVGKCLYE.......HVLIDVSFADFFLKKLLN............
A7SML1_NEMVE/1229-1585.........IPRNARVAMVSRLKSK....FRFLGRFLGRALLD.......FRMVDIPFSCAFYKWMLG............
Q38D88_TRYB2/1472-1912SSCRDTKALTERFLCMNDFFEVDEERAQLYYLVGTVLGRAFTD.......AVVFPLDISPALALFLCRGIPPSRIVLRCT
Q6BGB8_PARTE/609-908..................QEEKQK.....YAFIGKIIGKAIYE.......GVLIEKVLNQVFLNQVLG............
A2FIB4_TRIVA/386-683...................SENSL.....FRLLGLVIGLGAVN.......KVPLPVRFPLLMYKKILN............
L9KS41_TUPCH/1283-1677VAGGAWTYTTTLAVTVKSAIRRLKELKDQFRFSGRILGLALIH.......QYLLDAFFTRPFYKALLR............
A2DAL9_TRIVA/1571-1869......................SCTDYSKFEGIGRFIGIVVLH.......GEILGYQLAHHLIKAMIG............
A4VDG4_TETTS/3915-4210.................VPDHLIY.....FKFLGILLGKAFLE.......NYPVQANFAKPFLKLFLK............
A2FLN6_TRIVA/2545-2849.....................LTPQSRDFFFYAGVLMTICYTS.......RLPEPFKFARFVWNSLTQ............
A4IBT8_LEIIN/1017-1343......RSVLFSTVPYLPAPDADGIAPDLFVLLGKVLLKSIIE.......NRQIPLQLSSAVLKFLSG............
A4IC88_LEIIN/3812-4131.....................RSAYDLEAFAFIGKLMGGALRS.......EDPLDLFLPPLVWRYLCA............
F6U235_XENTR/611-908...................ETEGQ.....FTLIGIVLGLAIYN.......NCILDVHFPMVVYRKLMG............
A0D2G1_PARTE/170-483...................QSNTIDKRQLFSFLGIIVGKCLFE.......RIPLSSFLDRTIIKHILR............
A4HF82_LEIBR/3619-3949.......................SVLRRMFEWLGKIMGNMVLC......GTLKASFDFPQMLWKTLTF............
Q8SS57_ENCCU/454-746.......................EGDGEGYEAIGRIIAIALYN.......NVVLNIPFPSLFFKKLLD............
AREL1_MOUSE/512-823...................AHLRL...KMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIG............
Q4E2E5_TRYCC/2646-2975.....................HRLLFVEVFTWLGKLIGNATMS......GYLMFSFTFPRLLWKFLTF............
A7SQ93_NEMVE/299-612...................DQDEE.....FNLVGVLMGLAVYN.......SIILDIHFPSCCYKKLLSPAVVPFHNPNAR
TOM1_YEAST/2962-3268.................NPEHLSF.....FKFIGMIIGKAIRD.......QCFLDCHFSREVYKNILG............
Q6C901_YARLI/697-1001.................QDGDLRE.....YRLAGVITGLALYN.......SSMLDLPLPPVVFKKLLG............
Q9W0H2_DROME/761-1058...................ETENM.....YFLIGVLCGLAIYN.......FTIINLPFPLALFKKLLG............
A0BRN4_PARTE/3724-4023..............YIDPKFLNIPKKNDYAYVFGKFVANSIFN.......NHQIGIQFQPQFWKVIFS............
NEDD4_HUMAN/1013-1318................CNEDHLSY.....FKFIGRVAGMAVYH.......GKLLDGFFIRPFYKMMLH............
O17736_CAEEL/692-1001................LGVDCLAH.....FQFIGRMIGKLIYE.......RQLQEVRFAEFFIAQIFE............
A2FPQ0_TRIVA/408-705...................EQTYL.....FNLLGTIIGLAIYN.......GVILPIKFPCVMYKKLQE............
A2FR71_TRIVA/373-670...................SEPMK.....FNVLGTVVALAIAN.......SVILPIRFPIALYKKLLG............
Q7PSQ3_ANOGA/541-897........FPVLFLAAINPEHLSY.....FHFVGRILGIAVFH.......NHVLDGGFTLPFYKQLLN............
Q247X9_TETTS/2308-2606....................AISKKALEQIELLGKFVGKSMME.......DWSLMLSFAPFFIKSVLK............
A0DNI8_PARTE/201-510....................DTDEHIIDCFKLLGIVVGKCIFE.......RIPLNIYFDRSIIKHIIG............
A5K4K7_PLAVS/1441-1991..................NDNLNL.....YTFAGKVIGKAIYE.......RILIESVFNDVFLSFLLC............
A2DQ34_TRIVA/412-708...................EDYSA.....YMMLGTAVSLAIYN.......NVVLPIRFPTLLYKKILG............
Q5KBV2_CRYNJ/2952-3249.................NDVHLSY.....FKFVGRVIGGRL............LDAYFNRAFYKQILG............
A2FXS6_TRIVA/392-692.................SIEDDHL.....FTLYGLIIGLAIYN.......EILLPVHFPRALFKSILN............
A4VD17_TETTS/789-1090................LGPEHLEI.....FHFLGSVVGRAIYD.......QIQIQPIFSVFFLRQMIG............
A2F7U9_TRIVA/2273-2579.....................TNGEYSDIYRGIGIYIGMVVRT.......GFVQDMPFVPFVWKFIAG............
Q9W196_DROME/819-1122................LFEDYEKH.....YYFIGRILGKSIYE.......NLLVELPLAEFFLTKLAG............
A2DYB1_TRIVA/1674-1977................NYMEHKQY.....FKFAGRIMAKAIIE.......EQYLDAHLTMSILKAILG............
A2EDQ8_TRIVA/2183-2490......................TMSRLQDYYTIGVLLGIIIRT.......GLQQDLPFAPIVWKFIAN............
A4S7N1_OSTLU/131-443.................THEGILL.....LEMIGMMIGKGMYE.......GILQDINMAPFFAAHVLG............
A2EM50_TRIVA/2501-2807.....................EWGRTSHIYESVGCLIAISIRT.......GMVQPFTFPPFFWTCLVT............
Q0UNY9_PHANO/908-1229....................PGTLEPVWKFEMLGMIFSLAVYN.......GITLPVTFPHAFYQFLLH............
A2EQW9_TRIVA/2209-2511.....................RPFTSRSLFYAVGVFIGIVIRN.......GYFQDFPFAPFVWKYLAN............
HUL4_ASHGO/526-839.............LLQGEGSSSEL.....YYLFGVVLGLAIYN.......STILDLKFPRAFYKKICG............
Q7QE66_ANOGA/554-863................DRDDILEW.....YRFAGRVLGLALVH.......QYLLDAFFTRPFYKALLR............
A2E4I7_TRIVA/2634-2943.....................NNMHSEDMYKMLGVLFGISTRC.......GLTKPLPFPDFFWKYIAQ............
A5K5J0_PLAVS/8258-8564.................NPDHLHF.....FKFVGKFIAKAIYD.......GQVIDAYFCRSFYKHMLG............
Q54QF1_DICDI/778-1120.................IPDYRSI.....FKTLGRITGKSIIDSI..TKADRHFSLRFTPIFYKMILG............
UPL7_ARATH/828-1142.................LENGIQM.....IEFLGRIVGKALYE.......GILLDYSFSHVFIQKLLG............
Q8SR14_ENCCU/2104-2410.................NPEHLSY.....FKFVGRIIAKAIMD.......GNFINLHLSKFIYQYILG............
MUG30_SCHPO/482-807..................SKEIDY.....YHMSGILMGIAIHN.......SINLDVQMPRAFYKKLLQ............
A3FPU7_CRYPI/497-797...................ESNGE.....FELIGIVLALAIYN.......GIILDVHFPLAVYKKLLG............
Q38A01_TRYB2/1526-1868....................FQDDESLSNFELLGMLVGRVLME.......ERVVDLPLSECFLRGILG............
A1CTM1_ASPCL/1468-1817...........PMSEEQAASESGKRQLSLFKTLGKFVARSMLD.......SRIIDISFNPAFFRI...............
A2DAJ9_TRIVA/133-438.....................LGKDSYDQYKAIGTFLGIIIRN.......GFPQDIPFAPFIWKHLAG............
Q7PSA4_ANOGA/2506-2929..........LFPAPLPQDSDISEDVSGYFWFLGVFLAKVLQD.......NRLVDLPLSNSFLQLLSHSRSMARGATSQT
UPL3_ARATH/1518-1888......FPRPWPSTADISEGGQFHKVIEYFRLLGRVMAKALQD.......GRLLDVPLSTAFYKLILG............
C8VT87_EMENI/782-1089...................ESSEQ.....FFLVGVVLGLAIYN.......SIILDIALPPFAFKKLLAGAPQ.......T
Q22F29_TETTS/3359-3651.................VPNHLTH.....FRFAGRLIAKGLIE.......KLDFEVDFTKSFLKHILH............
Q4UD92_THEAN/251-554................IHENHLEL.....FCFIGKIVGKALYE.......QILIEPVLSRLLLNLILK............
Q580G4_TRYB2/3999-4304.................NPLHLQY.....FRFAGIVVGMAVAH.......RVAIDVHFTRAVYRHMIG............
A3LSX3_PICST/660-977............DDPQLQQKKLSY.....LKFLGSIVGKCLYE.......NVLIDVSFAPFFLNKWCN............
A2DBI7_TRIVA/375-665....................DQKL.....LKLFGIIVGLAITN.......QLILPVRFPKIFYKKFAR............
A0DLU6_PARTE/3989-4284....................QPDKEKEQYAIAFGKLIANSILN.......KEIIGVPFAHQFWKLIFN............
HACE1_MOUSE/602-909.................NPDHLNY.....FRFAGQILGLALNH.......RQLVNIYFTRSFYKHILG............
UBE3B_HUMAN/736-1068.................HENYLQL.....FEFVGKMLGKAVYE.......GIVVDVPFASFFLSQLLG............
A4IAG7_LEIIN/1064-1369..........................LKEFFALGAACARAFID.......EYRMDMDLLPQAWPLLMLPSLGLPVGQKAG
A7SNF7_NEMVE/430-737..........................LRQLRLIGRLIGAAICD.......DLLLSLHLSKPFVKQILG............
A2ERB6_TRIVA/1571-1861.........................YDDLLMVYGMILGRALIE.......DIPINRRMESYFYKFLKD............
A3GHK0_PICST/646-950...................ENFEM.....YYLLGAVLGLAIYN.......STILDLHFPMALYKILLD............
A7AV31_BABBO/1338-1643.........................VFRTFKLLGQLVALALID.......HKLLDLRLNPLFWHLCQH............
Q4Q7L2_LEIMA/1091-1400...............TSDPQHLLK.....IRFLGAMVGRALRD.......GVLQDVPFALHFRNAILG............
A8BYQ3_GIAIC/636-950.............GSEQWIKLSKN.....YCFAGMILGMCLLN.......RVNITNHFPRVLYRKLLG............
PUB2_SCHPO/367-671.................NPDFRSY.....FRFVGRVMGLAIYH.......RRYLDVQFVLPFYKRILQ............
Q54KP2_DICDI/1482-1898IHQYIYSSGGLFPKPINPNITIEKKTLEYFKFLGMFIAKAFFD.......QRLIDLPLSKPMYKYMID............
A5DS31_LODEL/333-694.........PAPMDRTQILSDNGKKILYFCSSLGKFVARALLD.......SRIIDFNFNPIFLKLIQFLNRK......TL
A2DQ30_TRIVA/383-682...................GDPGY.....FKFVGTIVGLAAVN.......SYNLNVQFPSLLFKKLVG............
A4HPV4_LEIBR/2168-2551.......VRRRPCMPLFPAAKQTPTTLHYWKLLGVLLGRLLVI.......GTTTSLNFHPLLLRRLRGESLNS.....TA
A4IBF5_LEIIN/1897-2310....................LEQRERAKAYYVIGAALGRAFVD.......EQVFPLPLSRAVAYFIRRGVPAYQ..CVVS

PF09814

C1FZL9_PARBD/14-464--------------------.....GERTFDLPARVSVS....-------.AYTTLATRPIRIYWGVV------------
F6W3S4_MONDO/6-378--------------------.....QCREIKFPAEVRLVPSSL-------RGLQ..YISGD.......------------
I3ITZ6_ORENI/17-395--------------------.....GVLYLTLPAGVAFEQGSC-------IPTPAGESCGE.......------------
N4UQV1_COLOR/12-395--------------------.....ARASLALPCKVAVKS...-------...ALLPAPAPGSR....------------
E9EVP5_METRA/11-385--------------------.....QTEALDLPGTVFGN....-------...TTLQVSQSASR....------------
M1WB37_CLAP2/12-387--------------------.....FVTTMLLPAPVAT.....-------...TSLKIADGASR....------------
E4UYL0_ARTGP/16-474--------------------.....KTLTLKLPCHISTR....-------.ARDYLTASPATSHGGEN------------
A1CJR3_ASPCL/19-423--------------------.....VSDTIKLPARVNEA....-------.SRHTLNTSRQAPTQPAN------------
C8VJ15_EMENI/28-442--------------------.....VMETIKLPAKVTEG....-------.SRRLLSNATQSAGQGKG------------
H2L971_ORYLA/17-387--------------------.....GQLELALPAGVSFTEGSC-------IPTP.GESSAE.......------------
G3NNB4_GASAC/18-377--------------------.....GELSLTLPAGVTFEQGSC-------TPTPAGDFCEE.......------------
A0A0C4E6U2_MAGP6/10-439--------------------.....DSRVLNLPAAVHIGSGAG-------SGPVVLPPAKPTTAS.AG------------
S8AD65_DACHA/9-378--------------------.....DISHVILPVPIDYPSRVL-------AT................------------
N1QJ23_SPHMS/6-366--------------------.....HVASIKLPAAVPKG....-------RTTAALPIPEAPCE....------------
G0WHB4_NAUDC/6-345--------------------.....SSSIVKLPCEVSIDQPVN-------LVKRTGN...........------------
M7PCP3_PNEMU/15-353--------------------.....ISEIIFLPDETEKD....-------...VSIQVNQQLN.....------------
F2SJ85_TRIRC/16-422--------------------.....KTLTLKLPLSISAR....-------.AREHLATSQATSHGGEN------------
E9CUF8_COCPS/14-449--------------------.....QKRSLRLPARVAPS....-------.APSYFPLQPGSASNIDQ------------
Q6BMI9_DEBHA/5-350--------------------.....NEISVNLPVKIKRDDKIR-------IANANQTAD.........------------
G8BQA7_TETPH/7-356--------------------IHAKVGGEPIRIPFAAKV.....-------..................------------
W5LC11_ASTMX/13-384--------------------.....EEYQVKLTPGVSLLEGSC-------QKSP..EVNDD.......------------
E9IFT1_SOLIN/7-367--------------------.......................-------.ENCSMNFLLPSVRVIPT------------
F2UGQ3_SALR5/7-364--------------------.....QLATIALPPHVRPSGLER-------THQDEHTN..........------------
W5NKD6_LEPOC/13-376--------------------.....CLVDLQLPAGVTIIQDSC-------REVP..SAAGD.......------------
J4KRH2_BEAB2/17-389--------------------.....TSGEAVLPATAPVK....-------...GTLPLSHKGST....------------
R7YJ95_CONA1/9-375--------------------.....ETTTIRLPTKLSGG....-------.SDAALTLPAAPAK....------------
S0DNZ8_GIBF5/11-387--------------------.....HTEHITLPAQTSAI....-------...GSLPVAQIGRS....------------
UBE3D_MOUSE/13-363--------------------.....GCTEIRLPAGVRLVPSSC-------GGLQ..YISGD.......------------
J3NIY5_GAGT3/10-440--------------------.....DTRELDLPAVVHTGGGAG-------SGPVVLPPTKPAAAAAAG------------
Q59X25_CANAL/5-335--------------------.....PPIDVHLPCKASQASIT.-------..................------------
S7Z7X2_PENO1/19-451--------------------.....VSETLKLPARVASA....-------.TRQNTNLRMSTPSTPAQ------------
N1JPA0_BLUG1/11-394--------------------.....QVHALSLPHKVYPK....-------...FNFQVPSKIGSQ...------------
A7USM4_ANOGA/14-433--------------------.....................KG-------ERERYEIRTGDYFQLHTQ------------
L8FLW5_PSED2/12-402--------------------.....ATASLQLPGTIAPTYTAT-------QPHPSLA...........------------
K1WUW9_MARBU/11-366--------------------.....QKTVLGLPGQAVAN....-------...FQLQKPILGNK....------------
G3JK97_CORMM/17-390--------------------.....VTVEASLPTSAPLK....-------...GPLPVSHKGSL....------------
M3ZXU8_XIPMA/13-391--------------------.....GDLSLALPAGVAFETGSC-------IHTPVDEPGGE.......------------
A7TPW1_VANPO/6-339--------------------KL...EVVDILFPNEIKLRGSEL-------RFVQN.............------------
B4MTF5_DROWI/9-373--------------------......................D-------DDENNLVIRYNCFGMDIQ------------
G9NH43_HYPAI/14-392--------------------.....EVRALDLPARVSVR....-------...SAIPIPENSSL....------------
H3AB66_LATCH/13-372--------------------.....SCEHIELPAGVRIVPSSC-------RGLQ..YVNGD.......------------
B6QVW6_PENMQ/12-421--------------------.....LVETLKLPVKVTDA....-------.SRRNLSFAGHRVDIGGA------------
G3Y5B6_ASPNA/22-416--------------------.....TSETIKLPARVSES....-------.SRRILQQRPPSTQGES.------------
G2Q453_THIHA/11-366--------------------.....STCVLRLPGKASLGG...-------...VVLPIQNKQCGST..------------
T5AMN1_OPHSC/15-387--------------------.....CSEVVDLPAPVTKS....-------...AALAVPKAAGS....------------
G1TSQ5_RABIT/13-382--------------------.....GCTDIELPAEVRLVPSSC-------RGLH..YVPGE.......------------
S3CHW0_OPHP1/592-1020--------------------.....AVQEMTLPGRVALAARP.-------...VRLPLPQPKKPGDLL------------
Q75DV5_ASHGO/6-338--------------------.....AAEVIELPCEVDPLARPR-------IRHS..............------------
H0ZQP0_TAEGU/10-364--------------------.....SCHAAALPAGVSLAPSSC-------RGLR..HLRGD.......------------
G0VL18_NAUCC/6-338--------------------.....SISIIKLPYEVELQDSLQ-------LTEGT.............------------
F8PKW0_SERL3/428-814--------------------.....SSPPLTLPARIASGVQDI-------KLR...............------------
F1Q7U1_DANRE/13-383--------------------.....SSFQVTLTPGVSLVETQK-------QKSP..ANSEQ.......------------
A4D9F3_ASPFU/21-419--------------------.....VADTIKLPARVNEA....-------.SRRVLATSRQGDAATAD------------
J4G0K5_FIBRA/670-1049--------------------.....TSPFLRLPARVAPGKQTV-------MVS...............------------
K0KTK1_WICCF/8-359--------------------.....SPFYIPLPSDVPQIPNIT-------QCILKRGN..........------------
U1HL67_ENDPU/9-360--------------------.....ESASIYLPTEIGGT....-------...AEVSIPVDRGK....------------
B4JWU6_DROGR/9-392--------------------.......................-------NGNSEFVLRHDSWDMDIT------------
J7RHU2_KAZNA/6-349--------------------.....VKKTISLPVNISLSQNGV-------PTSFKYNE..........------------
C5DRI9_ZYGRC/22-357--------------------.....ERLDIALPYNPGKVNSKR-------LVKVGGSD..........------------
N1PZE3_DOTSN/8-375--------------------.....EVATICLPVRVHVP..GA-------HNDVPLTMPSAPTK....------------
B2WD68_PYRTR/65-448--------------------.....ASAKIRLPINVKGG....-------.GDAALELPSQPPNK...------------
B3MZV3_DROAN/9-395--------------------.....KTSTPRSDSDSEEEYHEE-------DEENSLVIRHDCFGMDIG------------
S3DDS5_GLAL2/11-449--------------------.....LSSVLILPGQVTLY....-------...SQLQQPVSGQK....------------
G8ZSN1_TORDC/11-349--------------------.....NKATILLPCEEFVGEQAK-------FTTVS.............------------
F1NWJ5_CHICK/86-460--------------------.....ACEAAALPPGVSLAPSSC-------RGLR..RLPGD.......------------
G2Y6Z9_BOTF4/11-390--------------------.....QDILLTLPGQVVSN....-------...SKLREFPLGSL....------------
E3QET8_COLGM/12-395--------------------.....AHTSFALPGRVQTRG...-------...AALPAPPQASR....------------
H2RRY7_TAKRU/13-391--------------------.....GETSLALPKGVAFEQGSC-------IPTPAGESCE........------------
B4L5I9_DROMO/9-382--------------------...................NGQN-------SGGSQLVLRHDTFGMDIQ------------
I2H589_TETBL/10-368--------------------.....TIYHIKLPYIADATMDIS-------SIKYQKNG..........------------
Q6CWI5_KLULA/6-348--------------------.....RVITINLPCVVDVNTKGE-------VQR...............------------
C0NUQ4_AJECG/14-503--------------------.....TVHTLPLPACVSES....-------.AHTILSTKLTPNPPGAG------------
UBE3D_PONAB/13-384--------------------.....GCTEIQLPAEVRLVPSSC-------RGLQ..FVAGD.......------------
B4M301_DROVI/9-382--------------------...................NGTD-------STESELVLRHDSFGMDIQ------------
C5DFR9_LACTC/6-346--------------------.....ARYVIELPHRVVIDSSQN-------SFQSYKDYKTLRLRAVED------------
V5G5H4_BYSSN/14-443--------------------.....EMETMKLPARVSES....-------.SRSNLRFPEQASSGHTG------------
A0A088AUY8_APIME/8-357--------------------.......................-------.ENNTVTFLTKFVKLIPD------------
UBE3D_BOVIN/13-384--------------------.....GCTELRLPAGVRLAPSTC-------RGLQ..HVPGD.......------------
N1QC82_PSEFD/8-371--------------------.....ESASIRLPFQVPGA....-------HSDATLTIPAAPTK....------------
E7LWJ6_YEASV/7-341--------------------.....QVEDILLPVEVEEKVDAS-------YKFKNRGK..........------------
K7JNW4_NASVI/31-384--------------------.......................-------.EAKVFKLPLSNVKLLPS------------
B0WGJ1_CULQU/12-439--------------------.....................EN-------NDEQYEIRLGDFFKLHTQ------------
F4X8J5_ACREC/7-368--------------------.......................-------.EDCSTSFSLPSVKVIPT------------
U4LVT7_PYROM/7-364--------------------.....ETTPLILPAQANPGPRQL-------VLTTVLGEK.........------------
M2R8N7_COCSN/64-445--------------------.....ESATIRLPINVKGA....-------.GDAALELPSRPPSK...------------
Q7SDG7_NEUCR/13-419--------------------.....QSHTLHLPAKVALGG...-------...AILPIQRPGAS....------------
H6C728_EXODN/11-372--------------------.....ESSSIYLPTQISGT....-------...ANVTFPTDKRT....------------
E2C3X0_HARSA/7-364--------------------.......................-------.KDHNMDFSLPFIKIVPT------------
A5DWX9_LODEL/10-362--------------------.....SPLQIRLPVCISQFSIKS-------ARVV..............------------
Q9VWP0_DROME/9-387--------------------.....KPKNQAIDLDSSSESDSE-------DSDKLMLIRHAQYGMDIV------------
H2AW44_KAZAF/6-347--------------------EDA..HMTKIELPDKAIYNESVS-------QFKKGS............------------
F7E020_XENTR/11-384--------------------.....QCERFCIPAEVKLLPSSC-------RLVQ..QIAGE.......------------
G1XBI8_ARTOA/9-373--------------------.....RTSHIMLPTPIDSPSITL-------IP................------------
Q16XY0_AEDAE/12-443--------------------.....................EN-------NDERYEIRLGDYFKLHTQ------------
Q29GF2_DROPS/8-383--------------------.................ADRGTG-------KSIDTEIMRVNEFDMDLS------------
G8YFE7_PICSO/19-368--------------------.....YMEDVTLPIDLKEGNEIR-------IKNLSRGQN.........------------
Q6FK88_CANGA/6-346--------------------.....YKTSIRLK..........-------..................------------
U7PMZ7_SPOS1/17-440--------------------DDGDQQTAVLTLPGRVAVTAAG.-------...AQLPVPGPALASG..------------
L9L4K4_TUPCH/13-384--------------------.....GCTEIQLPAEVRLVPASC-------RGLQ..YVPGD.......------------
G2QZ38_THITE/12-401--------------------.....VVSQLQLPAKASLGG...-------...TLLPIQDRQRGTT..------------
K5W0X4_PHACS/481-860--------------------.....TSQRLALPAPVAVGPAQV-------NVVG..............------------
R0KID0_SETT2/64-441--------------------.....QTATIRLPINVKGA....-------.GDAALELPSKPPGK...------------

PF00632

Q9BL11_CAEEL/717-1019...T.......PPDL.....ED.................................LCEL.....S....PSE---GKG.L
UBR5_MOUSE/2479-2792..........RKVNW.....HD.................................FAFF.....D....PVM---YES.L
A0EFC1_PARTE/672-969...E.......KVTE.....ED.................................LKEL.....D....MEI---YTG.F
Q54GG5_DICDI/425-720...L.......DLTM.....ED.................................IESL.....D....PEV---YQS.F
Q2GSX9_CHAGB/694-1033...SAGASDTYRANI.....ND.................................LREL.....D....EEL---YQG.M
Q4WHR7_ASPFU/967-1337............LKV.....KH.................................LEHI....RDG..WPEL---TKG.L
Q5KIA2_CRYNJ/1499-1843...KP...IKKNLST........................................LRAV.....D....PSL---ARS.L
Q5CW92_CRYPI/1231-1561..........QNNDF.....TD.................................LLNL.....D....EEL---YKS.L
A2E5Q8_TRIVA/658-966..........NKVSI.....ED.................................IYEI.....D....VNY---KNT.I
A0BRI8_PARTE/1050-1354...Q.......KLSI.....FD.................................ISYH.....D....EGL---YQQ.F
HUL5_YEAST/607-910...YSNGFLSSFSD.........................................LGSY.....D....SVL---YNN.L
A7SML1_NEMVE/1229-1585...F.....EATFDY.....RD.................................LFDI.....D....PVL---AKS.I
Q38D88_TRYB2/1472-1912EKEEQPWEPERPIDFMSLGIEE.................................VEMM.....D....KQV---ASS.L
Q6BGB8_PARTE/609-908...I.....TNTIN.......D.................................FRFY.....D....SDQ---YHR.I
A2FIB4_TRIVA/386-683...K.......TITL.....ND.................................LAEI.....D....PHF---VTS.V
L9KS41_TUPCH/1283-1677...L.......PCDL.....SD.................................LEYL.....D....EEF---HQS.L
A2DAL9_TRIVA/1571-1869..........RNVNA.....SD.................................LADY.....S....PVV---YDT.I
A4VDG4_TETTS/3915-4210...K.......KIVI.....SD.................................IEEI.....D....PEL---YKN.L
A2FLN6_TRIVA/2545-2849..........RPVTL.....DD.................................IYEI.....D....SNF---KQF.I
A4IBT8_LEIIN/1017-1343..........AEPSF.....VD.................................LEEY.....D....PNI---AST.L
A4IC88_LEIIN/3812-4131..........YPITE.....AE.................................VEQV.....DVICVQCV---REFRV
F6U235_XENTR/611-908...K.......KGTF.....RD.................................LADS.....H....PVL---YQS.L
A0D2G1_PARTE/170-483..........QKIVL.....ED.................................IKYF.....D....EDL---FYS.W
A4HF82_LEIBR/3619-3949...Q.....EDTITL.....AD................................YAHDI.....DDNIIAAL---EDEEF
Q8SS57_ENCCU/454-746..........RRPTL.....DD.................................LREI.....S....SGI---ATS.L
AREL1_MOUSE/512-823...L.......RMHY.....KY.................................FETD.....D....PEF---YKSKV
Q4E2E5_TRYCC/2646-2975..........DNLTI.....ED................................YHADI.....DDTVRGAL---NDDEF
A7SQ93_NEMVE/299-612VGLA.......NLGL.....ED.................................LAEV.....M....PEL---ARG.L
TOM1_YEAST/2962-3268...R.......PVSL.....KD.................................MESL.....D....PDY---YKS.L
Q6C901_YARLI/697-1001...C.......PVGL.....ED.................................FTVV.....N....PTV---GRS.L
Q9W0H2_DROME/761-1058...K.......PVDL.....SD.................................LRQL.....S....PPE---ANS.M
A0BRN4_PARTE/3724-4023..........EKIQF.....KD.................................LNGF....LD....PIT---FQN.Y
NEDD4_HUMAN/1013-1318...K.......PITL.....HD.................................MESV.....D....SEY---YNS.L
O17736_CAEEL/692-1001...TD...KNKDVDL.....QH.................................MKSF.....D....PII---FKH.L
A2FPQ0_TRIVA/408-705...L.......ATSV.....ED.................................LKEI.....M....PQE---YQS.L
A2FR71_TRIVA/373-670...M.......KMTL.....ED.................................LNQI.....E....PDI---VKG.I
Q7PSQ3_ANOGA/541-897...K.......PITL.....SD.................................IEDV.....D....PDL---HRS.L
Q247X9_TETTS/2308-2606..........RDLSI.....GD.................................FYSY.....D....FNS---AQQ.H
A0DNI8_PARTE/201-510..........QSIFL.....ED.................................IYYY.....D....RQL---YQS.W
A5K4K7_PLAVS/1441-1991...DDL.DLDVDVAI.....ND.................................LYFI.....D....QHV---FNS.L
A2DQ34_TRIVA/412-708...K.......PITL.....TD.................................IGEI.....D....PDF---MKS.A
Q5KBV2_CRYNJ/2952-3249...R.......TVDM.....RD.................................LESI.....D....PEY---HKS.L
A2FXS6_TRIVA/392-692..FS.......NFTL.....ND.................................LEQI.....E....PDV---AKS.L
A4VD17_TETTS/789-1090..........KQNNL.....VE.................................LENF.....D....KEL---YKN.L
A2F7U9_TRIVA/2273-2579..........GELSS.....ND.................................ILMV.....D....KML---SDQ.F
Q9W196_DROME/819-1122...K.....YSDVDI.....HQ.................................LASL.....D....PEL---YRN.L
A2DYB1_TRIVA/1674-1977...I.......PVTL.....RD.................................LEDV.....D....EQL---HNS.L
A2EDQ8_TRIVA/2183-2490..........EHVGI.....DD.................................VTAI.....D....SGL---LEH.F
A4S7N1_OSTLU/131-443...T.....ARTID.......D.................................IPSL.....D....EDL---ARS.I
A2EM50_TRIVA/2501-2807..........GEITI.....DD.................................VFSI.....D....NEY---KDF.V
Q0UNY9_PHANO/908-1229...GVA..PLRATNL.....HN.................................IRDCLDLVADG..WPEL---AKS.F
A2EQW9_TRIVA/2209-2511..........EPLDK.....ND.................................ILCL.....D....EHF---ANM.A
HUL4_ASHGO/526-839...E.......VLSV.....ND.................................FLEL.....Y....PET---GTN.M
Q7QE66_ANOGA/554-863...L.......PVSL.....SD.................................LESL.....D....SSF---HQS.L
A2E4I7_TRIVA/2634-2943..........GILTI.....ED.................................IYSI.....D....TPY---KEL.M
A5K5J0_PLAVS/8258-8564...R.......KILP.....AD.................................AESV.....D....PEF---YNS.L
Q54QF1_DICDI/778-1120...E.......KITL.....DD.................................LELI.....D....PEL---YNNKV
UPL7_ARATH/828-1142...R.....YSFID.......E.................................LSGL.....D....PEL---YRN.L
Q8SR14_ENCCU/2104-2410...K.......SCDL.....QD.................................LESA.....D....PEF---HKS.L
MUG30_SCHPO/482-807...L.......PLSF.....ND.................................LDDF.....Q....PSL---YRG.L
A3FPU7_CRYPI/497-797...Y.......KVDI.....GD.................................LYEI.....Q....PEV---ANS.L
Q38A01_TRYB2/1526-1868.............DL.....DDT..............................NRLPYI.....D....PQL---DKQ.L
A1CTM1_ASPCL/1468-1817....................ADSGSSV......................APSLGTVKAV.....D....RDL---ANS.L
A2DAJ9_TRIVA/133-438..........ELLQE.....ND.................................IMMV.....D....EQV---KTL.F
Q7PSA4_ANOGA/2506-2929GSLLGKSGVSDDIMMSSILSEDSDRDRDLLVDSYQSKMAMASDGAWYDGILTQENLQEI.....D....PIR---YQF.L
UPL3_ARATH/1518-1888..........QELDL.....HD.................................IVLF.....D....AEL---GKT.L
C8VT87_EMENI/782-1089TGPQ.......PLTT.....QD.................................LAEY.....R....PVL---ARG.L
Q22F29_TETTS/3359-3651...K.......TLFI.....SD.................................LEDI.....D....PDE---ANN.L
Q4UD92_THEAN/251-554...R.....RNTLD.......D.................................LKLF.....D....SAL---YRN.I
Q580G4_TRYB2/3999-4304...I.......QPTF.....GD.................................LKSV.....D....PEL---YEN.L
A3LSX3_PICST/660-977...DNM..KNSIND.........................................LNYL.....D....HEL---FMG.L
A2DBI7_TRIVA/375-665...T.......QVTI.....ND.................................FEQY.....D....PSI---AQS.F
A0DLU6_PARTE/3989-4284..........KPIVF.....ED.................................LEGI....MD....DVE---FKN.I
HACE1_MOUSE/602-909...I.......PVNY.....QD.................................VASI.....D....PEY---AKN.L
UBE3B_HUMAN/736-1068...HHHSVFYSSVD.......E.................................LPSL.....D....SEF---YKN.L
A4IAG7_LEIIN/1064-1369ARSSPCASTLAALT......NL.................................LEVL.....D....PSL---HRS.F
A7SNF7_NEMVE/430-737...I......PLSHP.....DD.................................LSSF.....D....HEL---HSNQI
A2ERB6_TRIVA/1571-1861..........RKPTI.....RD.................................VKAI.....D....EQI---YDS.L
A3GHK0_PICST/646-950...K.......PVGL.....DD.................................YKQL.....F....PVS---YGN.L
A7AV31_BABBO/1338-1643...PS...MVNNCSL.....SV.................................LSSV.....D....PTL---ARS.L
Q4Q7L2_LEIMA/1091-1400...R.....RN..TL.....SN.................................LKSF.....D....AEL---YHQ.L
A8BYQ3_GIAIC/636-950...Y.......KGVF.....ED.................................LENY.....D....LTI---YKG.L
PUB2_SCHPO/367-671...K.......PLCL.....ED.................................VKDV.....D....EVY---YES.L
Q54KP2_DICDI/1482-1898..........QELNF.....DD.................................LRQL.....A....PTY---ASS.L
A5DS31_LODEL/333-694QAHTTPKQSRKFATL.....SN.................................LHLV.....D....PEL---ARS.L
A2DQ30_TRIVA/383-682...K.......KLIL.....DD.................................LAEI.....D....PAF---VQQ.V
A4HPV4_LEIBR/2168-2551GEAS................RN.................................MSQV.....D....AAL---ELT.L
A4IBF5_LEIIN/1897-2310DVTHIDPPPEYPIDL.....FE.................................LPLTAASWVD....QGI---ADS.L

PF09814

C1FZL9_PARBD/14-464-----------KHNEHN....E---------------------------------LTYR----------LQV...DE...
F6W3S4_MONDO/6-378-----------..........G---------------------------------IHMR----------LLV...QA...
I3ITZ6_ORENI/17-395-----------..........E---------------------------------LHFR----------LRI...S....
N4UQV1_COLOR/12-395-----------..........T---------------------------------ITWR----------LPL...HDSSA
E9EVP5_METRA/11-385-----------..........E---------------------------------LTWR----------LPL...SSEGT
M1WB37_CLAP2/12-387-----------..........Y---------------------------------LTWR----------LPL...SRDAP
E4UYL0_ARTGP/16-474-----------..........E---------------------------------YSFR----------LPI...DE...
A1CJR3_ASPCL/19-423-----------DSHSARQ...E---------------------------------YSFR----------MRI...DS...
C8VJ15_EMENI/28-442-----------TITGTER...E---------------------------------FSYR----------MQV...DD...
H2L971_ORYLA/17-387-----------..........E---------------------------------LHFR----------LRI...T....
G3NNB4_GASAC/18-377-----------..........E---------------------------------LHFR----------LRI...C....
A0A0C4E6U2_MAGP6/10-439-----------AAARDGSRERQ---------------------------------CTWR----------LPL...AP...
S8AD65_DACHA/9-378-----------..........S---------------------------------TTHR----------LPA...SQAFL
N1QJ23_SPHMS/6-366-----------..........R---------------------------------MSFR----------VQL...QQ...
G0WHB4_NAUDC/6-345-----------..........E---------------------------------AAFT----------LRL...KA...
M7PCP3_PNEMU/15-353-----------..........T---------------------------------LSIR----------LPL...SN...
F2SJ85_TRIRC/16-422-----------..........E---------------------------------YSFR----------LPI...DE...
E9CUF8_COCPS/14-449-----------R.........E---------------------------------FSFR----------LQV...DE...
Q6BMI9_DEBHA/5-350-----------..........Y---------------------------------LQLT----------IAL...TP...
G8BQA7_TETPH/7-356-----------...........---------------------------------...T----------LIY...NKEEE
W5LC11_ASTMX/13-384-----------..........G---------------------------------LHIK----------LRL...KV...
E9IFT1_SOLIN/7-367-----------SLSTLNIISNW---------------------------------ICFR----------LQT...AP...
F2UGQ3_SALR5/7-364-----------..........T---------------------------------STFR----------LVL...HP...
W5NKD6_LEPOC/13-376-----------..........G---------------------------------LHIR----------MQL...H....
J4KRH2_BEAB2/17-389-----------..........E---------------------------------VTWR----------FPL...KPARV
R7YJ95_CONA1/9-375-----------..........E---------------------------------LTLR----------LQL...KDTSP
S0DNZ8_GIBF5/11-387-----------..........N---------------------------------LSWR----------LPV...SPTEA
UBE3D_MOUSE/13-363-----------..........G---------------------------------LHLR----------LRV...QA...
J3NIY5_GAGT3/10-440-----------AGAAAG...RQ---------------------------------CAWR----------LPL...PP...
Q59X25_CANAL/5-335-----------...........---------------------------------...G----------LKL...AN...
S7Z7X2_PENO1/19-451-----------PADSGL....E---------------------------------YSLR----------MMI...HP...
N1JPA0_BLUG1/11-394-----------..........E---------------------------------LSWR----------LPL...ID...
A7USM4_ANOGA/14-433-----------TLSSLVIKNRY---------------------------------ICFR----------V..........
L8FLW5_PSED2/12-402-----------..........Q---------------------------------LSWR----------IPL...AA...
K1WUW9_MARBU/11-366-----------..........E---------------------------------LSWR----------LPL...AGQAS
G3JK97_CORMM/17-390-----------..........E---------------------------------LTWR----------LPL...QAARV
M3ZXU8_XIPMA/13-391-----------..........E---------------------------------LHFR----------LRI...M....
A7TPW1_VANPO/6-339-----------..........G---------------------------------LCYS----------SRL...RY...
B4MTF5_DROWI/9-373-----------GISIFTVSGNH---------------------------------LTFR----------F..........
G9NH43_HYPAI/14-392-----------..........D---------------------------------LAWR----------LPV...PATET
H3AB66_LATCH/13-372-----------..........G---------------------------------LHMN----------LEI...HT...
B6QVW6_PENMQ/12-421-----------EPEAQTA...E---------------------------------YSFR----------LQV...DP...
G3Y5B6_ASPNA/22-416-----------..........E---------------------------------YSFR----------MQV...DD...
G2Q453_THIHA/11-366-----------..........S---------------------------------LEWR----------LPL...DAPSL
T5AMN1_OPHSC/15-387-----------..........E---------------------------------LGWR----------LPV...SIAEA
G1TSQ5_RABIT/13-382-----------..........G---------------------------------LHLR----------LQA...WA...
S3CHW0_OPHP1/592-1020-----------PS........Y---------------------------------MIWR----------LPV.....VGL
Q75DV5_ASHGO/6-338-----------..........E---------------------------------GAFE----------VRL...KAVNG
H0ZQP0_TAEGU/10-364-----------..........G---------------------------------LHLR----------VRL...RR...
G0VL18_NAUCC/6-338-----------..........Q---------------------------------GEYL----------LRL...RTLAS
F8PKW0_SERL3/428-814-----------..........N---------------------------------DYYE----------LKL...SVVST
F1Q7U1_DANRE/13-383-----------..........G---------------------------------SHYR----------LRL...K....
A4D9F3_ASPFU/21-419-----------NDSGVRRR..E---------------------------------FSFR----------MQI...DE...
J4G0K5_FIBRA/670-1049-----------..........G---------------------------------QHYE----------IKL...AV...
K0KTK1_WICCF/8-359-----------..........I---------------------------------ISIR----------LPL...ADIKL
U1HL67_ENDPU/9-360-----------..........E---------------------------------MSVR----------LEL...ADIMN
B4JWU6_DROGR/9-392-----------QLSLFNASGCH---------------------------------ITFR----------F..........
J7RHU2_KAZNA/6-349-----------..........Q---------------------------------GTFT----------LRL...RVRSE
C5DRI9_ZYGRC/22-357-----------..........R---------------------------------DEYL----------LTL...KSEDV
N1PZE3_DOTSN/8-375-----------..........D---------------------------------LSFR----------VSL...PN...
B2WD68_PYRTR/65-448-----------..........E---------------------------------LTLR----------LQV...EE...
B3MZV3_DROAN/9-395-----------CISVFVVTGSH---------------------------------ISFR----------F..........
S3DDS5_GLAL2/11-449-----------..........E---------------------------------VSWR----------LPL...ASAPS
G8ZSN1_TORDC/11-349-----------..........P---------------------------------GCYR----------LRL...KSREE
F1NWJ5_CHICK/86-460-----------..........G---------------------------------LHLR----------LQL...RD...
G2Y6Z9_BOTF4/11-390-----------..........E---------------------------------LSWR----------LPL...AG...
E3QET8_COLGM/12-395-----------..........T---------------------------------ISWR----------LPLAVDASATS
H2RRY7_TAKRU/13-391-----------..........E---------------------------------LHFR----------LRI...T....
B4L5I9_DROMO/9-382-----------RISVFIANGCH---------------------------------ISFR----------F..........
I2H589_TETBL/10-368-----------..........P---------------------------------NEYV----------LRL...PI...
Q6CWI5_KLULA/6-348-----------..........G---------------------------------KLFN----------VRL...NE...
C0NUQ4_AJECG/14-503-----------HG........E---------------------------------LLFR----------LPV...DV...
UBE3D_PONAB/13-384-----------..........G---------------------------------LHLR----------LQA...HA...
B4M301_DROVI/9-382-----------RISVFIVNGCH---------------------------------ISFR----------F..........
C5DFR9_LACTC/6-346-----------KGDRDLYKNRS---------------------------------LNFM----------MQV........
V5G5H4_BYSSN/14-443-----------TTSDLTRI..E---------------------------------FSFR----------MQV...DK...
A0A088AUY8_APIME/8-357-----------SLSTLNITKNW---------------------------------ICFR----------AQI...VP...
UBE3D_BOVIN/13-384-----------..........G---------------------------------LHLR----------LHA...RA...
N1QC82_PSEFD/8-371-----------..........D---------------------------------LSFR----------VSL...QE...
E7LWJ6_YEASV/7-341-----------..........D---------------------------------LEWM----------TKL...RS...
K7JNW4_NASVI/31-384-----------SLSSLGITNRW---------------------------------ISFR----------ILT...QP...
B0WGJ1_CULQU/12-439-----------TLSSLLIKNNY---------------------------------ICFR----------I..........
F4X8J5_ACREC/7-368-----------SLSMLNIMNNW---------------------------------ICFR----------LQT...VP...
U4LVT7_PYROM/7-364-----------..........T---------------------------------LSSR----------LPL...AA...
M2R8N7_COCSN/64-445-----------..........E---------------------------------LTLR----------LQM...EE...
Q7SDG7_NEUCR/13-419-----------..........A---------------------------------LSWR----------LPL...GQGTY
H6C728_EXODN/11-372-----------..........E---------------------------------ISAR----------LQI...DDVDQ
E2C3X0_HARSA/7-364-----------SLSMLSIRNNW---------------------------------ICFR----------LQM...MP...
A5DWX9_LODEL/10-362-----------..........G---------------------------------RNLA----------LSL...SV...
Q9VWP0_DROME/9-387-----------CLSTFLVSGRN---------------------------------ISFR----------F..........
H2AW44_KAZAF/6-347-----------..........Q---------------------------------AEFV----------LRL...NAKAA
F7E020_XENTR/11-384-----------..........G---------------------------------LHMR----------LKV...EA...
G1XBI8_ARTOA/9-373-----------..........A---------------------------------QTYR----------LSA...SQTYL
Q16XY0_AEDAE/12-443-----------TLSSLLIKNNY---------------------------------ICFR----------I..........
Q29GF2_DROPS/8-383-----------SLSGFLLSGKN---------------------------------MSFR----------FSF...NR...
G8YFE7_PICSO/19-368-----------...........---------------------------------...S----------LTF...SI...
Q6FK88_CANGA/6-346-----------...........---------------------------------...G----------LNL...DNLYD
U7PMZ7_SPOS1/17-440-----------..........Y---------------------------------VAWR----------LPL...QG...
L9L4K4_TUPCH/13-384-----------..........G---------------------------------LHLR----------LQA...QT...
G2QZ38_THITE/12-401-----------..........T---------------------------------LSWR----------LPL...DASSS
K5W0X4_PHACS/481-860-----------..........G---------------------------------RHFQ----------VKL...AVIPP
R0KID0_SETT2/64-441-----------..........E---------------------------------LTLR----------LQL...EE...

PF00632

Q9BL11_CAEEL/717-1019....KMLLSY.EEDDV.............................EDVF.......GL...NFC.--ISF..........
UBR5_MOUSE/2479-2792....RQLILASQSSDAD..........................AVFSAM.......DL...AFA.--IDL..........
A0EFC1_PARTE/672-969....QYLREQ.TDSNL.............................IQSL.......TL...NFN.--ASY..........
Q54GG5_DICDI/425-720....IKIKTTEED................................VSDW.......SL...YFC.--ATY..........
Q2GSX9_CHAGB/694-1033....LRLK..NYPGN..............................VGDL.......SL...DFT.--ITD..........
Q4WHR7_ASPFU/967-1337....ELLLSWQDGD...............................VGDV.......FMRTYEFT.--..FEVFGAVETVD
Q5KIA2_CRYNJ/1499-1843....ERLQGYYCVRKEIEALPIPASSRR.....TKLAALTVGDAKLADL.......AL...DFT.--LP...........
Q5CW92_CRYPI/1231-1561....NYIKSLENYQE..............................VKNL.......CL...TFS.--.............
A2E5Q8_TRIVA/658-966....ESLKDAINSRISEDE......................FNKQF..........NL...YFV.--.............
A0BRI8_PARTE/1050-1354....YSLYYSKSNAD..............................FEQY........F...LYTI--VNN..........
HUL5_YEAST/607-910....IKLL..NMTTDE.............................IKSL.......DL...TFE.--IDE..........
A7SML1_NEMVE/1229-1585....SQLQGLVRQKHRLEKDSSLTPESL....QLAVENLTLDGASVEDL.......GL...DFV.--LP...........
Q38D88_TRYB2/1472-1912....RSLLSMSSKE...............................LSSL.......DL...PFT.--MP...........
Q6BGB8_PARTE/609-908....CNLK..NQ..D..............................VTDF.......GL...TFS.--ITQ..........
A2FIB4_TRIVA/386-683....SQMREMKEKGEN.............................IEDI.......GL...YFT.--TSY..........
L9KS41_TUPCH/1283-1677....QWMK..DNNITD.............................I..L.......DL...TFT.--VNE..........
A2DAL9_TRIVA/1571-1869....TWIQDTKND................................PADL.......CL...DFT.--VDS..........
A4VDG4_TETTS/3915-4210....NWLL..KNQINA.............................DE.I.......DI...NFA.--YDK..........
A2FLN6_TRIVA/2545-2849....LSIENSSSMSPQDF........................HSTY..........ML...NFT.--.............
A4IBT8_LEIIN/1017-1343....KRLRLLSAAD...............................LEDA.......GL...DFSY--FTH..........
A4IC88_LEIIN/3812-4131LSATHAAAAVADADESGG.........................TET..........ELFEDVF..--.............
F6U235_XENTR/611-908....KELLEY.EGNVE..............................EDM.......MM...TFQ.--ISQ..........
A0D2G1_PARTE/170-483....QYLLNNNSDQL.........................................DL...YFQ.--.............
A4HF82_LEIBR/3619-3949........................................................VLSEGFFAS--LP...........
Q8SS57_ENCCU/454-746....RNLRRLSRDE...............................VDSL.......DL...RFV.--.............
AREL1_MOUSE/512-823....CFIL..NNDMSE................................M.......EL...VFA.--EEK..........
Q4E2E5_TRYCC/2646-2975........................................................ILNDEFFYS--IP...........
A7SQ93_NEMVE/299-612....KELLSY.EGDVE..............................NDL.......CQ...TFQ.--VSF..........
TOM1_YEAST/2962-3268....VWIL..ENDITD.............................I..I.......EE...TFS.--VET..........
Q6C901_YARLI/697-1001....SQLLKF.TESEV.............................ESL........NL...SYN.--VII..........
Q9W0H2_DROME/761-1058....QSLLDY.QGDDF.............................KEVF.......DL...TFE.--ISR..........
A0BRN4_PARTE/3724-4023....EMMLSYDEKT...............................LESL.......GI...NFT.--.............
NEDD4_HUMAN/1013-1318....RWIL..ENDPTE................................L.......DL...RFI.--IDE..........
O17736_CAEEL/692-1001....KALQ..KMNNRE.............................LDEL.......QL...DFS.--VVT..........
A2FPQ0_TRIVA/408-705....MSLKELVAAGED.............................IEDC.......CL...TFS.--VTY..........
A2FR71_TRIVA/373-670....KEMRQMVQEGKD.............................VKDL.......YL...TFE.--ATV..........
Q7PSQ3_ANOGA/541-897....TWIL..ENNIT.........................................GIIDSTFS.--VEN..........
Q247X9_TETTS/2308-2606....QWLLENDIN................................GLDL.......GI...TFS.--.............
A0DNI8_PARTE/201-510....DFLVNNKFEADD.............................ISEF.............FV.--.............
A5K4K7_PLAVS/1441-1991....LYIQ....NTPH.............................VESL.......AL...TFC.--IYERKKPGVRDVR
A2DQ34_TRIVA/412-708....LDMINMRTKKED.............................VSEL.......CL...TFT.--TTI..........
Q5KBV2_CRYNJ/2952-3249....QWML..DNDITG.............................V..I.......DQ...EFT.--IED..........
A2FXS6_TRIVA/392-692....REILLMPENGEN.............................VADL.......CL...TFS.--SVV..........
A4VD17_TETTS/789-1090....KFLKEYKGD................................TKDL.......CL...TFSI--GDQ..........
A2F7U9_TRIVA/2273-2579....AQLRQAEADKDFQRCAVPWK.............IEQWNGQQA..........ML.......--.............
Q9W196_DROME/819-1122....LYLK..DYSGD..............................VSEL.......NL...DFT.--VAS..........
A2DYB1_TRIVA/1674-1977....QWIL..ENDIED.............................AC.L.......DL...NFT.--YNY..........
A2EDQ8_TRIVA/2183-2490....NHIRSVSNDADFAQHYAFQW............KVDDWDGTKV..........SL.......--.............
A4S7N1_OSTLU/131-443....VQIL..EYEGD..............................VADL.......CL...DFT.--CSE..........
A2EM50_TRIVA/2501-2807....TNLEKDSKEKTPQQFQEL................YGNNHNKI...................--.............
Q0UNY9_PHANO/908-1229....GQLLSFEGD................................VADI.......FMREYVFSY--DVF..........
A2EQW9_TRIVA/2209-2511....NSLVTINEHDFNKTYANMK...............WAVTDWDD...................--.............
HUL4_ASHGO/526-839....LKMLEY.DGEDF.............................EDIF.......AL...TFE.--TCF..........
Q7QE66_ANOGA/554-863....LWIR..DNNMDN.............................CGEL.......GL...NFT.--VTE..........
A2E4I7_TRIVA/2634-2943ISLENNIQNITDEKVFSSRFSLFFV...........VKDSLGQERP...................--.............
A5K5J0_PLAVS/8258-8564....IKIA..EYKLED.............................LN.L.......EI...NFS.--TEI..........
Q54QF1_DICDI/778-1120....KLILNTPMNQ...............................VNEIL....GEPL...CFV.--..CDIYNQNELLK
UPL7_ARATH/828-1142....MYVK..HYDGD..............................LKEL.......CL...DFT.--VTE..........
Q8SR14_ENCCU/2104-2410....VWIR..DNPVDK.............................S..L.......GI...TFS.--FDD..........
MUG30_SCHPO/482-807....KELLLF..EGDV.............................KNTY.......GL...NFT.--INL..........
A3FPU7_CRYPI/497-797....LSLLSI.KSDSE.............................MEQL.......CL...TFS.--ATI..........
Q38A01_TRYB2/1526-1868....DSLLKLTANE...............................LEEC.......EL...MFV.--.............
A1CTM1_ASPCL/1468-1817....LLLKRFASVKKTIEGDKSLSKAQK....SQALQNVEVDGVKVEDL.......SL...DFT.--LP...........
A2DAJ9_TRIVA/133-438....DRLRQSKNDLDFTSRFQQKW............TYISWTGEIV..........NL.......--.............
Q7PSA4_ANOGA/2506-2929....RELQELVQQKQAIEQNDALSSEEKLQQISELKLNTKTGCVALEDL.......AL...TFTY--LPSS.........
UPL3_ARATH/1518-1888....QELRVVVARKHYLEGVGGDNSS........TISDLCLRGCRIEDL.......SL...EFT.--LP...........
C8VT87_EMENI/782-1089....RALLEF.EGDVA..............................ETF.......CH...TFV.--ADV..........
Q22F29_TETTS/3359-3651....LWIL..DHDVT...............................D.L.......CL...THS.--IDR..........
Q4UD92_THEAN/251-554....TMLR..GMSESE.............................IEDL.......GL...TFT.--CTT..........
Q580G4_TRYB2/3999-4304....KWLL..VNDVSD................................L.......GL...FFT.--VSC..........
A3LSX3_PICST/660-977....MKLV..KMPEQE.............................LDSL.......DL...NFT.--VNE..........
A2DBI7_TRIVA/375-665....KMLRNIAKSGGD.............................VKDA.......EI...NFV.--.............
A0DLU6_PARTE/3989-4284....KSLRQMTKED...............................IDSL.......CI...TFT.--HSQ..........
HACE1_MOUSE/602-909....QWIL..DNDISD.............................LG.L.......EL...TFS.--VET..........
UBE3B_HUMAN/736-1068....TSIK..RYDGD..............................ITDL.......GL...TLS.--YDE..........
A4IAG7_LEIIN/1064-1369....AQLRRISEAE...............................LAAVGLEMDDGTL.......--.............
A7SNF7_NEMVE/430-737....TWVQ.....ENS.............................VDDL.......GF...TFS.--IDA..........
A2ERB6_TRIVA/1571-1861....MYIKEND..................................VTDL.......CL...TFS.--LSI..........
A3GHK0_PICST/646-950....MKLKKY.STEEL.............................LAL........DL...TFE.--VSY..........
A7AV31_BABBO/1338-1643....GNLLVADD.................................IDSA.......GL...VFT.--.............
Q4Q7L2_LEIMA/1091-1400....MSLT..QLSEEE.............................LEAV.......GL...TFV.--YTV..........
A8BYQ3_GIAIC/636-950....CNLYNYAAQLRE.............................GSNLPSIKDTFCL...TFT.--AL...........
PUB2_SCHPO/367-671....KWIK..NNDVDE.............................S..L.......CL...NFS.--VEE..........
Q54KP2_DICDI/1482-1898....NRLYSLVTSIKQIQARSDLDGAAK....KEEVGKLRVDGAVIEDL.......CL...DFT.--LP...........
A5DS31_LODEL/333-694....EHLQKYIKVYERTPELQKR..............DLRIDDATIEDL.......SL...YFV.--LP...........
A2DQ30_TRIVA/383-682....KTF......DGD.............................WAEW.......GL...SFE.--VSV..........
A4HPV4_LEIBR/2168-2551....HRLEMMDAGS...............................LAAC.......EL...FFT.--IPV..........
A4IBF5_LEIIN/1897-2310....ACLSTMDSST...............................LAAL.......DL...RFT.--LP...........

PF09814

C1FZL9_PARBD/14-464----TSPSVGPRLPDG.....GASF.........VNNGLQVPWTSKDMNS........E.SRIRC..RQC----------
F6W3S4_MONDO/6-378----DLNK.....KLV.....TALNQSLQAQKC...........................YVFHC..QTC----------
I3ITZ6_ORENI/17-395----VERSTDE..DSS.....ASMMKTLRAKKA...........................YCFYC..QGC----------
N4UQV1_COLOR/12-395----PSPRSPPDD..........................PAPWAAPSLVP........L.SAVTC..RRC----------
E9EVP5_METRA/11-385----PFPHFSPETQ.........................AVPWVASDLEH........G.SVIYC..RSC----------
M1WB37_CLAP2/12-387----SHPPFSPENQ.........................AVPWAAPDLEA........G.SAVTC..ERC----------
E4UYL0_ARTGP/16-474----AGTTTHGVSSRD.....YTS...............MSPWPAKSMTS........Q.TCICC..RDC----------
A1CJR3_ASPCL/19-423----EDDALPRTEAVD.....D.................FVPWTAADMGP........S.SKLRC..RRC----------
C8VJ15_EMENI/28-442----TEFVVRDAVEEH.....MDS...............FVPWSAGDMLP........T.TKLRC..VKC----------
H2L971_ORYLA/17-387----VEQSSHK..EAS.....DCVTESLRAKET...........................YCFYC..QGC----------
G3NNB4_GASAC/18-377----VTRSPDE..EAS.....DSAMETLRAKET...........................YCFHC..QGC----------
A0A0C4E6U2_MAGP6/10-439----SAQAPQAAAAAA.....ASPA....ARGV......AVPWEAVRIAP........AVTSVRC..RSC----------
S8AD65_DACHA/9-378----SSTSFDAIADSP.......................PVPWDASTLTA........E.ASIHC..TTC----------
N1QJ23_SPHMS/6-366----ATLADGSQEVES.......................IVPWTAAALNA........D.TELSC..MHC----------
G0WHB4_NAUDC/6-345----SSSRISEANVYS.....................DFQGKWSKNQLLQ.......SSKFKLKC..FNC----------
M7PCP3_PNEMU/15-353----FSIKSLKE...........................ISPWSAVYIDP........N.SDFCC..GFC----------
F2SJ85_TRIRC/16-422----ASSAVDVTSSHD.....YTS...............MSPWPAKNMTA........Q.TCICC..RCC----------
E9CUF8_COCPS/14-449----GNQCFPSRDAST.....P.................QIPWSAKHMSA........E.TRIKC..RAC----------
Q6BMI9_DEBHA/5-350----HDSNDVSEKTES.....FMDFSSSNLVQK.........WSCKDLKTKTPQTDNKNNFKLTC..LKC----------
G8BQA7_TETPH/7-356----ETLCSQEFNEVAHFKLQYSDLSTNKNSISLMNDDLNWKWSKKELLA.......MKNFSFGC..IDC----------
W5LC11_ASTMX/13-384----DEYS.....EAS.....DSVIERLKVQEK...........................YCFQC..QSC----------
E9IFT1_SOLIN/7-367----LESTFGSFSREV.....ITNSNRSIRSST..........YSQPILNDIKLLFETSKCIILC..ACC----------
F2UGQ3_SALR5/7-364----SDTPFHRKPSSV.....STSETRSSQQK............................ACVKC..TTC----------
W5NKD6_LEPOC/13-376----ADQDT....EAP.....PSLIESLKAQKS...........................YCLVC..QSC----------
J4KRH2_BEAB2/17-389----PERQFLPENQ.........................PLPWPASVIKP........G.SPISC..RAC----------
R7YJ95_CONA1/9-375----GRLRSGSFQGSE......................NHVPWSAGALNG........RHVRVYCASKGC----------
S0DNZ8_GIBF5/11-387----RPSRFSLESQ.........................AVPWTSVDIAT........G.SSVAC..RSC----------
UBE3D_MOUSE/13-363----ESSP.....QPI.....SVFNQSLQAQEC...........................CTFYC..QSC----------
J3NIY5_GAGT3/10-440----SRQAP...PQAA.....ASPA....ARGA......AVPWEAVRIAP........AATSVRC..RSC----------
Q59X25_CANAL/5-335----NTVSFGVKIHEK.....RLDSTVPFTDQA......IEKWSCKDLSQ.TPKIGRNHKFIFVC..KNC----------
S7Z7X2_PENO1/19-451----SDVATATPDVVS.....DE................YVPWTAADMTP........L.TRMRC..RGC----------
N1JPA0_BLUG1/11-394----QSSQQARQDTLS.....S.................EAPWSAKALES........R.TELRC..RSC----------
A7USM4_ANOGA/14-433----.NTNESVFGSER.....LSTGQEMPGSDQ........HEENFRLACN...VQPGQRYRVLC..SNC----------
L8FLW5_PSED2/12-402----TPSQQRAAPSL........................PAPWSAGALAN........T.SSFSC..RRC----------
K1WUW9_MARBU/11-366----RASIEDAQSN.........................EAPWSAKDISE........D.AEFAC..REC----------
G3JK97_CORMM/17-390----PERQFLPENQ.........................PLPWSAVDIKP........L.SPVSC..RAC----------
M3ZXU8_XIPMA/13-391----IERSER...EGP.....TSMMETLKAKET...........................YSFHC..QGC----------
A7TPW1_VANPO/6-339----FGDRVNVLSMAM.....................DLEEKWSKKWLLS.......MGHISFSC..IGC----------
B4MTF5_DROWI/9-373----.NYTK..IDMDA.....LEQNTVQVDMQ............PLVMACR.....ENEEFSLIC..HNC----------
G9NH43_HYPAI/14-392----GLPRFSAENQ.........................SVPWSSTDIKA........G.SRVCC..RHC----------
H3AB66_LATCH/13-372----.........DFS.....SVPASYFSIISH...........................GVLCCVFQTC----------
B6QVW6_PENMQ/12-421----ND....TGLTIP.....NQVL....QDDD......YVPWTASDVST........C.VALHC..RFC----------
G3Y5B6_ASPNA/22-416----NDTSLHKDETTL.....NDG...............FIPWTATDMSA........H.TRLRC..VKC----------
G2Q453_THIHA/11-366----PSANQAD............................YTPWSATDLDA........G.SGVDC..RQC----------
T5AMN1_OPHSC/15-387----SALRSAPESQ.........................AVPWSSVDLKT........G.SPIIC..REC----------
G1TSQ5_RABIT/13-382----EFST.....KQI.....SLFNQRSHVQGC...........................CTFHC..QSC----------
S3CHW0_OPHP1/592-1020----PTPARGSSDDE........................LAPWSAPDLQP........R.SKVSC..RAC----------
Q75DV5_ASHGO/6-338----TEGRGADFTMLA......................AEDGWGRKDLAR..........AELRC..AAC----------
H0ZQP0_TAEGU/10-364----PPPAA....DVV.....FALRESLKPNKN...........................YIFYC..QSC----------
G0VL18_NAUCC/6-338----PLEKMNDVMSVP.......................AGKWTKKDLNL.......ENGFELNC..LKC----------
F8PKW0_SERL3/428-814----SRSQSYDDRTSA....PLMDATQLSSLKP...........................TNFIC..TSC----------
F1Q7U1_DANRE/13-383----VEQPT....ESP.....CSVIGQLRVDES...........................YSVLC..QSC----------
A4D9F3_ASPFU/21-419----PDDSLPSKDPLI.....DD................FVPWTAADMSP........S.TRLRC..SGC----------
J4G0K5_FIBRA/670-1049----SSPMVSSDNTLA.....LLDGDRLQTLRP...........................TSYLC..ASC----------
K0KTK1_WICCF/8-359----DRSTNQSMTMST.......................NYKWNSTYLKR......KIGKYSFNC..IKC----------
U1HL67_ENDPU/9-360----MPCVGNTTGD.........................EAPWAANDLSP........N.TQLRC..RDC----------
B4JWU6_DROGR/9-392----.NYTK..IDLIK.....LFKIGSGPKVSH.........LMPLELSF....VEKKDHLTLHC..NKC----------
J7RHU2_KAZNA/6-349----SVNATDSLAPSS......................EKFLWDKTQLNE.......MGAFCFRC..LHC----------
C5DRI9_ZYGRC/22-357----PMDKSRNDVLMM......................PQMKWSKRQLNG.......LKNFKLCC..IQC----------
N1PZE3_DOTSN/8-375----KSHSTGLLTDTS.....LESRN.............VVPWSAPSMTA........D.TAIAC..RGC----------
B2WD68_PYRTR/65-448----.................QEGSDLLGALRRQDRQANIVPWDGASLND.......TKDVEIVC..KSC----------
B3MZV3_DROAN/9-395----.NYSQ..IDLDA.....LDAGSVQVAME............PLLLSCR.....EDDPFALTC..RNC----------
S3DDS5_GLAL2/11-449----SGRVVANLQEN........................ETPWSARDLGE........D.AEFSC..REC----------
G8ZSN1_TORDC/11-349----VVNAFNCNNKAQ................NVFMSLPEGKWSKKELIE.......SKGFRILC..LTC----------
F1NWJ5_CHICK/86-460----APSAP....ELA.....YNVRESLKPQKN...........................YVFYC..QSC----------
G2Y6Z9_BOTF4/11-390----......................DFQRADVDITQTIEAPWSAKDMVP........GEQLFEC..RRC----------
E3QET8_COLGM/12-395----PLTTRSPHDE.........................PVPWTALDLAP........G.SAVAC..RAC----------
H2RRY7_TAKRU/13-391----VSKSMDPVIEAS.....DSAKETLRAKRT...........................YCFYC..QSC----------
B4L5I9_DROMO/9-382----.NYTT..LDVEA.....LENSIAVPMKAQ...........PLVLGFE...EHSEQLVALHC..NNC----------
I2H589_TETBL/10-368----.................NSIEKLKRVNLLEMDDELEGLWSKKQLLS.......LSDFNFCC..IKC----------
Q6CWI5_KLULA/6-348----.................LKSGKTFDRSSNHIMEKLVAKWMRKDLVK........HPFVFYC..LDC----------
C0NUQ4_AJECG/14-503----EAGLPGASQPAN.....GQPG........HGSNEVQVPWTAKDMCA........E.SRVRC..QRC----------
UBE3D_PONAB/13-384----ELGT.....KLI.....SMFNQSLQAQEC...........................CTFYC..QSC----------
B4M301_DROVI/9-382----.NYTT..IDLEA.....LENCVGLPMAPQ...........PLLLSF....AERTQTVSLHC..SNC----------
C5DFR9_LACTC/6-346----..................................VPQRWMKRDLLG........EEFQLRC..KDC----------
V5G5H4_BYSSN/14-443----DEMPGLTKDEFV.....DD................ITPWMAEDMST........S.TLVRC..RTC----------
A0A088AUY8_APIME/8-357----.DPILGSSKTQV.....ITNSTINNNSLK..............NSVKNTELFNANKCNIMC..SCC----------
UBE3D_BOVIN/13-384----ESRP.....ELI.....SVFNQSSQDQEC...........................CTFYC..QSC----------
N1QC82_PSEFD/8-371----NPESNGLLTNTA.....IDSEN.............VVPWAADALTA........D.TEIRC..VHC----------
E7LWJ6_YEASV/7-341----KSSKIYDSSIMS.....................LPDGRWTKEELRS.......DSDFSIEC..LNC----------
K7JNW4_NASVI/31-384----.NSLYGTFETEI.....INTENSLTSSFS.............SYSNKVEFPPKNTACKFYC..KCC----------
B0WGJ1_CULQU/12-439----.NTNENKFHSEV.....LEINEYNACTDL.............KLECR...LEKGVNYTVTC..SNC----------
F4X8J5_ACREC/7-368----LESTFGSFSTEV.....MTNLNKLVQSNT..........HSQSIVNDIKLLFETSKCTILC..TCC----------
U4LVT7_PYROM/7-364----.PSTTASYDNEN.......................YAPWSALQLSS.......KESVSYCC..RAC----------
M2R8N7_COCSN/64-445----.................KEGSDLLGALQRQDRQANIVPWDGASLNG.......AEDAEILC..KRC----------
Q7SDG7_NEUCR/13-419----TDASSAE............................SSTWTATDLKA........G.SEVVC..RQC----------
H6C728_EXODN/11-372----LKPADDDAGSI........................EVPWSAGDLTT........N.TSVRC..KSC----------
E2C3X0_HARSA/7-364----LNSVFGSFSVEV.....LTDSNKSAQLTC...........SQPILEDIKLLFKASECIVLC..ACC----------
A5DWX9_LODEL/10-362----QTIEKCDENEKA.....SNEIV.............DDLWSCKWLKSETPTIDKKNVFQFVC..FKC----------
Q9VWP0_DROME/9-387----.NYNQ..IDLAS.....VDGSAVDVPLA............PLLLSCQ.....ENEPITINC..RDC----------
H2AW44_KAZAF/6-347----DYTDKYDALIAS......................SVEKWSKKDLLQ.......YSGFSLRC..KKC----------
F7E020_XENTR/11-384----ANDT.....DMP.....LLLKEILKTQKS...........................YTFYC..QSC----------
G1XBI8_ARTOA/9-373----GSDEYESLSGPV.......................QDPWDASSVSP........E.CSLRC..IAC----------
Q16XY0_AEDAE/12-443----.NTNENKFHSEV.....LEINEYNACTDL.............KLECG...LQAGKGYRLMC..SNC----------
Q29GF2_DROPS/8-383----.......IAVAV.....LDKRTVRVPMQ............PLLLSCC.....ENESLAIQC..VGC----------
G8YFE7_PICSO/19-368----HTINGTQKVDES.....TMSFMDGIYNSG......TQRWSCKDLQQKTPKRGNKNDFKFCC..IKC----------
Q6FK88_CANGA/6-346----EKNGHIHLSETSCGYVRLKRKTQALTNRISLVDLPDDKWNIERFKK.......MQGFQIAC..NNC----------
U7PMZ7_SPOS1/17-440----PTTQNGQTDDTD.......................LAPWSAPDLSL........G.SSVCC..RGC----------
L9L4K4_TUPCH/13-384----EFST.....KPI.....SVFNQNSQAGGR...........................CTFYC..QSC----------
G2QZ38_THITE/12-401----PSPSRQGD...........................DVPWSATDLVP........G.SVVSC..RAC----------
K5W0X4_PHACS/481-860----ASPQSQAFDTDA.....ELDATHFQHIQP...........................TSFIC..ASC----------
R0KID0_SETT2/64-441----.................KEGSDLLGALGREDRQANVVPWDGASLND.......AKDVEVVC..KNC----------

PF00632

Q9BL11_CAEEL/717-1019................................................................................
UBR5_MOUSE/2479-2792................................................................................
A0EFC1_PARTE/672-969................................................................................
Q54GG5_DICDI/425-720................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q4WHR7_ASPFU/967-1337MEKVGRDAVWPLRARDRSK.............................................................
Q5KIA2_CRYNJ/1499-1843................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
HUL5_YEAST/607-910................................................................................
A7SML1_NEMVE/1229-1585................................................................................
Q38D88_TRYB2/1472-1912................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FIB4_TRIVA/386-683................................................................................
L9KS41_TUPCH/1283-1677................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A4VDG4_TETTS/3915-4210................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A4IC88_LEIIN/3812-4131................................................................................
F6U235_XENTR/611-908................................................................................
A0D2G1_PARTE/170-483................................................................................
A4HF82_LEIBR/3619-3949................................................................................
Q8SS57_ENCCU/454-746................................................................................
AREL1_MOUSE/512-823................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A7SQ93_NEMVE/299-612................................................................................
TOM1_YEAST/2962-3268................................................................................
Q6C901_YARLI/697-1001................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
NEDD4_HUMAN/1013-1318................................................................................
O17736_CAEEL/692-1001................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2FR71_TRIVA/373-670................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q247X9_TETTS/2308-2606................................................................................
A0DNI8_PARTE/201-510................................................................................
A5K4K7_PLAVS/1441-1991KYEDIISYFQALGRKLSGGSGSMGGSGGVGGSGGVGGARWVGGSGGISGMGGTGWVGGTGWVGGSGGMGNARAIRGNVVR
A2DQ34_TRIVA/412-708................................................................................
Q5KBV2_CRYNJ/2952-3249................................................................................
A2FXS6_TRIVA/392-692................................................................................
A4VD17_TETTS/789-1090................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
Q9W196_DROME/819-1122................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2EM50_TRIVA/2501-2807................................................................................
Q0UNY9_PHANO/908-1229................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
HUL4_ASHGO/526-839................................................................................
Q7QE66_ANOGA/554-863................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
Q54QF1_DICDI/778-1120RSLNNN..........................................................................
UPL7_ARATH/828-1142................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
MUG30_SCHPO/482-807................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
UPL3_ARATH/1518-1888................................................................................
C8VT87_EMENI/782-1089................................................................................
Q22F29_TETTS/3359-3651................................................................................
Q4UD92_THEAN/251-554................................................................................
Q580G4_TRYB2/3999-4304................................................................................
A3LSX3_PICST/660-977................................................................................
A2DBI7_TRIVA/375-665................................................................................
A0DLU6_PARTE/3989-4284................................................................................
HACE1_MOUSE/602-909................................................................................
UBE3B_HUMAN/736-1068................................................................................
A4IAG7_LEIIN/1064-1369................................................................................
A7SNF7_NEMVE/430-737................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
A3GHK0_PICST/646-950................................................................................
A7AV31_BABBO/1338-1643................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4IBF5_LEIIN/1897-2310................................................................................

PF09814

C1FZL9_PARBD/14-464--------------------------------------------------------------------------------
F6W3S4_MONDO/6-378--------------------------------------------------------------------------------
I3ITZ6_ORENI/17-395--------------------------------------------------------------------------------
N4UQV1_COLOR/12-395--------------------------------------------------------------------------------
E9EVP5_METRA/11-385--------------------------------------------------------------------------------
M1WB37_CLAP2/12-387--------------------------------------------------------------------------------
E4UYL0_ARTGP/16-474--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-423--------------------------------------------------------------------------------
C8VJ15_EMENI/28-442--------------------------------------------------------------------------------
H2L971_ORYLA/17-387--------------------------------------------------------------------------------
G3NNB4_GASAC/18-377--------------------------------------------------------------------------------
A0A0C4E6U2_MAGP6/10-439--------------------------------------------------------------------------------
S8AD65_DACHA/9-378--------------------------------------------------------------------------------
N1QJ23_SPHMS/6-366--------------------------------------------------------------------------------
G0WHB4_NAUDC/6-345--------------------------------------------------------------------------------
M7PCP3_PNEMU/15-353--------------------------------------------------------------------------------
F2SJ85_TRIRC/16-422--------------------------------------------------------------------------------
E9CUF8_COCPS/14-449--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-350--------------------------------------------------------------------------------
G8BQA7_TETPH/7-356--------------------------------------------------------------------------------
W5LC11_ASTMX/13-384--------------------------------------------------------------------------------
E9IFT1_SOLIN/7-367--------------------------------------------------------------------------------
F2UGQ3_SALR5/7-364--------------------------------------------------------------------------------
W5NKD6_LEPOC/13-376--------------------------------------------------------------------------------
J4KRH2_BEAB2/17-389--------------------------------------------------------------------------------
R7YJ95_CONA1/9-375--------------------------------------------------------------------------------
S0DNZ8_GIBF5/11-387--------------------------------------------------------------------------------
UBE3D_MOUSE/13-363--------------------------------------------------------------------------------
J3NIY5_GAGT3/10-440--------------------------------------------------------------------------------
Q59X25_CANAL/5-335--------------------------------------------------------------------------------
S7Z7X2_PENO1/19-451--------------------------------------------------------------------------------
N1JPA0_BLUG1/11-394--------------------------------------------------------------------------------
A7USM4_ANOGA/14-433--------------------------------------------------------------------------------
L8FLW5_PSED2/12-402--------------------------------------------------------------------------------
K1WUW9_MARBU/11-366--------------------------------------------------------------------------------
G3JK97_CORMM/17-390--------------------------------------------------------------------------------
M3ZXU8_XIPMA/13-391--------------------------------------------------------------------------------
A7TPW1_VANPO/6-339--------------------------------------------------------------------------------
B4MTF5_DROWI/9-373--------------------------------------------------------------------------------
G9NH43_HYPAI/14-392--------------------------------------------------------------------------------
H3AB66_LATCH/13-372--------------------------------------------------------------------------------
B6QVW6_PENMQ/12-421--------------------------------------------------------------------------------
G3Y5B6_ASPNA/22-416--------------------------------------------------------------------------------
G2Q453_THIHA/11-366--------------------------------------------------------------------------------
T5AMN1_OPHSC/15-387--------------------------------------------------------------------------------
G1TSQ5_RABIT/13-382--------------------------------------------------------------------------------
S3CHW0_OPHP1/592-1020--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-338--------------------------------------------------------------------------------
H0ZQP0_TAEGU/10-364--------------------------------------------------------------------------------
G0VL18_NAUCC/6-338--------------------------------------------------------------------------------
F8PKW0_SERL3/428-814--------------------------------------------------------------------------------
F1Q7U1_DANRE/13-383--------------------------------------------------------------------------------
A4D9F3_ASPFU/21-419--------------------------------------------------------------------------------
J4G0K5_FIBRA/670-1049--------------------------------------------------------------------------------
K0KTK1_WICCF/8-359--------------------------------------------------------------------------------
U1HL67_ENDPU/9-360--------------------------------------------------------------------------------
B4JWU6_DROGR/9-392--------------------------------------------------------------------------------
J7RHU2_KAZNA/6-349--------------------------------------------------------------------------------
C5DRI9_ZYGRC/22-357--------------------------------------------------------------------------------
N1PZE3_DOTSN/8-375--------------------------------------------------------------------------------
B2WD68_PYRTR/65-448--------------------------------------------------------------------------------
B3MZV3_DROAN/9-395--------------------------------------------------------------------------------
S3DDS5_GLAL2/11-449--------------------------------------------------------------------------------
G8ZSN1_TORDC/11-349--------------------------------------------------------------------------------
F1NWJ5_CHICK/86-460--------------------------------------------------------------------------------
G2Y6Z9_BOTF4/11-390--------------------------------------------------------------------------------
E3QET8_COLGM/12-395--------------------------------------------------------------------------------
H2RRY7_TAKRU/13-391--------------------------------------------------------------------------------
B4L5I9_DROMO/9-382--------------------------------------------------------------------------------
I2H589_TETBL/10-368--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-348--------------------------------------------------------------------------------
C0NUQ4_AJECG/14-503--------------------------------------------------------------------------------
UBE3D_PONAB/13-384--------------------------------------------------------------------------------
B4M301_DROVI/9-382--------------------------------------------------------------------------------
C5DFR9_LACTC/6-346--------------------------------------------------------------------------------
V5G5H4_BYSSN/14-443--------------------------------------------------------------------------------
A0A088AUY8_APIME/8-357--------------------------------------------------------------------------------
UBE3D_BOVIN/13-384--------------------------------------------------------------------------------
N1QC82_PSEFD/8-371--------------------------------------------------------------------------------
E7LWJ6_YEASV/7-341--------------------------------------------------------------------------------
K7JNW4_NASVI/31-384--------------------------------------------------------------------------------
B0WGJ1_CULQU/12-439--------------------------------------------------------------------------------
F4X8J5_ACREC/7-368--------------------------------------------------------------------------------
U4LVT7_PYROM/7-364--------------------------------------------------------------------------------
M2R8N7_COCSN/64-445--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-419--------------------------------------------------------------------------------
H6C728_EXODN/11-372--------------------------------------------------------------------------------
E2C3X0_HARSA/7-364--------------------------------------------------------------------------------
A5DWX9_LODEL/10-362--------------------------------------------------------------------------------
Q9VWP0_DROME/9-387--------------------------------------------------------------------------------
H2AW44_KAZAF/6-347--------------------------------------------------------------------------------
F7E020_XENTR/11-384--------------------------------------------------------------------------------
G1XBI8_ARTOA/9-373--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-443--------------------------------------------------------------------------------
Q29GF2_DROPS/8-383--------------------------------------------------------------------------------
G8YFE7_PICSO/19-368--------------------------------------------------------------------------------
Q6FK88_CANGA/6-346--------------------------------------------------------------------------------
U7PMZ7_SPOS1/17-440--------------------------------------------------------------------------------
L9L4K4_TUPCH/13-384--------------------------------------------------------------------------------
G2QZ38_THITE/12-401--------------------------------------------------------------------------------
K5W0X4_PHACS/481-860--------------------------------------------------------------------------------
R0KID0_SETT2/64-441--------------------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019................................................................................
UBR5_MOUSE/2479-2792................................................................................
A0EFC1_PARTE/672-969................................................................................
Q54GG5_DICDI/425-720................................................................................
Q2GSX9_CHAGB/694-1033................................................................................
Q4WHR7_ASPFU/967-1337................................................................................
Q5KIA2_CRYNJ/1499-1843................................................................................
Q5CW92_CRYPI/1231-1561................................................................................
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354................................................................................
HUL5_YEAST/607-910................................................................................
A7SML1_NEMVE/1229-1585................................................................................
Q38D88_TRYB2/1472-1912................................................................................
Q6BGB8_PARTE/609-908................................................................................
A2FIB4_TRIVA/386-683................................................................................
L9KS41_TUPCH/1283-1677................................................................................
A2DAL9_TRIVA/1571-1869................................................................................
A4VDG4_TETTS/3915-4210................................................................................
A2FLN6_TRIVA/2545-2849................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A4IC88_LEIIN/3812-4131................................................................................
F6U235_XENTR/611-908................................................................................
A0D2G1_PARTE/170-483................................................................................
A4HF82_LEIBR/3619-3949................................................................................
Q8SS57_ENCCU/454-746................................................................................
AREL1_MOUSE/512-823................................................................................
Q4E2E5_TRYCC/2646-2975................................................................................
A7SQ93_NEMVE/299-612................................................................................
TOM1_YEAST/2962-3268................................................................................
Q6C901_YARLI/697-1001................................................................................
Q9W0H2_DROME/761-1058................................................................................
A0BRN4_PARTE/3724-4023................................................................................
NEDD4_HUMAN/1013-1318................................................................................
O17736_CAEEL/692-1001................................................................................
A2FPQ0_TRIVA/408-705................................................................................
A2FR71_TRIVA/373-670................................................................................
Q7PSQ3_ANOGA/541-897................................................................................
Q247X9_TETTS/2308-2606................................................................................
A0DNI8_PARTE/201-510................................................................................
A5K4K7_PLAVS/1441-1991RVFAQSRGAAPDAENANNINSFFNIIDNLDALIHTLDRNLSSLSPGPLEEHVPEVNATERYRGATYHLDAPLVQLLLRHN
A2DQ34_TRIVA/412-708................................................................................
Q5KBV2_CRYNJ/2952-3249................................................................................
A2FXS6_TRIVA/392-692................................................................................
A4VD17_TETTS/789-1090................................................................................
A2F7U9_TRIVA/2273-2579................................................................................
Q9W196_DROME/819-1122................................................................................
A2DYB1_TRIVA/1674-1977................................................................................
A2EDQ8_TRIVA/2183-2490................................................................................
A4S7N1_OSTLU/131-443................................................................................
A2EM50_TRIVA/2501-2807................................................................................
Q0UNY9_PHANO/908-1229................................................................................
A2EQW9_TRIVA/2209-2511................................................................................
HUL4_ASHGO/526-839................................................................................
Q7QE66_ANOGA/554-863................................................................................
A2E4I7_TRIVA/2634-2943................................................................................
A5K5J0_PLAVS/8258-8564................................................................................
Q54QF1_DICDI/778-1120................................................................................
UPL7_ARATH/828-1142................................................................................
Q8SR14_ENCCU/2104-2410................................................................................
MUG30_SCHPO/482-807................................................................................
A3FPU7_CRYPI/497-797................................................................................
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817................................................................................
A2DAJ9_TRIVA/133-438................................................................................
Q7PSA4_ANOGA/2506-2929................................................................................
UPL3_ARATH/1518-1888................................................................................
C8VT87_EMENI/782-1089................................................................................
Q22F29_TETTS/3359-3651................................................................................
Q4UD92_THEAN/251-554................................................................................
Q580G4_TRYB2/3999-4304................................................................................
A3LSX3_PICST/660-977................................................................................
A2DBI7_TRIVA/375-665................................................................................
A0DLU6_PARTE/3989-4284................................................................................
HACE1_MOUSE/602-909................................................................................
UBE3B_HUMAN/736-1068................................................................................
A4IAG7_LEIIN/1064-1369................................................................................
A7SNF7_NEMVE/430-737................................................................................
A2ERB6_TRIVA/1571-1861................................................................................
A3GHK0_PICST/646-950................................................................................
A7AV31_BABBO/1338-1643................................................................................
Q4Q7L2_LEIMA/1091-1400................................................................................
A8BYQ3_GIAIC/636-950................................................................................
PUB2_SCHPO/367-671................................................................................
Q54KP2_DICDI/1482-1898................................................................................
A5DS31_LODEL/333-694................................................................................
A2DQ30_TRIVA/383-682................................................................................
A4HPV4_LEIBR/2168-2551................................................................................
A4IBF5_LEIIN/1897-2310................................................................................

PF09814

C1FZL9_PARBD/14-464--------------------------------------------------------------------------------
F6W3S4_MONDO/6-378--------------------------------------------------------------------------------
I3ITZ6_ORENI/17-395--------------------------------------------------------------------------------
N4UQV1_COLOR/12-395--------------------------------------------------------------------------------
E9EVP5_METRA/11-385--------------------------------------------------------------------------------
M1WB37_CLAP2/12-387--------------------------------------------------------------------------------
E4UYL0_ARTGP/16-474--------------------------------------------------------------------------------
A1CJR3_ASPCL/19-423--------------------------------------------------------------------------------
C8VJ15_EMENI/28-442--------------------------------------------------------------------------------
H2L971_ORYLA/17-387--------------------------------------------------------------------------------
G3NNB4_GASAC/18-377--------------------------------------------------------------------------------
A0A0C4E6U2_MAGP6/10-439--------------------------------------------------------------------------------
S8AD65_DACHA/9-378--------------------------------------------------------------------------------
N1QJ23_SPHMS/6-366--------------------------------------------------------------------------------
G0WHB4_NAUDC/6-345--------------------------------------------------------------------------------
M7PCP3_PNEMU/15-353--------------------------------------------------------------------------------
F2SJ85_TRIRC/16-422--------------------------------------------------------------------------------
E9CUF8_COCPS/14-449--------------------------------------------------------------------------------
Q6BMI9_DEBHA/5-350--------------------------------------------------------------------------------
G8BQA7_TETPH/7-356--------------------------------------------------------------------------------
W5LC11_ASTMX/13-384--------------------------------------------------------------------------------
E9IFT1_SOLIN/7-367--------------------------------------------------------------------------------
F2UGQ3_SALR5/7-364--------------------------------------------------------------------------------
W5NKD6_LEPOC/13-376--------------------------------------------------------------------------------
J4KRH2_BEAB2/17-389--------------------------------------------------------------------------------
R7YJ95_CONA1/9-375--------------------------------------------------------------------------------
S0DNZ8_GIBF5/11-387--------------------------------------------------------------------------------
UBE3D_MOUSE/13-363--------------------------------------------------------------------------------
J3NIY5_GAGT3/10-440--------------------------------------------------------------------------------
Q59X25_CANAL/5-335--------------------------------------------------------------------------------
S7Z7X2_PENO1/19-451--------------------------------------------------------------------------------
N1JPA0_BLUG1/11-394--------------------------------------------------------------------------------
A7USM4_ANOGA/14-433--------------------------------------------------------------------------------
L8FLW5_PSED2/12-402--------------------------------------------------------------------------------
K1WUW9_MARBU/11-366--------------------------------------------------------------------------------
G3JK97_CORMM/17-390--------------------------------------------------------------------------------
M3ZXU8_XIPMA/13-391--------------------------------------------------------------------------------
A7TPW1_VANPO/6-339--------------------------------------------------------------------------------
B4MTF5_DROWI/9-373--------------------------------------------------------------------------------
G9NH43_HYPAI/14-392--------------------------------------------------------------------------------
H3AB66_LATCH/13-372--------------------------------------------------------------------------------
B6QVW6_PENMQ/12-421--------------------------------------------------------------------------------
G3Y5B6_ASPNA/22-416--------------------------------------------------------------------------------
G2Q453_THIHA/11-366--------------------------------------------------------------------------------
T5AMN1_OPHSC/15-387--------------------------------------------------------------------------------
G1TSQ5_RABIT/13-382--------------------------------------------------------------------------------
S3CHW0_OPHP1/592-1020--------------------------------------------------------------------------------
Q75DV5_ASHGO/6-338--------------------------------------------------------------------------------
H0ZQP0_TAEGU/10-364--------------------------------------------------------------------------------
G0VL18_NAUCC/6-338--------------------------------------------------------------------------------
F8PKW0_SERL3/428-814--------------------------------------------------------------------------------
F1Q7U1_DANRE/13-383--------------------------------------------------------------------------------
A4D9F3_ASPFU/21-419--------------------------------------------------------------------------------
J4G0K5_FIBRA/670-1049--------------------------------------------------------------------------------
K0KTK1_WICCF/8-359--------------------------------------------------------------------------------
U1HL67_ENDPU/9-360--------------------------------------------------------------------------------
B4JWU6_DROGR/9-392--------------------------------------------------------------------------------
J7RHU2_KAZNA/6-349--------------------------------------------------------------------------------
C5DRI9_ZYGRC/22-357--------------------------------------------------------------------------------
N1PZE3_DOTSN/8-375--------------------------------------------------------------------------------
B2WD68_PYRTR/65-448--------------------------------------------------------------------------------
B3MZV3_DROAN/9-395--------------------------------------------------------------------------------
S3DDS5_GLAL2/11-449--------------------------------------------------------------------------------
G8ZSN1_TORDC/11-349--------------------------------------------------------------------------------
F1NWJ5_CHICK/86-460--------------------------------------------------------------------------------
G2Y6Z9_BOTF4/11-390--------------------------------------------------------------------------------
E3QET8_COLGM/12-395--------------------------------------------------------------------------------
H2RRY7_TAKRU/13-391--------------------------------------------------------------------------------
B4L5I9_DROMO/9-382--------------------------------------------------------------------------------
I2H589_TETBL/10-368--------------------------------------------------------------------------------
Q6CWI5_KLULA/6-348--------------------------------------------------------------------------------
C0NUQ4_AJECG/14-503--------------------------------------------------------------------------------
UBE3D_PONAB/13-384--------------------------------------------------------------------------------
B4M301_DROVI/9-382--------------------------------------------------------------------------------
C5DFR9_LACTC/6-346--------------------------------------------------------------------------------
V5G5H4_BYSSN/14-443--------------------------------------------------------------------------------
A0A088AUY8_APIME/8-357--------------------------------------------------------------------------------
UBE3D_BOVIN/13-384--------------------------------------------------------------------------------
N1QC82_PSEFD/8-371--------------------------------------------------------------------------------
E7LWJ6_YEASV/7-341--------------------------------------------------------------------------------
K7JNW4_NASVI/31-384--------------------------------------------------------------------------------
B0WGJ1_CULQU/12-439--------------------------------------------------------------------------------
F4X8J5_ACREC/7-368--------------------------------------------------------------------------------
U4LVT7_PYROM/7-364--------------------------------------------------------------------------------
M2R8N7_COCSN/64-445--------------------------------------------------------------------------------
Q7SDG7_NEUCR/13-419--------------------------------------------------------------------------------
H6C728_EXODN/11-372--------------------------------------------------------------------------------
E2C3X0_HARSA/7-364--------------------------------------------------------------------------------
A5DWX9_LODEL/10-362--------------------------------------------------------------------------------
Q9VWP0_DROME/9-387--------------------------------------------------------------------------------
H2AW44_KAZAF/6-347--------------------------------------------------------------------------------
F7E020_XENTR/11-384--------------------------------------------------------------------------------
G1XBI8_ARTOA/9-373--------------------------------------------------------------------------------
Q16XY0_AEDAE/12-443--------------------------------------------------------------------------------
Q29GF2_DROPS/8-383--------------------------------------------------------------------------------
G8YFE7_PICSO/19-368--------------------------------------------------------------------------------
Q6FK88_CANGA/6-346--------------------------------------------------------------------------------
U7PMZ7_SPOS1/17-440--------------------------------------------------------------------------------
L9L4K4_TUPCH/13-384--------------------------------------------------------------------------------
G2QZ38_THITE/12-401--------------------------------------------------------------------------------
K5W0X4_PHACS/481-860--------------------------------------------------------------------------------
R0KID0_SETT2/64-441--------------------------------------------------------------------------------

PF00632

Q9BL11_CAEEL/717-1019.........................................................................N.IL..G
UBR5_MOUSE/2479-2792.........................................................................CKEEGGG
A0EFC1_PARTE/672-969.........................................................................V.VW..G
Q54GG5_DICDI/425-720.........................................................................ESIY..G
Q2GSX9_CHAGB/694-1033.........................................................................Q......
Q4WHR7_ASPFU/967-1337...........................................SSELATNWSELSQHADPADLSPPCSMSADHVDFLECG
Q5KIA2_CRYNJ/1499-1843...............................................................................G
Q5CW92_CRYPI/1231-1561.........................................................................L.TLDLG
A2E5Q8_TRIVA/658-966................................................................................
A0BRI8_PARTE/1050-1354...............................................................................G
HUL5_YEAST/607-910.........................................................................P..E..S
A7SML1_NEMVE/1229-1585...............................................................................G
Q38D88_TRYB2/1472-1912...............................................................................G
Q6BGB8_PARTE/609-908.........................................................................E.FY..G
A2FIB4_TRIVA/386-683.........................................................................E.AY..G
L9KS41_TUPCH/1283-1677.........................................................................E.VF..G
A2DAL9_TRIVA/1571-1869...............................................................................G
A4VDG4_TETTS/3915-4210.........................................................................F.YA..G
A2FLN6_TRIVA/2545-2849................................................................................
A4IBT8_LEIIN/1017-1343................................................................................
A4IC88_LEIIN/3812-4131...............................................................................G
F6U235_XENTR/611-908.........................................................................TDLF..G
A0D2G1_PARTE/170-483................................................................................
A4HF82_LEIBR/3619-3949................................................................................
Q8SS57_ENCCU/454-746................................................................................
AREL1_MOUSE/512-823.........................................................................YNKS..G
Q4E2E5_TRYCC/2646-2975................................................................................
A7SQ93_NEMVE/299-612.........................................................................T.SY..G
TOM1_YEAST/2962-3268.........................................................................D.DY..G
Q6C901_YARLI/697-1001.........................................................................D..S.EG
Q9W0H2_DROME/761-1058.........................................................................D.VF..G
A0BRN4_PARTE/3724-4023................................................................................
NEDD4_HUMAN/1013-1318.........................................................................E.LF..G
O17736_CAEEL/692-1001.........................................................................S.DM..G
A2FPQ0_TRIVA/408-705.........................................................................N.KF..D
A2FR71_TRIVA/373-670.........................................................................T.MF..G
Q7PSQ3_ANOGA/541-897.........................................................................N.SF..G
Q247X9_TETTS/2308-2606.........................................................................YISYSNG
A0DNI8_PARTE/201-510................................................................................
A5K4K7_PLAVS/1441-1991EVDLDPAPNGVLLGEDGEVLRYPLRSGDFDSEEGPEAARGGDPPEGGRGSLAVASIDHPDAANRDNIAAANRDN.LA..G
A2DQ34_TRIVA/412-708.........................................................................E.QF..G
Q5KBV2_CRYNJ/2952-3249.........................................................................D.QF..G
A2FXS6_TRIVA/392-692.........................................................................D.IF..G
A4VD17_TETTS/789-1090...............................................................................N
A2F7U9_TRIVA/2273-2579................................................................................
Q9W196_DROME/819-1122.........................................................................S.SL..G
A2DYB1_TRIVA/1674-1977.........................................................................D.YL..G
A2EDQ8_TRIVA/2183-2490................................................................................
A4S7N1_OSTLU/131-443.........................................................................E.IY..G
A2EM50_TRIVA/2501-2807................................................................................
Q0UNY9_PHANO/908-1229...............................................................................G
A2EQW9_TRIVA/2209-2511................................................................................
HUL4_ASHGO/526-839.........................................................................PDRFDES
Q7QE66_ANOGA/554-863.........................................................................ERSD..G
A2E4I7_TRIVA/2634-2943................................................................................
A5K5J0_PLAVS/8258-8564.........................................................................D.EF..G
Q54QF1_DICDI/778-1120........................................................NNNDEDNNKIENNNNNNNSEFKIQ
UPL7_ARATH/828-1142.........................................................................E.FC..G
Q8SR14_ENCCU/2104-2410.........................................................................V.SF..G
MUG30_SCHPO/482-807.........................................................................K.AV..E
A3FPU7_CRYPI/497-797.........................................................................N.NF..G
Q38A01_TRYB2/1526-1868................................................................................
A1CTM1_ASPCL/1468-1817...............................................................................G
A2DAJ9_TRIVA/133-438................................................................................
Q7PSA4_ANOGA/2506-2929.......................................................................RNY.....G
UPL3_ARATH/1518-1888...............................................................................G
C8VT87_EMENI/782-1089.........................................................................D.RY..G
Q22F29_TETTS/3359-3651.........................................................................V.VL..G
Q4UD92_THEAN/251-554.........................................................................Q.CF..G
Q580G4_TRYB2/3999-4304.........................................................................E.KF..G
A3LSX3_PICST/660-977.........................................................................T.LK..G
A2DBI7_TRIVA/375-665............................................................................FTKS
A0DLU6_PARTE/3989-4284...............................................................................G
HACE1_MOUSE/602-909.........................................................................D.VF..G
UBE3B_HUMAN/736-1068.........................................................................D.VM..G
A4IAG7_LEIIN/1064-1369................................................................................
A7SNF7_NEMVE/430-737.........................................................................TNPW.TG
A2ERB6_TRIVA/1571-1861...............................................................................D
A3GHK0_PICST/646-950.........................................................................QDLF..G
A7AV31_BABBO/1338-1643................................................................................
Q4Q7L2_LEIMA/1091-1400.........................................................................N.AL..G
A8BYQ3_GIAIC/636-950...............................................................................G
PUB2_SCHPO/367-671.........................................................................N.RF..G
Q54KP2_DICDI/1482-1898...............................................................................G
A5DS31_LODEL/333-694...............................................................................G
A2DQ30_TRIVA/383-682.........................................................................QDID..G
A4HPV4_LEIBR/2168-2551...............................................................................S
A4IBF5_LEIIN/1897-2310...............................................................................G

PF09814

C1FZL9_PARBD/14-464-------------------------------------------------------------------------------K
F6W3S4_MONDO/6-378-------------------------------------------------------------------------------G
I3ITZ6_ORENI/17-395-------------------------------------------------------------------------------M
N4UQV1_COLOR/12-395-------------------------------------------------------------------------------E
E9EVP5_METRA/11-385-------------------------------------------------------------------------------N
M1WB37_CLAP2/12-387-------------------------------------------------------------------------------H
E4UYL0_ARTGP/16-474-------------------------------------------------------------------------------L
A1CJR3_ASPCL/19-423-------------------------------------------------------------------------------A
C8VJ15_EMENI/28-442-------------------------------------------------------------------------------E
H2L971_ORYLA/17-387-------------------------------------------------------------------------------M
G3NNB4_GASAC/18-377-------------------------------------------------------------------------------M
A0A0C4E6U2_MAGP6/10-439-------------------------------------------------------------------------------R
S8AD65_DACHA/9-378-------------------------------------------------------------------------------T
N1QJ23_SPHMS/6-366-------------------------------------------------------------------------------Q
G0WHB4_NAUDC/6-345-------------------------------------------------------------------------------N
M7PCP3_PNEMU/15-353-------------------------------------------------------------------------------L
F2SJ85_TRIRC/16-422-------------------------------------------------------------------------------A
E9CUF8_COCPS/14-449-------------------------------------------------------------------------------G
Q6BMI9_DEBHA/5-350-------------------------------------------------------------------------------S
G8BQA7_TETPH/7-356-------------------------------------------------------------------------------G
W5LC11_ASTMX/13-384-------------------------------------------------------------------------------R
E9IFT1_SOLIN/7-367-------------------------------------------------------------------------------K
F2UGQ3_SALR5/7-364-------------------------------------------------------------------------------K
W5NKD6_LEPOC/13-376-------------------------------------------------------------------------------G
J4KRH2_BEAB2/17-389-------------------------------------------------------------------------------G
R7YJ95_CONA1/9-375-------------------------------------------------------------------------------G
S0DNZ8_GIBF5/11-387-------------------------------------------------------------------------------G
UBE3D_MOUSE/13-363-------------------------------------------------------------------------------G
J3NIY5_GAGT3/10-440-------------------------------------------------------------------------------R
Q59X25_CANAL/5-335-------------------------------------------------------------------------------N
S7Z7X2_PENO1/19-451-------------------------------------------------------------------------------G
N1JPA0_BLUG1/11-394-------------------------------------------------------------------------------D
A7USM4_ANOGA/14-433-------------------------------------------------------------------------------A
L8FLW5_PSED2/12-402-------------------------------------------------------------------------------G
K1WUW9_MARBU/11-366-------------------------------------------------------------------------------K
G3JK97_CORMM/17-390-------------------------------------------------------------------------------G
M3ZXU8_XIPMA/13-391-------------------------------------------------------------------------------T
A7TPW1_VANPO/6-339-------------------------------------------------------------------------------K
B4MTF5_DROWI/9-373-------------------------------------------------------------------------------G
G9NH43_HYPAI/14-392-------------------------------------------------------------------------------D
H3AB66_LATCH/13-372-------------------------------------------------------------------------------N
B6QVW6_PENMQ/12-421-------------------------------------------------------------------------------K
G3Y5B6_ASPNA/22-416-------------------------------------------------------------------------------H
G2Q453_THIHA/11-366-------------------------------------------------------------------------------A
T5AMN1_OPHSC/15-387-------------------------------------------------------------------------------G
G1TSQ5_RABIT/13-382-------------------------------------------------------------------------------G
S3CHW0_OPHP1/592-1020-------------------------------------------------------------------------------S
Q75DV5_ASHGO/6-338-------------------------------------------------------------------------------D
H0ZQP0_TAEGU/10-364-------------------------------------------------------------------------------G
G0VL18_NAUCC/6-338-------------------------------------------------------------------------------N
F8PKW0_SERL3/428-814-------------------------------------------------------------------------------S
F1Q7U1_DANRE/13-383-------------------------------------------------------------------------------G
A4D9F3_ASPFU/21-419-------------------------------------------------------------------------------E
J4G0K5_FIBRA/670-1049-------------------------------------------------------------------------------S
K0KTK1_WICCF/8-359-------------------------------------------------------------------------------D
U1HL67_ENDPU/9-360-------------------------------------------------------------------------------K
B4JWU6_DROGR/9-392-------------------------------------------------------------------------------L
J7RHU2_KAZNA/6-349-------------------------------------------------------------------------------D
C5DRI9_ZYGRC/22-357-------------------------------------------------------------------------------D
N1PZE3_DOTSN/8-375-------------------------------------------------------------------------------R
B2WD68_PYRTR/65-448-------------------------------------------------------------------------------Q
B3MZV3_DROAN/9-395-------------------------------------------------------------------------------S
S3DDS5_GLAL2/11-449-------------------------------------------------------------------------------S
G8ZSN1_TORDC/11-349-------------------------------------------------------------------------------R
F1NWJ5_CHICK/86-460-------------------------------------------------------------------------------G
G2Y6Z9_BOTF4/11-390-------------------------------------------------------------------------------S
E3QET8_COLGM/12-395-------------------------------------------------------------------------------A
H2RRY7_TAKRU/13-391-------------------------------------------------------------------------------M
B4L5I9_DROMO/9-382-------------------------------------------------------------------------------R
I2H589_TETBL/10-368-------------------------------------------------------------------------------Q
Q6CWI5_KLULA/6-348-------------------------------------------------------------------------------D
C0NUQ4_AJECG/14-503-------------------------------------------------------------------------------K
UBE3D_PONAB/13-384-------------------------------------------------------------------------------G
B4M301_DROVI/9-382-------------------------------------------------------------------------------H
C5DFR9_LACTC/6-346-------------------------------------------------------------------------------E
V5G5H4_BYSSN/14-443-------------------------------------------------------------------------------S
A0A088AUY8_APIME/8-357-------------------------------------------------------------------------------K
UBE3D_BOVIN/13-384-------------------------------------------------------------------------------G
N1QC82_PSEFD/8-371-------------------------------------------------------------------------------S
E7LWJ6_YEASV/7-341-------------------------------------------------------------------------------K
K7JNW4_NASVI/31-384-------------------------------------------------------------------------------K
B0WGJ1_CULQU/12-439-------------------------------------------------------------------------------G
F4X8J5_ACREC/7-368-------------------------------------------------------------------------------K
U4LVT7_PYROM/7-364-------------------------------------------------------------------------------K
M2R8N7_COCSN/64-445-------------------------------------------------------------------------------E
Q7SDG7_NEUCR/13-419-------------------------------------------------------------------------------Q
H6C728_EXODN/11-372-------------------------------------------------------------------------------G
E2C3X0_HARSA/7-364-------------------------------------------------------------------------------K
A5DWX9_LODEL/10-362-------------------------------------------------------------------------------K
Q9VWP0_DROME/9-387-------------------------------------------------------------------------------R
H2AW44_KAZAF/6-347-------------------------------------------------------------------------------K
F7E020_XENTR/11-384-------------------------------------------------------------------------------G
G1XBI8_ARTOA/9-373-------------------------------------------------------------------------------T
Q16XY0_AEDAE/12-443-------------------------------------------------------------------------------G
Q29GF2_DROPS/8-383-------------------------------------------------------------------------------Q
G8YFE7_PICSO/19-368-------------------------------------------------------------------------------L
Q6FK88_CANGA/6-346-------------------------------------------------------------------------------K
U7PMZ7_SPOS1/17-440-------------------------------------------------------------------------------S
L9L4K4_TUPCH/13-384-------------------------------------------------------------------------------G
G2QZ38_THITE/12-401-------------------------------------------------------------------------------T
K5W0X4_PHACS/481-860-------------------------------------------------------------------------------S
R0KID0_SETT2/64-441-------------------------------------------------------------------------------A

PF00632

Q9BL11_CAEEL/717-1019--ET.H........TTE...........LL.S--------------G..GTE......KPV........TNANRDEYV..
UBR5_MOUSE/2479-2792--QV............E...........LI.P--------------N..GVN......IPV........TPQNVYEYV..
A0EFC1_PARTE/672-969--EA.Y........FDD...........LK.P--------------N..GFQ......INV........TKDNREEYI..
Q54GG5_DICDI/425-720--QT.K........VHN...........LK.Q--------------G..GDD......IQV........TNENRNEYL..
Q2GSX9_CHAGB/694-1033--IS.LPGEPFRTTTRD...........LV.P--------------N..GEN......VVV........TNENRLLYI..
Q4WHR7_ASPFU/967-1337--SSHRSKSERLDYCV...............P--------------T....PPV.EEASLV........TNDNRAQFV..
Q5KIA2_CRYNJ/1499-1843--Y...........DIE...........LK.P--------------G..GAH......IEV........DDSNLGEYL..
Q5CW92_CRYPI/1231-1561--SLTDVGNNNKHLEID...........LI.P--------------N..GRN......IPV........NNENKIVYI..
A2E5Q8_TRIVA/658-966--..............VKDSL..GQDHSLN.Q--------------N..GTS......CKV........SISNANEYI..
A0BRI8_PARTE/1050-1354--IP.E........DLE...........LK.Q--------------G..GGD......ILV........TQQNKKEFI..
HUL5_YEAST/607-910--SA.K........VVD...........LI.P--------------N..GSK......TYV........TKDNVLLYV..
A7SML1_NEMVE/1229-1585--YT..........NIE...........LK.K--------------N..GRN......IPV........TIHNLEKYI..
Q38D88_TRYB2/1472-1912--DD..........RFE...........MI.D--------------K..GQS......TCV........NSTNVSAYI..
Q6BGB8_PARTE/609-908--QI.V........EFD...........LI.P--------------N..GRQ......INV........TNENKISYI..
A2FIB4_TRIVA/386-683--EM.M........ETP...........LV.P--------------D..GDK......IPV........TNDNFEQFV..
L9KS41_TUPCH/1283-1677--QV.T........ERE...........LK.S--------------G..GAN......TQV........TEKNKKEYI..
A2DAL9_TRIVA/1571-1869--NDSP........GIE...........LC.E--------------G..GRD......KML........TRENADEYV..
A4VDG4_TETTS/3915-4210--QK.Y........EIE...........LK.K--------------N..GRN......MQV........CNQNKKEYV..
A2FLN6_TRIVA/2545-2849--...AENS..LGSIVE...........LI.P--------------G..GSL......VPV........TFDRRLEFL..
A4IBT8_LEIIN/1017-1343--............EF............LK.T--------------QTDGRYT...TDSPL........TPESVSDYI..
A4IC88_LEIIN/3812-4131--EEFFVTQLSDHSTKE...........LI.E--------------G..GAQ......TRV........TLARSSEYA..
F6U235_XENTR/611-908--NP.L........MHD...........LK.E--------------N..GDK......IPI........TNENRKEFV..
A0D2G1_PARTE/170-483--...LEY...FGKTIN...........LK.E--------------N..GCE......IKV........TNSNAQEYI..
A4HF82_LEIBR/3619-3949--..............EHVRASPVFLRSLQ.G--------------G..GTGVMDGAVAPL........VARPLRPYACM
Q8SS57_ENCCU/454-746--.............VEHSVDGIPRSYPLV.K--------------N..GED......IKL........TSENMRLFI..
AREL1_MOUSE/512-823--QLDK........IVE...........LM.T--------------G..GAQ......TPV........TNANKIFYL..
Q4E2E5_TRYCC/2646-2975--............GIEWSGESVTDTMGMV.R--------------STRGYP......VVT........PTRSTADMASI
A7SQ93_NEMVE/299-612--EV.V........THN...........LK.P--------------K..GDT......IPV........TNTNRQEYV..
TOM1_YEAST/2962-3268--EH.K........VIN...........LI.E--------------G..GKD......IIV........TEANKQDYV..
Q6C901_YARLI/697-1001--VK.K........SCD...........LI.S--------------N..GSH......VSV........TTRNRRDYV..
Q9W0H2_DROME/761-1058--EA.E........TKC...........LK.P--------------N..GNE......IAV........TLENRQEFV..
A0BRN4_PARTE/3724-4023--...YQK...KKELIQ...........LI.P--------------D..GQN......VTV........NKENCSVYL..
NEDD4_HUMAN/1013-1318--QT.H........QHE...........LK.N--------------G..GSE......IVV........TNKNKKEYI..
O17736_CAEEL/692-1001--LV.R........NVN...........LK.P--------------N..GSK......FRV........TVENVHEYV..
A2FPQ0_TRIVA/408-705--AQ.V........TED...........LI.T--------------D..GRN......IPV........TSENFDNYV..
A2FR71_TRIVA/373-670--DP.I........VVE...........FI.P--------------G..GSQ......KDV........TNENLEEYI..
Q7PSQ3_ANOGA/541-897--VL.K........VHE...........LK.P--------------N..GAS......IAV........TEDNKREYV..
Q247X9_TETTS/2308-2606--AS.K........VIE...........LK.N--------------D..GQN......IEV........NDQNKKEYI..
A0DNI8_PARTE/201-510--............IYRKSKG...DYYELK.K--------------G..GQT......IQL........DMDNCQEYV..
A5K4K7_PLAVS/1441-1991--AS.AED....LECID...........LI.E--------------N..GRN......IPV........DDSNKKLYI..
A2DQ34_TRIVA/412-708--ER.I........EIP...........LV.Q--------------N..GSN......IDV........TNDNLDAFI..
Q5KBV2_CRYNJ/2952-3249--EK.K........TVE...........LK.E--------------N..GAN......IPV........TEGNKEEYV..
A2FXS6_TRIVA/392-692--HQ.E........TVD...........FI.K--------------N..GST......IDV........TNENVEQYV..
A4VD17_TETTS/789-1090--QK..........EIS...........LV.P--------------N..GKN......IPV........DNSNILRYI..
A2F7U9_TRIVA/2273-2579--.............................P--------------GHSADS.......TV........GPGEVENFI..
Q9W196_DROME/819-1122--QT.Q........IVE...........LK.P--------------Q..GQS......IPV........TNSNRIEYL..
A2DYB1_TRIVA/1674-1977--RV.K........AAN...........LK.P--------------D..GAK......IAV........DNKNKEEYV..
A2EDQ8_TRIVA/2183-2490--.............................P--------------GHDKGD.......IL........NKEDVEQYI..
A4S7N1_OSTLU/131-443--EL.V........TRE...........LV.A--------------G..GRD......VEV........TAANKLFYV..
A2EM50_TRIVA/2501-2807--.............................K--------------NIRGEE......VSVFSFSSKSLNQGSAGRFI..
Q0UNY9_PHANO/908-1229--HR.VDHDMDEPYTQ...............P--------------GSPPLTSTPKEPKMV........TNKNRAQFI..
A2EQW9_TRIVA/2209-2511--..............................--------------...STNWLKSKDQIV........GYNDIKNYL..
HUL4_ASHGO/526-839--KI.H........YRQ...........LC.P--------------D..GST......QAV........TRENKHEYF..
Q7QE66_ANOGA/554-863--TS.I........DIE...........LK.P--------------N..GRN......ITV........SERNKRDYL..
A2E4I7_TRIVA/2634-2943--.............................L--------------SEYGRT......RPV........TLQNVREYI..
A5K5J0_PLAVS/8258-8564--KT.K........VID...........LI.P--------------N..GRN......IPV........TDENKHKYI..
Q54QF1_DICDI/778-1120--IM.K........TIN...........LK.P--------------F..GNL......IRV........TDDNKLEYL..
UPL7_ARATH/828-1142--KM.S........IIE...........LK.P--------------G..GKD......TSV........TNENKMQYI..
Q8SR14_ENCCU/2104-2410--VH.R........TVE...........LV.E--------------G..GAH......VFV........DDSNKAEYV..
MUG30_SCHPO/482-807--GF.R........TVE...........LK.E--------------G..GSE......LSV........DNENRKEYV..
A3FPU7_CRYPI/497-797--VM.A........EVP...........IA.P--------------GEFDPS......EPV........TICNVHRYV..
Q38A01_TRYB2/1526-1868--............IQHGDAEHNGGIVELC.P--------------N..GAT......TQV........SAMNVNEYV..
A1CTM1_ASPCL/1468-1817--YP..........SIE...........LI.D--------------N..GSN......IPV........TTDNVDQYV..
A2DAJ9_TRIVA/133-438--.............................P--------------SQHHTD.......YV........TGESVEQFI..
Q7PSA4_ANOGA/2506-2929--YA..........SAD...........LL.P--------------N..GAN......IDV........TINNVEEYC..
UPL3_ARATH/1518-1888--YPEY......................IL.R--------------S..GDE.......IV........DITNLEEYI..
C8VT87_EMENI/782-1089--EV.V........SVP...........LC.P--------------G..GEK......KPV........TNANRREFV..
Q22F29_TETTS/3359-3651--QN.Y........TLD...........LI.P--------------N..GRN......IEV........TEQNKKEYV..
Q4UD92_THEAN/251-554--SS.I........QEN...........LI.P--------------N..GHN......TRV........TKQNVESFI..
Q580G4_TRYB2/3999-4304--VT.E........EVE...........LI.P--------------N..GSQ......VAV........TNANKSQYV..
A3LSX3_PICST/660-977--KN.Y........VFD...........LLPP--------------N..GEN......TKL........NSSNKLSYI..
A2DBI7_TRIVA/375-665--DK.G........EVE...........LK.E--------------G..GSN......IVV........DNDSVEEYI..
A0DLU6_PARTE/3989-4284--TH..........IIN...........LI.P--------------N..GYK......IQV........TIHNTERYL..
HACE1_MOUSE/602-909--AM.E........EVP...........LK.P--------------G..GGS......ILV........TQNNKAEYV..
UBE3B_HUMAN/736-1068--QL.V........CHE...........LI.P--------------G..GKT......IPV........TNENKISYI..
A4IAG7_LEIIN/1064-1369--..........................LR..--------------.......................THADLEQHL..
A7SNF7_NEMVE/430-737--RP.V........TID...........LS.E--------------N...PD......EEL........TDSNKSEYV..
A2ERB6_TRIVA/1571-1861--NK..........TIK...........LI.E--------------N..GEN......VDV........TNENKEKYI..
A3GHK0_PICST/646-950--KT.Y........SAE...........LI.K--------------D..GRK......IFV........TAETRKSYI..
A7AV31_BABBO/1338-1643--...Y.......GNIP...........LV.P--------------G..GES......MKV........TSSNLHEYV..
Q4Q7L2_LEIMA/1091-1400--IT.R........EVE...........LV.P--------------D..GAQ......MHV........TPRNCLFYV..
A8BYQ3_GIAIC/636-950--PNGE........DVP...........LI.E--------------G..GQE......IYV........DEHNVEGYI..
PUB2_SCHPO/367-671--ES.V........TVD...........LI.P--------------N..GRN......IAV........NNQNKMNYL..
Q54KP2_DICDI/1482-1898--FA..........GWE...........LK.P--------------N..GEQ......INV........TLDNIEEYL..
A5DS31_LODEL/333-694--YP..........NYE...........LI.P--------------N..GRE......VQV........DHTNLEAYI..
A2DQ30_TRIVA/383-682--TL.K........SIE...........LK.K--------------G..GSD......IAL........TNDNYKEYI..
A4HPV4_LEIBR/2168-2551--EA............DGYVPGEVEVLPLI.P--------------G..GAN......RRV........TVDNVQEYT..
A4IBF5_LEIIN/1897-2310--DD..........SVE...........LC.P--------------D..GAQ......IPV........TKKNLRLYQ..

PF09814

C1FZL9_PARBD/14-464..NI------------------------LF-N..............P--.SEKGGIIWKDL--------PSSDWAEMM--
F6W3S4_MONDO/6-378..EI------------------------IV-K..............E--.RKLLR..VLPL--------PSENWNALV--
I3ITZ6_ORENI/17-395..TR------------------------LL-E..............D--.RVFNR..VLPL--------PNGNWNAIV--
N4UQV1_COLOR/12-395..GA------------------------VV-P..............E--.GKAAE..WKDL--------PSENWAEMM--
E9EVP5_METRA/11-385..SI------------------------VI-P..............K--.DTIQS..WKDL--------PSENWAEMM--
M1WB37_CLAP2/12-387..ST------------------------II-P..............D--.GKLKV..WKDL--------PSENWAEMM--
E4UYL0_ARTGP/16-474..NI------------------------LF-D..............P--.REGQDIVWKDL--------PSADWAEMM--
A1CJR3_ASPCL/19-423..GL------------------------IL-DAPGLDSADSQMSDAS--....DGWVWKDL--------PSGNWAEMM--
C8VJ15_EMENI/28-442..QV------------------------IL-DKPSNTAAPTLSDENS--.TSHAGWLWKDL--------PSGNWAEMM--
H2L971_ORYLA/17-387..TR------------------------LL-E..............D--.RVFKR..VLPL--------PNGSWNAIV--
G3NNB4_GASAC/18-377..TR------------------------LL-E..............D--.REFKR..VLPL--------PNCNWNAIV--
A0A0C4E6U2_MAGP6/10-439..AV------------------------VV-P..............G--.RHITC..WKDL--------PSADWAEMM--
S8AD65_DACHA/9-378..SR------------------------II-P..............S--.LRIRK..WKNL--------PSEHWADLM--
N1QJ23_SPHMS/6-366..QI------------------------VL-A..............R--.GKVLT..WKNL--------PSENWAEMM--
G0WHB4_NAUDC/6-345..SD------------------------II-D..............E--.QNYRK..LNDM--------PSEYWAELM--
M7PCP3_PNEMU/15-353..CF------------------------LL-N..............K--.DQIKH..WRNL--------PSDNWVDMM--
F2SJ85_TRIRC/16-422..NI------------------------LF-S..............P--.REAQNIIWKDL--------PSADWAEMM--
E9CUF8_COCPS/14-449..NI------------------------LL-E..............P--.QGGNRMVWKDL--------PSANWAELM--
Q6BMI9_DEBHA/5-350..HA------------------------II-D..............S--.KEYDR..FFDM--------PSELWSEMM--
G8BQA7_TETPH/7-356..NV------------------------IF-E..............S--DDNCRK..LNIM--------PSEFWAELM--
W5LC11_ASTMX/13-384..AT------------------------LL-K..............D--.RVFKR..VLPL--------PNGNWNTLV--
E9IFT1_SOLIN/7-367..NV------------------------IS-K..............S--.ISFKR..FLPL--------PDTEYDP..--
F2UGQ3_SALR5/7-364..AA------------------------VS-P..............P--.LQPYR.....L--------PSLRWHEIQ--
W5NKD6_LEPOC/13-376..EQ------------------------VL-M..............E--.RVFNR..VLPL--------PNGNWNALV--
J4KRH2_BEAB2/17-389..QI------------------------FI-N..............S--.ATVTT..WKDL--------PSENWAEMM--
R7YJ95_CONA1/9-375..QE------------------------LV-K..............R--.GTVGDGGWKDL--------PNENWAEMM--
S0DNZ8_GIBF5/11-387..SE------------------------FV-A..............Q--.SIINA..WKDL--------PSENWAEMM--
UBE3D_MOUSE/13-363..EV------------------------TI-K..............D--.RKLLR..VLPL--------PSENWSALV--
J3NIY5_GAGT3/10-440..AI------------------------VV-P..............G--.KRIAR..WKDL--------PSADWAEMM--
Q59X25_CANAL/5-335..SE------------------------LI-D..............S--.SQYD...FKDM--------PSEQWYEMM--
S7Z7X2_PENO1/19-451..TP------------------------FM-K..DGGSEESVNGELP--.SVRSEWLWKDL--------PSGNWAEMM--
N1JPA0_BLUG1/11-394..EV------------------------IM-K..............K--.GKIHT..WKDL--------PSENWAEMM--
A7USM4_ANOGA/14-433..GP------------------------LQ-QSADPAGD.......P--DTSFQR..VLEL--------PSEQLDT..--
L8FLW5_PSED2/12-402..QV------------------------IL-S..............P--.RRVTT..WRDL--------PSENWAEMM--
K1WUW9_MARBU/11-366..AV------------------------IL-E..............K--.GTVRV..WKDL--------PSENWAEMM--
G3JK97_CORMM/17-390..AQ------------------------FI-K..............N--.EAVET..WKDL--------PSENWAEMM--
M3ZXU8_XIPMA/13-391..TR------------------------LL-E..............D--.RMFSR..VLPL--------PNGNWNAIV--
A7TPW1_VANPO/6-339..KV------------------------LL-Q..............K--GDNVTK..LNSL--------PSEFWMELM--
B4MTF5_DROWI/9-373..NE------------------------LA-E..............S--.TVYKR..LREF--------PSCIVDP..--
G9NH43_HYPAI/14-392..HV------------------------IV-Q..............P--.ERIKS..WKDL--------PSENWAEMM--
H3AB66_LATCH/13-372VISS------------------------VN-Q..............E--VKSFRR..VLPL--------PSGNWSALV--
B6QVW6_PENMQ/12-421..QT------------------------IV-D..........TTSKA--.DTSSPWQWKDL--------PSGNWAEMM--
G3Y5B6_ASPNA/22-416..NP------------------------IM-E...............--....GGKVWKDL--------PSGNWAEMM--
G2Q453_THIHA/11-366..TN------------------------LV-R..............P--.GSVKV..WKDL--------PSENWAEMM--
T5AMN1_OPHSC/15-387..SG------------------------LV-R..............S--.GQIKS..WQDL--------PSENWAEMM--
G1TSQ5_RABIT/13-382..EA------------------------II-K..............D--.RKLLR..ILPL--------PSENWGALV--
S3CHW0_OPHP1/592-1020..AV------------------------IV-P..............A--.GRIAA..WKDL--------PSDNWAEMM--
Q75DV5_ASHGO/6-338..GL------------------------LV-T..............G--.EACRR..VSAM--------PSEFWTELM--
H0ZQP0_TAEGU/10-364..DI------------------------VV-S..............D--.RKFLR..VLPL--------PSENWSDLV--
G0VL18_NAUCC/6-338..TP------------------------VI-S..............T--.SNINK..INEL--------PSEFWMELM--
F8PKW0_SERL3/428-814..LP------------------------LV-H..............S--.SAIVE..YKDL--------PSEHWEELV--
F1Q7U1_DANRE/13-383..SR------------------------VL-Q..............H--.RSFGR..VLPL--------PNGNWNALV--
A4D9F3_ASPFU/21-419..NV------------------------IL-NNP..RCADGSGDTSP--....AGWTWKDL--------PSGNWAEMM--
J4G0K5_FIBRA/670-1049..LP------------------------LV-Q..............C--.SQLRD..YRDL--------PSEHWEELV--
K0KTK1_WICCF/8-359..YK------------------------LL-N..............S--.NDIET..VLDM--------PSSLWAEMM--
U1HL67_ENDPU/9-360..TE------------------------IL-T..............N--ELPLQ...FKAL--------PSEHWAEMM--
B4JWU6_DROGR/9-392..YE------------------------LA-P..............G--.CNYNR..LREL--------PSGLFDA..--
J7RHU2_KAZNA/6-349..AP------------------------VL-D..............S--VTNCLK..LNNM--------PSEYWAELM--
C5DRI9_ZYGRC/22-357..MD------------------------II-D..............H--.DNCFR..LNEM--------PSEFWMELM--
N1PZE3_DOTSN/8-375..SE------------------------VV-S..............R--.GQIRA..WKDL--------PSENWAEMM--
B2WD68_PYRTR/65-448..GV------------------------LV-P..............K--.GKIQQ..WKDL--------PNENWAEMM--
B3MZV3_DROAN/9-395..AE------------------------LV-E..............N--.RGYRR..LREF--------PSCVVDP..--
S3DDS5_GLAL2/11-449..AI------------------------II-K..............N--.GSIKD..WKDL--------PSENWAEMM--
G8ZSN1_TORDC/11-349..TD------------------------II-N..............E--.QNCFK..INEM--------PSEFWMELM--
F1NWJ5_CHICK/86-460..NV------------------------IV-K..............E--.RKFLR..VLPL--------PSENWSALV--
G2Y6Z9_BOTF4/11-390..TT------------------------IV-E..............P--.DRINE..WRDL--------PSEGWAEMM--
E3QET8_COLGM/12-395..AP------------------------LV-P..............P--.GRARE..WKDL--------PSENWAEMM--
H2RRY7_TAKRU/13-391..TR------------------------LL-E..............D--.REFKR..VLPL--------PNGNWSALV--
B4L5I9_DROMO/9-382..SE------------------------LV-P..............G--.CSYNR..LREC--------PSGLIDP..--
I2H589_TETBL/10-368..NI------------------------II-S..............K--.SNSFK..INQM--------PSEYWMELM--
Q6CWI5_KLULA/6-348..TP------------------------VI-S..............S--.INCKR..IRDM--------PSEFWADFM--
C0NUQ4_AJECG/14-503..NT------------------------LF-T..............P--.SDKGKVTWKDL--------PSTDWAEMM--
UBE3D_PONAB/13-384..EV------------------------II-N..............D--.RKLLR..VLPL--------PSENWGALV--
B4M301_DROVI/9-382..NQ------------------------LV-P..............G--.CSYSR..LREF--------PSGIIDP..--
C5DFR9_LACTC/6-346..SC------------------------VL-A..............K--.KDCVQ..INEM--------PSEFWAELM--
V5G5H4_BYSSN/14-443..KV------------------------IL-D..............S--TKHTEGWTWKNL--------PSGNWAEMM--
A0A088AUY8_APIME/8-357..NI------------------------LS-E..............D--.IHIKR..ILPV--------PNMNYDP..--
UBE3D_BOVIN/13-384..EV------------------------II-R..............D--.RMLLR..VLPL--------PGDNWGALV--
N1QC82_PSEFD/8-371..SV------------------------LV-Q..............R--.HSVAI..WKNL--------PSENWAEMM--
E7LWJ6_YEASV/7-341..QK------------------------II-S..............K--.DNCQV..LNDM--------PSEFWFELM--
K7JNW4_NASVI/31-384..NE------------------------IT-K..............T--.VCFQR..ILPL--------PSSDCDP..--
B0WGJ1_CULQU/12-439..ND------------------------LH-E..............Q--PVAFKR..ILEL--------PSDHMDS..--
F4X8J5_ACREC/7-368..NV------------------------IS-K..............L--.ISFKR..FLPL--------PDAEYDP..--
U4LVT7_PYROM/7-364..AV------------------------VL-P..............S--.GRIQK..WKNL--------PSGNWADMM--
M2R8N7_COCSN/64-445..GV------------------------VM-P..............K--.GKVQQ..WKDL--------PNENWAEMM--
Q7SDG7_NEUCR/13-419..AV------------------------VV-K..............R--.DVVKV..WKDL--------PSENWAEMM--
H6C728_EXODN/11-372..AD------------------------IL-S..............A--.GKVTV..WKDL--------PSTHWAELM--
E2C3X0_HARSA/7-364..NV------------------------IS-K..............P--.TTFKR..ALPL--------PDIQCSP..--
A5DWX9_LODEL/10-362..HL------------------------LI-N..............S--QNHV....FKDM--------PNEYWYELM--
Q9VWP0_DROME/9-387..AE------------------------LV-A..............G--.RSYRR..LREF--------PSLLVDP..--
H2AW44_KAZAF/6-347..HP------------------------VI-D..............N--.SNCKK..LNEM--------PSEFWMEFM--
F7E020_XENTR/11-384..EL------------------------II-R..............K--.QQFCR..VLPL--------PSENWSSLV--
G1XBI8_ARTOA/9-373..TT------------------------II-P..............G--.GRIQK..WKNL--------PSEHWADMM--
Q16XY0_AEDAE/12-443..NP------------------------LK-D..............E--TVSFRR..ILEL--------PSDHMDS..--
Q29GF2_DROPS/8-383..AE------------------------VA-P..............R--.RIYTR..LREF--------PNCIVDP..--
G8YFE7_PICSO/19-368..SP------------------------IV-D..............S--.SNISM..FYDM--------PSEFWSEMM--
Q6FK88_CANGA/6-346..LV------------------------VL-D..............S--EVNIKK..ISEM--------PSEFWAEFM--
U7PMZ7_SPOS1/17-440..AE------------------------LV-A..............A--.HRIQA..WKDL--------PSDNWAEMM--
L9L4K4_TUPCH/13-384..EV------------------------VI-R..............D--.RKLLR..VLPL--------PSENWGALV--
G2QZ38_THITE/12-401..AA------------------------VV-P..............A--.GAVKA..WKDL--------PSENWAEMM--
K5W0X4_PHACS/481-860..LP------------------------LV-R..............G--.SALHR..YRDL--------PSEHWAELV--
R0KID0_SETT2/64-441..SP------------------------II-P..............K--.GKIQQ..WRDL--------PNENWAEMM--

PF00632

Q9BL11_CAEEL/717-1019................................RLYV....H---------------------------------------
UBR5_MOUSE/2479-2792................................RKYAEHRML---------------------------------------
A0EFC1_PARTE/672-969................................ELYTDWYLN---------------------------------------
Q54GG5_DICDI/425-720................................DLYKDYLLN---------------------------------------
Q2GSX9_CHAGB/694-1033................................SYVARHRLI---------------------------------------
Q4WHR7_ASPFU/967-1337................................KDYIFWLTD---------------------------------------
Q5KIA2_CRYNJ/1499-1843................................EKVLDWTLG---------------------------------------
Q5CW92_CRYPI/1231-1561................................KLLTHYKLI---------------------------------------
A2E5Q8_TRIVA/658-966................................ALSNEFRI.---------------------------------------
A0BRI8_PARTE/1050-1354................................KMYCDQIMA---------------------------------------
HUL5_YEAST/607-910................................TKVTDYKLN---------------------------------------
A7SML1_NEMVE/1229-1585................................KLVVHWTLV---------------------------------------
Q38D88_TRYB2/1472-1912................................RRAASALLY---------------------------------------
Q6BGB8_PARTE/609-908................................NLYCHFRLN---------------------------------------
A2FIB4_TRIVA/386-683................................VMYLDWHTS---------------------------------------
L9KS41_TUPCH/1283-1677................................ERMVKWRVE---------------------------------------
A2DAL9_TRIVA/1571-1869................................ELLTQYYLY---------------------------------------
A4VDG4_TETTS/3915-4210................................KSICHAKLI---------------------------------------
A2FLN6_TRIVA/2545-2849................................AKIKKFRV.---------------------------------------
A4IBT8_LEIIN/1017-1343................................NLREKFDLV---------------------------------------
A4IC88_LEIIN/3812-4131................................EALLQARL.---------------------------------------
F6U235_XENTR/611-908................................SLYTDYILN---------------------------------------
A0D2G1_PARTE/170-483................................NLNIFYYTS---------------------------------------
A4HF82_LEIBR/3619-3949TPEMSMQDMSHLVLEELEEMAASVEAAEVDRRRALAQEALL---------------------------------------
Q8SS57_ENCCU/454-746................................EKYVEFHTD---------------------------------------
AREL1_MOUSE/512-823................................NLLAQYRLA---------------------------------------
Q4E2E5_TRYCC/2646-2975FPTDGH.................EESVTVAQRRKEAERALL---------------------------------------
A7SQ93_NEMVE/299-612................................QLYVDYLLN---------------------------------------
TOM1_YEAST/2962-3268................................KKVVEYKLQ---------------------------------------
Q6C901_YARLI/697-1001................................SRLVKFFLE---------------------------------------
Q9W0H2_DROME/761-1058................................DLYVDFVFN---------------------------------------
A0BRN4_PARTE/3724-4023................................DKVAEYVIQ---------------------------------------
NEDD4_HUMAN/1013-1318................................YLVIQWRFV---------------------------------------
O17736_CAEEL/692-1001................................RLYVNYHLK---------------------------------------
A2FPQ0_TRIVA/408-705................................KLYVDWYLN---------------------------------------
A2FR71_TRIVA/373-670................................QMSIDFYLN---------------------------------------
Q7PSQ3_ANOGA/541-897................................KLYVNYRFM---------------------------------------
Q247X9_TETTS/2308-2606................................QLYCKAKMQ---------------------------------------
A0DNI8_PARTE/201-510................................NLCIDYYTN---------------------------------------
A5K4K7_PLAVS/1441-1991................................KLYINYKFK---------------------------------------
A2DQ34_TRIVA/412-708................................ASYINWWAN---------------------------------------
Q5KBV2_CRYNJ/2952-3249................................RLVVSYRLD---------------------------------------
A2FXS6_TRIVA/392-692................................EQYIKYKFI---------------------------------------
A4VD17_TETTS/789-1090................................YLVADYKMN---------------------------------------
A2F7U9_TRIVA/2273-2579................................IECINFRI.---------------------------------------
Q9W196_DROME/819-1122................................QLIADYKLN---------------------------------------
A2DYB1_TRIVA/1674-1977................................NLMVQYRLR---------------------------------------
A2EDQ8_TRIVA/2183-2490................................KECVDYRL.---------------------------------------
A4S7N1_OSTLU/131-443................................FSLADYHLN---------------------------------------
A2EM50_TRIVA/2501-2807................................SSANSLRIQ---------------------------------------
Q0UNY9_PHANO/908-1229................................WDYLNHLTY---------------------------------------
A2EQW9_TRIVA/2209-2511................................NMCVGARI.---------------------------------------
HUL4_ASHGO/526-839................................RLWMDFYLN---------------------------------------
Q7QE66_ANOGA/554-863................................DRIIKWRLE---------------------------------------
A2E4I7_TRIVA/2634-2943................................SLSKDFRI.---------------------------------------
A5K5J0_PLAVS/8258-8564................................ELLCEMKVT---------------------------------------
Q54QF1_DICDI/778-1120................................ELWVNSLFY---------------------------------------
UPL7_ARATH/828-1142................................HAMADYKLN---------------------------------------
Q8SR14_ENCCU/2104-2410................................KLATQYRLF---------------------------------------
MUG30_SCHPO/482-807................................LRYVDYLLN---------------------------------------
A3FPU7_CRYPI/497-797................................ELYLDWFLN---------------------------------------
Q38A01_TRYB2/1526-1868................................QEVRRYYSK---------------------------------------
A1CTM1_ASPCL/1468-1817................................DRVVDMTLG---------------------------------------
A2DAJ9_TRIVA/133-438................................DEFVQARI.---------------------------------------
Q7PSA4_ANOGA/2506-2929................................NLTVAFCLQ---------------------------------------
UPL3_ARATH/1518-1888................................SLVVDATVK---------------------------------------
C8VT87_EMENI/782-1089................................DLFVHYHLD---------------------------------------
Q22F29_TETTS/3359-3651................................KQIAHFKMT---------------------------------------
Q4UD92_THEAN/251-554................................HQFSNFKCN---------------------------------------
Q580G4_TRYB2/3999-4304................................RLRCEFCMT---------------------------------------
A3LSX3_PICST/660-977................................HQISNFKLN---------------------------------------
A2DBI7_TRIVA/375-665................................RLYIDYVAN---------------------------------------
A0DLU6_PARTE/3989-4284................................QKLADYLIV---------------------------------------
HACE1_MOUSE/602-909................................QLVTELRMT---------------------------------------
UBE3B_HUMAN/736-1068................................HLMAHFRMH---------------------------------------
A4IAG7_LEIIN/1064-1369................................QLTVVTRFE---------------------------------------
A7SNF7_NEMVE/430-737................................KLVSQFKLQ---------------------------------------
A2ERB6_TRIVA/1571-1861................................ELYINQFIL---------------------------------------
A3GHK0_PICST/646-950................................EKYTQFFLQ---------------------------------------
A7AV31_BABBO/1338-1643................................RAVIRMRLY---------------------------------------
Q4Q7L2_LEIMA/1091-1400................................HLVADFKLN---------------------------------------
A8BYQ3_GIAIC/636-950................................KAYANYILN---------------------------------------
PUB2_SCHPO/367-671................................KALTEHKLV---------------------------------------
Q54KP2_DICDI/1482-1898................................NLIVKNFLY---------------------------------------
A5DS31_LODEL/333-694................................HKVVDATLF---------------------------------------
A2DQ30_TRIVA/383-682................................QLYMEYYMI---------------------------------------
A4HPV4_LEIBR/2168-2551................................RCLRTYYLH---------------------------------------
A4IBF5_LEIIN/1897-2310................................RRVVGALLY---------------------------------------

PF09814

C1FZL9_PARBD/14-464--------------------------------DLWHCHKPD..AHEDGHGDATNYT...............GPHVNDENE
F6W3S4_MONDO/6-378--------------------------------EEWCCHPDP.......................................
I3ITZ6_ORENI/17-395--------------------------------DDWCCHPDP.......................................
N4UQV1_COLOR/12-395--------------------------------DFWHCHKPTAEDDGH.........................GGAEHEHL
E9EVP5_METRA/11-385--------------------------------EFWHCHKPH..DHSE...........................HQQESL
M1WB37_CLAP2/12-387--------------------------------EFWHCHKPH..DRDQ...........................QENKDL
E4UYL0_ARTGP/16-474--------------------------------DLWHCHKPD..PIPANNG.....................GVDSTDPNG
A1CJR3_ASPCL/19-423--------------------------------DFWHCHKPD..PEDHG.......................HGDGEDGNA
C8VJ15_EMENI/28-442--------------------------------DFWHCHKPD..PHEGQDADGAA.................KQTIEDENS
H2L971_ORYLA/17-387--------------------------------DDWCCHPDP.......................................
G3NNB4_GASAC/18-377--------------------------------DDWCCHPDP.......................................
A0A0C4E6U2_MAGP6/10-439--------------------------------EFWHCHKPD..DHAD....GSGGGEHGHDHD......RDGGKADDQTL
S8AD65_DACHA/9-378--------------------------------DLWHCHKPH...................................DEKG
N1QJ23_SPHMS/6-366--------------------------------DFWHCHRPH..VAHD............................HDRDP
G0WHB4_NAUDC/6-345--------------------------------DYWHCHKPD..IHNG.............................STQV
M7PCP3_PNEMU/15-353--------------------------------DYWVCCKEK.......................................
F2SJ85_TRIRC/16-422--------------------------------DLWHCHKPD..PIPSKDG.....................DTDFTSLNG
E9CUF8_COCPS/14-449--------------------------------DIWHCHKPD..SHEDGDHKDKVTHNG.............PMSTHNESA
Q6BMI9_DEBHA/5-350--------------------------------EFWHCHKPA..EDPN................................E
G8BQA7_TETPH/7-356--------------------------------DNWHCHKPS..ENND...........................SEGNNL
W5LC11_ASTMX/13-384--------------------------------DDWCCHPDP.......................................
E9IFT1_SOLIN/7-367--------------------------------DEWFCCKHN.......................................
F2UGQ3_SALR5/7-364--------------------------------DFVNCCEDD.......................................
W5NKD6_LEPOC/13-376--------------------------------DDWCCHPDP.......................................
J4KRH2_BEAB2/17-389--------------------------------EFWHCHKPI..DHDT...........................AEDGDL
R7YJ95_CONA1/9-375--------------------------------DFWHCHKPD..HRHG...........................HGARDG
S0DNZ8_GIBF5/11-387--------------------------------EFWHCHKPH..DHDH...........................QDPESL
UBE3D_MOUSE/13-363--------------------------------GEWCCHPDP.......................................
J3NIY5_GAGT3/10-440--------------------------------EFWHCHKPD..DHAD....GRDGGEHEHSHNHDLEHRQDGGKANGQTL
Q59X25_CANAL/5-335--------------------------------DFWHCHKPE..NYEK.................................
S7Z7X2_PENO1/19-451--------------------------------DFWHCHKPD..PHEHDPKSEADA................ALKLEGETA
N1JPA0_BLUG1/11-394--------------------------------DFWHCHKPD..NTQS...........HHIPDDDCSGSQENRTSTHSKM
A7USM4_ANOGA/14-433--------------------------------DDWFCHRHD.................................HQPSEG
L8FLW5_PSED2/12-402--------------------------------EFWHCHKPD..VPVG.......................EKGDEEGGDN
K1WUW9_MARBU/11-366--------------------------------DYWHCHKPD..APVALSEANGSSGQ..............ESRDFSGVA
G3JK97_CORMM/17-390--------------------------------EFWHCHKPV..EHHQ...........................PEDGHL
M3ZXU8_XIPMA/13-391--------------------------------DDWCCHPDP.......................................
A7TPW1_VANPO/6-339--------------------------------DYWHCHKPH..VEGQ...............................AV
B4MTF5_DROWI/9-373--------------------------------SDFFCHNHG.......................................
G9NH43_HYPAI/14-392--------------------------------EFWHCHKPH..EHEH...........................HDGEAL
H3AB66_LATCH/13-372--------------------------------EEWCCHPDP.......................................
B6QVW6_PENMQ/12-421--------------------------------DFWHCHKPDVHPDEKED......................QKNIEAQNA
G3Y5B6_ASPNA/22-416--------------------------------DFWHCHKPD..PPEEER......................NKEGEDPNA
G2Q453_THIHA/11-366--------------------------------EFWHCHKPDHGHHHHHHNQNHDGK...............TGKAGDESL
T5AMN1_OPHSC/15-387--------------------------------EFWHCHKPH..DHGS...........................PEDERL
G1TSQ5_RABIT/13-382--------------------------------GEWCCHPDP.......................................
S3CHW0_OPHP1/592-1020--------------------------------EFWHCHKPE.HKHDHGHDKTQPAK...............DGQATEDAL
Q75DV5_ASHGO/6-338--------------------------------DYWHCHKPA..DESA...............................GA
H0ZQP0_TAEGU/10-364--------------------------------EEWCCHPDP.......................................
G0VL18_NAUCC/6-338--------------------------------DYWHCHKPQ..VGDN...............................EL
F8PKW0_SERL3/428-814--------------------------------DAWMCHTDQ..TLHE.................................
F1Q7U1_DANRE/13-383--------------------------------DDWCCHPDP.......................................
A4D9F3_ASPFU/21-419--------------------------------DFWHCHKPD..PPEG........................HRHVEDPNA
J4G0K5_FIBRA/670-1049--------------------------------DAWMCHSDQ..KLHE.................................
K0KTK1_WICCF/8-359--------------------------------DFWHCHKPE..TDDS.................................
U1HL67_ENDPU/9-360--------------------------------DIWHCHRPQ..DIEP.......................SQGEDARQAA
B4JWU6_DROGR/9-392--------------------------------SEFFCHSHG.......................................
J7RHU2_KAZNA/6-349--------------------------------DYWHCHKPD..SRDP.................................
C5DRI9_ZYGRC/22-357--------------------------------DYWHCHKPQ..DKTS.................................
N1PZE3_DOTSN/8-375--------------------------------DFWHCHRPD..VPHD............................CDHKV
B2WD68_PYRTR/65-448--------------------------------DFWHCHKPD..EHHL........................HDHTHEHAV
B3MZV3_DROAN/9-395--------------------------------GEFFCHNHG.......................................
S3DDS5_GLAL2/11-449--------------------------------EFWHCHKPD..VPKHEQNGPNNGSSDH............KHHSHTDSN
G8ZSN1_TORDC/11-349--------------------------------DYWHCHKPH..DISK................................E
F1NWJ5_CHICK/86-460--------------------------------EEWCCHPNP.......................................
G2Y6Z9_BOTF4/11-390--------------------------------DFWHCHKPS..DHAD........................HNHENENLA
E3QET8_COLGM/12-395--------------------------------DFWHCHKPT..DHEH..........................GQHDHLA
H2RRY7_TAKRU/13-391--------------------------------DDWCCHADP.......................................
B4L5I9_DROMO/9-382--------------------------------SEFFCHNHG.......................................
I2H589_TETBL/10-368--------------------------------DYWHCHKPD..DKSV...............................AG
Q6CWI5_KLULA/6-348--------------------------------DYWHCHKPD..MEPH........................QKGHHVAAS
C0NUQ4_AJECG/14-503--------------------------------DLWHCHKPD..THADDHGDAAVGT...............VLHTHDENE
UBE3D_PONAB/13-384--------------------------------GEWCCHPDP.......................................
B4M301_DROVI/9-382--------------------------------SEFFCHNHG.......................................
C5DFR9_LACTC/6-346--------------------------------DYWHCHKPA..SSDG.................................
V5G5H4_BYSSN/14-443--------------------------------DFWHCHKPD..PHEGHDHGSHD.................DKQIEDPNA
A0A088AUY8_APIME/8-357--------------------------------DEWFCCKHN.......................................
UBE3D_BOVIN/13-384--------------------------------DEWCCHPDP.......................................
N1QC82_PSEFD/8-371--------------------------------DFWHCHRPH..VPHS............................HDHEA
E7LWJ6_YEASV/7-341--------------------------------DYWHCHKPD..VKED.................................
K7JNW4_NASVI/31-384--------------------------------QEWFCCKHS.......................................
B0WGJ1_CULQU/12-439--------------------------------NEWYCHRHD...................................TPET
F4X8J5_ACREC/7-368--------------------------------DEWFCCKHS.......................................
U4LVT7_PYROM/7-364--------------------------------DFWHCHKPH..DHVK........................EKTNKESKE
M2R8N7_COCSN/64-445--------------------------------DFWHCHKPD..EHHL........................HNHTHEHAI
Q7SDG7_NEUCR/13-419--------------------------------EFWHCHKPGDHDHDHHHHDKSNGVDANGQ..........SDRADDMSL
H6C728_EXODN/11-372--------------------------------DFWFCHKPH..DDPS...........................NEQHAA
E2C3X0_HARSA/7-364--------------------------------DEWFCCKHS.......................................
A5DWX9_LODEL/10-362--------------------------------DFWHCHKPE.....................................TG
Q9VWP0_DROME/9-387--------------------------------TEFFCHNHG.......................................
H2AW44_KAZAF/6-347--------------------------------DYWHCHKPT..INDD..............................KGN
F7E020_XENTR/11-384--------------------------------EEWCCHPDP.......................................
G1XBI8_ARTOA/9-373--------------------------------DLWHCHKPH...................................NKDG
Q16XY0_AEDAE/12-443--------------------------------NEWYCHQHP..............................HGEGKTDDT
Q29GF2_DROPS/8-383--------------------------------NEFFCHGHG.......................................
G8YFE7_PICSO/19-368--------------------------------EFWHCHKPD..IHKN.................................
Q6FK88_CANGA/6-346--------------------------------DYWHCHKPT..IGES...............................KT
U7PMZ7_SPOS1/17-440--------------------------------EFWHCHKPDVKETETAGGPGAAAK...............NGVDTGTGL
L9L4K4_TUPCH/13-384--------------------------------EEWCCHPDP.......................................
G2QZ38_THITE/12-401--------------------------------EFWHCHKPH...HHHGRGHNHEGEE..............GGKADEQSL
K5W0X4_PHACS/481-860--------------------------------DAWMCHADQ..KLHE.................................
R0KID0_SETT2/64-441--------------------------------DFWHCHKPD..EHHL........................HNHTHEHAM

PF00632

Q9BL11_CAEEL/717-1019-------------------HRLELGY-NGEIAQQALLFRKGFSESL.H......SRTLRFFQP-----------------
UBR5_MOUSE/2479-2792-------------------VVAEQPL-HA........MRKGLLDVL.P......KNSLEDLTA-----------------
A0EFC1_PARTE/672-969-------------------KLVKHQF-DL........LYSGFKSVV.D......GDGIKLFSG-----------------
Q54GG5_DICDI/425-720-------------------KSISKQF-AP........FFKGFRMVC.D......SPILKILKP-----------------
Q2GSX9_CHAGB/694-1033-------------------IQPYAQT-RA........FLRGLGMII.D......PSWLSMFNQ-----------------
Q4WHR7_ASPFU/967-1337-------------------KSIRPQF-EA........FARGFYTCL.D......RAALSIFTP-----------------
Q5KIA2_CRYNJ/1499-1843-------------------SGVAEQV-KA........FQDGFSSIF.P......IKSIKIFSL-----------------
Q5CW92_CRYPI/1231-1561-------------------TSIKLQA-EA........FLRGLSTVI.P......NESLRLFSP-----------------
A2E5Q8_TRIVA/658-966-------------------KELQKYL-NW........VRIGFLKNI.K......EGIPNSLDP-----------------
A0BRI8_PARTE/1050-1354-------------------KNVENQM-KA........FLEGFYSVI.P......RQYISIFDS-----------------
HUL5_YEAST/607-910-------------------KRCFKPV-SA........FHGGLSVII.A......PHWMEMFNS-----------------
A7SML1_NEMVE/1229-1585-------------------EGVERQM-QA........FQEGFDSVF.P......LTNLKVYYA-----------------
Q38D88_TRYB2/1472-1912-------------------ESVVMPI-RF........ITYGFRDVV.P......CEALAALDA-----------------
Q6BGB8_PARTE/609-908-------------------KQIKEQS-QI........FRAGLEQVI.D......PEKFKLFTN-----------------
A2FIB4_TRIVA/386-683-------------------ESFRSKF-ES........LAEGFRAVI.T......PELINIFSP-----------------
L9KS41_TUPCH/1283-1677-------------------RGVVQQT-EA........LVRGFYEVV.D......SRLVSVFDA-----------------
A2DAL9_TRIVA/1571-1869-------------------KETDKQI-DA........LKKGFQFVL.K......PSLFTLFTS-----------------
A4VDG4_TETTS/3915-4210-------------------REIYYQA-HA........ITSGFKEIV.C......EDLLQILDE-----------------
A2FLN6_TRIVA/2545-2849-------------------KEFNESL-EQ........LRRGFNFFF.P......APAASILAP-----------------
A4IBT8_LEIIN/1017-1343-------------------ERRRTAL-EA........MRKGFYCEPSL......EHHLKLLSP-----------------
A4IC88_LEIIN/3812-4131-------------------HEFDLQL-HK........MREGLLSVV.P......EVAVLLLTP-----------------
F6U235_XENTR/611-908-------------------KSVEKQF-KA........FRRGFHMVTNE......SPLKYLFRP-----------------
A0D2G1_PARTE/170-483-------------------QFLEPYL-SD........FLTGFYQVI.P......KTLLRIFKP-----------------
A4HF82_LEIBR/3619-3949-------------------HQYDPAF-LA........IRAGLTSVV.P......ATSLRSVRW-----------------
Q8SS57_ENCCU/454-746-------------------ALIKPQF-ES........IKRGFYSII.D......KDKLAYLDP-----------------
AREL1_MOUSE/512-823-------------------SQVKEEV-EH........FLKGLNELV.P......ENLLAIFDE-----------------
Q4E2E5_TRYCC/2646-2975-------------------HQYDELL-LA........MLSGITFVL.P......ASSLQLIRW-----------------
A7SQ93_NEMVE/299-612-------------------SSIYKQF-EA........FYHGFHSVC.A......SNALIMLRP-----------------
TOM1_YEAST/2962-3268-------------------TSVKEQM-DN........FLVGFYALI.S......KDLITIFDE-----------------
Q6C901_YARLI/697-1001-------------------TSISTTF-AE........YKKGFHSVV.G......GNALSLFRP-----------------
Q9W0H2_DROME/761-1058-------------------KSVELHY-NA........FHKGFMKVC.S......GRVIHIFQP-----------------
A0BRN4_PARTE/3724-4023-------------------TQYQDIY-TP........FISGFQSVLEI......KDLKKFFKP-----------------
NEDD4_HUMAN/1013-1318-------------------NRIQKQM-AA........FKEGFFELI.P......QDLIKIFDE-----------------
O17736_CAEEL/692-1001-------------------QRIASMV-DA........VRKGISEII.S......IEWMRMFAP-----------------
A2FPQ0_TRIVA/408-705-------------------KSVDKMF-DA........FKKGFDKLC.H......RPEFKIFTP-----------------
A2FR71_TRIVA/373-670-------------------KHIANEF-SA........FQRGFKKLE.S......LHILDYVLP-----------------
Q7PSQ3_ANOGA/541-897-------------------RGIEQQF-LA........LSKGFGELI.L......SHLLRPFDE-----------------
Q247X9_TETTS/2308-2606-------------------DEIALQT-QY........FQKGLFSII.P......EDALEALEP-----------------
A0DNI8_PARTE/201-510-------------------ISVKPFL-TA........FLSTLYSII.P......KQLLSLLEP-----------------
A5K4K7_PLAVS/1441-1991-------------------KMVQKKT-QA........FLKGLSELI.P......TKWLKLFNA-----------------
A2DQ34_TRIVA/412-708-------------------ISIAKQY-EA........FLSGFMKIS.I......SKLYKLFGA-----------------
Q5KBV2_CRYNJ/2952-3249-------------------NSIRDQI-KS........FLEGFYDII.P......QELIQIFEP-----------------
A2FXS6_TRIVA/392-692-------------------KSIQFPM-NY........LRKGFSLVC.K......AGMYQKLTP-----------------
A4VD17_TETTS/789-1090-------------------KCIENQT-KA........FMNGLTKVI.P......KNWLQMFNE-----------------
A2F7U9_TRIVA/2273-2579-------------------NSIKPTL-QL........IRQGFIDNT.K......IDSHPLLTG-----------------
Q9W196_DROME/819-1122-------------------VQIRRHC-NA........FRKGLSNVL.P......IEWLYMFSN-----------------
A2DYB1_TRIVA/1674-1977-------------------GQISTQV-DS........FLEGFHSLI.P......QKDLSMFSP-----------------
A2EDQ8_TRIVA/2183-2490-------------------NSILPLL-RE........MKAAFRRNT.G......FKHNALLTG-----------------
A4S7N1_OSTLU/131-443-------------------RRIATPM-LA........FMRGLTKII.N......QRWLRLFNV-----------------
A2EM50_TRIVA/2501-2807-------------------KLLTPLL-L.........IRNGFWKAL.D......LAPPPFVTP-----------------
Q0UNY9_PHANO/908-1229-------------------LSVQPQL-HA........FKQGFYACL.N......TKAIALFTP-----------------
A2EQW9_TRIVA/2209-2511-------------------NSVKANL-EN........MKRGFYDNL.G......FSNPSIFNS-----------------
HUL4_ASHGO/526-839-------------------RSIAPGF-ES........FRNGFFHVI.E......GNSFRLFGS-----------------
Q7QE66_ANOGA/554-863-------------------RGVLEQT-EW........LVRGFNEVV.D......HRLVAVFDA-----------------
A2E4I7_TRIVA/2634-2943-------------------KELKSNL-DI........IRQGYWENL.G......LKPPPFVTG-----------------
A5K5J0_PLAVS/8258-8564-------------------NSIKEQL-EA........FMDGFKELI.Q......PKLISIFDD-----------------
Q54QF1_DICDI/778-1120-------------------NGVKTQI-EE........YREGLFQMI.P......HSILSIFNW-----------------
UPL7_ARATH/828-1142-------------------RQIVPFS-NA........FYRGLTDLI.S......PAWLKLFNA-----------------
Q8SR14_ENCCU/2104-2410-------------------NGIELQL-SA........LKSGLFEIL.G......SKALEMFDE-----------------
MUG30_SCHPO/482-807-------------------TTVKKQF-SA........FFDGFMKVC.G......GNAISLFQD-----------------
A3FPU7_CRYPI/497-797-------------------KSIESQF-RA........FYNGFQSVC.G......GRTLELFSP-----------------
Q38A01_TRYB2/1526-1868-------------------TALARPV-SH........FIQGLRYTLIP.......YHLRLFDA-----------------
A1CTM1_ASPCL/1468-1817-------------------RGVQHQV-DA........FRAGFSQVF.P......YSALRTFTP-----------------
A2DAJ9_TRIVA/133-438-------------------NEISQYL-DL........IRSGFAINI.G......FETHPMMNA-----------------
Q7PSA4_ANOGA/2506-2929-------------------EGIAKQL-AA........FHRGFCEVF.A......LNKLAAFTP-----------------
UPL3_ARATH/1518-1888-------------------RGVTRQI-EA........FRSGFNQVF.D......ITSLQIFTP-----------------
C8VT87_EMENI/782-1089-------------------TAVARQF-EP........FRRGFFSVC.G......GNALSLFRP-----------------
Q22F29_TETTS/3359-3651-------------------EEIKEQI-QS........FLKGFYEIL.P......QRSLKYMNE-----------------
Q4UD92_THEAN/251-554-------------------RMIESQC-SA........FLQGLSSII.P......LEWLQMFSP-----------------
Q580G4_TRYB2/3999-4304-------------------RQIEEQL-QE........FLKGFYAVI.P......RKEIRNFSA-----------------
A3LSX3_PICST/660-977-------------------QSLHIQT-KY........FIEGLFGLI.S......SSWLSMFDS-----------------
A2DBI7_TRIVA/375-665-------------------KSIEKEF-EA........FFSGYNDVC.D......IPIVSLLSS-----------------
A0DLU6_PARTE/3989-4284-------------------GKFQAIT-QN........IIEGFDTVLNR......QLLMDCFDA-----------------
HACE1_MOUSE/602-909-------------------RAIQPQI-NA........FLQGFHMFI.P......PSLIQLFDE-----------------
UBE3B_HUMAN/736-1068-------------------TQIKNQT-AA........LISGFRSII.K......PEWIRMFST-----------------
A4IAG7_LEIIN/1064-1369-------------------VALENLR-H.........FQWGLLSVM.E......VEALWCLSD-----------------
A7SNF7_NEMVE/430-737-------------------DSIAAEV-KE........LAGGLNEVV.P......QDLLSFFTA-----------------
A2ERB6_TRIVA/1571-1861-------------------RDHEREY-KI........IRDGFYSVI.S......KEELNCFTP-----------------
A3GHK0_PICST/646-950-------------------EGIKKQI-TA........FSSGFKNVI.G......GNGLSLFLP-----------------
A7AV31_BABBO/1338-1643-------------------DGIRLPI-WA........FRMGFATIV.P......LSCLSLFTP-----------------
Q4Q7L2_LEIMA/1091-1400-------------------REAAEQT-RA........FCAGLHSVI.D......TNRLRLFDS-----------------
A8BYQ3_GIAIC/636-950-------------------DSVSRQF-ED........FADGFHLLV.R......SRSLTLFTP-----------------
PUB2_SCHPO/367-671-------------------TSTEEQF-NA........LKGGLNELI.P......DSVLQIFNE-----------------
Q54KP2_DICDI/1482-1898-------------------DGVIRQI-TS........FKEGFNQTF.P......ISSLKPFTI-----------------
A5DS31_LODEL/333-694-------------------TGVISQI-KA........FMEGFSKVF.P......INSLIIFSY-----------------
A2DQ30_TRIVA/383-682-------------------TSIEIPY-QY........FERGFKEVVENNDKMKASETLKCLSY-----------------
A4HPV4_LEIBR/2168-2551-------------------TVLDLAL-LH........LRQGLQHTVNP.......LYLQLFNV-----------------
A4IBF5_LEIIN/1897-2310-------------------ESVAVPL-YF........LTMGCRDVV.P......HEALTVMDV-----------------

PF09814

C1FZL9_PARBD/14-464TIKG..YGA.AN.......QIVCAPG.TV--------LIDILSFVMAE------DDCQGLEKS.................
F6W3S4_MONDO/6-378...............FANKPLHPGEN.DC--------FIGDTHLLVNV------RSDSCIPGP.................
I3ITZ6_ORENI/17-395...............FANKKLLPRAE.DC--------LMGDSFVLLAR------DGSCEQTLT.................
N4UQV1_COLOR/12-395AKRG..YGA.NS.......SIAARSG.TG--------LVDLTSLLFSE------VDCAGLVFS.................
E9EVP5_METRA/11-385ADRG..YGA.NS.......VITAQPG.TG--------FVDITSFMFDE------TNCQNLLFS.................
M1WB37_CLAP2/12-387ADKG..YGANNN.......VISAQSG.VG--------FVDIISFMFDE------RDCQNLLFS.................
E4UYL0_ARTGP/16-474HTKG..YGA.SN.......RVVCNPG.TI--------FVNVTSFIMTE------SDCRGAKIM.ARGVKFRRYRSSRRIP
A1CJR3_ASPCL/19-423QTKG..YGA.AN.......QVVARRG.TV--------LVDVVSFLVAE------EDCRGVKKV.................
C8VJ15_EMENI/28-442KVKG..YGA.SN.......QVLATPG.TV--------LVDVATFLVAA------IECKGLKKV.................
H2L971_ORYLA/17-387...............FANKKLLPRAE.DC--------LLGDTFVLLAR------DSSCTQTLT.................
G3NNB4_GASAC/18-377...............FANRKLLPRAE.DC--------LLGDTFLLLAK------DGGCAETLT.................
A0A0C4E6U2_MAGP6/10-439TGRG..YGA.NS.......RIQAQKG.VG--------FVDLATFLFAE------EDCQNIMFS.................
S8AD65_DACHA/9-378HADGGKYAG.VG.......RILAEPS.LG--------LVDPMYFLLSR------DDCENIACE.................
N1QJ23_SPHMS/6-366PTKG..YSV.DS.......TLALNPG.IG--------MVDPVDFVLAS------KDCGNLKIT.................
G0WHB4_NAUDC/6-345YNTGNAYAS...........LKPLDG.EI--------LIGGSYFMMTE------KTLKE.....................
M7PCP3_PNEMU/15-353......YNAFGNYGMLQKIKSLSDSG.II--------FVGLSYFLISE------KNLQNIKVE.................
F2SJ85_TRIRC/16-422DTKG..YGA.SN.......RVVCKPG.TV--------FVNITSFVMTQ------GDCQGAKMT.................
E9CUF8_COCPS/14-449ASKG..YGA.GN.......HTVCQAD.TV--------LVDVMNFYVTE------TNAIGVESM.................
Q6BMI9_DEBHA/5-350KDSHRNYNG..........NLKPGDN.DV--------IIGSSYFLINK------SK........................
G8BQA7_TETPH/7-356NASFLKYSQ...........LKPNNF.EI--------LIGNSFFICNS------ATLNS.....................
W5LC11_ASTMX/13-384...............FANKKLHPKQE.DC--------LLGDTYILLTR------DRSCDQSLT.................
E9IFT1_SOLIN/7-367.............CNAVSNNVQPQES.DY--------LYGSCFSVLHE------NIFRNNTCI.................
F2UGQ3_SALR5/7-364............HHTHVDLSVRIGEH.SV--------LFDDEQLLLQR------DQLITHDRQ.................
W5NKD6_LEPOC/13-376...............FAKKKLLPRKE.DC--------LLGDTFILLSW------ERDNNGTLT.................
J4KRH2_BEAB2/17-389QHRG..YGA.AS.......AITAQPG.VG--------FVDITSLLFAE------EDCGSIKFS.................
R7YJ95_CONA1/9-375EGKG..YAA.AN.......RLVARRG.TG--------FVDLGGLLLKE------EDCCVKRNT.................
S0DNZ8_GIBF5/11-387ATKG..YGA.NH.......AISAQQG.VG--------FVDLTSFLFSE------SDCRGLQYS.................
UBE3D_MOUSE/13-363...............FANRPLHPREN.DC--------FIGDSFFLVNL------KSDLEQ....................
J3NIY5_GAGT3/10-440AGRG..YGA.NS.......RIQGQKG.VG--------LVDLAMFLFAE------EDCEGIMFS.................
Q59X25_CANAL/5-335..HKKEYKG..........ILKPDNK.TI--------IIGSYYLLEKS------NR........................
S7Z7X2_PENO1/19-451QMKG..FGA.AS.......RVEAIPG.TV--------LIDVASFLLSE------ADCTNLNRY.................
N1JPA0_BLUG1/11-394TERG..YGA.NN.......SISAQHG.VG--------FVDISTFLLTE------DDCINIKVL.................
A7USM4_ANOGA/14-433APEPCHGRQQGEPSSQLSTKFEPQPG.DL--------FYGTFYALLHR------NVLQRVHVR.................
L8FLW5_PSED2/12-402TTKG..YGA.NT.......RMMAQKG.VG--------KVDLTYFLLDS------EDCSGLETN.................
K1WUW9_MARBU/11-366ASKG..YGA.NT.......RFLARSG.IG--------LINITTFLLAS------VDCKNLKGL.................
G3JK97_CORMM/17-390EHRG..YGA.AS.......AITAQPG.VG--------FVDITSFLFAE------SDCSSIKFY.................
M3ZXU8_XIPMA/13-391...............FANKKLLPRAE.DC--------LLGDTFVLLAR------DAGCDHTLT.................
A7TPW1_VANPO/6-339VDYSKKYNS...........LQPSQG.EL--------LLGPSVLCCSQ------LTLDS.....................
B4MTF5_DROWI/9-373...........SAAESHQDVLVPPER.DL--------FYGLNFIVVNI------FKIKGVMN..................
G9NH43_HYPAI/14-392SKRG..YGA.DS.......SITAQPE.SG--------FVDLTSFMFSE------SDCDGLLFS.................
H3AB66_LATCH/13-372...............FANRKLRPLKD.DC--------FLGDTFILVNS------ASVSSSVAW.................
B6QVW6_PENMQ/12-421SVKG..YGA.SN.......RVVATPR.TG--------LVDVASFLVAE------SDCHGIKVL.................
G3Y5B6_ASPNA/22-416VVKG..YGA.GN.......QLVAVEG.TV--------LVDVTSFLVKG------VDCLDSTST.................
G2Q453_THIHA/11-366AARG..YGA.SS.......SISAQKG.VG--------FVDLTTLLFDE------TDCQPLT...................
T5AMN1_OPHSC/15-387ANRG..YGA.NS.......TITARPG.VG--------FVDITLFMLSE------SDCNNLLFS.................
G1TSQ5_RABIT/13-382...............FANKPLHPREN.DC--------LIGDSFFLVKL------RSDRWQVRP.................
S3CHW0_OPHP1/592-1020AGRG..YGA.NS.......VISADAG.IG--------FVDLITLLFAE------SDCQGLKFS.................
Q75DV5_ASHGO/6-338QQYLTKYNA...........LLPADG.EL--------LVGDTFVTVGE------GLLSE.....................
H0ZQP0_TAEGU/10-364...............FARRTLHPQHG.DC--------FVGDTFFLLNS------TNESHLP...................
G0VL18_NAUCC/6-338LDYSVGRNT...........LIPLTG.EL--------LVGNSFFLLLP------STLQR.....................
F8PKW0_SERL3/428-814............QITKHGRGFWPEQG.QA--------LVGGSYVLFED------TSVVKSTIT.................
F1Q7U1_DANRE/13-383...............FANRKLLPRAG.DC--------LLGDTFILLLR------DDGCDESLT.................
A4D9F3_ASPFU/21-419QTKG..YGA.AN.......QVVATAG.TV--------LVDVATFLVSE------ADCGGLKKV.................
J4G0K5_FIBRA/670-1049...........HVSKHSNEGFWPTRS.RA--------LVGGSYILFEQ------SVVVSGNLA.................
K0KTK1_WICCF/8-359PLVLDKFKQ...........FKPKQN.GI--------LTGPFYIAINF------EDDNH.....................
U1HL67_ENDPU/9-360DSKG..YGA.ST.......KLKAAAG.IA--------FVDTASFLFAE------QSCKDVQTH.................
B4JWU6_DROGR/9-392.........TSGQEQPTSSVLVPRAT.QI--------YYGLNYIVLNM------CVVQNRISN.................
J7RHU2_KAZNA/6-349.NISAKYGA...........LKPLLN.EL--------LIGESFLETSP------ATVAG.....................
C5DRI9_ZYGRC/22-357EFYSLQKNS...........LSPCLN.EI--------LIGDSFFQALE------DTFAG.....................
N1PZE3_DOTSN/8-375AVKG..YGA.DS.......KLALQSG.VG--------MVDPTDFVLVS------EDCSNLKVS.................
B2WD68_PYRTR/65-448GQKG..YAA.GN.......RLQATQG.IG--------FVDLASFLLVE------ADCEGAQLS.................
B3MZV3_DROAN/9-395...........SGCDSKPPSLVPAET.DL--------FYGLNYVVVSL------SQTNPNILI.................
S3DDS5_GLAL2/11-449ANRG..YGA.NS.......KFIARKS.TG--------FVDPTTFLLAS------ADCSNIQGL.................
G8ZSN1_TORDC/11-349NEYSVRYNS...........LKPLKG.EI--------LLGSAFFLAQQ------DTFAG.....................
F1NWJ5_CHICK/86-460...............FARSTLLPQHG.DC--------FLGDTFLLLNS------RNQSYVPES.................
G2Y6Z9_BOTF4/11-390STKG..YGA.NT.......KFNAQPR.IG--------FMDHSTFLLAE------TDCT......................
E3QET8_COLGM/12-395TRRG..YGA.NS.......SIAAQPG.VG--------MVDLTSFLFSE------SDCTGLEFS.................
H2RRY7_TAKRU/13-391...............FANRKLLPRVD.DC--------LLGDTFFLLNR------DGSCDQTLT.................
B4L5I9_DROMO/9-382............PADKPAATLVPGPK.DL--------YYGLNYIVLNM------SVLQDRIMN.................
I2H589_TETBL/10-368QRYSVKYNG...........LQPNIN.EL--------LVGGSFFLGQS------NVFHN.....................
Q6CWI5_KLULA/6-348ETLLHRYNN..........PLNPAVG.EI--------MLSDSFIYINK------DWIPE.....................
C0NUQ4_AJECG/14-503TVKG..YGA.SN.......QVVCTSG.TV--------LIDVLSFVMAE------GDCQGLQKSKIAGNPRKGFRASDYLV
UBE3D_PONAB/13-384...............FANKPLHPQEN.DC--------FIGDSFFLVNL------RTSLWQQRP.................
B4M301_DROVI/9-382.............TVTKPATLVPRRD.DL--------YYGLNHVVLNM------TAVEAQVIN.................
C5DFR9_LACTC/6-346.MRVDRYAK...........LSPLPG.EL--------LVGNSFFLISS------SWPGN.....................
V5G5H4_BYSSN/14-443VLKG..YGA.AN.......QISASSG.TI--------LVDVASLLVAE------TDCNGLRKS.................
A0A088AUY8_APIME/8-357.............HKNIVHNLIPLQS.DI--------FYGSLFFIIHR------SLFNHHLKI.................
UBE3D_BOVIN/13-384...............FANKPLHPREN.DC--------FTGDCFYLVNL------KSDLWQPRP.................
N1QC82_PSEFD/8-371PAKG..YGA.DS.......TLRIQSG.LG--------LVDPIDFVLAP------ENCSSLKIS.................
E7LWJ6_YEASV/7-341KSSYTRFET...........LKPSKN.EI--------LIGSSYFQGTP------ATFEN.....................
K7JNW4_NASVI/31-384..............GEESFSLDPKET.DL--------FYSINYSVLNK------RLFVENLKF.................
B0WGJ1_CULQU/12-439HTEGECSSKSSSAASPHPNSFTPAET.DL--------FYGPFYAVLNC------QHLQRVHLR.................
F4X8J5_ACREC/7-368.............CNSVLNSVQPQES.DY--------LYGSCFSVLHK------SIFASNVCT.................
U4LVT7_PYROM/7-364PTGGGRYSTFGQ.......GFAVEQG.VG--------LVDRGYFLFSS------KDCDSVQIV.................
M2R8N7_COCSN/64-445GQKG..YAA.AN.......RLQAKEG.VG--------FVDLASFLLAD------SDCEGAQLS.................
Q7SDG7_NEUCR/13-419AARG..YGA.SS.......AISAQQG.VG--------FVDLTTLLFVE------QDCSNITYS.................
H6C728_EXODN/11-372ESKG..FAP.TS.......KFTASPG.AG--------LVDTVSFLLHE------KDCQNLKLF.................
E2C3X0_HARSA/7-364..............SNDIVNIETQKS.DY--------LYGSYFALLHK------NIFINNLRI.................
A5DWX9_LODEL/10-362EFNDKNFNT...........LKPSDNATV--------LIGSYYLLQLH------NEYLEISKL.................
Q9VWP0_DROME/9-387...........PAGKTQPISLVPAET.DL--------FYGLNYVVINF------NEESSCMLN.................
H2AW44_KAZAF/6-347GVLLGKYNS...........LAPLKY.EI--------LVGGSYFLGVA------ETFQD.....................
F7E020_XENTR/11-384...............FANRNCLPKVN.DC--------FLGDTFLLLNK------RNHYWSQRV.................
G1XBI8_ARTOA/9-373NSEGSRYSG.VG.......RIVAEST.VG--------LVDPMYFLLRK------EDCENITFK.................
Q16XY0_AEDAE/12-443HAHAECSSSSTKA..PHPNKFSPTEV.DL--------FYGPFYALLDR------KHLERVHLR.................
Q29GF2_DROPS/8-383......HDHGHGHGQDRPQSLLPGEK.DL--------FYGLNNVIIRM------VNLAKIVR..................
G8YFE7_PICSO/19-368.EFSKNYNG..........NLKPKGN.DA--------IIGSYYVLVNS------S.........................
Q6FK88_CANGA/6-346DAKPYDYYK..........ELKPRLN.EV--------LVGNTYFQTIG------STIDR.....................
U7PMZ7_SPOS1/17-440ANRG..YGA.NS.......TISADAD.VG--------FVDLTTLLVSE------VDCHGVLFS.................
L9L4K4_TUPCH/13-384...............FANKPLHPQEN.DC--------FIGDTFFLVNL------RSNLRQPRP.................
G2QZ38_THITE/12-401AARG..YGA.SS.......AISAQEG.VG--------FIDLTALMFAE------SDCRGVTFS.................
K5W0X4_PHACS/481-860...........HVQKGSKEGFWPADN.EA--------LVGGSYLLLRE------NAVVKVNLC.................
R0KID0_SETT2/64-441GQKG..YAA.GN.......RLQATQG.VG--------FVDLTSFLLKE------ADCEGAQLN.................

PF00632

Q9BL11_CAEEL/717-1019--------------------------------------------------------CELKEMIVG---------------
UBR5_MOUSE/2479-2792--------------------------------------------------------EDFRLLVNG---------------
A0EFC1_PARTE/672-969--------------------------------------------------------EELQALIIG---------------
Q54GG5_DICDI/425-720--------------------------------------------------------EELGNLVCG---------------
Q2GSX9_CHAGB/694-1033--------------------------------------------------------NELQRLVGG---------------
Q4WHR7_ASPFU/967-1337--------------------------------------------------------EAFKTVVEG---------------
Q5KIA2_CRYNJ/1499-1843--------------------------------------------------------DELYLLF.G---------------
Q5CW92_CRYPI/1231-1561--------------------------------------------------------YELQSLISG---------------
A2E5Q8_TRIVA/658-966--------------------------------------------------------DTLEFSCCG---------------
A0BRI8_PARTE/1050-1354--------------------------------------------------------IQLEQLLCG---------------
HUL5_YEAST/607-910--------------------------------------------------------IELQMLISG---------------
A7SML1_NEMVE/1229-1585--------------------------------------------------------VNMDQLLCG---------------
Q38D88_TRYB2/1472-1912--------------------------------------------------------SEAMSLLCG---------------
Q6BGB8_PARTE/609-908--------------------------------------------------------QELQLLISG---------------
A2FIB4_TRIVA/386-683--------------------------------------------------------QDLDQIVSG---------------
L9KS41_TUPCH/1283-1677--------------------------------------------------------RELELVIAG---------------
A2DAL9_TRIVA/1571-1869--------------------------------------------------------SEIGSIICG---------------
A4VDG4_TETTS/3915-4210--------------------------------------------------------QMLSFIFSG---------------
A2FLN6_TRIVA/2545-2849--------------------------------------------------------WELELIICG---------------
A4IBT8_LEIIN/1017-1343--------------------------------------------------------SDLLLLLCG---------------
A4IC88_LEIIN/3812-4131--------------------------------------------------------EELELRVCG---------------
F6U235_XENTR/611-908--------------------------------------------------------EEIELLICG---------------
A0D2G1_PARTE/170-483--------------------------------------------------------QELEMILFG---------------
A4HF82_LEIBR/3619-3949--------------------------------------------------------EDLRARVCG---------------
Q8SS57_ENCCU/454-746--------------------------------------------------------KELEKIMMG---------------
AREL1_MOUSE/512-823--------------------------------------------------------NELELLMCG---------------
Q4E2E5_TRYCC/2646-2975--------------------------------------------------------DDLQQRVCG---------------
A7SQ93_NEMVE/299-612--------------------------------------------------------EEVEMLVCG---------------
TOM1_YEAST/2962-3268--------------------------------------------------------QELELLISG---------------
Q6C901_YARLI/697-1001--------------------------------------------------------EELEALVKG---------------
Q9W0H2_DROME/761-1058--------------------------------------------------------EELMAVVVG---------------
A0BRN4_PARTE/3724-4023--------------------------------------------------------NDMGLITLG---------------
NEDD4_HUMAN/1013-1318--------------------------------------------------------NELELLMCG---------------
O17736_CAEEL/692-1001--------------------------------------------------------HELQIMIAG---------------
A2FPQ0_TRIVA/408-705--------------------------------------------------------DELQVLVSG---------------
A2FR71_TRIVA/373-670--------------------------------------------------------DELDILVSG---------------
Q7PSQ3_ANOGA/541-897--------------------------------------------------------RELELLISG---------------
Q247X9_TETTS/2308-2606--------------------------------------------------------DDFISFYQG---------------
A0DNI8_PARTE/201-510--------------------------------------------------------LELEMILYG---------------
A5K4K7_PLAVS/1441-1991--------------------------------------------------------HELKTLISG---------------
A2DQ34_TRIVA/412-708--------------------------------------------------------DELDILVSG---------------
Q5KBV2_CRYNJ/2952-3249--------------------------------------------------------DQLELLISG---------------
A2FXS6_TRIVA/392-692--------------------------------------------------------DELDLCMSG---------------
A4VD17_TETTS/789-1090--------------------------------------------------------NEVQMLISG---------------
A2F7U9_TRIVA/2273-2579--------------------------------------------------------ARLSHMAQG---------------
Q9W196_DROME/819-1122--------------------------------------------------------KELQILISG---------------
A2DYB1_TRIVA/1674-1977--------------------------------------------------------NELDLLICG---------------
A2EDQ8_TRIVA/2183-2490--------------------------------------------------------ALLSRMAQG---------------
A4S7N1_OSTLU/131-443--------------------------------------------------------TELSLLLSG---------------
A2EM50_TRIVA/2501-2807--------------------------------------------------------QLLEFLACG---------------
Q0UNY9_PHANO/908-1229--------------------------------------------------------YTLRHLVEG---------------
A2EQW9_TRIVA/2209-2511--------------------------------------------------------NLISYLAQG---------------
HUL4_ASHGO/526-839--------------------------------------------------------EELEQLVCG---------------
Q7QE66_ANOGA/554-863--------------------------------------------------------SELELVISG---------------
A2E4I7_TRIVA/2634-2943--------------------------------------------------------DIIRSCCSP---------------
A5K5J0_PLAVS/8258-8564--------------------------------------------------------KELELLISG---------------
Q54QF1_DICDI/778-1120--------------------------------------------------------KELEMLICG---------------
UPL7_ARATH/828-1142--------------------------------------------------------HEFNQLLSG---------------
Q8SR14_ENCCU/2104-2410--------------------------------------------------------SELELLICG---------------
MUG30_SCHPO/482-807--------------------------------------------------------NEISKLIRG---------------
A3FPU7_CRYPI/497-797--------------------------------------------------------EELVLVICG---------------
Q38A01_TRYB2/1526-1868--------------------------------------------------------RELQLVISG---------------
A1CTM1_ASPCL/1468-1817--------------------------------------------------------SELVMLF.G---------------
A2DAJ9_TRIVA/133-438--------------------------------------------------------TLIALLVQG---------------
Q7PSA4_ANOGA/2506-2929--------------------------------------------------------DEIRKMLCG---------------
UPL3_ARATH/1518-1888--------------------------------------------------------SELDYLLCG---------------
C8VT87_EMENI/782-1089--------------------------------------------------------EEIELLVRG---------------
Q22F29_TETTS/3359-3651--------------------------------------------------------QELGLLLSG---------------
Q4UD92_THEAN/251-554--------------------------------------------------------SELELLISG---------------
Q580G4_TRYB2/3999-4304--------------------------------------------------------QELELVICG---------------
A3LSX3_PICST/660-977--------------------------------------------------------FELQMLISG---------------
A2DBI7_TRIVA/375-665--------------------------------------------------------RDLELCVSG---------------
A0DLU6_PARTE/3989-4284--------------------------------------------------------TEMHTLTVG---------------
HACE1_MOUSE/602-909--------------------------------------------------------YELELLLSG---------------
UBE3B_HUMAN/736-1068--------------------------------------------------------PELQRLISG---------------
A4IAG7_LEIIN/1064-1369--------------------------------------------------------EERSMLICG---------------
A7SNF7_NEMVE/430-737--------------------------------------------------------DEFSLLING---------------
A2ERB6_TRIVA/1571-1861--------------------------------------------------------LEVELAICG---------------
A3GHK0_PICST/646-950--------------------------------------------------------EEIQLLLCG---------------
A7AV31_BABBO/1338-1643--------------------------------------------------------LELSSQMFS---------------
Q4Q7L2_LEIMA/1091-1400--------------------------------------------------------NEVGKLFGG---------------
A8BYQ3_GIAIC/636-950--------------------------------------------------------ADLEIALCG---------------
PUB2_SCHPO/367-671--------------------------------------------------------NELDTLLNG---------------
Q54KP2_DICDI/1482-1898--------------------------------------------------------SEVESLLCG---------------
A5DS31_LODEL/333-694--------------------------------------------------------KELVELF.G---------------
A2DQ30_TRIVA/383-682--------------------------------------------------------DELQELVCG---------------
A4HPV4_LEIBR/2168-2551--------------------------------------------------------GELGRLLGS---------------
A4IBF5_LEIIN/1897-2310--------------------------------------------------------KELIGVLCG---------------

PF09814

C1FZL9_PARBD/14-464.................................KPSLSSSSAYDTYNGDQQSASKTHPVVSLSCS.....WCGAIVGE..
F6W3S4_MONDO/6-378.................................EIAQAETHQ...LS.ESHLESKPKANTKIICK.....RCKAMLGE..
I3ITZ6_ORENI/17-395...................................EEVSPVG...TEDSQDPKKPCRRLALISCA.....SCSSVLGE..
N4UQV1_COLOR/12-395..............................TSSYDTGSGSSA...AVLLGTAAEPVPRMLYVFCK.....SCESHVGF..
E9EVP5_METRA/11-385.................................MSTLAKAAR...NSSDALADAAPPKFLHIFCG.....ACEAEIGL..
M1WB37_CLAP2/12-387.................................ASNAAQASG...SSSEALANASLESYLHVFCS.....QCKAEVGS..
E4UYL0_ARTGP/16-474CIELSQRPVGQFEIRSKIHGCKTALTVVMVANYSLYNANPGA...PCDHGTDSSSVLPVSNLCCK.....SCGSTIGE..
A1CJR3_ASPCL/19-423...............................................QTLASGETPKDSSSLACD.....TCDSLLGT..
C8VJ15_EMENI/28-442.............................................SKGHPKSINVPLSEQELQCE.....NCGTLIGV..
H2L971_ORYLA/17-387...................................EE................KACRRVTFISCA.....SCSSVLGE..
G3NNB4_GASAC/18-377...................................EE................KPCRRLALISCK.....SCSLVLGE..
A0A0C4E6U2_MAGP6/10-439.................................PSPAGDLLK...SPPLDIPAATPVRHLSASCA.....SCQSTIGY..
S8AD65_DACHA/9-378...................................................KHVGTNEADTITCQ.....TCEAPLGI..
N1QJ23_SPHMS/6-366.............................................SS....HNSQNKEAGQLECV.....SCSTVLGH..
G0WHB4_NAUDC/6-345.............................................RI....CIDDNEDNSSLYCG.....QCSCKLGE..
M7PCP3_PNEMU/15-353..........................................................KNKALCN.....FCHMNIGI..
F2SJ85_TRIRC/16-422....................................IAKGDS...SFDQGINSFPPHSVPNLCCK.....SCGSTVGE..
E9CUF8_COCPS/14-449..............................VPPLDESKNAADAERQRRQEKEETSRCSHLPVRCT.....KCLGIVGQ..
Q6BMI9_DEBHA/5-350.....................................................QLEISDQDVKCG.....LCKYNLGI..
G8BQA7_TETPH/7-356...................................................KVIIDSKLNIVGCK.....NCNSIIGE..
W5LC11_ASTMX/13-384......................................QEVD...LSHQQSEKTPGHKTVGVLCK.....KCSAVLGE..
E9IFT1_SOLIN/7-367.........................................................DNKTLTCN.....KCLLHIGT..
F2UGQ3_SALR5/7-364..................................................PLDTSTLSDEVVRCE.....RCLASIGA..
W5NKD6_LEPOC/13-376................................................QEPETLKPKENVKVICK.....NCRAVLGE..
J4KRH2_BEAB2/17-389.................................SSNPLEKFD...SSQDAIQATKEEKFLTISCS.....NCATEVGT..
R7YJ95_CONA1/9-375...................................................SDHERSKLQQLLCL.....GCGGLVGT..
S0DNZ8_GIBF5/11-387.................................SSTPDARFD...LSSLALNDDESKKFLHIYCR.....ECTTEVGL..
UBE3D_MOUSE/13-363......................................................EPKANTKVICK.....RCKVTLGE..
J3NIY5_GAGT3/10-440.................................PSSPGDFLE...SPSLDVLAGAPARHLGASCS.....LCESTIGY..
Q59X25_CANAL/5-335.....................................................NIVKIQDSITCN.....KCGQLLGE..
S7Z7X2_PENO1/19-451..........................IGTTRHTDLVIAWQAC...IEGSETGNATSPLERSLQCT.....KCEGIVGM..
N1JPA0_BLUG1/11-394........................................................................KNEVGT..
A7USM4_ANOGA/14-433.........................................................NDRFVYCK.....RCLQYLGS..
L8FLW5_PSED2/12-402........................................................PSSLSLACT.....SCAALIGT..
K1WUW9_MARBU/11-366...........................................................................LGL..
G3JK97_CORMM/17-390.................................SSKSAARFH...DSDSAIKATLEEKFLSISCS.....NCAADIGT..
M3ZXU8_XIPMA/13-391...................................QEVTSVG...SADGQDPKKPCHRLALVSCA.....SCSSVLGE..
A7TPW1_VANPO/6-339....................................................SRITIAEGSVVCV.....SCDSLLGV..
B4MTF5_DROWI/9-373.........................................................RGGQLYCQ.....RCLGLVGN..
G9NH43_HYPAI/14-392.................................HPASDASFD...SVKEAIDEADPVKPLRVSCK.....ACKAEIGM..
H3AB66_LATCH/13-372......................................................EPKPTTALLCLESGGIKCSFTLG...
B6QVW6_PENMQ/12-421.....................................EQRPT...SNSVKSTLYGGKNPMNLGCS.....RCSAIIGT..
G3Y5B6_ASPNA/22-416...............................................QPDPNKETETEPTILTCT.....TCTTQLGL..
G2Q453_THIHA/11-366...........................................................................LGF..
T5AMN1_OPHSC/15-387..................................PSTRATFN...TSAQAMGDELPRKHVHILCS.....GCNSEVGL..
G1TSQ5_RABIT/13-382.................................KLVPVGRFY...ISFENHFKLEPKANTKVICK.....RCKVILGE..
S3CHW0_OPHP1/592-1020................ASTYEHASDRESILAADSTLQTQTQI...QAQAQTNQTKAMRGLNVFCA.....SCGAQIGY..
Q75DV5_ASHGO/6-338.....................................................KLAMSGTAVLCK.....ACRAPLGA..
H0ZQP0_TAEGU/10-364......................................................KSKENTRVICK.....RCKVMLGE..
G0VL18_NAUCC/6-338.....................................................QAAMKHEELTCL.....KCNSILGD..
F8PKW0_SERL3/428-814.................................TTERPKSIS...VDTKRPISTTAEDWRLVRCM......CGAMVGR..
F1Q7U1_DANRE/13-383....................................................RAAAEKRVLVSCR.....RCSTALGE..
A4D9F3_ASPFU/21-419..............................................QQPTPEESAQKKEISLNCA.....NCNASIGI..
J4G0K5_FIBRA/670-1049.............................................RVEELIERKHVDDWQRVRCI......CGAIVGR..
K0KTK1_WICCF/8-359.....................................................KLIKDEFKLKCK.....NCETFIGESC
U1HL67_ENDPU/9-360..........................................................NSELHCA.....TCKALLGA..
B4JWU6_DROGR/9-392.........................................................ISGNLYCK.....RCMRMLGS..
J7RHU2_KAZNA/6-349.....................................................STEVNDLRVNCS.....KCGTKLGE..
C5DRI9_ZYGRC/22-357....................................................RTTVVDENIAMCS.....NCKKPLGR..
N1PZE3_DOTSN/8-375..................................................SSASSTSADDQLLCC.....NCDTCIGH..
B2WD68_PYRTR/65-448...................................................PAEEGTQSASVVCK.....HCNHTIGT..
B3MZV3_DROAN/9-395.........................................................REDHLYCR.....RCMRFLGL..
S3DDS5_GLAL2/11-449........................................QK...SE....LSNKQLDYQPLSCL.....GCNQYLGI..
G8ZSN1_TORDC/11-349.....................................................RVKTENGFLQCA.....KCSASLGE..
F1NWJ5_CHICK/86-460................................PKCSSETE.H...HASQNDSTLKSKENTRVICE.....RCKSTLGE..
G2Y6Z9_BOTF4/11-390..................................................LPPGGNEIKRTIKCE.....VCLATIGT..
E3QET8_COLGM/12-395.............................SSPSRGASSDTTS...SAVLAGGPDPPPRMLHAFCA.....GCGAQVGF..
H2RRY7_TAKRU/13-391...................................EEVKPAG...SEDVQDPKKTCRRLALVSCK.....SCSSGVGE..
B4L5I9_DROMO/9-382.........................................................RADHLYCK.....RCMWMLGL..
I2H589_TETBL/10-368......................................................IKMDRNIIRCK.....TCNTLIGE..
Q6CWI5_KLULA/6-348.....................................................KFIYDEELVRSR.....SCNTVIGS..
C0NUQ4_AJECG/14-503LSPTAAQSIMMKEARKWENRGPNQMSGSSIRSEILPLSSTSRHIGNGNQPANETKFQPVVDLSCS.....RCSAVVGE..
UBE3D_PONAB/13-384.................................ELSPVEMCC...VSSDNHCKLEPKANTKVICK.....RCKVMLGE..
B4M301_DROVI/9-382.........................................................RSEHLYCK.....RCMWMLGL..
C5DFR9_LACTC/6-346.....................................................QLSFEGDNTACS.....KCSSVLGC..
V5G5H4_BYSSN/14-443.............................................QNEGISQTGNPSSRVYLECE.....SCGATIGT..
A0A088AUY8_APIME/8-357.........................................................KENTVICN.....RCLQYIGK..
UBE3D_BOVIN/13-384.................................EGAPVETHH...LSSENHLKLKPKANTKVICK.....RCKVMLGE..
N1QC82_PSEFD/8-371...................................................SIASSDHDEILRCS.....TCNTIVGH..
E7LWJ6_YEASV/7-341....................................................VATTKENDNVLCI.....KCSAVLGQ..
K7JNW4_NASVI/31-384.........................................................KNSIIHCN.....RCLSILGSFD
B0WGJ1_CULQU/12-439.........................................................ADRFLYCK.....CCLQFLGV..
F4X8J5_ACREC/7-368.........................................................DNKTLSCN.....KCLLHIGT..
U4LVT7_PYROM/7-364..........................................................DEKVTCS.....SCNSILGA..
M2R8N7_COCSN/64-445.................................................VEENKEEERPQSILCK.....NCTQPLGI..
Q7SDG7_NEUCR/13-419...............................LSTPEHGSPDR...QVVASDESSNQVRSLNVFCS.....SCQSQLGF..
H6C728_EXODN/11-372...................................................KHASRAGAYVVKCF.....GCGTTIGS..
E2C3X0_HARSA/7-364.........................................................DNKTLTCD.....KCFLHIGA..
A5DWX9_LODEL/10-362.........................................................DPSVYICR.....NCGNEIGE..
Q9VWP0_DROME/9-387.........................................................RDDHLYCQ.....RCMRYLGL..
H2AW44_KAZAF/6-347.....................................................RVEYDSDNLVCA.....TCHNNLGQ..
F7E020_XENTR/11-384................................QWIASEMAIK...MGTSNICNLKSKENTKVICK.....RCKAMLGE..
G1XBI8_ARTOA/9-373....................................................QTGSNEAETTICQ.....VCDIPLGI..
Q16XY0_AEDAE/12-443.........................................................AERFLYCK.....RCLQFLGT..
Q29GF2_DROPS/8-383.........................................................RGEHLHCQ.....RCMRFLGM..
G8YFE7_PICSO/19-368.....................................................TGNVKDGQVVCG.....QCNHVLGS..
Q6FK88_CANGA/6-346....................................................KVVVQTDGSVDCS.....NCRSTLGY..
U7PMZ7_SPOS1/17-440..................ESTVDKASSRLDEVLSTVQTAATN...AAATTANTVAAPRGLSVFCA.....ACRAQVGY..
L9L4K4_TUPCH/13-384.................................ELAPVEMHC...LSSENHFKSVPKANTKVICE.....RCKVILGE..
G2QZ38_THITE/12-401..............................LSTFEQGSSDRQ...SVPLTDPPTSPTRNLNIFCS.....SCRAQLGL..
K5W0X4_PHACS/481-860..............................................GVQGLDANKVDDWSRVRCI......CGAVVGR..
R0KID0_SETT2/64-441.....................................................VKEEGSSSIMCK.....HCQSMIGT..

PF00632

Q9BL11_CAEEL/717-1019---NE....N..-----YDWNEFRDILMY...RGE....YS.....SSH..........................PTIQA
UBR5_MOUSE/2479-2792---CG....E..-----VNVQMLISFTSFNDESGENAEKLL..................................QFKRW
A0EFC1_PARTE/672-969---LP....H..-----FDLKDLELVTKY....DG....FD.....DKS..........................EYIRY
Q54GG5_DICDI/425-720---VE....D..-----LNFIELERGTNY...EGG....YT.....QDD..........................TTIKN
Q2GSX9_CHAGB/694-1033---DS....S.E-----IDVEDLRKHTAY...SGV....YEIGDDGQEH..........................PTVKL
Q4WHR7_ASPFU/967-1337---IQ....E..-----IDLGELERHARY...EGG....FG.....PHH..........................RVIQD
Q5KIA2_CRYNJ/1499-1843---NA....DED-----WSRETLEVAIKA...DHG....YN.....QDS..........................RAVQN
Q5CW92_CRYPI/1231-1561---VY....Q.K-----LDVNNLRLNTCY...TG.....YT.....ETS..........................QQIIW
A2E5Q8_TRIVA/658-966---DPECSYENL-----VKIVRFEEISE...............................................DQQSI
A0BRI8_PARTE/1050-1354---QT......Y-----IDVDDLISNLQY...VD.....YA.....PQD..........................QVIIW
HUL5_YEAST/607-910---ER....D.N-----IDLDDLKSNTEY...GG.....YK.....EED..........................QTIVD
A7SML1_NEMVE/1229-1585---SV....GQK-----WEVKELVESCRP...DHG....YS.....HDS..........................RAIKC
Q38D88_TRYB2/1472-1912---NRIRDSEPL-----WTAAEIKSIIVP...DHG....YN.....SES..........................PQITM
Q6BGB8_PARTE/609-908---.Q....P.V-----IDIQDLISNTKY...QG.....YQ.....PYD..........................KTIED
A2FIB4_TRIVA/386-683---SP....Q..-----YDWPALKKATRY...V.G....YQ.....MNS..........................RAIKN
L9KS41_TUPCH/1283-1677---TA....E..-----IDLNDWRNNTEY...RGG....YH.....DGH..........................LVIRW
A2DAL9_TRIVA/1571-1869---EQ......K-----TDVEELIKNFEILPPLS............QEH..........................PIVQM
A4VDG4_TETTS/3915-4210---NP....E..-----ISIPELKETIQL...QG.....YT.....KND..........................KQIKW
A2FLN6_TRIVA/2545-2849---DN......E-----CPIEDMKRNCSF...P.............AND..........................PSSTM
A4IBT8_LEIIN/1017-1343---QLHVSAQVI-----VDALEFQGFG...................RNS..........................NTPKY
A4IC88_LEIIN/3812-4131---QA......D-----YTPEELRKGASYEGLT.............SED..........................RRVQL
F6U235_XENTR/611-908---SR....N..-----LDFQALKDTTEY...DGG....YT.....RDS..........................NIIKE
A0D2G1_PARTE/170-483---LP......F-----IDLQDWSKYTIYKDCS.............AED..........................YFIIW
A4HF82_LEIBR/3619-3949---TAPASSEHV-----IAELDMSPLSP...............................................SMRAI
Q8SS57_ENCCU/454-746---SN......T-----FDIKAIRSTTTY...SG.....FR.....EDS..........................PIIVY
AREL1_MOUSE/512-823---TG....D..-----INVSDFKAHAVV...VGG...SWH.....FRE..........................KVMRW
Q4E2E5_TRYCC/2646-2975---NSCATAEDV-----ISSLDLSLLSE...............................................ELCHM
A7SQ93_NEMVE/299-612---NP....E..-----LDMEALKKVTVY...D.G....YS.....KND..........................NTIRY
TOM1_YEAST/2962-3268---LP....D..-----IDVDDWKNNTTY...VN.....YT.....ATC..........................KEVSY
Q6C901_YARLI/697-1001---SS....E.P-----LDIGTLKTVTRY...QNF.....T.....TEDPE......................SELVVRW
Q9W0H2_DROME/761-1058---NE....D..-----YDWQALQDNCEY...REG....YT.....SVD..........................DTIKW
A0BRN4_PARTE/3724-4023---VQDIKPEQI-----LNILSFKGGQDY...............................................HISF
NEDD4_HUMAN/1013-1318---LG....D..-----VDVNDWREHTKY...KNG....YS.....ANH..........................QVIQW
O17736_CAEEL/692-1001---YE....E.V-----FTAKELRKFCELRFAAGTQDINYE.....................................EM
A2FPQ0_TRIVA/408-705---ED....V..-----FDWDALRLGTKY...IEG....YK.....ETS..........................TSVKM
A2FR71_TRIVA/373-670---LP....T..-----RDWNIFKKGVKY...ENG....YS.....QNS..........................EPVIW
Q7PSQ3_ANOGA/541-897---IS....K..-----IDVNDWKANTRL...KQ.....CT.....ADT..........................PQIVW
Q247X9_TETTS/2308-2606---VQ....E..-----IDIQYLKKKMKY...EG.....FK.....STD..........................KIIEW
A0DNI8_PARTE/201-510---TP......F-----IDINDWKDNTDY...KGA....YY.....RTH..........................QTIQW
A5K4K7_PLAVS/1441-1991---ND....K.C-----FDVDDLRRNVVY...GGG....YN.....ANS..........................ETVLN
A2DQ34_TRIVA/412-708---EA....V..-----LDWAALKKNAKY...IDG....YT.....KDS..........................QQIIW
Q5KBV2_CRYNJ/2952-3249---IT....T..-----VDVDELKNATQL...NG.....WK.....ATD..........................PEVAW
A2FXS6_TRIVA/392-692---EE....K..-----IDWDFIKRNTEY....SG....YH.....KYD..........................ITIIR
A4VD17_TETTS/789-1090---QE....K.G-----IDIENLKSNTKY...EGG....YG.....SWD..........................FYIRD
A2F7U9_TRIVA/2273-2579---SN......V-----ITTQQLRSITQVNDYKG............LED..........................KNIRW
Q9W196_DROME/819-1122---AE....I.P-----IDLEDLKKHCEY...GGE....FS.....PEH..........................PSIVT
A2DYB1_TRIVA/1674-1977---VP....E..-----VDVDDMEKNCVI...TRP....LT.....KDS..........................DVVKF
A2EDQ8_TRIVA/2183-2490---SG......D-----ISVQHLKQITHVSDFEDG...........IKN..........................EYVKR
A4S7N1_OSTLU/131-443---GE....S.A-----IDVDDWELHTRY...SGG....YS.....SSS..........................ATVRN
A2EM50_TRIVA/2501-2807---DR......T-----ISVSKLRALTEFQGAPR.........................................KMIDI
Q0UNY9_PHANO/908-1229---EQ......H-----ISIPALRRCARY...EDG....YS.....ATH..........................PTIIT
A2EQW9_TRIVA/2209-2511---SR......T-----VTTQAFKSITSMLAPTN.........................................QQERY
HUL4_ASHGO/526-839---SN....EQS-----LDVSMLRSVTRY...QG......G.....FDDN........................SPVVQW
Q7QE66_ANOGA/554-863---TV....E..-----IDVHDWRANTEY...RGG....YH.....DTH..........................HVIMW
A2E4I7_TRIVA/2634-2943---PNELTAEAI-----LSVTEFDHGLPK..............................................ELKDL
A5K5J0_PLAVS/8258-8564---IP....T..-----IDLNDLKENVEY...HN.....YS.....PNS..........................IQIIW
Q54QF1_DICDI/778-1120---RE....R..-----INLDDLKQHSSF...TGY....FN.....Q............................TLIDE
UPL7_ARATH/828-1142---GN....H.D-----IDVDDLRRNTKY...TGG....YS.....DSS..........................RTIKI
Q8SR14_ENCCU/2104-2410---IP....D..-----IDVDDWKNNTLY...YG.....YA.....ENS..........................KTVIW
MUG30_SCHPO/482-807---SE....E.V-----IDWELLKNVCVY....DF....YD.....QNAISNSISESEPSMTASKYLCHSFVSKRKIILW
A3FPU7_CRYPI/497-797---SS....D..-----FNIDSLIEASQY...QDG....YT.....KDS..........................TTVVM
Q38A01_TRYB2/1526-1868---PE...GKIW-----ESAGDLLTVITT...NHG....YD.....KNS..........................LVVAY
A1CTM1_ASPCL/1468-1817---RA....EED-----WTIETLMDSIKA...DHG....FN.....MDS..........................KSVRN
A2DAJ9_TRIVA/133-438---SN......V-----ITTAQLRQITTFDGFNK............SNE..........................YVISN
Q7PSA4_ANOGA/2506-2929---EQ....NPE-----WTREDIMTYTEP...KLG....YT.....KES..........................PGFLR
UPL3_ARATH/1518-1888---RR....E.L-----WEVETLAEHIKF...DHG....YN.....AKS..........................PAIIN
C8VT87_EMENI/782-1089---SD....E.Q-----LDVKSLRAVATY..LNWG....TP.....KPES........................VPVVRW
Q22F29_TETTS/3359-3651---VK....K..-----IDVDDMKKHMRY...YR.....YN.....KDS..........................QIIQW
Q4UD92_THEAN/251-554---SS....E.V-----IDISDLRKNTIY...AGG....FD.....ETN..........................ATIQW
Q580G4_TRYB2/3999-4304---MP....D..-----IDVEDLRLNTTY...DG.....YT.....STS..........................LQIRW
A3LSX3_PICST/660-977---GQ....N.D-----INILDWKNNVEY...GG.....YL.....DSD..........................ITVRY
A2DBI7_TRIVA/375-665---EE....T..-----YNWIELQQSAGY....NG....YD.....KSS..........................KSVQY
A0DLU6_PARTE/3989-4284---SS....E..-----IKPEKVLELMIY..........IN.....GSD..........................QLIQF
HACE1_MOUSE/602-909---MP....E..-----IDVNDWIKNTEY...TSG....YE.....RED..........................PVIQW
UBE3B_HUMAN/736-1068---DN....A.E-----IDLEDLKKHTVY...YGG....FH.....GSH..........................RVIIW
A4IAG7_LEIIN/1064-1369---SDAKADGPL-----FTEEELRAQTTM...GSG....YS.....SGS..........................VHVEM
A7SNF7_NEMVE/430-737---VS....K..-----IDVQDWRANTLY...RG.....CK.....ESD..........................EIITW
A2ERB6_TRIVA/1571-1861---YS......V-----IDVEDFIKCCSY...EHP....FT.....KDH..........................QTVKM
A3GHK0_PICST/646-950---SE....EGG-----IDVDVLKSVTKY...VGW....KT.....PDDGA......................DSTVVQW
A7AV31_BABBO/1338-1643---VVD..QDCF-----WTVDHLEMYLIP...DHG....YD.....VSS..........................SAYRY
Q4Q7L2_LEIMA/1091-1400---DE....TGQ-----IDLEDWKANTVYDKPED............VNT..........................PQVRL
A8BYQ3_GIAIC/636-950---EP....N..-----LDFIALKNNTKY...DEP....LS.....PTH..........................PLIIW
PUB2_SCHPO/367-671---KR....D..-----IDVQDWKRFTDY...RS.....YT.....ETD..........................DIVIW
Q54KP2_DICDI/1482-1898---SLT.GSESD-----WTLDSLMDSTKA...DHG....YT.....LQS..........................KSVQN
A5DS31_LODEL/333-694---NA....EED-----WSFDALSSAINA...NHG....YN.....KES..........................EGIKN
A2DQ30_TRIVA/383-682---SQ....K..-----FDWSEFKRNVKY...SGQ....YT.....PTS..........................KTIQM
A4HPV4_LEIBR/2168-2551---PLD..VKVW-----ETREQFARNVEA...AHG....YH.....IKS..........................DVVQY
A4IBF5_LEIIN/1897-2310---EDKNPSDPL-----WTTEEIRSVLVG...DHG....YR.....NDS..........................PQLEL

PF09814

C1FZL9_PARBD/14-464...EDT..SFPS.....LRLYKTNVSVLQ----------KP-----KDEISS...............DDDLWESYPVDMI
F6W3S4_MONDO/6-378...TDSSGT........TKFYITEIIIQP----------SG-----RDFDMIPRS...................QFVQSV
I3ITZ6_ORENI/17-395...AVTPET........LKLYVTQVVVEP----------AV-----GDRKPEASLNRS................LFVERT
N4UQV1_COLOR/12-395...FNV..AIAS.....VVLLKWRVSCRT----------TE-----PSSP........................PSSPDC
E9EVP5_METRA/11-385...FNV..KIGS.....VNLFKWQVKCNT----------TV-----PSNR.......................VPSGPEC
M1WB37_CLAP2/12-387...YSI..KTDS.....VLLLKPHVSCRT----------IV-----RMKQ.......................PPTILSW
E4UYL0_ARTGP/16-474...VQK..HLQG.....VELFKASVSVSH----------EA-----GCATATRM.............DRDVLETYPPEMI
A1CJR3_ASPCL/19-423...EDP..VAQG.....WRLFKTSLSATI----------AN-----PST..................PQPTWHSPPTESI
C8VJ15_EMENI/28-442...EDT..IARG.....WRLFKASLAAEG----------RL-----.....................EEGSLEAHPTELI
H2L971_ORYLA/17-387...AVSPEA........LKLYITQVVVEP----------AV-----GDPKPEAAQSRTDPEEGKIWF.......HFLERT
G3NNB4_GASAC/18-377...AVAPET........LKLYITQVVVEP----------AV-----GDRQPEASLNRS................LFLQQT
A0A0C4E6U2_MAGP6/10-439...YSF..GPSA.....VALLKWQVLIQE----------EP-----EATV....................ALPSPSIGQC
S8AD65_DACHA/9-378...VDA..KSDG.....IRLMKWSLLLGC----------GQ-----ESSSNEG..............DGDRLESYTMVQW
N1QJ23_SPHMS/6-366...VH...TSGG.....YKLRKLHLAATS----------AI-----DQPSR......................SYEAEKW
G0WHB4_NAUDC/6-345...RSTNNL........LKIYKWQLTLET----------LD-----GLSH........................FAPKDD
M7PCP3_PNEMU/15-353...LIEDG.........IKLYKWKLAEKN----------ME-----KIIS........................FDIDIF
F2SJ85_TRIRC/16-422...MQN..SLQG.....IELFKASVSISH----------QE-----NCASGTCI.............DKNLLENYPPELI
E9CUF8_COCPS/14-449...MQP..SING.....LVLFKSDLMASR----------PL-----QNSSGGGV.............LANDCEIYPADMI
Q6BMI9_DEBHA/5-350...LDNST.........LKLFKWNLALKY----------KE-----NIET........................FPSYIY
G8BQA7_TETPH/7-356...INQDKL........CQIFKWKLLLNG----------ED-----K...........................YPIYKH
W5LC11_ASTMX/13-384...AVTTDV........IKFYITEIVVKQ----------SE-----DEECAVTQHRQ.................QFLERS
E9IFT1_SOLIN/7-367...FHAYNL........FKIWNCCVDYKP----------QN-----NALS........................TVNATN
F2UGQ3_SALR5/7-364........CAVFQGQPCVSLHRHAVHMDG----------GG-----LPA.........................ISLVHA
W5NKD6_LEPOC/13-376...EISPDT........LKLYITEVTVRQ----------LS-----KETENANVKN..................RFLEHV
J4KRH2_BEAB2/17-389...FSV..LAST.....VAFYKWQISCEI----------SS-----VQKP........................PSSSDC
R7YJ95_CONA1/9-375...IDD..RVEG.....FKLWKWAVALSF----------GD-----EPPKQ.......................YSIQKW
S0DNZ8_GIBF5/11-387...YNI..AALS.....VTLFKWKITCQT----------KT-----TDPS........................PSSSEC
UBE3D_MOUSE/13-363...TMSSET........TKFYMTEVIIRP----------SE-----GSFPNIPRS...................QFLQSI
J3NIY5_GAGT3/10-440...YSF..GTSA.....VTLLKWRVLIQE----------EP-----EVDV....................APASPSMGQC
Q59X25_CANAL/5-335...MFQGT.........LKIFKWCVELQF----------ES-----GNAIHKEQ....................YRPGLF
S7Z7X2_PENO1/19-451...DDP..SARG.....WRLLKAHLSLSH----------DP-----TSPSV................DEATWDSPPVQLI
N1JPA0_BLUG1/11-394...YHS..ELNG.....IKLWKWKLRLV.----------..-----SPSPSVRFGQGGSNTTVPSPTLSSWGSKFSGSTF
A7USM4_ANOGA/14-433...TRKNRTS.......VKLWYENVRFQP----------SE-----RSAIPLS.....................LFRTDD
L8FLW5_PSED2/12-402...STP....AG.....YQLYKWSLSLSA----------PL-----TTATSSPT.............IQLAPTSPPLPHF
K1WUW9_MARBU/11-366...VDS..QAGG.....IRIYKWRLTLLP----------D.-----...........................CYLVTMY
G3JK97_CORMM/17-390...YSV..LAST.....VAFFKWQISCEV----------LS-----PQKA........................PSSSDC
M3ZXU8_XIPMA/13-391...AIAPGT........LKLYITQVVVQP----------AV-----GDGRPDASLNRS................FFLEKT
A7TPW1_VANPO/6-339...VENDGL........LKLNKWCLLLND----------IE-----R...........................FPPEQH
B4MTF5_DROWI/9-373...TVLNDKA.......AKLWADAVRYLP----------TS-----LDIT........QKRH............LFQHPS
G9NH43_HYPAI/14-392...FNA..LASS.....ITLFKWQVTCET----------IH-----PSQA........................PSSSEC
H3AB66_LATCH/13-372...SMQNFT........NQFFFFEVHKQP----------YV-----SSFPLLLRSRG.................QFVEGV
B6QVW6_PENMQ/12-421...EDS..VAEG.....LRLYKNNISVQH----------AG-----A....................TEDVYETHSIDII
G3Y5B6_ASPNA/22-416...PDP..IANG.....YRLFKTSLSANT----------TS-----SSEDNNP..............PEETWESHPPETI
G2Q453_THIHA/11-366...FNF..RTSA.....VTLLKWQVSCKS----------AS-----GTA.........................PSIPEC
T5AMN1_OPHSC/15-387...YSQ..SALS.....VTLFKWQVSCET----------VA-----PSRT........................PSAPEC
G1TSQ5_RABIT/13-382...TMSSET........TKFYKTEIIIQP----------SE-----RSFPILPRS...................QFVQSI
S3CHW0_OPHP1/592-1020...YGL..RIAA.....ANLFKWQVDCAS----------VA-----SSA.........................PTVADC
Q75DV5_ASHGO/6-338...VTREKL........LRLHKWNLVQVR----------SD-----GSRKK.......................YRQASA
H0ZQP0_TAEGU/10-364...TVSSGT........IKYYVTEVIIQS----------DE-----GSFSPTPRS...................QFVQSI
G0VL18_NAUCC/6-338...RTTEGL........CRLYKWKLYLRK----------ND-----ETDY........................FKPEDH
F8PKW0_SERL3/428-814...CQERHEDGGVITM.YRLLKYAIRPVS----------PT-----AKPQR.......................VPLSAF
F1Q7U1_DANRE/13-383...EITAEV........LKLYITEISVKP----------SE-----DGECDLTQLSLEPKSESVRQ........RFLEQT
A4D9F3_ASPFU/21-419...EDA..VAQG.....WRLFKTSLSASI----------H.-----.....................DPTTWETHPIETI
J4G0K5_FIBRA/670-1049...CQQHRPAKMPPSVVYRLAKYAIRPLS----------PT-----IELPK.......................IPLSAF
K0KTK1_WICCF/8-359EDPKNKENL........DRLFYWNLKLSH----------NK-----GNEI........................YKPYYQ
U1HL67_ENDPU/9-360...IDV..SAEG.....WRLYKSSLSLRP----------SP-----TAEWQ......................SFPPEIF
B4JWU6_DROGR/9-392...SIESGAA.......AKLWADALRWLP----------LS-----SLNANGNDRASALTRL............LFKHAT
J7RHU2_KAZNA/6-349...LTKDGL........YKFYKWQLKLYD----------NS-----KMCEYL......................FNPRDD
C5DRI9_ZYGRC/22-357...RTSDRM........LRIPKWQLRLKS----------DG-----VCDDV.......................FPAESE
N1PZE3_DOTSN/8-375...VHF..STGG.....YKLRKAYTSLST----------AV-----EAPFV......................SYESEKW
B2WD68_PYRTR/65-448...RDP..TTDG.....WRIRKWTVGITS----------TA-----TDPSS..................SSIPFFSTQRW
B3MZV3_DROAN/9-395...AIFNGAA.......ARLWADAVSWLP----------SG-----GGST.......SLPRH............FFKSSS
S3DDS5_GLAL2/11-449...VDP..QAEG.....VRLYKWRLLCNS----------RP-----SSQPNGST.............TGSILEAPSLSVF
G8ZSN1_TORDC/11-349...ETQDHL........FKIYKWQVLLKK----------SN-----KEEDV.......................FPPEQD
F1NWJ5_CHICK/86-460...TVSSDT........VKYYVTEVIIWP----------SE-----ESFSTLPRS...................QFIQSV
G2Y6Z9_BOTF4/11-390...SDP..QNEG.....IRLFKWSLRMRT----------LE-----GSQLSN...............LSDKFLEPSMARI
E3QET8_COLGM/12-395...FNV..AIAS.....VVLLKWQVSCQT----------AS-----PSAA........................PTSSEC
H2RRY7_TAKRU/13-391...AVSPET........LKLYITQVVVEP----------AE-----SSFKAIPRS...................LFLERT
B4L5I9_DROMO/9-382...STQAGAA.......AKLWADALRWLP----------QP-----TDAT....APKLQPRQ............LFKHST
I2H589_TETBL/10-368...KTTNDL........AKIHKWKLQLLA----------RS-----SPEFQLATT...................YPPEYS
Q6CWI5_KLULA/6-348...FTKEGS........VRIGKWNLRAEI----------GG-----FLDV........................FDPSNY
C0NUQ4_AJECG/14-503...EHK..AFSG.....LRLYKANVSLLR----------KP-----KDGINS...............DHDVWETYPVDMI
UBE3D_PONAB/13-384...TVSSET........TKFYMTEIIIQS----------SE-----RSFPIIPRP...................RFVQSV
B4M301_DROVI/9-382...TIESGSA.......AKLWADALRWLP----------SA-----VKTE...DATQQEPRQ............LFKYST
C5DFR9_LACTC/6-346...LSTDNL........YKINKWNLGLVR----------NG-----RKEV........................YPPEHF
V5G5H4_BYSSN/14-443...EDI..AANG.....WKLFKACIAVQR----------HS-----SSDPK......................TYPKETI
A0A088AUY8_APIME/8-357...IHSNTS........FKLWSCAVDYNL----------LN-----NSE.........................IKNATD
UBE3D_BOVIN/13-384...TVSSET........TKFYMTEIIILP----------SE-----RNFPIIPRS...................QFVQSV
N1QC82_PSEFD/8-371...VH...TSGG.....YKVRKQHLSLSS----------SP-----SHRSA......................SYPPEKW
E7LWJ6_YEASV/7-341...VTAGSL........YKLHKWKLQLIR----------SG-----NTYK........................FPPECD
K7JNW4_NASVI/31-384GHETKS...........LKIWNCCVEYKG----------SN-----DSIS.........................KRISS
B0WGJ1_CULQU/12-439...AKRNGS........VKLWYENLKFLK----------PD-----EHEQEHVNPAS.................LFRTDD
F4X8J5_ACREC/7-368...FHAYNL........FKIWNCCIDYKP----------EN-----STLS........................ITNATN
U4LVT7_PYROM/7-364...PDR..GVSSEDSPLWRLNKWNLSLNE----------AE-----S...........................HPLECF
M2R8N7_COCSN/64-445...QDP..LTNG.....WRIHKWCLTLTS----------KL-----SNIPS.....................YFNSPQKW
Q7SDG7_NEUCR/13-419...YNF..RTAA.....VTLLKWQISCDS----------VS-----NLS.........................PGLEEC
H6C728_EXODN/11-372...SQE..NEDS.....RRLVKSRLQVVP----------DS-----NRDSE......................SFPAATF
E2C3X0_HARSA/7-364...LYSCNL........LKLWNCCVDYKP----------QD-----DTLS........................IVNATN
A5DWX9_LODEL/10-362...KYQNI.........VRLLKWHISLQR----------LE-----LLGRDVVFLD..................YNPLLY
Q9VWP0_DROME/9-387...TMFDGAA.......ARIWADAVRWRP----------AG-----AATN.......APDRH............FFQNST
H2AW44_KAZAF/6-347...VTFEKL........LRLHKWELLLET----------SD-----TSES........................FAPSND
F7E020_XENTR/11-384...KVSSDA........IKYYITEIMIQP----------SS-----QGYNMISRM...................EFLESI
G1XBI8_ARTOA/9-373...VDE..KADG.....IRLMKWSLSLGL----------GS-----FKQN.................GDEMLDSYTLSQW
Q16XY0_AEDAE/12-443...MKRNGS........AKLWYENVRFKS----------VG-----EDQSDELNPTGQS...............LFCVDQ
Q29GF2_DROPS/8-383...AIFNGEA.......ARLWADTVRWLP----------SA-----QKSD....GLPPAIRH............FFQFST
G8YFE7_PICSO/19-368...LMENT.........QRLLKWNLKLSA----------DE-----KVDT........................YPPSLH
Q6FK88_CANGA/6-346...KEGSEI........LVLEKQNLQLQD----------TF-----KELSED......................YPGYLV
U7PMZ7_SPOS1/17-440...FTL..RQQS.....IHLFKWQVQVAT----------AG-----QQGQ........................PTIADC
L9L4K4_TUPCH/13-384...TMSSET........TKFYMTEIIIQP----------SE-----RSFPVMPRS...................QFVESI
G2QZ38_THITE/12-401...FNF..RTAA.....VTLLKWQISCQS----------TL-----DAA.........................PGISEC
K5W0X4_PHACS/481-860...SQEHKPKYGESTIVYRLAKYAIRPVS----------PT-----AEPSR.......................IPLSAF
R0KID0_SETT2/64-441...QDA..TADG.....WRIRKWGISIAS----------SL-----PGSPP....................APFYSTQKW

PF00632

Q9BL11_CAEEL/717-1019FWKA..............................F.FALTDD------------------ERRKFLQFLTGS--------
UBR5_MOUSE/2479-2792FWSI..............................VEK.MSMT------------------ERQDLVYFWTSS--------
A0EFC1_PARTE/672-969FWSC..............................I.HSLSIE------------------MQKRFLFFCTGT--------
Q54GG5_DICDI/425-720FWKV..............................L.HGLSDE------------------DKRRFLTFVTGG--------
Q2GSX9_CHAGB/694-1033FWEV..............................MYQ.LEDR------------------ERRDVLKYVTST--------
Q4WHR7_ASPFU/967-1337FWSI..............................VKS.FSQE------------------KKAQLLEFVTAS--------
Q5KIA2_CRYNJ/1499-1843LIEV..............................MSS.YNKE------------------QRRQFLQFMTGA--------
Q5CW92_CRYPI/1231-1561LWDI..............................LENEFSTE------------------EQGEFLLFVTSS--------
A2E5Q8_TRIVA/658-966FFKV..............................IQK.FTPE------------------QRACLIKFATGR--------
A0BRI8_PARTE/1050-1354LQNT..............................LKN.FSQD------------------LLAKFLKFATSL--------
HUL5_YEAST/607-910FWEV..............................LNE.FKFE------------------EKLNFLKFVTSV--------
A7SML1_NEMVE/1229-1585LFEI..............................LSE.YDAD------------------QQRLFLQFVTGS--------
Q38D88_TRYB2/1472-1912LQNI..............................LAKRFGPR------------------EQRAFLLFCTGC--------
Q6BGB8_PARTE/609-908FWSV..............................VND.FEYE------------------QQSQFLFFFSSC--------
A2FIB4_TRIVA/386-683FWSI..............................FENDFNDD------------------NRRAFLKFVTGA--------
L9KS41_TUPCH/1283-1677FWAA..............................VER.FNNE------------------QRLRLLQFVTGT--------
A2DAL9_TRIVA/1571-1869FFKI