Sequence alignment for CL0553

PF00148

B4SC77_PELPB/21-398CGLACVG.WMYQKIK---DSFFLILGTHTC...AHFLQNALGMMIF.............AKP...R.........FGIAL
B0UCN0_METS4/77-469CPAFGAL.RVGLRMR---RTATILSGSACCVYGLTFTSHFYGARRT.............................VGYVP
B2JYA8_BURP8/19-425SQPLGAS.YAAMGLD---ACMPVMHGSQGC...TSFGLVLLVRHFR.............EAI...P.........LQTTA
A8ML60_ALKOO/11-412SDRMGTI.WTLSTIK---DAYIIEFGPAGT...THFAIEGMMQFNA.............DHN..AN.........VYTTH
Q3A2R7_PELCD/48-471CQPLGAE.LVAHGFE---GTLPFVHGSQGC...ASYYRSALTRHFR.............EPA...A.........AVADS
A1WTQ5_HALHL/61-466CAYAGSKGVVWGPIK---DMVHVSHGPVGC...GQLSRAGRRNYYT............GHTGV.DTFG.....TINFTSD
A0LH04_SYNFM/16-440CGPLGAC.LAFRGVE---GAVPMLHGSQGC...ATYMRRYIISHFR.............EPM...D.........IASSA
CHLB_PROMT/11-419PPHIGAM.RIATSMK---KLHYVLHAPQG....DTYADLLFTMIER.............RGSR.PP.........VTYTT
Q72WS7_DESVH/65-519CCYAGCKGVVIGPYG---DMVHIVHGPVGC...SFYAWLTRRNQFRARG.......EAGKNYL.SY.........CFTTD
A5GAJ7_GEOUR/498-905SPALGAT.LAYLGID---QMLGLLHGAQGC...STFIRLQLSRHFK.............ESI...A.........LNSTS
Q0RAV6_FRAAA/76-504CQPLGAV.LAALGFE---GTMPLVHGSQGC...VAYFRSHFARHFK.............EPV...P.........AASTS
A6UWY1_META3/60-461CTFHGSKIIINSHIK---NVIHLIHSPASC...AYYSWDYR..................PDTY.SF.........CFTTD
Q2RS09_RHORT/44-448CAFDGAK.IALQPVT---DVVHLVHGPIAC...EGNSWDTRNVGTS............GPLIY.RW.........GFTTD
Q3Z7D0_DEHM1/60-516CAYAGCKGVILGPTR---DVLSITHGPIGC...GFYSWLTRRNQTRPPK.......PEDENFM.TY.........CLSTD
Q20XD3_RHOPB/20-446CQPAGAQ.FASIGIK---DCIGIVHGGQGC...VMFVRLLISQHLK.............ESF...E.........IASSS
A1WTP6_HALHL/19-436SQPVGGT.LATLGFR---GAVPLLHGAQGC...TAFGKVYFVRHFN.............EPI...P.........LQTTA
Q8TP84_METAC/341-740CAFSGAA.TATFQVS---DAATVLHGPRSC...THITADALACS..FLRGG...GINAGEVKQ.VP........GLLPTD
Q2J4G2_FRASC/19-525SQPLGGA.LVFLGLA---GSLPIMHGAQGC...ASFAKALLTRHFN.............EPI...P.........LQTTA
Q8TJ87_METAC/15-494CQPMGSA.LAFKGVE---NTMVLYHGSQGC...STYMRLHLAHHFR.............EPV...D.........IASSS
Q8TRG0_METAC/31-443CALEGAA.GILAGIK---DISIVIHSPQGC...SSTVSVAYDTHEI.............DFTK.RK.........VACTR
BCHB_CHLAA/11-419TAHHGVG.RIANSMR---NVHAVFHAPQG....DDYVNAIFAMLDR.............TPNF.PA.........MTTSV
A3DFR2_CLOTH/52-456CATSKAA.CMTVLIQ---DAAVISHGPVGC...ASCLHEFAFTYRVNY.........PLRGIE.RPTP.....RRIFSTN
A5USK3_ROSS1/51-447CTYAGCRGVVGGPVK---DAIQLTHGPIGC...AFFSWGYRPHLAD............SDFHM.KY.........TFVTD
A6LR27_CLOB8/53-455CNAGHAF.CQLSMIR---DAVVVNHAPIGC...AGDFFGFNFTYRV.............EQMK.RELPA..TIGRYFSTC
Q7M8U9_WOLSU/69-488CQPLGAV.MVALGFE---NTMPYVHGSHGC...VAYFRSYFTRHFK.............EPT...P.........CVSDS
A4XMA4_CALS8/25-448CQPIGAM.YATLGID---KAVPLVQGSQGC...CTYVRYQFNRHFK.............EPV...N.........IAVTS
A6UWY5_META3/46-455CAFAGARGVVGGPVK---DIIHMVHGPVGC...AFYTWGSRRALSD............NELHR.RY.........CWTTD
Q72WT1_DESVH/16-490CTPLGAT.LAFRGIE---GAVPFLHGSQGC...ATYMRRYVISHYR.............EPM...D.........IASSA
A4XMA3_CALS8/36-422CTFNGAR.WVLAPIK---NSLHLVHAPADC...AFYGQNVRKKNYM.............................ILSTD
O27608_METTH/13-425CQPLGAV.MAFLGVR---GAMPLIHGSQGC...STYMRFQITRHFR.............EPV...N.........IASSS
A5N026_CLOK5/32-415CPMRIAS.VIVEDIK---GLSSLLVGMQEY...TTHSRLFSPNPEG....................KH....GELHWLYV
Q3Z7D3_DEHM1/21-437CAPLGAS.IAFSGIA---RCLPYLHGGQGC...ATYIRRYTISHFR.............EPM...D.........IASSS
O27526_METTH/12-396CKLFGAV.RAVTGIK---NAVPLIHGPRGC...AYHIGYLLTARGG.............RRI..A..........VASTE
A4XMA5_CALS8/46-442CAFAGARGVVGGPVK---DVIQIVHGPVGC...AYYTWSSRRHLSD............SEFHR.KY.........CFSTD
Q6NA14_RHOPA/19-430CQPIGAS.LAFLGLA---DCLPLEHGARGC...TSFNKLFFMRHFN.............EPI...A.........LQTTA
Q97ME2_CLOAB/52-505CCYAGCKGVVMGPIK---DMIHITHGPIGC...SYYTWGVRRNKAKAE........DGGQNFI.EY.........VFSTD
A5USK2_ROSS1/20-440CAPIGAM.LANYGIH---GAITINHGSQGC...ATYPRHQMSRHFR.............EPV...E.........VATTS
Q24QP1_DESHY/324-722CAFNGAM.SVGAQIS---DAVILAHSPKSC...THIMYQTISSAGRRTLFE...RGALLPVSL.AP........NLESTD
Q2RWB8_RHORT/53-460CAGLCAT.LNLTLIE---DAVVINHAPVGC...AGDFAQLNRCRRR.............GQGK.RAMEV..TNARLLSTA
NIFE_METTH/64-456CVYGGAR.VVLMPIT---DAAHIVHGPVGC...AACTWDIRGSRSS............KSDLY.KT.........GFSTN
Q2RL08_MOOTA/46-462CAFAGARGVIGGPIA---DVIAMVHAPVGC...AWYTWGTRRHLSDLYTWATPTRLTNVAFNR.RY.........CVCTD
Q6N6J8_RHOPA/13-414CALHGAL.YAATAID---GVTPLVHATPGCGVQAGLWQGVGGCGVS.............................WPTSN
A5N1T7_CLOK5/17-439CMPMGGV.MAFKGIE---NNMVILHGSQGC...STYIRRHMATHYN.............EPV...D.........IASSA
A6LUZ4_CLOB8/44-438CVYCGAR.VVLNPIT---DAYHIVHGPIGC...ASYTWDIRGSLSS............GDNLY.RN.........SFSTD
BCHB_CHLTE/11-426TALHGVS.RVTNSMK---GVHTVYHAPQG....DDYITATYTMLER.............TPEF.PK.........LSISV
NIFK_CYAA5/69-490CQPLGAL.LAAIGFE---GTLPFVHGSQGC...VAYFRTHLTRHFK.............EPV...S.........AVSSS
A7I7F2_METB6/56-518CAYAGCKGVVVAPIK---DMITITHGPVGC...GYYSWGTRRNKARADST.....TPKDKIYS.QL.........CFTTD
Q2FLM7_METHJ/320-717CAFAGAI.AVLSQIQ---DASIIAHCPSSC...AHIVSNLLVSSQN............RDRDK.SADYGKQTSFSFIHTG
A0L6W2_MAGSM/19-431SQPVGAA.LAFMGIR---DAIPMLHGSQGC...TAFAKVFFVRHFR.............EPI...P.........LQTTA
A6TTX7_ALKMQ/17-436CMPMGAS.TAFKGIE---STMVLLHGSQGC...STYIRRHMAGHYN.............EPI...D.........IASSS
NIFN_RHILO/19-429SQPLGAA.FAFLGVE---GAMPLFHGSQGC...TSFALVLFVRHFK.............EAI...P.........LQTTA
A7I7F4_METB6/48-446CVFCGAR.VVLNPVT---DAVHLIHGPVGC...ATYTMDIRGSLSS............GSELF.RT.........SFSTD
Q8KC88_CHLTE/24-443CQPIGAM.YAALGIH---GCLPHSHGSQGC...CAYHRSTLTRHYK.............EPV...M.........AATSS
Q6D2Z0_PECAS/69-501CQPLGSV.LCSLGFA---NTLPYVHGSQGC...VAYFRTYFNRHFK.............EPI...A.........CVSDS
A6UWY4_META3/30-461CQPIGAM.WATLGVC---EGVPFVQGGQGC...TTYARYQFARHFR.............EPS...P.........IASAS
A5N1T9_CLOK5/23-438CQPIGAM.YAALGIH---NCMPHSHGSQGC...CSYHRMQLTRHFK.............DPI...M.........ATTSS
A7I7F3_METB6/23-439CQPIGAM.YASLGIH---GCLPHSHGSQGC...CAYHRMHLTRHFR.............DQV...L.........AASSS
A4YYY7_BRASO/19-429SQPIGGS.FAFLGLR---GAMPLLHGSQGC...TSFGLTLFVRHFK.............EAV...P.........MQTTA
A5HZN4_CLOBH/32-412CPMHTAL.ALSSRVK---GMSTLVVGTPEC...GTYSRNIVSGIKS.............EEG..EL.........HWTYI
A5UYB5_ROSS1/24-407CPAFGSL.RILSRIE---GSHPVMATDTGCLYGLTFVTHFYGARKS.............................ILAPT
A6LUZ3_CLOB8/23-437CQPVGAM.YAALGVH---GCMPHSHGSQGC...CSYHRTVLSRHFK.............EPA...I.........ATSSS
A6LUZ5_CLOB8/18-440CMPMGVS.NALYGIK---NCMTILHGSQGC...STYIRRHMATHYN.............EPV...D.........IASSS
A9WCM1_CHLAA/32-409CPAFGAL.RVLTRIE---GAQPAMVTDTGCLYGLTFVTHFYAARKS.............................IVAPA
A9WCM2_CHLAA/14-404.SYWGAS.WVFGCFP---DVHIVCDAPIGC...YNLLGMAVTDYTDA...........LPHM..AN.........LTPTS
C1DH03_AZOVD/37-442CSFDGAQ.IALLPVA---DVAHIVHGPIAC...AGSSWDNRGTRSS.............GPDLYRI.........GMTTD
C1DH04_AZOVD/19-431SQTMGAA.LAILGLA---RSMPLFHGSQGC...TAFAKVFFVRHFR.............EPV...P.........LQTTA
C1DI25_AZOVD/57-448........VIGGVLK---DTIQMIHGPLGC...AYDTWHTKRYPTDN..........GHF.NM.KY.........VWSTD
C1DI39_AZOVD/19-429SQPMGAA.LAFLGLS---RSLPLEHGAQGC...TAFSKVFFTRHFR.............EPI...P.........LQTTA
C5AV88_METEA/12-413.PHIGAM.RVATAME---GLHYVLHAPQG....DTYADLLFTMIER.............RAKR.PP.........VTYTT
D5ARY2_RHOCB/46-446CAFDGAM.IALQPIV---DVAHLVHAPAAC...WSNGWDNRSSASSG...........SELY..RK.........GFTTD
G8AJS3_AZOBR/22-428SQPLGAA.LAFLGVD---RCMPLFHGSQGC...TAFGLVLLVRHFR.............EAI...P.........LQTTA
NIFD_METMP/49-457CAFAGVKGVITGAIK---DVLHVVHSPVGC...TAYGNGTTKRYPTRPEMPD.GSVFPVE.....NFN....LKHIVGTD
NIFE_METMP/74-470CVYGGAR.VVLMPIT---DAVHLVHGPIGC...AACTWDIRGSKST............GDKLY.KN.........GFSTD
BCHY_RHOS4/55-446CPAFGSL.RTGLRMR---RVGTIISGSACCTYGLSFVSHFYGARRS.............................IGYVP
Q3J0H5_RHOS4/19-424SAPLGAA.MAYLGIE---GAIPLFHGAQGC...TAFAMVHMVRHFK.............EAI...P.........LQTTA
Q6LYX6_METMP/15-428CQPMGAI.FALMGVK---NSMPLIHGSHGC...STYMRFQLGRHFK.............EAV...N.........VASSS
Q72WS8_DESVH/23-443CQPIGAM.YAALGIH---GCLPHSHGSQGC...CSYHRSHLTRHFR.............EPV...M.........ASTSS
Q8TJ89_METAC/23-439CQPIGAV.YAALGVH---NCMPHSHGSQGC...LSYLRMCLSRHYR.............EAA...L.........ATTSS
Q8TRG2_METAC/20-444CQPAGAQ.YAGIGVK---DCIPLVHGGQGC...SMFVRLLFAQHFK.............ENF...D.........IASSS
V6EWQ5_9PROT/19-430SAPLGAS.MAFMGMD---GTMPLLHGSQGC...TAFALVMLVRHFR.............EAI...P.........LQTTA

PF01497

Q4KAK8_PSEF5/33-281IVSTSPSVTGILLAM....DAPLVASAATT---PSRLTDERGFFSQ-------------WAEV...---------ARQRG
A9KLK9_CLOPH/127-364VAVLFSSYAQVWQDG...GGVVSITVPDSI---NRGLVKKDAV...-------------.......---------....T
A8LBT9_FRASN/61-297IATLGRLTVSFLDLG...GEPVGVTEVDAS---VLDVLPEEQQAAY-------------K......---------...AA
Q9HMG8_HALSA/70-339VAVYESGYADMVVAL...GHGDALTAVGNS---DRFHTDAYDAL..-------------.......---------....D
Q03SI0_LACBA/39-270IVATTYAIVQIAAKL.....HLPLVGVPTT---ANTMPKQYQ....-------------.......---------....H
Q8TKF6_METAC/99-361IITTNPDNSRIVIAL...GDLEKMVSTDEA---TRGSSVLPKDEEG-------------NKLAPEA---------WEALQ
Q129U2_POLSJ/29-259IVCLTEEPTEWLYLL...GEERRIVGISGY---TVRPPRARE....-------------.......---------....E
Q5E5H9_VIBF1/28-260IISAGSAVTELIYAL...GAEDSLVAVDVT---SKMPQTQ......-------------.......---------....S
Q73TK8_MYCPA/66-308VSAGYTEQDDLLAVGVVPIAVTNWFGDQPF---AVWPWAADKLGGA-------------.......---------....Q
A8AWA6_STRGC/24-267VITNNLSTTEILIEL...RLKDKIAGMLNP---DNDVTDKYKADIA-------------.......---------....T
Q5WC89_BACSK/255-486LAAYDLDSLGDLLALRQIPFAAPMHPKWTK---HYYELYQHEVPVH-------------.......---------...LS
Q4JSY9_CORJK/57-307VVALDNRSFEILNEW...GVELSAAPKKLV---PATVTDYKDNE..-------------.......---------....E
Q6L1D8_PICTO/51-271IVSLSPAFTATLYGI...GALNDVVGISTC---TFYPEPVK.....-------------.......---------....N
Q8TM94_METAC/62-323IAYTHYSVAEVLKAI...GAWDRVVARDGY---ISDENFYPNLDEI-------------.......---------...PA
Q9HKZ6_THEAC/7-228IVSLSPAVTEILYMI...GESDNIAGNSAF---CVHPEEAR.....-------------.......---------....K
Q2G941_NOVAD/48-274LVSLNPCTDAILAEV...ADPAQILAISHY---SKDPRSSSMDS..-------------.......---------....A
Q7MWG9_PORGI/105-345IACLSTTQIGSLPLL...DQTDKLVGCINL---KNICNADIRNRIK-------------K......---------...GY
Q8FRS2_COREF/66-320VATVAWSNHEVPLAL...GVTP..VGFEKA---TWGDDDGDGVLPW-------------VAEQLAV---------LGAPE
A4FH22_SACEN/55-310IAQVSAAGALKDFGVDVVGTFGPLVKDDGT---TENEAGSVNPAEV-------------.......---------....T
B1HSF6_LYSSC/69-304IASLWYFYPEILVAL...GEPPTASTDKEY---LSSLAYLNGKLD.-------------.......---------....S
D9QEM0_CORP2/95-325....YGTYTKTLEGL...GLTKNIVGRTVS---STENALKD.....-------------.......---------....L
M9X349_PASHA/55-314IAVTGVENFDKVV.....GISREFWEKFNP---GSWALFAEKMPNL-------------.......---------...KN
Q0P8Q4_CAMJE/73-305VVILDLGILDTFDAL...KLNDKVVGVPAK---NLPKYLQQFK...-------------.......---------....N
Q2FWN6_STAA8/51-277VAVLTGFYVGDFIKL...GIKPIAVSDITK---DSSILKP......-------------.......---------....Y
Q74XT9_YERPE/44-278VVALEWLPVELLLAL...GVTPFGVADIHN---YRLWVGEPALPA.-------------.......---------....D
Q92XA6_RHIME/55-318.VSIGQSSTEILYLL...GLADKVAGTALW---VGPVLEGYEEVN.-------------.......---------....A
R7FQC8_9FIRM/141-385...AATSAMALFDSM...DGLDSIRMSGAQ---ASDWYIDNAKKAM-------------E......---------..EGR

PF00148

B4SC77_PELPB/21-398M---------EEGDLSKQ..EPSLQDIISEIMADHHP..SVIFLLSSCTPEVMKVDFKGLAHLL.....STPDV......
B0UCN0_METS4/77-469F---------NSETLVTGKLFEDIRDAVRAVADPAQC..DAVVVINLCVPTASGVPLRLLPREI.....DGVR.......
B2JYA8_BURP8/19-425M---------NEVTTILG.GYENVETALLNIRRRAAP..KIIVLCSTGLTETNGEDIVGHLAMV.....RRRKPELN...
A8ML60_ALKOO/11-412I---------NETDISFG.KQDRLENAILEIDGQYGP..KYIFVMASSISAIIGTDIESVCYEL.....QPKVKA.....
Q3A2R7_PELCD/48-471M---------TEDGAVFG.GQNNLHEGLENALKLYKP..KMMAIFTSCMPEIIGDDLNAFIINA.....RNAGIVPQ...
A1WTQ5_HALHL/61-466F---------QERDIVFG.GDPKLEKIVDEIEMLF.PLNKGITVQSECPIGLIGDDIDSVGRQA.....TERLGK.....
A0LH04_SYNFM/16-440L---------GEKHAVYG.GGANLKQGLKNVMTKFGA..RLIGIATTCLTETIGEDVPMIVEEF.....RREIRRKGG..
CHLB_PROMT/11-419F---------QARDLGGD.TAELVKGHIKEAVDRFKP..ETLLVGESCTAELIQDQPGSLAKGMG..FDIP.........
Q72WS7_DESVH/65-519M---------QDEDIIFG.GEKKLAQAIREAAAIFRP..EAISVHATCPVGLIGDDIQAVAREL.....SKETGI.....
A5GAJ7_GEOUR/498-905M---------SEDTAIFG.GWENLKKGIKRVIEKFGP..QVVGVMTSGLTETMGDDVRSAIVHF.....RQEN.PEF...
Q0RAV6_FRAAA/76-504M---------TEDAAVFG.GINNLVEAMENITALYKP..KHIAVSTTCMAEVIGEDLFAYIGAA.....REQEAITQ...
A6UWY1_META3/60-461I---------KEEDVVFG.GEKKLYDAILKICEEFNP..DAIFVYETCQTALIGDDISAVVKEV.....KKKLKNTNHK.
Q2RS09_RHORT/44-448L---------SEMDVIHG.GEKKLYRAIKEAVAKYAP..PAIFVYQTCVPALIGDDIDQVCKVA.....SERLGL.....
Q3Z7D0_DEHM1/60-516M---------QESEIVFG.GEKKLAQAIEEAYQLFKP..KTIVVHATCPVGLIGDDIHQVTRAA.....QEKLGI.....
Q20XD3_RHOPB/20-446V---------HEDGAVFG.ALDRVETAVDVLLMRY.PHVKVVPIITTCSTEVIGDDVDGLITKLEEGLLAEKYADR....
A1WTP6_HALHL/19-436I---------DPISAVLG.ADDNVLGALDTLCGKSAP..ALITLLTTGLSEAEGTDIERLVRTF.....REAH.PEH...
Q8TP84_METAC/341-740M---------EEEDVIFG.GIEKLERKIEEALSA.GW..QTVFVVSTCPGGIIGDDVKRATSRV.....ETRFPG.....
Q2J4G2_FRASC/19-525I---------TEVTAVLG.SGEAMVETLDAIRKKQRP..EIIGLLTTGVTEVSGEDVGGQLRKY.....LSAWNETDSSG
Q8TJ87_METAC/15-494L---------SEKGAVYG.GRENLKKGLRNVINRYKP..KVIGVATTCLAETIGDDVPAIIREF.....KEEEGIGDDL.
Q8TRG0_METAC/31-443L---------FETDIVMG.ASDKLKELIREVDSKFKT..RAIFVIGTCAADIIGEDLEGLCRNLQ..PQINAK.......
BCHB_CHLAA/11-419V---------SGTDLARG..TIRLPDTLRQVEERVHP..DLIVVVASCSTILLQENLEIAAQHA....GLQCE.......
A3DFR2_CLOTH/52-456L---------KEKDTVYG.GNIKLANTIREVYERTHA..NAIFVLTTCAAGIIGDDVESVCNEA.....EEEL.G.....
A5USK3_ROSS1/51-447M---------NETNIVFG.GEKKLLQSIIEANAEF.PNAKAVFVYNTCSTALIGDDGRDVAKQA.....EAIIGK.....
A6LR27_CLOB8/53-455I---------EEKDTVFG.AAKKLEDTVREAYKRTKP..NAIFVTTSCASGIIGEDVDAITENL.....SKEL.G.....
Q7M8U9_WOLSU/69-488M---------TEDAAVFG.GLQNMIDGLANCYAMYKP..EMIAVSTTCMAEVIGDDLQAFVENA.....RSAGSIPA...
A4XMA4_CALS8/25-448F---------HEDAAVFG.GRRNLIEGIRNLVLRYSP..TVIGVITTCSSETIGDDIEAFIKEA.....YKKLSEELSSE
A6UWY5_META3/46-455L---------QESDIVYG.GEKTLEKACMEAIDEF.PEANGMMIYTNCPTALIGDNIDAVGNKV.....EEYMKK.....
Q72WT1_DESVH/16-490L---------GEKHAIHG.GGPNLKKGLLNVMKKYHP..RLVGVATTCLTETIGDDVGRILREF.....RNEFGDLD...
A4XMA3_CALS8/36-422L---------IEKDIVFG.AARKLEESIVEADKIFDS.YDLVFVYATCTAAQIGEDIEWSIKMV.....KDRVNK.....
O27608_METTH/13-425L---------NEATVVYG.GEKNLLKAIRTVEENYKP..EVIGVISGCLSETIGDDINRIVRIY.....RDAGSE.....
A5N026_CLOK5/32-415L---------DAQEVVFG.CRNSLMGALRKMDKA.GA..KAILMIVTCVPELIGEDIEGIVHEIQ..PELSAQ.......
Q3Z7D3_DEHM1/21-437F---------GEEATVFG.GKDNLFCGLKNVISQYQP..DLIGIASTCLSETIGENVPALIEEF.....RQSVDLG....
O27526_METTH/12-396L---------SESDVVFG.ASEKLRDRIIEVDRTRKP..DIIVIMSSCATSIIGEDIGRVADETS..ELVDAE.......
A4XMA5_CALS8/46-442M---------QEKDIVFG.GEKKLYNAIIEANQEF.PEAKAVFIYATCPTALIGDDLEAVAKKA.....SKAIGK.....
Q6NA14_RHOPA/19-430M---------DQITTVIG.ADSNVIEALATICERDKP..KVIGLISTGLSSMQGADLPRTIVEF.....YAKL.PEY...
Q97ME2_CLOAB/52-505M---------QERDIVFG.GEGKLRKAIKEAVEIFHP..KAIGIYATCPVGLIGDDINAVARES.....TEKYGI.....
A5USK2_ROSS1/20-440L---------TEKTTVYG.GKQNLLAALKNIWERFHP..TMIMVCSTCLSETIGDDIPAIIDEF.....LDKHPDV....
Q24QP1_DESHY/324-722M---------GEAEMIFG.GMEKLEEKILELKAR.QP..RAIVVVSACPAGIIGDDIGR.TRRF.....SE..PG.....
Q2RWB8_RHORT/53-460L---------TEHDTIFG.GAQKLAETIDQAVARYHP..RAIFVTASCASGIVGEDIDSVVTEA.....EERH.A.....
NIFE_METTH/64-456L---------EEKDVVFG.GEDRLLKCILEVDEIYSP..SAIFVYSTCVSGVIGDDITAVCRNA.....EYKTGK.....
Q2RL08_MOOTA/46-462M---------QEKDVVFG.GIKKLEQACLEAIRLF.PEAKGLIIFTTCTTGLIGDDVQAVARSV.....EKKTGR.....
Q6N6J8_RHOPA/13-414L---------SEKHIVFG.GASRLREQIKNTRGVVSS..EITVVLTGCPAEMIGDDVEAMAQEAR..DAGDE........
A5N1T7_CLOK5/17-439L---------TEQGTVYG.GADNLKKGLNNMIKMYNP..TTIGILTTCLAETIGEDINRIVEEF.....YREQEKNEN..
A6LUZ4_CLOB8/44-438L---------SEQNVIFG.GEKKLIAAIEGIMENHNP..KLIFVYATCIVGVIGDDVKAVCKMA.....EEKYNV.....
BCHB_CHLTE/11-426V---------RGQDLARG..TSRLPGTVEQVDKHYKP..ELIVVAPSCSTALLQEDLGQMARASG...VDQSK.......
NIFK_CYAA5/69-490M---------TENAAVFG.GLKNMVDGLQNSYALYKP..KMIAVCTTCMAEVIGDDLGAFLGNA.....RQDGVIPD...
A7I7F2_METB6/56-518M---------QEPDIVFG.GDKKLARMIDEIVAAFHP..RGINICSTCPIGLIGDDIGAVAKAA.....TERHGI.....
Q2FLM7_METHJ/320-717M---------DEKMMVFG.GIEGLKKTIIKSVESGN...RVIFIVSGCTPGITGDDIVGCASEM.....SQNL.G.....
A0L6W2_MAGSM/19-431M---------DQVSTVMG.GDESITEGLDVLSGGAKT..RVVGLISTGLTECQGADIHRVVRQF.....RDSH.PQH...
A6TTX7_ALKMQ/17-436L---------NEKETVHG.GAANLKKGLKNILRLYNP..KMIGISTTCLAETIGEDIQRLIIEF.....KEEEPQYK...
NIFN_RHILO/19-429M---------DEVATILG.GADHLEEAILNLKTRTKP..KLIGVCTTALVETRGEDCASDIANV.....KLKHVEEL...
A7I7F4_METB6/48-446M---------KEKDVIFG.GEKKLAACIDEVVEKYHP..PAVFVYATCVSGMIGDDIVAVCKAA.....SARHNT.....
Q8KC88_CHLTE/24-443F---------TEGASVFG.GQANLLSAIETIFTVYDP..EVIAVHSTCLSETIGDDLQQITKKA.....SDDGKIPE...
Q6D2Z0_PECAS/69-501M---------TEDAAVFG.GNNNLNAGLENASALYKP..EVIAVSTTCMAEVIGDDLQAFIANA.....KKDGFVDA...
A6UWY4_META3/30-461F---------HEHAAVYG.GMKNLVDGLTNLVSRYDP..NLIAVITTCSSETIGDDIESFIRAA.....RKNIAKEVGE.
A5N1T9_CLOK5/23-438F---------TEGASVFG.GGANFKTAMKNIFSIYNP..DIVAVHTTCLSETVGDDLVTYIASS.........EIPE...
A7I7F3_METB6/23-439F---------TEGASVFG.GASNLKTSIKNIFKIYNP..DIIAVHTTCLSETIGDDIPNIIKQS.........EIPE...
A4YYY7_BRASO/19-429M---------SEVATVLG.GYENVEQAILNIYKKQKP..EIIGICSTGVTETKGDDVDGYIKLI.....REKHPELA...
A5HZN4_CLOBH/32-412L---------DSNEVVFG.CRRGLINTIKEMDKSG.A..KAIMIILTCVPEIIGEDIEGIVHEM.....QPEVSA.....
A5UYB5_ROSS1/24-407L---------GSAELYSGEIVEGTRAAIEAAAREPGC..RLVPVVSLCVAETAGMPEELLPRRV.....GEAD.......
A6LUZ3_CLOB8/23-437F---------SEGACVFG.GGSNIKTAVKNIFDMYNP..EIIAVHTTCLSETIGDDLKGFIDAI.....DIPEGK.....
A6LUZ5_CLOB8/18-440L---------TEEGTVYG.GENNLIKGLENLIKLYNP..EVIGIATTCLAETIGEDVVRLSKIF.....YEKHPDS....
A9WCM1_CHLAA/32-409L---------GTAELSSGKVQEAANAAIAEAASAANT..TFIPVISLCVAETAGLAEELLPKEI.....D...GK.....
A9WCM2_CHLAA/14-404I---------REEDVING.TAKALIRTIDDLRTMGMLDGKRLLVISTAESEMISADHAQLVARI.....DPD........
C1DH03_AZOVD/37-442L---------TENDVIMGRAEKRLFHAIRQAVESYSP..PAVFVYNTCVPALIGDDVDAVCKAA.....AERFGT.....
C1DH04_AZOVD/19-431M---------DQVSSVMG.ADENVVEALKTICERQNP..SVIGLLTTGLSETQGCDLHTALHEF.....RTQYEEYK...
C1DI25_AZOVD/57-448M---------KESHVVFG.GEKRLEKSMHEAFDEM.PDIKRMIVYTTCPTALIGDDIKAVAKKV.....MKDRPD.....
C1DI39_AZOVD/19-429L---------DMASTVLG.SDERLQEGLATVIDGHHP..EVVGLITTGLVEMQGADIRRVLRSF.....HAERCES....
C5AV88_METEA/12-413F---------QAQDLGRD.TAAIFKDAVAAAYARFQP..QAMIVGASCTAELIQDDPGGLAKAL.....A..LPI.....
D5ARY2_RHOCB/46-446L---------SELDIVMGHGEKKLYRALREVIEAESP..AAVFVYATCVTALIGDDLDAVCKAA.....TAKWGT.....
G8AJS3_AZOBR/22-428M---------DQVSTILG.GYENLEQAVRTIHERNAP..ALIGVATTGVTETKGEDMSGQYSLF.....RQRNPALA...
NIFD_METMP/49-457L---------TESDVVFG.GMNKLKKVIREASKEF.PFVNAIYVYATCTTGLIGDDLDAVCKEM.....QAELGK.....
NIFE_METMP/74-470L---------QEKDIVFG.GEKKLYESILEVNKLYHP..GAIFVYSTCVVGLIGDDLKAVCRQA.....QEATGC.....
BCHY_RHOS4/55-446F---------NSESLVTGKLFEDIREAVHEMADPQRY..DAIVVTNLCVPTASGVPLRLLPSEI.....NGVR.......
Q3J0H5_RHOS4/19-424M---------NEVSAILG.GGEQIEEAIENLRKRASP..KFIGIASTALVETRGEDIAGELREM.....LARRRDFA...
Q6LYX6_METMP/15-428M---------SEANAVLG.GEENLKHAIRNVSKIYGP..EIIGVTTSCLSETIGDDVEGIIRLF.....KTQNDDL....
Q72WS8_DESVH/23-443F---------TEGASVFG.GGPNLRQALKTIFQVYDP..DMVAVHTTCLSETIGDDIPTITKVA.....MEDGTVPQ...
Q8TJ89_METAC/23-439F---------SEGTAVFG.GAANLKEALVNLTTVYQP..EVIAIHTTCVAETIGDDVGVILEDV.....SAEELIDP...
Q8TRG2_METAC/20-444L---------HESAAVFG.GAIRVEEAVETLIARY.PHLRIIPIITTCSTETIGDDIEGIIRKV.....NQKIKENHP..
V6EWQ5_9PROT/19-430M---------NEVSTILG.GMDQVEAALLNIAKRTKP..KIIGLISTALTETRGEDMKGDLKLI.....LARNPELA...

PF01497

Q4KAK8_PSEF5/33-281V.........AVLYRNLQ-FDI.......EAVIAADP--DLLVVSATGA....DSVVAHRSELQ----------------
A9KLK9_CLOPH/127-364V.........IGNGDGRS-INV.......ERLLKLKP--DLVILTNDF.....PEHVELAEILR----------------
A8LBT9_FRASN/61-297K.........LLGSGASE-ADL.......ELLATLKP--DLILFSAPD......SDFEQMKSQL----------------
Q9HMG8_HALSA/70-339G.........VSVDTSGL-VDLVDAGVTRETLLDLDP--DVYLMDPNW........LTSTFELD----------------
Q03SI0_LACBA/39-270V.........TKVGSPMN-PSV.......EKIAALKP--TVVYSVTTL.....DDQFGAAFKTQ----------------
Q8TKF6_METAC/99-361IYGGGQLDELPETNTRRE-IDY.......ETMALLKP--DVVFDSLGY........NRGDLVEE----------------
Q129U2_POLSJ/29-259K.........PKVSAFLS-AKI.......DKIVELQP--DCVIGFSDL.......QADIASQLV----------------
Q5E5H9_VIBF1/28-260L.........PKIGYHRQ-LST.......EGLLALQP--TQIIGSNEM......GPQSTLDLLS----------------
Q73TK8_MYCPA/66-308P.........TVLNLDNG-IPV.......DQIAGLKP--DLIVAINAG.......LDADTYQKL----------------
A8AWA6_STRGC/24-267I.........PQVGDKKT-VSQ.......ETVLSYEP--DALLGRNMMF...SEKSLGTVSAWN----------------
Q5WC89_BACSK/255-486A.........YRANHDWQ-ANM.......ERLIDWKP--DVLIAKRKL........HEEERNAF----------------
Q4JSY9_CORJK/57-307I.........KDLGNHKE-PDF.......EALVAAQP--DLVISGQRF......KDRDEEIKEL----------------
Q6L1D8_PICTO/51-271I.........TVVGSYDS-INT.......EEILNLSA--QVIIGCSMP........ASLISKVD----------------
Q8TM94_METAC/62-323I.........CPARNPMD-INY.......EKTVEVQP--DVLILPKFEW....YDDTDEIINRL----------------
Q9HKZ6_THEAC/7-228K.........KKVGSYGT-VSW.......DILSKIDP--DAVFLISGY........PHALYEKL----------------
Q2G941_NOVAD/48-274L.........ASSLPATR-GTV.......EEVLALRP--DLVLGSTFI.....DPATASAYRRL----------------
Q7MWG9_PORGI/105-345V.........QEIGTGMT-KNI.......EQIAGLRP--EILLQDLFH.......VSDKDEELI----------------
Q8FRS2_COREF/66-320P.........VLFDATDS-LPF.......ESIANTQP--DVILAAYSG.......LTQEDYDQL----------------
A4FH22_SACEN/55-310D.........VTGPAYGE-LNM.......ERVASLHP--DLLVSGKYAEFPGLWHLTQDQEETA----------------
B1HSF6_LYSSC/69-304T.........EELGDKLS-PSI.......EKTLSTEP--DFILATEHH.........EKLYESL----------------
D9QEM0_CORP2/95-325P.........VVTEGGHT-INV.......EAVLNLRP--SLVIVDHSI......GPRDAIDQIR----------------
M9X349_PASHA/55-314I.........ADLGYVNS-GTFS.....TEKTIALKP--DVLVLPEIQY....QALASEISRIE----------------
Q0P8Q4_CAMJE/73-305K.........PSVGGVQQ-VDF.......EAINALKP--DLIIISGRQ.........SKFYDKL----------------
Q2FWN6_STAA8/51-277L.........KGVDYIGE-NDV.......ERVAKAKP--DLIVVDAMD..........KNIKKY----------------
Q74XT9_YERPE/44-278V.........INVGQRTE-PNL.......ELLQQMAP--SLILLSQGY.........GPSPEKL----------------
Q92XA6_RHIME/55-318K.........VERLADND-PSF.......ESVLAKKP--DMVAVQFQWQV.GPEGVVARPEQFE----------------
R7FQC8_9FIRM/141-385I.........LFAGKYSE-PDY.......EMLVDEDC--DLAIESTMI.....LHTPKVQEMIE----------------

PF00148

B4SC77_PELPB/21-398..............PVLFVPASGL.VYNFTQAEDSVLAALVPFC....................................
B0UCN0_METS4/77-469...............IIGIDVPGFGVPTHAEAKDVLAGAMLRVARAEAERG.............................
B2JYA8_BURP8/19-425............DTELVYVSTPDY.VGAFEDGYRHALTAIVKTLVK..................................
A8ML60_ALKOO/11-412..............KLIPITTGGY.HGDHTLGIEATMDMLCKEVVQ..................................
Q3A2R7_PELCD/48-471............DYPIPYANTPSF.NGTHINGYDSMLKSVVSYLATD.................................
A1WTQ5_HALHL/61-466..............PVIPVRCEGFRGVSQSLGHHIANDTIRDHVLE..................................
A0LH04_SYNFM/16-440..........EEPPAFVSVRTPSY.SGTHMEGFHGAVRAVVEQL....................................
CHLB_PROMT/11-419...............IVSLELPAY.SKKENWGGSETFYQIVRTLLKDHSN..............................
Q72WS7_DESVH/65-519..............PVMAFNCEGYKGVSQSAGHHIANNKIFDMALG..................................
A5GAJ7_GEOUR/498-905...........AHVPVIHASTPDY.CGSMQEGYAAAVEAIVATI....................................
Q0RAV6_FRAAA/76-504............DFPVSYAHTPSF.VGSHITGYDVMLKGIIEMLAKSPD...............................
A6UWY1_META3/60-461..........NKDTPILAFECAGFKGKTQNKGHMIANKKLFELIAT..................................
Q2RS09_RHORT/44-448..............PVVPVNAPGF.VGSKNLGNKLGAEALLAHVIG..................................
Q3Z7D0_DEHM1/60-516..............KVFGFSCEGYKGVSQSAGHHIANNQIFKHMVG..................................
Q20XD3_RHOPB/20-446............EVHLLAIHSPSF.VGSMVSGYDVAVRDFVKKF....................................
A1WTP6_HALHL/19-436...........AGTAVVPVNTPDF.VGSLESGYAATVEAIIEHLVPEAA...............................
Q8TP84_METAC/341-740.............ARVIPVPVEGVLTGDFSTGLLEGYKRVA.DLID..................................
Q2J4G2_FRASC/19-525PEAGANGSAPGRAPLIVGVSTPDF.IGGLSDGWSAALEALVRAVVPAEHSETEPSEARYFTGRTAFIAASAPVTHLTTPG
Q8TJ87_METAC/15-494..........EKDIIIIPVSTPSY.GESHVSGYIKALDAVVRKFTEKPESPEESKSPEDVELMDCMENMEIM........
Q8TRG0_METAC/31-443...............LIPLMAGGF.RGDSYAGIDMGLKVLFPFI....................................
BCHB_CHLAA/11-419...............VMVYDANPY.RMQEIVAAESLFTDLVKRF..A.................................
A3DFR2_CLOTH/52-456.............IPVVAIFCEGFRSKVWTTGFDAAYHGIARKL..I.................................
A5USK3_ROSS1/51-447..............PVVFFECEGFRGVSQSMGHHVGNETIFRQLVG..................................
A6LR27_CLOB8/53-455.............IPVISCSCEGFRSKIWTTGFDAAYHSILRKL....................................
Q7M8U9_WOLSU/69-488............DYPVPYANTPSF.KGSHITGYDNMMYSIITQLSN..................................
A4XMA4_CALS8/25-448.........AANSVYIVPIHTPSY.AGTHVKGYDTATISYVKYFA...................................
A6UWY5_META3/46-455..............PVFPVNCPGFAGVSQSKGHHVFNTMFYRWLKK..................................
Q72WT1_DESVH/16-490............LPDIVHVSTPSF.AGTHMDGWYDAVRAVTEQLVESTPGAMSGTMSGTMSGVISGAPHEAA........
A4XMA3_CALS8/36-422..............ILIPVIVPGFSGYSQADGHYIAQRAIASYILK..................................
O27608_METTH/13-425.............SRIIPVSTPGF.KGSHVDGYDMAVTSILRSIAG..................................
A5N026_CLOK5/32-415...............VTFVLLGQFKNISYPPGSWKTMEALGVLM....................................
Q3Z7D3_DEHM1/21-437............ETQLVFASTPSY.AGSHLTGFHKAVLATAKAL....................................
O27526_METTH/12-396...............LITVSAGGF.ESSQGEGYEEVMMALIHKF..C.................................
A4XMA5_CALS8/46-442..............PVIAFNSPGFCGVSQSKGHHIANHTIFEKIVG..................................
Q6NA14_RHOPA/19-430...........ADVKVIAAAATDT.LGCLESGFALAVEAIIEAV..A.................................
Q97ME2_CLOAB/52-505..............QVIAFSCEGYKGVSQSAGHHIANNNILDTVIG..................................
A5USK2_ROSS1/20-440............TIPILSVKTPSY.IGNHTTGFDNFLKEIALNLPDR.................................
Q24QP1_DESHY/324-722.............LPVVTLKTDGNLAGDYLQGMLMAYTSLARQVIR..................................
Q2RWB8_RHORT/53-460.............IPVVAIDCVGFRTQVWATGFDMAYDALLRKI..V.................................
NIFE_METTH/64-456..............WVIPVQSEGFRSFNKSLGHQLACDVLLDHVIG..................................
Q2RL08_MOOTA/46-462..............LVFTAESPGCSGVSQSKGHHDFNIQFYRQVRS..................................
Q6N6J8_RHOPA/13-414...............VLDLATAGF.RGSAYHGYQSFLLAAVERT....................................
A5N1T7_CLOK5/17-439..........MKDIKIITASTPGY.GNTQAEGYFSVLRKIVEQV....................................
A6LUZ4_CLOB8/44-438..............PVIPVMSPGF.SGNKSKGYKLACNALMNLF....................................
BCHB_CHLTE/11-426...............IMVYAVNPF.RVAENEAAEGLFTELVRRF..A.................................
NIFK_CYAA5/69-490............DLPVPFAHTPSF.VGSHITGYDSMMKSILSTLTE..................................
A7I7F2_METB6/56-518..............QVLAYACEGYKGVSQSAGHHIANNTIMQNVIG..................................
Q2FLM7_METHJ/320-717.............IPIIPVSVNGIGEGDFSAGIMAGYHASLQLV....................................
A0L6W2_MAGSM/19-431...........ANKEVIAVNAADF.KGCLESGYAHAVGSFIKAWLPE.................................
A6TTX7_ALKMQ/17-436............EVSFVPVSTPGY.GGTNYEGYYFTIREIVKNI....................................
NIFN_RHILO/19-429...........AGTEVVLANTPDF.DGAIEEGWAKAVAAMIEGI..T.................................
A7I7F4_METB6/48-446..............DIIPVESSGFISGNKVVGYRAAAEALLRLI....................................
Q8KC88_CHLTE/24-443............GKYVIYASTPSY.VGSHITGYANMVTSMTEQFAV..................................
Q6D2Z0_PECAS/69-501............DMPIPYAHTPSF.IGSHITGWDNMFEGFARTFTV..................................
A6UWY4_META3/30-461.........EKAELPIIPVHCPAY.KGSHATGYDNASKAYFQYLAK..................................
A5N1T9_CLOK5/23-438............GKIVIHANTPSY.VGSHITGFSSMVKAMVAYLSK..................................
A7I7F3_METB6/23-439............GKIVIHTNTPSY.VGSHITGFSNMCKSMVAYLAE..................................
A4YYY7_BRASO/19-429............NYPLVYVSTPDF.KDAFQDGWDKTVAKMVEVLVDK.................................
A5HZN4_CLOBH/32-412..............QLTFVLMAHFKCNSYPSGYWKTLVAFGNLM....................................
A5UYB5_ROSS1/24-407...............VVLVRVPAYAIHSHPEAKDVALEALLRRLGD..................................
A6LUZ3_CLOB8/23-437..............YVLHANTPSY.VGSHITGFSNMVTGFIKGLSK..................................
A6LUZ5_CLOB8/18-440............KVKLIPIQSPGY.GGTQYGGYFTALRAVVENV....................................
A9WCM1_CHLAA/32-409..............PVILVRVPAYAIHSHPEAKDVALAAVMRRFID..................................
A9WCM2_CHLAA/14-404...............ARFFWSQSL.EQDEWIGRERALRFAWEQY.GKP................................
C1DH03_AZOVD/37-442..............PVIPVDSAGF.YGTKNLGNRIAGEAMLKYVIGTREPD.............................
C1DH04_AZOVD/19-431............DVPIVPVNTPDF.SGCFESGFAAAVKAIVETLVPE.................................
C1DI25_AZOVD/57-448.............VDVFTVECPGFSGVSQSKGHHVLNIGWINEKVE..................................
C1DI39_AZOVD/19-429.............ASVVAVNTPDT.LGGLESGYALAVEAIIEALVPD.................................
C5AV88_METEA/12-413..............PVIPLELPAY.QKKENWGASETFYRLVRALAG..................................
D5ARY2_RHOCB/46-446..............PCIPVNVPGF.AGSKNLGNKLGGEALLDHVIGT.................................
G8AJS3_AZOBR/22-428............GLKLVFANTPDF.SGGFEDGFSAAVTGIVEEVVQ..................................
NIFD_METMP/49-457..............DVVAFNAPGFAGPTQSKGHHVGNYTIFEKLVG..................................
NIFE_METMP/74-470..............RVIPVQSEGFKSFNKTAGHKLACDAMLDYVIG..................................
BCHY_RHOS4/55-446...............IVGIDVPGFGVPTHAEAKDVLAGAMLKYARSEIEAG.............................
Q3J0H5_RHOS4/19-424............DTAVVYAATPDF.AGGLEEGWARAVEAIIEALVT..................................
Q6LYX6_METMP/15-428.............PEIVPISTPSY.KHTHVEGYDSTVKALVENL....................................
Q72WS8_DESVH/23-443............GKKVIHCNTPSY.VGSHVTGFSNMVEGMVNYLAA..................................
Q8TJ89_METAC/23-439............SIKICAASTPSY.VGTHITGYDNMVKSFVTTF....................................
Q8TRG2_METAC/20-444..........DRDVKLVAIHTPSY.SGSMVTGYDNAISAMVKALA...................................
V6EWQ5_9PROT/19-430............DIKVIPVSAPDF.TGSLETGWGKAVTAIINALAEP.................................

PF01497

Q4KAK8_PSEF5/33-281-----------------AQGLETLVVDYSN................----------------------------------
A9KLK9_CLOPH/127-364-----------------DNEIKTLLFQVDSF...............----------------------------------
A8LBT9_FRASN/61-297-----------------ESIAPTIFFGFS.................----------------------------------
Q9HMG8_HALSA/70-339-----------------RGDIDFLTQRSAPFLGNTIFRRT.DAWHD----------------------------------
Q03SI0_LACBA/39-270-----------------HVTPHFLDLTSV.................----------------------------------
Q8TKF6_METAC/99-361-----------------KVGCPCVDAETGFTF..............----------------------------------
Q129U2_POLSJ/29-259-----------------KKGIQVTIFNQRSV...............----------------------------------
Q5E5H9_VIBF1/28-260-----------------QSNVKVNIVNTTPTV..............----------------------------------
Q73TK8_MYCPA/66-308-----------------SAIAPTVAQSDGDAF..............----------------------------------
A8AWA6_STRGC/24-267-----------------ENKIPVYTQKASLSNIK............----------------------------------
Q5WC89_BACSK/255-486-----------------TVSIPTFIDLSNA................----------------------------------
Q4JSY9_CORJK/57-307-----------------VPDAAVVELEPREDKP.............----------------------------------
Q6L1D8_PICTO/51-271-----------------SLGIKYLEYVPCNI...............----------------------------------
Q8TM94_METAC/62-323-----------------EPDIPVVFVDTLNP...............----------------------------------
Q9HKZ6_THEAC/7-228-----------------SEKYHVVEFELPSTV..............----------------------------------
Q2G941_NOVAD/48-274-----------------GLHLETLGMANTV................----------------------------------
Q7MWG9_PORGI/105-345-----------------ASGINTVLYNEWKERD.............----------------------------------
Q8FRS2_COREF/66-320-----------------SQIAPVVAYPEQPWG..............----------------------------------
A4FH22_SACEN/55-310-----------------KSIVQTVGVQQSGVALP............----------------------------------
B1HSF6_LYSSC/69-304-----------------EKIAPVITLKYQDIY..............----------------------------------
D9QEM0_CORP2/95-325-----------------AAGVTTVVMEPTRTI..............----------------------------------
M9X349_PASHA/55-314-----------------QAGIPVVVDFNKQTI..............----------------------------------
Q0P8Q4_CAMJE/73-305-----------------KEIAPTLFVGLDNANF.............----------------------------------
Q2FWN6_STAA8/51-277-----------------QKIAPTIPYTYNK................----------------------------------
Q74XT9_YERPE/44-278-----------------APIAPTMSFAFNEQGSS............----------------------------------
Q92XA6_RHIME/55-318-----------------ELGIPVYTSPSDCTGKENSAASDGVRRQV----------------------------------
R7FQC8_9FIRM/141-385-----------------DLDIPVFIDRSSYESH.............----------------------------------

PF00148

B4SC77_PELPB/21-398................................................PEAPAGQK.............KVVFL.GSVND
B0UCN0_METS4/77-469...........................................PVAAPRQGRDGRP.............TVTLL.GEMFP
B2JYA8_BURP8/19-425.................................................PLPTVHR.............QVNLL.PGSHL
A8ML60_ALKOO/11-412................................................ETVQKKPN.............TYNIV.GNNGD
Q3A2R7_PELCD/48-471...............................................KKVEGKDNG.............KLNLI.PGFDA
A1WTQ5_HALHL/61-466.................................................NREGDG.RQA.......GPYDVAIV.GDYNI
A0LH04_SYNFM/16-440................................................AGEGHAAR.............MLNLL.PGF.L
CHLB_PROMT/11-419...........................................ESKHTWQEEKRRP.............RVNLL.GPTLL
Q72WS7_DESVH/65-519.................................................T..RER.EA........GRFSVNVL.GEYNI
A5GAJ7_GEOUR/498-905...............................................PEGGEKIKG.............QVTIL.PGCHL
Q0RAV6_FRAAA/76-504............................................ADASKVAKSDKV.............RLNVI.PGFDT
A6UWY1_META3/60-461.................................................KEVEEV.LEQP.....PTPYDVNII.GDFS.
Q2RS09_RHORT/44-448.................................................T..IEP.SDA.......GPTDINII.GEYNV
Q3Z7D0_DEHM1/60-516.................................................T..DNT.ASP.......SPYRVNLL.GEYNI
Q20XD3_RHOPB/20-446................................................AKKGEPSG.............RINLL.TGW.V
A1WTP6_HALHL/19-436.............................................SAGTRPGRAAR.............QVNLL.LSDAV
Q8TP84_METAC/341-740................................................PSVTPEKG.............LVNII.GERSF
Q2J4G2_FRASC/19-525SAGSAEAARSTRSTRSTRSARSLGSAEAARSTRSARSLGSAARRVAAADGGALDPR.............QLAVL.VGPSL
Q8TJ87_METAC/15-494.....................EYTEILEKEKAKANVREAKKPDMEEETDAIEASNG.............KLNLI.PVESI
Q8TRG0_METAC/31-443...............................................KKQSEKIPN.............TVNLIAPQANL
BCHB_CHLAA/11-419...............................................KPQPRTERP.............TVNIL.GPASL
A3DFR2_CLOTH/52-456...............................................QKPRRRRDD.............MINVI....NF
A5USK3_ROSS1/51-447.................................................SVEPEGDF..........SRSINII.GDYNI
A6LR27_CLOB8/53-455...............................................VKPPRKKTN.............KINVA....NF
Q7M8U9_WOLSU/69-488...............................................VSQSADKKD.............RINII.PGFEP
A4XMA4_CALS8/25-448.................................................KKKEENG.............KAYII.PGM.I
A6UWY5_META3/46-455.................................................K..KEQYPEKCLKEENKTPYDIALI.GDYNM
Q72WT1_DESVH/16-490......................PGAAARGPATAGATVSDTTPGAISGTTSGTVSTG.............RTCLL.PGL.L
A4XMA3_CALS8/36-422.................................................NFEKTE.EI.........EDSVNII.GEYNV
O27608_METTH/13-425.................................................DPSDQIE.............RVNVI.NGI.M
A5N026_CLOK5/32-415................................................KAKKTEPA.............RINIL.GRSPE
Q3Z7D3_DEHM1/21-437................................................AVKKEEHG.............GINIM.PGM.I
O27526_METTH/12-396...............................................WRMEPSSKP.............SVNII.GEFRG
A4XMA5_CALS8/46-442.................................................T..KEL.EDP.......TPYDVNII.GEYNI
Q6NA14_RHOPA/19-430..............................................PGRSSVRLPR.............QVNVL.ASAML
Q97ME2_CLOAB/52-505.................................................TGDWKH.K..........KYSVNIL.GEYNI
A5USK2_ROSS1/20-440...............................................RKKKGETNG.............RINII.PGW.V
Q24QP1_DESHY/324-722................................................KDVPTLPD.............TVNIV.FEKFI
Q2RWB8_RHORT/53-460...............................................KPAVTKRPE.............VVNIV....CF
NIFE_METTH/64-456.................................................R..GDA.EV........GERSVNLV.GEFNV
Q2RL08_MOOTA/46-462.................................................L..RERRPELKMPETEKTPYDICLI.GDYNM
Q6N6J8_RHOPA/13-414...............................................VVPGPTRAG.............LVNIL.GPVPH
A5N1T7_CLOK5/17-439................................................CKECENTG.............KLNIV..CANL
A6LUZ4_CLOB8/44-438....................................................SRN.ILP.......KRKGINML.GDFNL
BCHB_CHLTE/11-426...............................................AEQPKTEKP.............SVNLL.GFTSL
NIFK_CYAA5/69-490...............................................GKKKETTNG.............KINFI.AGFET
A7I7F2_METB6/56-518.................................................K..GNE.RKP.......GKHVINVL.GEYNI
Q2FLM7_METHJ/320-717...............................................KQEAGKNER.............SVILV.GEKIL
A0L6W2_MAGSM/19-431...............................................RPATKGDAK.............RINLL.VGPHL
A6TTX7_ALKMQ/17-436................................................AKDTTPID.............SINLI.AGS.L
NIFN_RHILO/19-429..............................................RSGERTRQPK.............KIAIL.PGCNL
A7I7F4_METB6/48-446.................................................RPKEGG.TIE.......KTQKINFL.GEYNL
Q8KC88_CHLTE/24-443.................................................STGEKKD.............QVNVI.AGW.M
Q6D2Z0_PECAS/69-501...............................................GEDKHYQPGS..........LPRLNLV.TGFET
A6UWY4_META3/30-461................................................KDPEVEPH.............KINII.SGFGT
A5N1T9_CLOK5/23-438.................................................NTGVENG.............KVNIL.PGF.V
A7I7F3_METB6/23-439................................................AQGETKKE.............QVNVI.PGF.V
A4YYY7_BRASO/19-429...............................................PTSTRRDPA.............RVNVL.PGCHL
A5HZN4_CLOBH/32-412................................................KKGKKSTD.............TINIL.GRSPR
A5UYB5_ROSS1/24-407................................................REGPREDR.............TVVVV.GEVFP
A6LUZ3_CLOB8/23-437.................................................TTGVKNG.............KMCVI.PGF.V
A6LUZ5_CLOB8/18-440................................................EMYPDKNE.............KVNVI.AGPMS
A9WCM1_CHLAA/32-409................................................TSGDHEPG.............TLALI.GEVFP
A9WCM2_CHLAA/14-404.............................................FVDADVQPRPR.............TVNII.GPS.L
C1DH03_AZOVD/37-442..........................................PLPVGSE......RPGI.......RVHDVNLI.GEYNI
C1DH04_AZOVD/19-431..............................................RRDQVGKRPR.............QVNVL.CSANL
C1DI25_AZOVD/57-448.................................................TMEKEITS..........EYTMNFI.GDFNI
C1DI39_AZOVD/19-429..............................................SVVPAAQRAR.............QVNLL.AGSML
C5AV88_METEA/12-413................................................SPAERSPRDG........RRPACNIL.GPTAL
D5ARY2_RHOCB/46-446...............................................LEPETVTPY.............DVNII.GDYNL
G8AJS3_AZOBR/22-428................................................PSETTMKG.............QINVL.AGCHL
NIFD_METMP/49-457.................................................T..KEPPKT........TDYDINLI.GEYNI
NIFE_METMP/74-470.................................................TEEPEEEH..........PYSINII.GEFNV
BCHY_RHOS4/55-446...........................................PVQAPVSGRSDRP.............TVALL.GEMFP
Q3J0H5_RHOS4/19-424.................................................EGPRRLR.............QVNLL.PGANM
Q6LYX6_METMP/15-428................................................ATPSKPNS.............KLNVI.TGM.V
Q72WS8_DESVH/23-443................................................GTGKQAAG.............QVNVI.PGF.V
Q8TJ89_METAC/23-439................................................ASKSKPNG.............KLNII.PGF.V
Q8TRG2_METAC/20-444.................................................KKGEPSE.............KLNIF.TGW.V
V6EWQ5_9PROT/19-430...............................................ASARAQECN.............RVNIL.PGVHQ

PF01497

Q4KAK8_PSEF5/33-281--------------------------------------------------------------------------------
A9KLK9_CLOPH/127-364--------------------------------------------------------------------------------
A8LBT9_FRASN/61-297--------------------------------------------------------------------------------
Q9HMG8_HALSA/70-339--------------------------------------------------------------------------------
Q03SI0_LACBA/39-270--------------------------------------------------------------------------------
Q8TKF6_METAC/99-361--------------------------------------------------------------------------------
Q129U2_POLSJ/29-259--------------------------------------------------------------------------------
Q5E5H9_VIBF1/28-260--------------------------------------------------------------------------------
Q73TK8_MYCPA/66-308--------------------------------------------------------------------------------
A8AWA6_STRGC/24-267--------------------------------------------------------------------------------
Q5WC89_BACSK/255-486--------------------------------------------------------------------------------
Q4JSY9_CORJK/57-307--------------------------------------------------------------------------------
Q6L1D8_PICTO/51-271--------------------------------------------------------------------------------
Q8TM94_METAC/62-323--------------------------------------------------------------------------------
Q9HKZ6_THEAC/7-228--------------------------------------------------------------------------------
Q2G941_NOVAD/48-274--------------------------------------------------------------------------------
Q7MWG9_PORGI/105-345--------------------------------------------------------------------------------
Q8FRS2_COREF/66-320--------------------------------------------------------------------------------
A4FH22_SACEN/55-310--------------------------------------------------------------------------------
B1HSF6_LYSSC/69-304--------------------------------------------------------------------------------
D9QEM0_CORP2/95-325--------------------------------------------------------------------------------
M9X349_PASHA/55-314--------------------------------------------------------------------------------
Q0P8Q4_CAMJE/73-305--------------------------------------------------------------------------------
Q2FWN6_STAA8/51-277--------------------------------------------------------------------------------
Q74XT9_YERPE/44-278--------------------------------------------------------------------------------
Q92XA6_RHIME/55-318--------------------------------------------------------------------------------
R7FQC8_9FIRM/141-385--------------------------------------------------------------------------------

PF00148

B4SC77_PELPB/21-398V......TADDLRAEA.EELGI..........................PVGGFLPESRFDKMPAIGPDTVLAPIQPY.LS
B0UCN0_METS4/77-469A......DPVQIGALL.EPLGL.........................SPGPVV.PTREWRELYAALDCAAVAAIHPF.YT
B2JYA8_BURP8/19-425S.P...GDIDELREIV.SAFGLDPIILPDIS.......RSLDGHLSPVWRGTTLGGTTLDQIRMAGGSAFTIGVGEQ.TR
A8ML60_ALKOO/11-412V.FNFLSDVEEIKNLMKSAFNF.........................DVNTTFTAYTSMEEIEKAGEAQFNLVLRGE.GL
Q3A2R7_PELCD/48-471N.T...GNYREYKRIC.EEFGIPVNLLADIS.......ETFDSPLDGTYRTYP.GGTPLEDAADSLNAHATLSMQLH.AT
A1WTQ5_HALHL/61-466G.....GDCWASRILL.EEMGL.........................NVVAQWSGDGTLAEMENTPKVQLNLLHCYR.SM
A0LH04_SYNFM/16-440S.P...EDLRHLKEIL.AAFRCAATILPDIS.......MTLDGPALDDYPKIPGGGTPIEDIWRMGGAGATFELGRT.LH
CHLB_PROMT/11-419G.FRCRDDVLEIQKLL.GQYGI.........................DVNVVAPLGASPADILRIPNADVNVCLYPE.IA
Q72WS7_DESVH/65-519G.....GDAYEIERVL.EKCGI.........................EVVATFSGNSVYEDMCTAHSANLNLVMCHR.SI
A5GAJ7_GEOUR/498-905T.P...ADVEEVAEIC.EAFGLTPLVIPDIS.......NALDGHIDETVSPLSVGGVTLDKVRLAGRSEATLYLGDS.LA
Q0RAV6_FRAAA/76-504Y.V...GNHREYKRIL.ELMGVDPLILGDHS.......SALDSPANGEYELYP.GGTPLKEGALAKFSRASLLLQES.TL
A6UWY1_META3/60-461T.....GSSNSIEQIF.NKMGV.........................RVLCSFTGNATIDRIRIMDSAKLNIVHCMK.SS
Q2RS09_RHORT/44-448A.....GEFALVKPLF.DELGI.........................RIRACITGNSRYRDLAGAHTARVNMMVCSQ.AM
Q3Z7D0_DEHM1/60-516G.....GDAFVIEDLF.ARCGF.........................ELVSTFCGNSDHDSMCRSHTAELNLVMCHR.SI
Q20XD3_RHOPB/20-446N.P...GDVKELKHLV.SELGIEANVLFEI........ESFDSPLMPDGAGISHGNTTVADLEATGSAIHTFALNRY.EG
A1WTP6_HALHL/19-436S.P...GDAEALCELL.EAFGLEPVAIPDLG......ASMDGHLEDGDFSPVTTDGTPLDALRECGNAAATVVVGAS.LH
Q8TP84_METAC/341-740S.LREEEHFRTIEGLI.KKLGY.........................GVNCRFLKGADTLSLRSFKKAEINMLACDDPET
Q2J4G2_FRASC/19-525T.A...ADLDELGELI.RAFGLDPVLVPDLS.......GSVDGHLAPAWQPTTTGGTGLARLRALGRSRAVLVAGAT.AA
Q8TJ87_METAC/15-494S.P...ADVRELKEILAETAG.DYIFLPDIS.......ETFDAPLGEELPKIAPGGTPLSEIADMPNSKASLGLGIV.ST
Q8TRG0_METAC/31-443N.PTWWADLKWIREVL.EKIGI.........................RVLAVLPHETSLEELGSAGLASADILLSHD.AG
BCHB_CHLAA/11-419G.FHARHDLISLRRML.KTLGL.........................EVNVVAPWGASIADLRRLPAAWLTIAPYRE.LG
A3DFR2_CLOTH/52-456W......GSDVFYEWF.APFGA..........................KPNYIIPFSTVNGLKYASEAAATVQACST.LG
A5USK3_ROSS1/51-447K.....NDIRTFEYLF.EALGL.........................RIIARFTGNVSVDDLKIMHKAALNIVHCQR.SA
A6LR27_CLOB8/53-455W......GSHIFDEFL.NRLGY..........................EAQYIVPFSTVAELEYISEAAATIHICPS.LS
Q7M8U9_WOLSU/69-488Y.I...GSLREVKEIV.EAFGADYIMLGDH........SEQWDMPAGKYQMFS.GGTKLDDARDAGASKVTITLQKY.TT
A4XMA4_CALS8/25-448N.P...GDIEEIKHIL.DLMKIDYSVLFDIS.......KTLNSPLMPPKPLYPEGGTPYSELEDSANGKVAVSLCPH.AG
A6UWY5_META3/46-455D.....WDVAVINDLF.EKIGV.........................RNVVTFTGNAAMDDLFKLTDVKLNVVHCQR.SA
Q72WT1_DESVH/16-490S.P...ADIRHLRDVM.EAFGLAPVILPDIS.......ETLDAPCLEAYAPIPAGGTPLDDIRALGRARAVVEMGDPLGS
A4XMA3_CALS8/36-422A.....GESQVIERLL.EKIGI.........................NVICTYTGDCSLSQMEKSVNARLNLLLCKS.SG
O27608_METTH/13-425S.P...ADTYELKSIL.RSMGTEFLMITDTS.......ESLDEPFNGDPYFITRHGTPISKIEGASNSMATLSLGGC...
A5N026_CLOK5/32-415E..K.HIPMPSLLPEL.VKRSF..........................ALRYLAPGASLTDFQSAPDAALNLVVCPF.MQ
Q3Z7D3_DEHM1/21-437S.P...ADIRYIKRIC.QDLGISAALLPDYS.......DTLDGVSWPEYHCFPEGGTPVSVLKGMGGAKASIELCRF..S
O27526_METTH/12-396G.....ADLREVRESL.SLMGV.........................DVNCVLTSGCSIRDMTMIPAGHLNCSFCDV.SG
A4XMA5_CALS8/46-442D.....GDYWVLEKLF.TKIGL.........................RIITAFTGNASYDNLCKMHHAKLNIVHCQR.SA
Q6NA14_RHOPA/19-430T.P...GDVEAIKAWI.EAYGLTPIVLPDIA......DSLDGHLIDAGFSTLTYGGTTLDDIGRMSQSAATLVIGRS.LD
Q97ME2_CLOAB/52-505G.....GDAWEIERIL.KKIGY.........................TVVGRLSGDGSYERVKNADTADLNLVQCHR.SI
A5USK2_ROSS1/20-440N.P...GDIRELKHML.REMGLHGLWITDYS.......ETLDGGYYDPRPHVPRGGTTIEELRSSSKSLATIALQRH.VG
Q24QP1_DESHY/324-722V.TNTNDNFQTIGSLL.SRLGV.........................RVNCRFLCETTFDSLETFCTAQLNLLAYKDYTG
Q2RWB8_RHORT/53-460S.....GKKAYFSELL.EPLGL..........................VANPIVQFLTVAEIETLSEAGATAHMCPT.LG
NIFE_METTH/64-456A.....GDLWEIKRLL.EKMGV.........................KVVASITGDSTVAEISAAHKAQLNLVQCSK.SS
Q2RL08_MOOTA/46-462D.....WDLKAIRPLF.EKMGL.........................RIVAVFSGNERIENLVKMPDVKLNVVHCQR.SA
Q6N6J8_RHOPA/13-414QDATWLAEIEELSRLI.AGVGL.........................IPNPIFGPFGGLSSLRATAQAELSVSLSPW.GG
A5N1T7_CLOK5/17-439N.P...GDVRNIKKIL.DDFKIEYTILPDVS.......NTLDSSHNEKYRRIPKGGTKIEDIKKMAGAAATIEMGLT.IQ
A6LUZ4_CLOB8/44-438A.....GEIWIVKEYL.KKIGV.........................DVISTITGDSSYDKLIKASSASFNVVQCAG.SM
BCHB_CHLTE/11-426G.FHLRSNLTSLRRML.KTLGI.........................EVNVVAPWGAGIDDLKKLPAAWVNIAPFRE.IG
NIFK_CYAA5/69-490Y.I...GNVRAIKNII.SAFDLEGTLLSDTE.......MYLDSPNLGEFKMYH.EGTSLEDAADSINAEATVTLQTY.TT
A7I7F2_METB6/56-518G.....GDGWEQERIL.KDCGY.........................TVNCVMTGDASYEDIKNLHLADLNLVQCHR.SI
Q2FLM7_METHJ/320-717A.NNTTANFNELSQYL.STLDI.........................QVSCRFLAYTSVNEVQSMSEQSLILPVSSDKIT
A0L6W2_MAGSM/19-431T.P...GDLERLLDTV.ERFGLKAVLLPDLS......RSLDGHLAPDDFSPITTGGATVEDFQTIGDACATLVVGDI.MN
A6TTX7_ALKMQ/17-436T.P...ADVRKVKEMM.DLFAIKYTIVPDIS.......KTLDAPFTTEYKKLSSEGTKLSEIEKMAGASATIEMGML.VA
NIFN_RHILO/19-429T.V...ADVEHLRDMV.ESFGLKPVILPDVS.......GSLDGTVPDRWVTTTYGGTSVEEIRELGTAAQCIVIGEH.MR
A7I7F4_METB6/48-446G.....GEKWLAERYL.REIGI.........................EINVAFTGDSTVAALKRAPSACLNLVQCTG.SM
Q8KC88_CHLTE/24-443E.P...SDMREIKSLA.SRLGVKIVLFPDTS.......DVLDAPQTGKHEFYPKGGITINELKSAGDSKCSLAVGCI.SA
Q6D2Z0_PECAS/69-501Y.L...GNYRVLKRMM.ADMGVPCAILSDPS.......EVLDTPADGHYRMYA.GGTTQQEMRDAPNAIDTLLLQPW.HL
A6UWY4_META3/30-461N.P...GDILEIKRML.KMMGLEEGKDFSIIFDISENLYKPLREPLDEVPYYPDAGTTIEEFVDAGNGKATFALCQS.AG
A5N1T9_CLOK5/23-438G.P...ADMREYKRIL.KIMGIPYIIMPDTS.......GVVDSPMTEGFKMFPKGGTKIEEIKDTGNSKRTFAFGSV.SS
A7I7F3_METB6/23-439N.P...GDMREIRRIV.TALGVKLVMFPDTS.......GVLDAPLTSKYQMYPEGGTTIAEIRDSGNSEVTLALGAF.AS
A4YYY7_BRASO/19-429T.P...GDIEELRTIF.EDFGLEPSFLPDIG.......GSLDGHIPDEFTPTTIGGIGLEEIATMGSASWTIAIGAQ.MK
A5HZN4_CLOBH/32-412E.K..HVPMPGLLTAL.EKRGF..........................YLRMLAPKSDVEDFIVSPDAALNIVLSPF.MN
A5UYB5_ROSS1/24-407A......DQLAIDAIL.RRMGV..........................ETTVALPGRSIDDLRRAGRAAALAPLHPF.YK
A6LUZ3_CLOB8/23-437N.P...GDMREVKRLL.KLMGVDFTMLPDTT.......GVLDAPMTGKYEMYPKGGTKIQDIIELGDCEKTLALGSF.AS
A6LUZ5_CLOB8/18-440S.....ADMREIKEIL.EDFKIDYILLPDLS.......ENLDGVHSKKYNRLPSNGTSIEEIKFMGGAKATIELTTF.IK
A9WCM1_CHLAA/32-409A......DPLLIDGVV.RRMGG.........................RVVTTL.PGRHVDEIRQAGRAAAVAALHPF.YR
A9WCM2_CHLAA/14-404GCFNAPSDLYELKRLI.TGIGA.........................EINLVYPYEGSIATTPKLAEAAVNVVMYRE...
C1DH03_AZOVD/37-442A.....GEFWHVLPLL.DELGL.........................RVLCTLAGDARYREVQTMHRAEVNMMVCSK.AM
C1DH04_AZOVD/19-431T.P...GDLEYIAESI.ESFGLRPLLIPDLS......GSLDGHLDENRFNALTTGGLSVAELATAGQSVATLVVGQS.LA
C1DI25_AZOVD/57-448Q.....GDTQLLQTYW.DRLGI.........................QVVAHFTGNGTYDDLRCMHQAQLNVVNCAR.SS
C1DI39_AZOVD/19-429T.P...ADVEAIREWI.EGFGLQAVILPDLA......DSLDGHLTPQGYTTLTTGGTTRQEIAAMGRSALTLVIGDS.LG
C5AV88_METEA/12-413G.FRHRDDLIEVRRLL.DGLGI.........................AVNVVAPLGATPADLARLGEADFNVVLYPE.VA
D5ARY2_RHOCB/46-446S.....GELWQVKPLL.DKLGI.........................RILGSIAGDARYKQVAMAHRAKVTMLVCSQ.AL
G8AJS3_AZOBR/22-428S.P...GDVEELRDII.ESFGLSPIFLPDLS.......LSMSGRQPDDFTATSLGGVTVDQIASMGASELTLVIGEH.MR
NIFD_METMP/49-457D.....GDYWVLEKYF.EDMGI.........................NVLSKFTGDATHGELCWMHKAKLSLVRCQR.SA
NIFE_METMP/74-470A.....GDLWGIIPLY.EKMGV.........................KVHTAITGDSTVAKVASAHRSKLNIVQCQK.SS
BCHY_RHOS4/55-446A......DPVMIGALL.APLGL.........................AAGPVV.PCRDWRELYAALDSGVAAAIHPF.YT
Q3J0H5_RHOS4/19-424T.A...ADIEEIAGLI.RAFGLHPLILPDLS.......LSLDGHLAEDWRGHSLGGTRLADIATMGGSIATLALGEA.MR
Q6LYX6_METMP/15-428S.P...GDIAETKRIL.REMGIESIILTDTS.......ESMDAPFDGEVSFVSSAGTTVEELKDTANSFATISLCKH.AN
Q72WS8_DESVH/23-443E.P...SDMRKIKGML.AQMGVDGVVFPDTS.......DVLDTPQTGEYRMYPAGGTTQADFARSGDSMATLALGAW.AS
Q8TJ89_METAC/23-439E.P...ADIREIKRIL.SIMGISSIVFPDTT.......DVFDAPLTKEHTFYPKGGTPIGDIEDSANSLGTIALCRM.AG
Q8TRG2_METAC/20-444N.P...GDVSEIKHIL.SEMQVDGNILLDT........ETFDSPIMPDKSAFAYGNTTIEDIADSANALGSIALSRY.EG
V6EWQ5_9PROT/19-430S.P...GDIEHLVELV.EEFGLKANVLPDLS.......GSVDGHVPDHFIPTTLGGATVENARALGRAKLTIAIGEH.MR

PF01497

Q4KAK8_PSEF5/33-281------...QSWQDIA-TALGQ----------------------------------------------------------
A9KLK9_CLOPH/127-364------...LDYLTML-KSCTT----------------------------------------------------------
A8LBT9_FRASN/61-297------...SDWKTRL-SVTAD----------------------------------------------------------
Q9HMG8_HALSA/70-339------YDYYSLYEAF-ETVAE----------------------------------------------------------
Q03SI0_LACBA/39-270------...GHLQTTL-TQLGQ----------------------------------------------------------
Q8TKF6_METAC/99-361------...EENYVQI-RLLGE----------------------------------------------------------
Q129U2_POLSJ/29-259------...AEIFSMM-YQLAA----------------------------------------------------------
Q5E5H9_VIBF1/28-260------...QGLLNRI-DEIAS----------------------------------------------------------
Q73TK8_MYCPA/66-308------..FEPWKEQA-AAVGQ----------------------------------------------------------
A8AWA6_STRGC/24-267------QDLGNIVEDV-KNIGT----------------------------------------------------------
Q5WC89_BACSK/255-486------...GSWKDQF-IVVAE----------------------------------------------------------
Q4JSY9_CORJK/57-307------.MDEELIRQI-TTLGE----------------------------------------------------------
Q6L1D8_PICTO/51-271------...NEIENMT-LQLGI----------------------------------------------------------
Q8TM94_METAC/62-323------...DSFCDTV-QIIGT----------------------------------------------------------
Q9HKZ6_THEAC/7-228------...AGILDLV-MKVGF----------------------------------------------------------
Q2G941_NOVAD/48-274------...EASRDQI-RQIAR----------------------------------------------------------
Q7MWG9_PORGI/105-345------..LLGRAEWM-KLTAM----------------------------------------------------------
Q8FRS2_COREF/66-320------...TTLEDQI-LMNAT----------------------------------------------------------
A4FH22_SACEN/55-310------ESIRKYEELA-RALGG----------------------------------------------------------
B1HSF6_LYSSC/69-304------...EDWQYGL-RTVAE----------------------------------------------------------
D9QEM0_CORP2/95-325------...DSVSEDI-KNLGG----------------------------------------------------------
M9X349_PASHA/55-314------...ENHTKSV-RVFGQ----------------------------------------------------------
Q0P8Q4_CAMJE/73-305------..LSSFENNV-LSVAK----------------------------------------------------------
Q2FWN6_STAA8/51-277------...YNHKEIL-KEIGK----------------------------------------------------------
Q74XT9_YERPE/44-278------.PLAVGKNSL-QTLGQ----------------------------------------------------------
Q92XA6_RHIME/55-318------FTMDLVYREI-RELAH----------------------------------------------------------
R7FQC8_9FIRM/141-385------..PLGRTEWI-KAYAA----------------------------------------------------------

PF00148

B4SC77_PELPB/21-398R....VAVKLSRERGCSVLH..SLFPFGPDGTRAFWEDLAREFG................IT.V...DLRD..RE.KAAW
B0UCN0_METS4/77-469A....AIREFEAA.GRTVLG...SAPVGHEGTAAWLDAVGEACG...................VARLTVEA..AK.NRIL
B2JYA8_BURP8/19-425E....GAQTLESIAGTPFEI..FERLTGLEPNDRFLQRLAQLSG................QA.V.PAKYRR..QR.SQLV
A8ML60_ALKOO/11-412K....AADTLKKNHGMGYHY...GRPYGLEGTTFWLKSLEKALG................IP.ADEQYIAK..KT.AEIR
Q3A2R7_PELCD/48-471K...ETIKWFKSETEAPVEV..MPSPIGVANTDAFLMKLSELFG................KE.V.PASLKA..ER.GRLV
A1WTQ5_HALHL/61-466N...YICEHMEKTHGIPWME...FNFFGPTRIAQSLREIAAQFDE.............TIQA.NAEQVIAK..YQ.PTME
A0LH04_SYNFM/16-440GDPQSTGKLLKERFEVALHS..MGVPIGLRETDTFFGALEQLTG................ME.R.SPRFAM..ER.GRLV
CHLB_PROMT/11-419E...STCIWLERNLNIPFTT...TVPLGVGATQDFLKELHKVLE..................MEIPQSVNESNNSKLTWY
Q72WS7_DESVH/65-519N...YLAEMMETKFGIPWMK...VNFIGMRSMSQSLRKIARYFDDA............ALTA.RIESVIAE..EE.ARAE
A5GAJ7_GEOUR/498-905K....AAEILKENFAIPCYG..FTSITGLAETDSLMETLSAIAG................RP.V.PEKLRR..WR.SRLM
Q0RAV6_FRAAA/76-504R...RTAEYIEKDWKQETIT..LETPLGVKGTDAFLTAVAKVAD................VE.V.PAELTA..ER.GRLV
A6UWY1_META3/60-461I...QFANMMEKVYEVPYIV...SNFFGIQNCCDALENIGKILDI..............DKK.VVDNTIDY..YL.NKNE
Q2RS09_RHORT/44-448I...NLGRGMRERWGIPYFE...GSFYGIGDTSQTLRTIATLLVERGA........TADLIA.RTEALIAR..EE.AKAW
Q3Z7D0_DEHM1/60-516N...YMADMMETKYGIPWIK...VNFIGAEATAKSLRKIARYFGDE............KLIE.QTERVIEE..EM.PAVS
Q20XD3_RHOPB/20-446G...KAAQLLEKKFKIPSTI..GPTPIGIRNTDALLKKLSQVTG................KP.I.PASLVK..ER.GIAL
A1WTP6_HALHL/19-436A....AADRLRARTGVPDYR..FDHLMGLHATDRLVMVLCAIAG................RE.VPPPRVQR..QR.RQLQ
Q8TP84_METAC/341-740R...ALQAYLSDRFGLEFFE..LPFPVGFRESSLWVKALTARLL................PG.EDPSPLLE..EQ.EELY
Q2J4G2_FRASC/19-525A....AGDLLAARTGARILR..HRHLSGLTEMDTLVTELIELTG................AS.A.PARVRQ..AR.ARLA
Q8TJ87_METAC/15-494N...LAVKYLEASHGVPGHN..VPIPIGLLNNDLFFTELVRILG................CP.I.PEKYQK..ER.GRLL
Q8TRG0_METAC/31-443Y...EFGLKMQEVHGIPLILSDIPLPVGLKNTARWLRALGKYFG................IE.ENVETIIK..EGEDLTI
BCHB_CHLAA/11-419L...RAAIYLEEQFGVPALL...DAPIGVQPTLRWIERLRELLAQAGADV...PMPPLTA...FSLDGMSA..PSAVPWF
A3DFR2_CLOTH/52-456S...YLGAVLEQDFGVPEIP..AAPPYGIAQTDRWFRALGKILG................KE.EIAEKIIA..EKKKEYL
A5USK3_ROSS1/51-447T...YIADMMKDKYGTPYIN...VTLWGMKNMAKALRDTAAFFG...............LEA.RAEEVIAR..EV.ARIQ
A6LR27_CLOB8/53-455T...YLGAALEQEYGVKEIK..APPAYGIEGTDIWMREIGRVLG................KE.EEIEEIIK..EEHERVL
Q7M8U9_WOLSU/69-488P...RTMKSFAKKFKQETLE..LN.PIGLAGTDAFVSAISKLTG................KS.V.PQKLKD..ER.GRLV
A4XMA4_CALS8/25-448G...SAAKYLESEFGVKSIL..GPFPVGIANTDKFIENLSQVYG................TE.I.PYELKV..ER.GLLL
A6UWY5_META3/46-455E...YIAHMVQDGFNVPFTR...VSFFGITKTSEALYDVAERLNI..............PKE.TVDEVIEK..EL.KPIN
Q72WT1_DESVH/16-490R..PSAGAALHARHGVPLFR..VGVPVGLRETDTFMEALERISG................TA.M.PPRMML..ER.GRLV
A4XMA3_CALS8/36-422L...LLAQFMKERFSIPYME...VSFYGIENTIASIKKIAKFFG................KE.KAAEIVAE..EEFSKIK
O27608_METTH/13-425....KGGRVLEGRYGIKNIG..LEIPAGLENTDRFIGKLTELFD................AS.I.SQSLMR..DR.GRLI
A5N026_CLOK5/32-415P....LAVKMEREFSVPYIA..LHTLYDVKRIHRTYEGIAKHFG...................FSWDNAFE..EERQEAL
Q3Z7D3_DEHM1/21-437DPQLSAASFLEKCHGLPAYR..IGLPVGVRAADEFMDLLSGYAG................RP.L.PEGYTR..ER.GRLL
O27526_METTH/12-396I...APCRFLEENFGTPFIH..HPIPIGFSNSLRFYREVLGYLN.....................LDYPIN..EEFSAFI
A4XMA5_CALS8/46-442T...YIARLMKEKYGTPFIR...VTLFGITETINSLREIGEFFG...............IQK.KVEEVIEE..EL.ESIM
Q6NA14_RHOPA/19-430R....AADRLRERTGVPDHR..FDSLMGLDASDAFSGALGSIAN................CA.M.PAKIAR..KR.AQFL
Q97ME2_CLOAB/52-505N...YIAEMMYTKYGIPWIK...TNFIGVTSTIQTLRDMAKVFDDP............YIYK.KTEEVISE..EL.SNIE
A5USK2_ROSS1/20-440G...EAARIYERRYNVPAHV..LTMPIGLKNTDAFVNTLIEITD................HT.I.PESLEV..ER.ARLL
Q24QP1_DESHY/324-722K...LLEDFFTREYGSVFLD..RAFPVGFAETEDWLRDVAAFFG................RP.AAAEGIIE..EH.KELY
Q2RWB8_RHORT/53-460T...WLGAGLERRFGVPEVK..APPPYGLAGTDHWLRALAALTG................RS.DRVEAYIA..AERAAIA
NIFE_METTH/64-456G...YIAEEMEKRHGTPHIN...VNFFGMRETMDSLISISEFFG................LE.LAEKWVLG..MV.EETK
Q2RL08_MOOTA/46-462E...YIAHIEKDGYNIPFIR...VSLYGIEQTCKALRETAAFFG...............LEE.RAEAVIAE..EM.ARVE
Q6N6J8_RHOPA/13-414A....AVRALDDRFGIPWIE.SAGLPVGAAATGALLERIVAAAGE.............VD...DAAARIFI..DRERQRE
A5N1T7_CLOK5/17-439DE.DSPGVYLRDKFKVPLYK..CGIPVGIRNTNKFISLVSKITG................KA.I.PEEYII..QK.GRYL
A6LUZ4_CLOB8/44-438T...YLAKRMEAEMDIPFVK...ISFVGLEDTKNSLLRIASLFGDE............EMLA.KAKAFVKE..EE.EKIL
BCHB_CHLTE/11-426C...QAAGYLKEKFGMPSIT...EAPLGVNATLRWLRAIIAEVNKIGAEKGMAPMAMPELRD.FSLDGQSA..PSSVPWF
NIFK_CYAA5/69-490P...KTREYIEKKWGQKTYT..YR.PWGVKGTDEFLMGLSELTG................KP.I.PKEFEI..AR.GRAV
A7I7F2_METB6/56-518N...YIAEMMETKYGTPWLK...VNFVGVEATNESLRQMAKCFSDP............ELEK.QTEEVIAR..ET.ARIE
Q2FLM7_METHJ/320-717L...EISKIISEKTGSEIFN..HAFPYTFNETVRWIQDLADRFR................IQ.DKGSALIA...RNEKIY
A0L6W2_MAGSM/19-431I....CADLIQERCGLADYR..FSSLMGIEAWDRLLMVLMNLSG................QP.V.PERFGH..QR.RQLQ
A6TTX7_ALKMQ/17-436DH.LSPGKYLEDQFGIPLYR..CPLPIGLENTDKFVSILRKISG................KE.M.PQSLME..DR.GRML
NIFN_RHILO/19-429H....PAKTLHGLTGVPYAV..FQSLTGLKAVDRFVSLLSAVSG................AA.V.PDRVRR..HR.AQLE
A7I7F4_METB6/48-446H...WVAQNLERTFGTPYMD...VNFFGPENTAESLRRIAAFYDDT............AMME.RAEALIAR..EM.ARIR
Q8KC88_CHLTE/24-443E...PAAIALEKKCKVPFET..VDMPIGLSATDRFIMALSKAGS................VK.V.PDEITA..ER.GRLV
Q6D2Z0_PECAS/69-501I...KTKKMVQDVWNQPATE..VSVPIGLNATDKLLMTISALTD................VP.I.GEALTL..ER.GRLV
A6UWY4_META3/30-461G...AGALFLKKKFKIPDFY...GQPIGVKNTDEFLINVAQLTG................KG.I.PDELLD..ER.GKLI
A5N1T9_CLOK5/23-438Q...DAAIELEKKCKVPFDT..LPIPIGIDATDEFLMKLVKLAG................GE.V.PYEIEE..ER.GQLV
A7I7F3_METB6/23-439N...AAADLLQEKCGVTGIP..LKLPIGLKATDDFIMAVKDWFG................AD.I.PKEIAI..ER.GQVI
A4YYY7_BRASO/19-429R....AAEAMQAKTGVPYRL..FERLCGLLPNDEFMAFLSEISG................RP.V.PAKYRR..QR.GQLA
A5HZN4_CLOBH/32-412P....LAEMMWEKFKVPFIS..LHEIYDVFEVDSLYEDVEKSLK................IR.F.NNEFDE..SR.EKAI
A5UYB5_ROSS1/24-407G.....VTRLYREWGASVAG...GAPVGISGTYAWIKSIGALLDL..............DPT.LVDQVAQE..ER.AKAE
A6LUZ3_CLOB8/23-437E...AGASTLEKSFKIPYST..LKMPIGIGSTDELIMELSKFSK................QQ.V.PYELEE..ER.GQLV
A6LUZ5_CLOB8/18-440EE.YSVGSYLEENFGVKNFR..INVPRGLRDTDNFLKVLAKISG................NP.I.PEKYKK..QR.GRYL
A9WCM1_CHLAA/32-409E....TIGVLRER.GVAVIS...GAPIGADGSAAWLRAIGAALE...............LDE.DVVERVAA..EE.EAAA
A9WCM2_CHLAA/14-404.....FGQGLAEDLGRPYLF....APFGVFGTTAFLRELGQLLGI..............DPA.QVDAFIER..EK.RTTL
C1DH03_AZOVD/37-442L...NVARKLQETYGTPWFE...GSFYGITDTSQALRDFARLLDDP............DLTA.RTEALIAR..EE.AKVR
C1DH04_AZOVD/19-431G....AADALAERTGVPDRR..FGMLYGLDAVDAWLMALAEISG................NP.V.PDRYKR..QR.AQLQ
C1DI25_AZOVD/57-448G...YIANELKKRYGIPRLD...IDSWGFNYMAEGIRKICAFFG................IE.EKGEELIA..EEYAKWK
C1DI39_AZOVD/19-429R....AADLLQARTGVPDLR..LPGLTALADCDAFVQALADVSG................RP.V.PARILR..QR.EQLL
C5AV88_METEA/12-413R...SAAQYLEKTFQQPFVD...VVPIGVGATTRFVEAVAALAG................VD.PAPVLADA..PSRLPWY
D5ARY2_RHOCB/46-446I...NVARKMQERYGIPYFE...GSFYGISDTSQSLRRMCELLVDQGA........PKDLLN.RCEVLIAR..EE.AKAW
G8AJS3_AZOBR/22-428V....AAAALELKTDVRSVF..FDRLTGLEASDRLVRTLSELSG................RP.V.PAKLRR..QR.ETLV
NIFD_METMP/49-457T...YVAKLIEEKYGVPYLK...VDFFGPEYCAENLRAVGKYFG................KEIEAEAVIKK..EM.EKIQ
NIFE_METMP/74-470N...YLAAQMEKKYGIPSIK...VNFFGLDETTKSLRAVAEFFGDE............EMIK.RTEELIKS..EI.KNLR
BCHY_RHOS4/55-446A....SVREFQAA.GRAIVG...SAPVGHDGTAAWLAAIGEAYG...................IAADKVAA..AQ.NAFL
Q3J0H5_RHOS4/19-424P....AAEKLAA.LGVPAHV..FPSVTGLKAVDAFVATLMRLSG................AE.V.PAGVRR..DR.ARLA
Q6LYX6_METMP/15-428S....AAKFLHEAYGINSVS..PYLPIGLQSTDEFMNELCKLTN................KE.I.PEQITR..ER.GKLI
Q72WS8_DESVH/23-443E...AGAKALEKKCGVPYRL..LDTPIGVLATDRFLAALQETTG................MT.V.PRSLKD..ER.GKLV
Q8TJ89_METAC/23-439G...AAAKILESRYKVPAKI..GPTPIGIRNTDRFIMNAAKLAN................VA.I.PPELED..ER.GRLV
Q8TRG2_METAC/20-444A...NAATFLKEKFDVPSIV..TPTPIGINNTDIFLKNISELTG................KP.I.PESLVI..ER.GKAI
V6EWQ5_9PROT/19-430I....SAETLQEKTGVPYVL..FDRLTGLEASDRLMVCLSTAAG................KP.V.PAKIRR..AR.SQLI

PF01497

Q4KAK8_PSEF5/33-281----------------------RTGLE..QQARAAIQRFDQYTA-------------------QTAARITP--P.....P
A9KLK9_CLOPH/127-364----------------------ILNTQ..DRYHTYGTEVLDTVE-------------------HIVEDTSN--V....KN
A8LBT9_FRASN/61-297----------------------ATELT..DALNEQKTEYEEKLA-------------------EFQNKYPE--IIKTTKF
Q9HMG8_HALSA/70-339----------------------LFDET..DRFDAFQSFHDSALD-------------------RLETALPS--E....GP
Q03SI0_LACBA/39-270----------------------RYQRQ..SAAAKQNRLINQAKQ-------------------RVKQRAQR--Q....KA
Q8TKF6_METAC/99-361----------------------VLDRE..AEAEDLENFIQSKVD-------------------MVKSVTDQ--L....DD
Q129U2_POLSJ/29-259----------------------MVGQE..ARGLELMQGMQRRLL-------------------EIEQAAAT--L....KR
Q5E5H9_VIBF1/28-260----------------------ITQHQ..SQAEAIKDQVNKKVA-------------------LLNSSIPS--K...AKQ
Q73TK8_MYCPA/66-308----------------------AVFAA..EKMKSLVAGVDQKFT-------------------DIGKKNPQ--W....TG
A8AWA6_STRGC/24-267----------------------IFNVQ..DKANQYANQLQKRID-------------------TVKKANKA--S...QGE
Q5WC89_BACSK/255-486----------------------ALHEQ..NEAQRFLSHYEETAV-------------------ACKQSIEK--E...NTA
Q4JSY9_CORJK/57-307----------------------IFDKK..DEADKMVQDFNDAKD-------------------RAKKAYDK--LD..GDK
Q6L1D8_PICTO/51-271----------------------LTGNE..RNASIIVKWMNSAID-------------------SFSNISDL--E......
Q8TM94_METAC/62-323----------------------IVGNE..DEAQEYIEFYSGIYD-------------------PIVAKTSQ--I...AQE
Q9HKZ6_THEAC/7-228----------------------EVDSL..DASRDLYHKLLRSIP-------------------EATNDVMT--G......
Q2G941_NOVAD/48-274----------------------LAGHP..ARGEALVARIDAALA-------------------AAAPPAGA--S.....P
Q7MWG9_PORGI/105-345----------------------LLSCN..RRAHEVFEQIESEYA-------------------EARKLVAE--K....TD
Q8FRS2_COREF/66-320----------------------ALGLE..NEGEQLVAKLDGEVA-------------------AAMDAHPQ--L.....R
A4FH22_SACEN/55-310----------------------DVDSPRVRADEEAFNAAAQRLR-------------------GLGERLRS--Q....NR
B1HSF6_LYSSC/69-304----------------------IIGKE..DEAEKVIEKMMQAIT-------------------TGREDLKS--I....EG
D9QEM0_CORP2/95-325----------------------VVGLN..DEAVKLAERSVNEIH-------------------SAQEAIKE--IAPKDPM
M9X349_PASHA/55-314----------------------LTGTE..ERAEKIAKEYEEGIA-------------------DIQSCIDN--AK.VSKP
Q0P8Q4_CAMJE/73-305----------------------LYGLE..KEALEKISDIKNEIE-------------------KAKSIVDE--D.....K
Q2FWN6_STAA8/51-277----------------------LTNNE..DKAKKWIEEWDDKTR-------------------KDKKEIQS--K...IGQ
Q74XT9_YERPE/44-278----------------------RLGLE..TAAQQHLADFDHFML-------------------AARARLSG--D....TQ
Q92XA6_RHIME/55-318----------------------IYNVQ..DKGEKVVAELKSREE-------------------AARAKVAS--AG..DKL
R7FQC8_9FIRM/141-385----------------------MLNKE..DVADTFFGKQTKVIE-------------------NLKDFKNT--G......

PF00148

B4SC77_PELPB/21-398EKIRS.QT....ELLK...G.KKIFLTADT.MMELPLARFLH.S.AGADVVECSSAYINKKFH.................
B0UCN0_METS4/77-469PAIRGALA....ANPI...R.GRITLSGYE.GSELIVARLLV.E.SGAELPYVGTACPRTRFAEDD..............
B2JYA8_BURP8/19-425DAMLD.GH....FYTG...G.IKVAVGAEP.DLLLAIGSLLQ.E.MGAELSVCVSTTTSASHA.................
A8ML60_ALKOO/11-412KHLMN.YR....FMTRGLNK.KNVLLVGDY.DVVVGLAALVE.E.LGLTVEAIILKHKMNR...................
Q3A2R7_PELCD/48-471DAMTD.AH....QYLH...N.KKFAIWGDP.DFLAGMISFLL.E.MGAKPYHVICSRGNKKVA..K..............
A1WTQ5_HALHL/61-466AVIAK.YR....PRLE...G.KKVMLYVGG.LRSRHVIGAYE.D.LGMEVIGTGYEFAHDDDY..D..............
A0LH04_SYNFM/16-440DSYVD.AH....KYLF...G.KRAVVYGEE.DLAVGLTAFLA.E.VGITPVLCATGGRSGRFR..S..............
CHLB_PROMT/11-419SNSVD..S....NYLT...G.KRVFIFGDG.THALAAARIANEE.LGFKVVGLGTYSREMARKVRP..............
Q72WS7_DESVH/65-519TALAA.YM....PGLE...G.KTAMLFVGG.SRAHHYMHLMR.D.LGMEPLVAGFEFAHRDDY..EGRRVIPTIRVDADS
A5GAJ7_GEOUR/498-905DAMVD.CH....YQFG...L.KRISLALEA.DLLKTMTLFLA.G.MGCRIQAAISATRVRGLD.................
Q0RAV6_FRAAA/76-504DAITD.SH....AYVH...G.KRVAIAGDP.DLVVALTRFVL.E.LGMIPVHIVSTNADTSFK..A..............
A6UWY1_META3/60-461KELEY.YK....KELK...G.KKVFICHGA.QRALNYMGPTM.EELEMEVVGVATYFANKENY..E..............
Q2RS09_RHORT/44-448AAMAA.YR....PRLA...G.KRVLLYTGG.VKSWSVVHALQ.E.MGMEVVGTSVRKSTEDDK..A..............
Q3Z7D0_DEHM1/60-516EARQL.YQ....ERCR...G.KKVMLFVGG.SRAHHYQELFK.E.LGMEVVAAGYEFAHRDDY..EGRRVLPSITVDADS
Q20XD3_RHOPB/20-446DAISDVAH....MFLA...D.KKVAIYGNA.DLVIGLAEFCL.D.LEMKPQLLLLGDDNAGYVNDP..............
A1WTP6_HALHL/19-436DALLD.TH....SVLG...T.TPVGVAAEA.DLLAGLTTLLH.D.AGAEVTTAVAPERSPVLD.................
Q8TP84_METAC/341-740RAGVVKYA....PQLS...G.KRVLVVSYTEDIGWVLDTIRD...LGMEIVKVGISVSFFGRGSPG..............
Q2J4G2_FRASC/19-525DGLLD.TH....FVLG...G.ARVALAMEP.ETLVAVGSLLH.D.VGAEVVAAVSPTA.APVL..A..............
Q8TJ87_METAC/15-494DSMVD.VH....KYLY...G.VKAAVYGDP.DTVFSLTTFML.E.LGINPVLVATGSKSRDFE..K..............
Q8TRG0_METAC/31-443DVLRRRGL....MMIQRYRN.CRVAVSADA.TLGIGLTRMLFEE.LEMIPELLLFRSSMPDSQSLL..............
BCHB_CHLAA/11-419ARTAD..M....DSFS...G.KPAFVFGDA.THVVGVTRFLRDE.LGMPIAGAGTYVKHQADWVRE..............
A3DFR2_CLOTH/52-456PKIEA.LR....EKLA...G.KTAYVTAGA.AHGHALLDVLG.E.LGIKAVGAAIFHHDPIYDSGR..............
A5USK3_ROSS1/51-447PYIDA.YR....QRLQ...G.KRVFIYQGG.PRVWHWIELLR.E.LGMETETAATTFGHTDDY..E..............
A6LR27_CLOB8/53-455PKLEE.YR....EKLK...G.KIAYVTAGA.AHGHAIIAMLR.E.LGLIVQGAAIFHHDPLYDNKD..............
Q7M8U9_WOLSU/69-488DAMQD.SY....PYMH...G.KSFAIWGDP.DFLIGAVSFLI.E.MGAEPKHVLCHNAPDGWE..E..............
A4XMA4_CALS8/25-448DAMAD.TC....QYTM...M.KKAAVFGDP.DIVIGVTRFLC.E.LGMDVKVVETATPSPTFT..D..............
A6UWY5_META3/46-455EELEF.YK....SKLN...G.KKCMVYVGG.PRTWHWIMAMK.E.LGIDYVVACCTFSHEDDY..E..............
Q72WT1_DESVH/16-490DALVD.GH....KYVA...G.KRAVVYGDA.DMVTGLCAMLA.E.TGIRPVLVATGARGCGLA..A..............
A4XMA3_CALS8/36-422NKIQF.FK....SQLQ...G.KKAIVLLGA.SRIGFMTNAFK.E.AGLEILVCGSQFGCSNDY..E..............
O27608_METTH/13-425DAMID.AH....QYTY...G.RNVAIFTDP.GYAVAITSMVL.E.MGMTPSAVFTGSESIYFN..E..............
A5N026_CLOK5/32-415TLQNQ.AK....ERLD...GLRYVFCLRI..DIPIPMAIYLA.R.LGMEPLLLHLEEYYPEDRSYA..............
Q3Z7D3_DEHM1/21-437DAYVD.AH....KYVF...G.RKALVYGDA.DFVMGIGRFLA.E.IGMVPVLCTADKGGNLAG.................
O27526_METTH/12-396EERDR.IR....AELE...G.LRVAVVSGP.TRAVALTEFIT.E.LRMKPVLVSMDMIGDYTLENL..............
A4XMA5_CALS8/46-442PRLQF.YR....EKLR...G.KRAMIYVGA.PRVWHWIPLMR.D.LGIEVVACATTFGHEDDY..E..............
Q6NA14_RHOPA/19-430DAMVD.TQ....FQIG...G.ARVAIAADA.GLCAALVSFFT.E.MGAEVIAAVAAAKAPQLA.................
Q97ME2_CLOAB/52-505GEMAY.FK....ERLE...G.KTACLFVGG.SRAHHYQMLLK.D.YGVKTVLAGYEFGHRDDY..EGREVIPTIKADADS
A5USK2_ROSS1/20-440DALVD.TH....MYTT...G.LRVALYGDP.DLLEGLVGLIA.E.MGMTPAYILTAADNRPWG..E..............
Q24QP1_DESHY/324-722AREVEALK....ADLA...G.KRLMIITYNHELDWILKTALD...VGIDIVKIGVFNFSQDEGFRT..............
Q2RWB8_RHORT/53-460PDLAD.LR....AQLA...G.RTAFVAAGS.AQGHSFMTVLR.D.LGIDVIGGCALHHDPVLDHGH..............
NIFE_METTH/64-456RKVAR.YR....NTLE...G.KKVAIYVGG.NKAWSLIRAFE.D.LGMEVIMSGTQNGLPNDY..L..............
Q2RL08_MOOTA/46-462KSLAF.YR....EKLQ...G.KRVAIYVGG.PRVWHWIKLME.E.LGMQVVAVACTFAHEDDY..E..............
Q6N6J8_RHOPA/13-414AYFIDRLL....ETLYRQGGARGFAVALPS.LHVGGIVRFLNRT.LGWSPAAIVVTDNPPAEHRST..............
A5N1T7_CLOK5/17-439DAMID.NH....KYTG...E.ARVVLYGEP.ELLLSTARLCV.E.NGILVKVAGTGSRNSILK..K..............
A6LUZ4_CLOB8/44-438PILEK.YK....ENLR...G.KKAAIYVGGGFKAISLIKQFN.E.LGIDTVMVGTQTGKKDDY..E..............
BCHB_CHLTE/11-426ARTAD..M....ESFS...N.KRAFVFGDA.TQVVGVTKFLKDE.LGMKIIGAGTYLPKQADWVRE..............
NIFK_CYAA5/69-490DAMTD.TQ....AWVH...G.KRAAVYGDP.DLVMGLLQFML.E.MGIEPVHVLVNNSTKEFE..E..............
A7I7F2_METB6/56-518PALEQ.FR....KICR...G.KKAFAFVGG.SRSHHYQHLLK.D.LGMEVVVAGYEFAHRDDY..EGRQVIPTIKSDADS
Q2FLM7_METHJ/320-717RKEIALIM....LMTA...G.KRVIIASSGPDISWVLEAVRE...CGMEIIRAGYFSSPYTTKNNQ..............
A0L6W2_MAGSM/19-431DAMLD.TH....FFLN...Q.RKLALAGDP.DFLSNWLPLFQ.E.NGLQPVAVVSPVGTDYLQ..K..............
A6TTX7_ALKMQ/17-436DGMID.SH....KYNA...E.GRAAIFGEP.DTVYAASKLCL.E.NGIRPLVIATGTRAGKLK..E..............
NIFN_RHILO/19-429DALLD.GH....FHFG...G.KKIAIAAEP.DQLYQLATFFT.G.MGCDIAAAVTTTDMSKIL..Q..............
A7I7F4_METB6/48-446PAIEK.YR....ARLR...G.KRAAIYVGGAYKAIAIIRQLR.G.LGMEIALTGTQTGKADEY..E..............
Q8KC88_CHLTE/24-443DVMVD.ME....QYFY...G.KKVALFGDP.DQLIPLTEFLL.D.LGMIPAHIVSGTPGLRFE..K..............
Q6D2Z0_PECAS/69-501DMMLD.SH....TWLH...G.KRFGLYGDP.DFVMGLTQFLL.E.LGCEPTVILCHNGNKRWQ..K..............
A6UWY4_META3/30-461DAIADTVH.....YTM...D.KKVGIFGDP.DHVIAVARFCC.E.IGMKPVVVSTQTPSRIYK..K..............
A5N1T9_CLOK5/23-438DLMLD.TH....QYFH...G.KKVAIIGDP.DTVIPFTQFAI.S.LGMNPRYVVTGTPGDKFE..K..............
A7I7F3_METB6/23-439DTLID.TH....FHYQ...G.KTVAIFGDP.DHVIAMTEFVI.T.MGMVPKYVLTGTPGKEFE..A..............
A4YYY7_BRASO/19-429DAMLD.AH....FHIG...G.RKLAIGAEP.DLLFDVASMLH.D.MGAEIAVAVTTTQSPVLE.................
A5HZN4_CLOBH/32-412ALQKQ.AK....DVFK...G.KSYILTHIGAMMPLPLVLYLT.K.FEMEPVILHMDEFYPDDR..K..............
A5UYB5_ROSS1/24-407AVLAA.......KSLK...G.ARVLVTGYE.GTELAYARLLV.E.AGAEVPYVSTSIGADPLALPD..............
A6LUZ3_CLOB8/23-437DIMID.SH....PYYD...G.KKVALYGDP.DVLIALSKFLL.E.LGMIPKYVITGTPSNVFE..K..............
A6LUZ5_CLOB8/18-440DAMID.SH....KYNA...E.ARIAILGEP.DFVYSTARLAV.E.NGAVPVLIASGDVCKKLE..P..............
A9WCM1_CHLAA/32-409RGFLA..S....KPLQ...G.ATILVSGYE.GNEMLYARLLI.E.GGAHVPYVSTSIGPSALTAAD..............
A9WCM2_CHLAA/14-404QPVWDLWRGPQSDWFA...T.VDCAIVAAR.SYADGLRSFLGDE.LGMKIAWVSGRPRRED.E.................
C1DH03_AZOVD/37-442AALEP.WR....ARLE...G.KRVLLYTGG.VKSWSVVSALQ.D.LGMKVVATGTKKSTEEDK..A..............
C1DH04_AZOVD/19-431DAMLD.TH....FMLS...S.ARTAIAADP.DLLLGFDALLR.S.MGAHTVAAVVPARAAALV..D..............
C1DI25_AZOVD/57-448PKLDW.YK....ERLQ...G.KKMAIWTGG.PRLWHWTKSVEDD.LGVQVVAMSSKFGHEEDF..E..............
C1DI39_AZOVD/19-429DAMVD.SY....VPVG...G.TRIAIGADA.DQLVAIGRFLD.D.VGARLVAAVSPCRSAALE..A..............
C5AV88_METEA/12-413SRSVD..S....TYLT...G.KRVFVFGDA.THALALARVAAHE.LGFKLVGLGTYTREFARE..V..............
D5ARY2_RHOCB/46-446AALKP.FR....PRVA...G.RRVLLYTGG.HKSWSVVSALQ.E.LGMEVVGTSMRKATANDR..D..............
G8AJS3_AZOBR/22-428DGMLD.GH....FFYS...R.KRIAVALEP.DLLYAVTSFLA.D.MGAEVIAAVSPTQTAVLE.................
NIFD_METMP/49-457PELDF.YK....SKLQ...G.KKIWISAGG.PKSWHLSKPIEQY.LGMDVVALSGLFEHEDGY..E..............
NIFE_METMP/74-470DEISE.YK....KDLS...G.RTVAIYSGA.HKSWALVSAFG.E.LDMEIIMSGTQNGKPEDY..Q..............
BCHY_RHOS4/55-446PAIRGALA....GAPI...K.GRITLSGYE.GSELIVARLLI.E.SGAEVPYVGTAAGRTPWSAAD..............
Q3J0H5_RHOS4/19-424DAMLD.AH....FHIG...G.LKVAMGLDP.DLGLALGSTLA.A.MGAELTVVASTASPAV.E.................
Q6LYX6_METMP/15-428DAMID.AH....QHNF...G.RKVAIYGDP.DVVVGFTRFVL.E.LGMIPSIVCTGSESKTFV..E..............
Q72WS8_DESVH/23-443DMMTD.YQ....SLLF...G.KRVAAWGDP.DIVIPLVEFLV.S.AGMRPTVVVTGTPGKAFE..R..............
Q8TJ89_METAC/23-439DMMTD.AH....PHYH...G.KKVAIYGDP.DILSGLTSLVL.E.MGMEPSVVLTGTQNSEFE..K..............
Q8TRG2_METAC/20-444DSIVDLAH....MFFA...N.KKVAIFGNP.DLVFGLAQFCL.E.CELEPVLLLLGDDNSSYKKDP..............
V6EWQ5_9PROT/19-430DAMLD.GH....FYFG...G.RKFAIAGEP.DFLWSWAKLIA.D.MGGELAAAITSVHAAHLT.................

PF01497

Q4KAK8_PSEF5/33-281GPVSVVGY----NIA....G-SYSIGRLNS-----PQARLLGA.-LGFKVAELPEALAGKVTRASD--------------
A9KLK9_CLOPH/127-364PPKVLFLL----ASL....Q-GIKVKGTNH-----FVGDMLNE.-MKAINI.ASES.......SIL--------------
A8LBT9_FRASN/61-297GEVNRGSW----QDA....G-MFTLNGSQC-----SEIARADIP-LDIPDL............GEG--------------
Q9HMG8_HALSA/70-339RGALVWGG----SNEPTSFS-PYLLSGAGT-----NKKPFHD..-LNVRDA.IADSGID.ALSQSQ--------------
Q03SI0_LACBA/39-270PRVLVLMG----LPG....A-SYMIATNRS-----YVGDLVRL.-AGGQNV.FTSQ.......HQE--------------
Q8TKF6_METAC/99-361SEIPTVYF----APR....G-AKKGFYDSV-----EGRDFTRTE-AVYEPLTIAGGNNLAKDCTGE--------------
Q129U2_POLSJ/29-259RPRVYFEE----WYD.....-..PQISGIA-----WVSEVIGI.-AGGDDC.FPELAAK..AMGKD--------------
Q5E5H9_VIBF1/28-260KKVIYLLL----HEG....R-APYVAGSDT-----TMDELIHL.-AGANNP.ASSS.......ISS--------------
Q73TK8_MYCPA/66-308KKALLMHG----ALW....Q-GTVVATMAG-----WRTDFLNQ.-MGLVIA.DSIKPF....GTDQ--------------
A8AWA6_STRGC/24-267KKKALIMC----AYN....D-ETFGAYKSA-----LQESLLNQ.-LGYTNV............ATG--------------
Q5WC89_BACSK/255-486SPVILRIA----GEG.....-..IYLYTNP-----GISSLFHD.-VGFEGW............QQS--------------
Q4JSY9_CORJK/57-307KVMAVNVS----GGE....I-GYVAPHIGR-----VWGPVFDW.-LGMDPA.LEVDNA...SSNHE--------------
Q6L1D8_PICTO/51-271.KTCIFYY----LDS....D-PVYTAGNNT-----FMNQIFNI.-IDLKNV.AAF........HNG--------------
Q8TM94_METAC/62-323DSLNVFYK----AFSDTPEQ-IKTYGKEMP-----GGNELFNA.-AGGKNI.AETL.......SFA--------------
Q9HKZ6_THEAC/7-228.....YIE----LDL....G-GPVSFGSYS-----YITDALSL.-MRIQSI.YQRE.......RRE--------------
Q2G941_NOVAD/48-274VPTVVWQ.----.......S-GGMVPGDGT-----LIADLLRR.-TGFANF.AAARG......LGQ--------------
Q7MWG9_PORGI/105-345TIAIMYGQ----DYN....G-TWYLPGEYS-----YSTAMFRD.-ARVSFD.YAAG.......KVS--------------
Q8FRS2_COREF/66-320ETTPVFAF----FDESDLSQ-IGVYTALDP-----RMGFLLDAG-MRQASI.LEEYAG....SDSF--------------
A4FH22_SACEN/55-310SILAVGGT----PQE....Y-FVVVPARNP-----DLGYYVRE.-LGLPIT.TPAHPDT..AGGGY--------------
B1HSF6_LYSSC/69-304ESVALIVS----WDG....K-TFNVLGEDN-----PVYTLAFDK-EKGLGL.TPDITF....NGKS--------------
D9QEM0_CORP2/95-325KMAFLYAR----GNG....G-VFFIMGDGT-----GAKDLIEG.-LSAVDL.AAEHK......LSY--------------
M9X349_PASHA/55-314KIYAEFGN----KGP....K-EHSFTFGKN-----MWGAIAET.-VRGDNI.SAPF.......VEN--------------
Q0P8Q4_CAMJE/73-305KALIILTN----SNK.....-.ISAFGPQS-----RFGIIHDV.-LGINAV.DENIK.....VGTH--------------
Q2FWN6_STAA8/51-277ATASVFEP----DEK....Q-IYIYNSTWG-----RGLDIVHD.-AFGMPM.TKQYKDKLQEDKKG--------------
Q74XT9_YERPE/44-278TPLLMFSL----LDP....R-HALIIGNGS-----LFQDVLST.-LNIENAWQGETN......FWG--------------
Q92XA6_RHIME/55-318SAVFWFSS----AAD....A-DPYVAGRNG-----APGYIMAA.-LGIENI.IDT........EDE--------------
R7FQC8_9FIRM/141-385KTVAYFFV----NAD....G-TVVVRSSKD-----YIPKMIDI.-AGGKYI.FSDLKNT..ESKSA--------------

PF00148

B4SC77_PELPB/21-398..........................................ARELEALDG.........VRVVEQ.PNF.HRQLEDV.R
B0UCN0_METS4/77-469..........................................RAWLEARGT..........RVQFR.ASL.EQDLAAL.E
B2JYA8_BURP8/19-425..........................................LLPA..............SRVVLG..DL.EDME..R.A
A8ML60_ALKOO/11-412..........................................KAKKHLPEK.......WERVMKLD.YSE.REMEAYL.S
Q3A2R7_PELCD/48-471..........................................YLQALLDESVY....GEGCKLWMN.KDL.WHLRSLV.M
A1WTQ5_HALHL/61-466..........................................RTYPELKEG........T.LVYDD.ANA.FELERFI.E
A0LH04_SYNFM/16-440..........................................AVEQVTADIL.....PEAPAVGEG.MDF.RQIEEQA.E
CHLB_PROMT/11-419..........................................AAKALGLEA............LIT.NDY.LEVEDAI.K
Q72WS7_DESVH/65-519KNIEELKVTAD.....PERYRPRLDPAYREQLEREGLLSSYEGMWDDMGEG........T.LVIDD.VSH.VEIEKLI.H
A5GAJ7_GEOUR/498-905..........................................RLPT..............DNIFVG..DL.EDLE..N.S
Q0RAV6_FRAAA/76-504..........................................RMEKVLSASKF....GDEATVWPE.KDL.WHLRSLV.F
A6UWY1_META3/60-461..........................................KIVKQLPKG........A.VIIDN.PNT.YELENAI.I
Q2RS09_RHORT/44-448..........................................RARAALDQNTG....KVG.ELFGA.IAN.PEMYRMF.R
Q3Z7D0_DEHM1/60-516RNIEELTVEKDP....ERYKERVSPEKCAELAANGVEFKDYAGMMPEMEAG........S.LTIDE.PSH.HETFRLL.E
Q20XD3_RHOPB/20-446..........................................RIKALQENVD......YPMEIITN.ADF.WELENRI.K
A1WTP6_HALHL/19-436..........................................GLPA..............GRVAVG..DL.EALEHHG.R
Q8TP84_METAC/341-740..........................................LLSCE............AFPVERD.YTD.EKRARDV.R
Q2J4G2_FRASC/19-525..........................................DAPW..............DEVVVG..DL.TDLAERA.R
Q8TJ87_METAC/15-494..........................................RIKQIFEEIRP....ELEPVVLNG.IDF.DTLNDAV.G
Q8TRG0_METAC/31-443..........................................ENELKAMGI........SPRVVFS.ADG.YQVKQSL.M
BCHB_CHLAA/11-419..........................................QLTGYVDE............VLVT.DEF.QVVADRI.A
A3DFR2_CLOTH/52-456..........................................EENDQLAQRVADYGNVFNYNVCNK.QEF..ELVNAL.N
A5USK3_ROSS1/51-447..........................................KIFNQIGEG........A.LVIDN.PNV.PEIEEIL.T
A6LR27_CLOB8/53-455..........................................KTSDALAQTVNIYGDIKHYNVCNK.QAY..ELVNIL.N
Q7M8U9_WOLSU/69-488..........................................EMKALLATSP.....AKDLHVWAG.KDL.WHMRSLL.F
A4XMA4_CALS8/25-448..........................................EIKAIFDEYN......IEGEILVD.SDL.YEFEYLA.K
A6UWY5_META3/46-455..........................................KMNINLEKAGL....TNV.LVMDS.PNE.PELEEAA.E
Q72WT1_DESVH/16-490..........................................RVAAVCGGLM.....PDLPEVREG.VDF.HEIAERA.G
A4XMA3_CALS8/36-422..........................................MARCILPDS..........MLVDD.FNC.AEVEEII.L
O27608_METTH/13-425..........................................KISQLQKEYG......FKCMAMSG.ADI.FDLQSYI.S
A5N026_CLOK5/32-415..........................................KELVSMGYN..........PWICRMVNAEADLLV.L.E
Q3Z7D3_DEHM1/21-437..........................................QAEDLLAGV.......EKAVVLEG.ADF.ADIETLA.T
O27526_METTH/12-396..........................................RGVPGLRSE...........ILVG.VDV.SDIEEAI.I
A4XMA5_CALS8/46-442..........................................KINARADDG........V.LVIDN.PNE.LELEEVI.Q
Q6NA14_RHOPA/19-430..........................................NLPL..............DSVVIG..DL.EDLEWLA.S
Q97ME2_CLOAB/52-505KNIPELHVEKD.....PKKYRIIIPEDRYEVLKQEIPLEYYGGMFKDMEEG........A.VAVDD.LNH.HETEQFI.K
A5USK2_ROSS1/20-440..........................................RMVELTGELG......VESEIILK.GDL.HELHKRI.K
Q24QP1_DESHY/324-722..........................................RLD.A............AFNVVEN.YDR.GERDQDI.A
Q2RWB8_RHORT/53-460..........................................QEEDTLAHATRD.KAEVPYGVCNK.QSF..ELINLV.G
NIFE_METTH/64-456..........................................RIMEKSGRE........L.ILFDD.ANP.VELSRLL.N
Q2RL08_MOOTA/46-462..........................................KINARAPEG........M.LVIDA.PNE.FELEEML.T
Q6N6J8_RHOPA/13-414...................................................L.....EDDLPVVHYSEDD.DEIAALI.G
A5N1T7_CLOK5/17-439..........................................MLKEELKAQK......EDSIVLDD.TDF.ETMESYA.K
A6LUZ4_CLOB8/44-438..........................................VINSLVKDG........T.VVLDD.ANP.SELEKFM.I
BCHB_CHLTE/11-426..........................................QLEGYLPGE...........LMVT.DKF.QEVSAFI.E
NIFK_CYAA5/69-490..........................................EAKALLAASPY....GQQATVWGG.KDL.WHMRSLL.F
A7I7F2_METB6/56-518KNIPELHLKADEKLYREGNEYLNLSKEQFEALKKEVPLNYYEGMYPDMKNG........D.IMIDD.CNH.YELEELI.K
Q2FLM7_METHJ/320-717...................................................K.....ESEPSIVMD.YTP.DALYDDI.K
A0L6W2_MAGSM/19-431..........................................SLY...............ETIKIG..DL.EDLQDLA.R
A6TTX7_ALKMQ/17-436..........................................LLEEDLKKVD......ENCMVIDD.TDL.QTIQKYV.R
NIFN_RHILO/19-429..........................................KVPA..............EWVQIG..DL.GDLE..A.L
A7I7F4_METB6/48-446..........................................SMSRILSEG........T.IIIDD.ANP.AELEKFL.L
Q8KC88_CHLTE/24-443..........................................RMKEILERAP.....GANFRNGPQ.ADM.FLMHQWI.K
Q6D2Z0_PECAS/69-501..........................................AMKKILEASPY....GQESDVYIN.SDL.WHFRSLM.F
A6UWY4_META3/30-461..........................................EMEKIAKEF........NVDIEVQFSDL.WDFEKKV.K
A5N1T9_CLOK5/23-438..........................................TINGMMEKAG.....VQGAKVKSS.GDF.FEMHQWI.K
A7I7F3_METB6/23-439..........................................TVTKMLDEAG.....ITGSRVKAE.GDL.FELHEWI.R
A4YYY7_BRASO/19-429..........................................RMPC..............EEVLIG..DL.EDLETRA.K
A5HZN4_CLOBH/32-412..........................................WAKAINEKG.......YDPMICHM.VNN.DADIELL.E
A5UYB5_ROSS1/24-407..........................................ELWLKARGT.........QEVVYR.KAL.EEDMAAL.D
A6LUZ3_CLOB8/23-437..........................................QMQALFDEFG.....VEGCIAKQD.ADL.FELHQLI.K
A6LUZ5_CLOB8/18-440..........................................SLREEVDELSNQ.LFAGECKIIDE.ADF.KEIEKFA.L
A9WCM1_CHLAA/32-409..........................................EAWLKAHGT.........QAVIYR.KTL.EDDKAAM.E
A9WCM2_CHLAA/14-404...................................................................PDN.IEIRKRL.H
C1DH03_AZOVD/37-442..........................................RIRELMGDD.........VKMLDE.GNA.RVLLKTV.D
C1DH04_AZOVD/19-431...........................................SPL..............PSVRVG..DL.EDLEHAA.R
C1DI25_AZOVD/57-448..........................................KVIARGKEG........T.YYIDD.GNE.LEFFEII.D
C1DI39_AZOVD/19-429...........................................LNI..............KEVMIG..DF.EDLEERA.R
C5AV88_METEA/12-413..........................................RAEAALHGI........E.ATITD..DY.LDVEAAI.Q
D5ARY2_RHOCB/46-446..........................................RVIEIMGDD........K.HMYEN.MAP.REMYQML.R
G8AJS3_AZOBR/22-428..........................................KLKA..............ATVMVG..DH.SDVETLA.R
NIFD_METMP/49-457..........................................KMQERAKDG........T.IIIDD.PNT.LEMEEVV.E
NIFE_METMP/74-470..........................................QIRDHVCEG........T.LIVDD.ASS.MELVQLL.K
BCHY_RHOS4/55-446..........................................REWLEARG..........TVVKFR.ASL.EDDLAAM.Q
Q3J0H5_RHOS4/19-424..........................................RLPV..............EEVLIG..DL.GDLERLA.E
Q6LYX6_METMP/15-428..........................................DIKAVTKDSK......HKPVILAP.GDL.YDLHQEI.K
Q72WS8_DESVH/23-443..........................................RIAEVMEKAGA....TWDYEVRAA.NDL.FHLHQRV.K
Q8TJ89_METAC/23-439..........................................EIEALIGSEY......PDADIISG.GDL.FMLHQII.K
Q8TRG2_METAC/20-444..........................................RLKE.LEEKT.....NCDMQIIWN.ADL.WELESRI.K
V6EWQ5_9PROT/19-430..........................................QLPC..............QQVIIG..DF.QDMEDQILE

PF01497

Q4KAK8_PSEF5/33-281-------------------------------------------------------------------FQF-ISRENLPA.
A9KLK9_CLOPH/127-364-------------------------------------------------------------------SDK-LNPEIFST.
A8LBT9_FRASN/61-297-------------------------------------------------------------------GEE-RSFEQIGG.
Q9HMG8_HALSA/70-339-------------------------------------------------------------------RSE-IDAETLLN.
Q03SI0_LACBA/39-270-------------------------------------------------------------------YQQ-PNDEAIQK.
Q8TKF6_METAC/99-361-------------------------------------------------------------------NIN-VAPEQIVA.
Q129U2_POLSJ/29-259-------------------------------------------------------------------RII-ADGSEIVR.
Q5E5H9_VIBF1/28-260-------------------------------------------------------------------FKP-ISMEAMIS.
Q73TK8_MYCPA/66-308-------------------------------------------------------------------RAV-IPRDHIKSV
A8AWA6_STRGC/24-267-------------------------------------------------------------------TSD-LTLENLVS.
Q5WC89_BACSK/255-486-------------------------------------------------------------------AAP-LSLLELKE.
Q4JSY9_CORJK/57-307-------------------------------------------------------------------GDD-ISVEAIAD.
Q6L1D8_PICTO/51-271-------------------------------------------------------------------YFP-ISMEYILND
Q8TM94_METAC/62-323-------------------------------------------------------------------YGD-VDREWILE.
Q9HKZ6_THEAC/7-228-------------------------------------------------------------------WLQ-PDFGYVKS.
Q2G941_NOVAD/48-274-------------------------------------------------------------------ADL-LPLERMLA.
Q7MWG9_PORGI/105-345-------------------------------------------------------------------SQP-CSFEYIFSR
Q8FRS2_COREF/66-320-------------------------------------------------------------------YEQ-ISAENPEA.
A4FH22_SACEN/55-310-------------------------------------------------------------------FER-LSWENANA.
B1HSF6_LYSSC/69-304-------------------------------------------------------------------NQF-SAFEGIST.
D9QEM0_CORP2/95-325-------------------------------------------------------------------AEP-ANAEALAK.
M9X349_PASHA/55-314-------------------------------------------------------------------WGQ-INPEQVLV.
Q0P8Q4_CAMJE/73-305-------------------------------------------------------------------GKS-INSEFILE.
Q2FWN6_STAA8/51-277-------------------------------------------------------------------YAS-ISKENISK.
Q74XT9_YERPE/44-278-------------------------------------------------------------------SAV-VGIERLATI
Q92XA6_RHIME/55-318-------------------------------------------------------------------WPT-VGWETIAK.
R7FQC8_9FIRM/141-385-------------------------------------------------------------------SVE-LSMEEFYSK

PF00148

B4SC77_PELPB/21-398RIK..PDLIITSLM---------------.TANPFVGN..............GFVVKWSM-EFM.LMSIHSWSGVI....
B0UCN0_METS4/77-469EFR..PDLAVGTTP---------------.VVQRAKER..............AIPALYFT-NLISARPLMGIAGAG....
B2JYA8_BURP8/19-425ANG..CDLLITHSH---------------.GRQMAARL.......DKPLMRVGFPVFDRI-GNA.HRCQIGYRGTM....
A8ML60_ALKOO/11-412ETP..SYLLLADEA---------------.TLKLENKS........KLHFQIANPNFSKH-SIYPYTPFVGYHGAL....
Q3A2R7_PELCD/48-471TDP..VDGLIGSTH---------------.GKFIARDA.......NIPHIRLGFPILDRV-NLH.RVPYIGYQGTM....
A1WTQ5_HALHL/61-466RAR..PDLVAAGIK---------------.EKYVFQKM..............GLPFRQMH-SWDYSGPYHGYDGFA....
A0LH04_SYNFM/16-440ILS..PDIMIGHSK---------------.GYSIARKL.......GIPLVRVGFPIHDRF-GGQ.RTLHVGYRGTQ....
CHLB_PROMT/11-419ETS..PELVLGTQM---------------.ERHSAKRL.......GIPCAVISTPMHVQD-VPARYSPQMGWEGAN....
Q72WS7_DESVH/65-519RMN..PDIICSGIK---------------.DKYVIEKF..............GVPCKQLH-NYDYSGPYAGYEGAV....
A5GAJ7_GEOUR/498-905AQG..SDLLVANSN---------------.GRQAAARL......GGIPLLRAGLPVFDRL-GAH.QKMYVGYRGTM....
Q0RAV6_FRAAA/76-504TEP..VDVLIGSMQ---------------.LKYISREA.......NVPLVRVGFPIFDRH-HLH.RFPIIGYTGGL....
A6UWY1_META3/60-461DCK..PDIFISDSK---------------.TKELVHKL..............GIPYINGR-AP..STVYIGFDGFV....
Q2RS09_RHORT/44-448DGE..ADIMLSGGR---------------.SQFVALKA..............RTAWMDIN-QER.HHGYAGYDGML....
Q3Z7D0_DEHM1/60-516LYK..PDLYCAGVK---------------.EKYAVQKT..............GIPCLQLH-SYDYGGPFAGFEGAI....
Q20XD3_RHOPB/20-446NEGLELDLILGHSK---------------.GRFISIDY.......NIPMVRVGFPTYDRA-GLY.RHPVVGYGGAT....
A1WTP6_HALHL/19-436EDG..VELILGSGH---------------.AAATAGRL.......GVPILQCGYPIWERV-GLH.ARPRVGYRGSR....
Q8TP84_METAC/341-740ILM..PDLVLSNYA---------------.PSVPEDGV...........HYDTIP.....-....FSPQVGFLSGL....
Q2J4G2_FRASC/19-525AGG..AHLVLGSSH---------------.AREVADRI.......GAAHLPVGFPIFDRL-GAA.LAGTAGYAGSL....
Q8TJ87_METAC/15-494ECS..PEILIGNSN---------------.GRYIAKAR.......NIPLVRVGLPIHDRV-GAQ.RILTVGYRGAL....
Q8TRG0_METAC/31-443DSN..VDAVFGSSW---------------.EYYMAEEL.......GIKFAFDVFNPTNRV-NYL.NKSYFGYEGML....
BCHB_CHLAA/11-419ALR..PELVCGTQM---------------.ERHTSRRY.......DLNCMVISPPTHIEN-HLLAYRPFLGFDGAD....
A3DFR2_CLOTH/52-456RLR..PDVLLARHG---------------GMTLWGAKL..............GIPSLLIG-DEHYS...MGYEGLV....
A5USK3_ROSS1/51-447RRR..PDLFISGNK---------------.ERYLAYKM..............GVPFVNGH-TYD.TGPYAGFVGMV....
A6LR27_CLOB8/53-455RVK..PDLMIARHG---------------GMTMWGAKL..............GIPTLLIG-DEQFG...FGYQGVL....
Q7M8U9_WOLSU/69-488TEP..VDFMIGNTY---------------.GKELERDT.......GIPLIRVGFPIFDRH-HLH.RYSISGYKGTL....
A4XMA4_CALS8/25-448EAG..VDVVLGNSK---------------.GVEVTKSI.......KCPLVRIGFPVYDRV-GYF.RYGITGYKGSI....
A6UWY5_META3/46-455IYK..PDFMLVGLK---------------.ERYLFRKF..............GIPTVNSH-SYE.EGPYAGYRGFV....
Q72WT1_DESVH/16-490TLA..PDLLVGNSK---------------.GYRYARAW.......GIPLVRTGFPVHDRF-GGQ.RLLHVGYTGAL....
A4XMA3_CALS8/36-422RFS..PDLFIGGTR---------------.EWYLSHKF..............GVPFLVLP-QE..TKPYACFEGFL....
O27608_METTH/13-425EKP..IDVLIGNSY---------------CGRAAEEN........GIPLMRVGFPVYDRL-GSQ.RIRIAGYSGGI....
A5N026_CLOK5/32-415KLA..PDLCFGYLS---------------DINK...................NIPCVLDM-FD..FYGQVGYGRTS....
Q3Z7D3_DEHM1/21-437ELK..PDIFIGSSK---------------.GYKLARLL.......GVPLVRLGFPVHDRL-GGA.RLRCVGYAGTQ....
O27526_METTH/12-396RTE..PELILGGLA---------------.ETRISEVS..............GAPLIDVM-HG..SSLTAGFRGAV....
A4XMA5_CALS8/46-442KYK..PDIFLTGLK---------------.EKYLAHKL..............GVPSLNSH-SYE.NGPYVAFEGLV....
Q6NA14_RHOPA/19-430DRG..ADLIVTNSH---------------.GADIAKRT.......GAALLRAGFPIYDSY-GAY.AESFIGYGGGR....
Q97ME2_CLOAB/52-505LLK..PDMFFSGVK---------------.DKYVIQKM..............GILSKQLH-SYDYTGPYAGFKGAV....
A5USK2_ROSS1/20-440QQP..VDLLIGHSK---------------.GRFIAEAE.......NIPLVRVGFPVEDRF-GHH.RRSIVGYNGAI....
Q24QP1_DESHY/324-722AYK..PDILLTNYA---------------.SSLADEPF...........VADTIP.....-....MCPDVGFHSGL....
Q2RWB8_RHORT/53-460KLK..PDILLIRHP---------------GLVVWGAKL..............GIPTLYVE-DEHAG...IGYRGLIRYGR
NIFE_METTH/64-456KYR..PDLFVSGAK---------------.EKYLSYKL..............GIPFCEFN-HDR.IKPFSCFRGFL....
Q2RL08_MOOTA/46-462STK..PDLFLTGLK---------------.EKYLGRKM..............GIPTVNSH-SYE.KGPYEGFAGMV....
Q6N6J8_RHOPA/13-414GSG..AEILFGSSL---------------.ERAVADRL.......AVPLIECAAPTRRLS-L...TSGFGGFRGGL....
A5N1T7_CLOK5/17-439RFN..VNLMIGNSD---------------.GRRMAKKL.......GVKLIRTGFPIHDRV-GGQ.RQVITAYNGSS....
A6LUZ4_CLOB8/44-438EQD..VDILVGGVK---------------.ERPLAYKL..............GVAFCDHN-HER.KHPLGGFVGAV....
BCHB_CHLTE/11-426EEM..PELVCGTQM---------------.ERHSCRKL.......DVPCMVISAPTHIEN-HLLGYYPFFGFDGAD....
NIFK_CYAA5/69-490TEP..VDFLVGNSY---------------.AKYLQRDT.......KTPLIRIGYPIFDRH-HLH.RYSTIGYEGAI....
A7I7F2_METB6/56-518KLR..PDLIFTGVR---------------.DKYIAEKM..............GIPAKQMH-SYDYAGPYAGYNGAI....
Q2FLM7_METHJ/320-717TYR..PDLVLTTIW---------------LDYKKADVR............YGMIP.....-....FCPNVGFFGAL....
A0L6W2_MAGSM/19-431EAD..AELFIGNSH---------------.VAALAQRL.......GRPILRAGYPLYDQI-GSQ.SRCWIGYTGSR....
A6TTX7_ALKMQ/17-436ELN..INVLIGSSE---------------.GKFITEKD.......GVPLVRIGFPIHDRV-GAQ.RKTYSGYEGSM....
NIFN_RHILO/19-429AAG..ADLLVTHSH---------------.GRQASRRL.......EIPLMRVGFPIFDRL-GSQ.HKLTILYRGTR....
A7I7F4_METB6/48-446EKH..VDVMIGGVK---------------.ERVLAYKL..............GIGFVDHN-HDR.KDGLAGFEGAV....
Q8KC88_CHLTE/24-443NEP..VDLLIGNTY---------------.GKYIARDE.......DIPFVRFGFPILDRI-GHS.YFPNVGYSGSL....
Q6D2Z0_PECAS/69-501TKQ..PDFMIGNSY---------------.GKFIQRDTLAKGEQFEVPLIRLGFPLFDRH-HLH.RQTTWGYEGAM....
A6UWY4_META3/30-461EIG..VDLIIGHPR---------------GGTAIAKDM.......GIGLLRTGFPVYDRV-GYS.RWPIMGYMGSL....
A5N1T9_CLOK5/23-438NEP..VDLIVGNSH---------------.AKYIARAE.......NTPLIRLGFPVLDRY-GYY.YNPKIGYRGSM....
A7I7F3_METB6/23-439EEK..VDLMIGTTY---------------.GKYIARTE.......DIPLVRFGFPILDRA-VHP.LMPVVGYRGCL....
A4YYY7_BRASO/19-429ERD..CGLMMTHSH---------------.GRQAAARL.......KIPFYRIGFPMFDRL-GAG.HLLTVGYRGTR....
A5HZN4_CLOBH/32-412GIK..ADFSLGKLL---------------.....KDSS..............LIPCVPYL-ED..LYGQIGYERIA....
A5UYB5_ROSS1/24-407RYA..PDFVLGTTP---------------.FAAAAKER..............GIPAMYFT-NQLASRPFFLSGGMA....
A6LUZ3_CLOB8/23-437NES..VDLLMGGTH---------------.GKYIARAE.......DIPLVRIGFPVLDRY-VHS.YMPNVGYRGAM....
A6LUZ5_CLOB8/18-440DLK..VNVMIGSSD---------------.GRRIEEKH.......KIPLIRMSFPIHDRI-GGQ.RILSIGYEGSL....
A9WCM1_CHLAA/32-409RWS..FDLIIGTTT---------------.LAAYAKEK..............GIPAVYYT-NILSVRPLFLAGGMI....
A9WCM2_CHLAA/14-404AKA..PAFVFGSIN---------------EKIYLAEANA.....RGTHFIPATFPGPVVR-RTT.GTPFMGYAGAA....
C1DH03_AZOVD/37-442EYQ..ADILIAGGR---------------.NMYTALKG..............RVPFLDIN-QER.EFGYAGYDGML....
C1DH04_AZOVD/19-431AGQ..AQLVIGNSH---------------.ALASARRL.......GVPLLRAGFPQYDLL-GGF.QRCWSGYRGSS....
C1DI25_AZOVD/57-448LVK..PDVIFTGPR---------------.VGELVKKL..............HIPYVNGH-GYH.NGPYMGFEGFV....
C1DI39_AZOVD/19-429ETS..AQLLIGNSH---------------.ALQSAERL.......GIPLLRAGFPQYDHY-GAA.ARLWVGYRGAR....
C5AV88_METEA/12-413AAA..PELVLGTQM---------------.ERHIAKRL.......GIPCAVISAPIHVQD-FPARHSPQMGFEGAN....
D5ARY2_RHOCB/46-446DAG..ADVLLSGGR---------------.SQFVALKA..............LVPWVDVN-QEK.HEPYAGYMGMV....
G8AJS3_AZOBR/22-428D....ADLIVSNSH---------------.GRQGAARI.......GVPLHRMGLPMFDRL-GAG.LKVHVGYRGTR....
NIFD_METMP/49-457KYQ..PEIVLGGIK---------------.EKYFFHKL..............GVPSVMIH-SYE.NGPYIGFEGFV....
NIFE_METMP/74-470EYK..PDILISGAK---------------.EKYLSLKS..............GIPHCDFN-HDR.ITAFSGYQGFI....
BCHY_RHOS4/55-446GFE..PDLAVGTTP---------------.VVQKAKSL..............GIPSLYFT-NLISARPLMGPAGAG....
Q3J0H5_RHOS4/19-424ASG..AQLLLTHAH---------------.GRMMAERL.......HLPHVRAGFPIFDRL-GTM.DACRTGYRGTR....
Q6LYX6_METMP/15-428KSK..VDLLIGNSY---------------.GSRIAGAE.......NIPLIRMGFPIYDRV-GAQ.RITSLGYTAGI....
Q72WS8_DESVH/23-443AAP..VDLLVGNSY---------------.GKYIAQAE.......DTPLVRFGFPILDRV-GHS.HFPKVGYMGGM....
Q8TJ89_METAC/23-439RKP..VDLLIGNTY---------------.GKFISRAE.......DVPLVRVGFPIMDRA-NLH.YFPIMGYAGAA....
Q8TRG2_METAC/20-444NKTIDVDLILGHSK---------------.GRYIAIDN.......DIPMVRVGFPTFDRA-GLW.KYPVIGYKGAE....
V6EWQ5_9PROT/19-430AGG..ADLVISNTN---------------.ARLSCQSL.......GIPHFRAGFPVYDRL-GGA.HRVHVGYRGTR....

PF01497

Q4KAK8_PSEF5/33-281AIT--GDSVFLLSA.....................TDG-------DVQAFLAD.PVLANL.PAVINRRVYALGPSS----
A9KLK9_CLOPH/127-364.SN--VDQIYISIMED..............NIEETKKL-------VDQEFIKN.PAYQNL.KAIKENKIYYLPKDL----
A8LBT9_FRASN/61-297LSE--YDVLLYPVD.................AEGKVTE-------GFAPVAES.GAWKAL.PAVTSGKALGV..YC----
Q9HMG8_HALSA/70-339.VD--PDVLFVRGHED.............KTAAEFQDT-------VVSFLQNH.DTAGRI.TAVENGDVYRGGPIY----
Q03SI0_LACBA/39-270.AN--PQVILRLAHA...............MPTMVTKQ-------FNQEFKSN.RMWSKM.AAVKHHRVYDLTEPT----
Q8TKF6_METAC/99-361.WA--PEYIFVAWS..................SWDNQT-------GKDFVMET.PELSEI.PAVKNGNVYDC.FYP----
Q129U2_POLSJ/29-259.RN--PDIIFGSWC....................GRKF-------RPEHVVAR.PGWENV.NAVRNRQLFEIKSAE----
Q5E5H9_VIBF1/28-260.MQ--PDVVLVSNR..................SIKKLK-------GIDKIIESIPTLAST.PAGINKQIIGIDGSA----
Q73TK8_MYCPA/66-308LES--ADVVIWTTQ.....................NPD-------DQKALLAD.PEVAGSLTTAQNRHIFTTKDQA----
A8AWA6_STRGC/24-267.MD--PEVIIYVTSD...............RNKSMDEQ-------AVDLMKAN.PVLEDV.PAVKNQKIMTI.SYD----
Q5WC89_BACSK/255-486.LA--PRWLWVLCL.................HDSQTKT-------FYEHVRQS.EEWNGL.PAVRTGQVKHLPSDL----
Q4JSY9_CORJK/57-307.AK--PDWMLVMDRDGA...........INADKPDYSP-------AADVIKRS.DALKGV.PALKEDHVIVAPQDT----
Q6L1D8_PICTO/51-271SSN--IRYIIMSPY..................VNYTNL-------KTKAFEAT........YAFKHNNIIYTNSSL----
Q8TM94_METAC/62-323.QD--IDAVVVMCWDQHYPETFGYAVNDSELATKSGKE-------IQEEIMGQ.DIFAHT.EAVKNKKVYLLHNEL----
Q9HKZ6_THEAC/7-228.MD--PDIIIFEPK...................MFRSV-------SPDDIIRE.RGWTDL.RAYRNGNVYVTPSKY----
Q2G941_NOVAD/48-274.DP--PALILVAGQ..................GAETGR-------GDDRVLSH.PAL....KALKSTRRATLDSRL----
Q7MWG9_PORGI/105-345HRH--AEIWICTMM...................GNIKT-------MDEFLALN.ERYRHF.DATQTGKVYIDRKRV----
Q8FRS2_COREF/66-320FDD--VDLLITYGSG................DAAVNAA-------LLAKLQAD.PLLSRI.PAIAQGRVVFLGENP----
A4FH22_SACEN/55-310.YS--GDILLWDTR....................RASM-------NPEQMKQN.PLFAAQ.PAAAANRFVEWDAVA----
B1HSF6_LYSSC/69-304.IQ--ADHIFLIGD..................ITKKET-------LLSELNEN.NVWNNM.NAVKKGNIHLMDTS.----
D9QEM0_CORP2/95-325.IN--PEAIIMMSG..................GLESTG-------GIDGLLSR.PGVAQT.TAGKNKRVITIPD..----
M9X349_PASHA/55-314.SK--PDVIMISGTELGNDTNPEIMSMGINIEEADAQK-------RLKGFIER.TGWKEL.PAVKSGRVYGLYHT.----
Q0P8Q4_CAMJE/73-305.KN--PDYIFVVDRN................VILGNKE-------RAQGILDN.ALVAKT.KAAQNKKIIYLDPE.----
Q2FWN6_STAA8/51-277.YA--GDYIFLSKP......................SY-------GKFDFEKT.HTWQNI.EAVKKGHVISYKA..----
Q74XT9_YERPE/44-278KTA--RAVCFGHGN......................NE-------MLQQVART.PLWQSL.SFVRENQLRLLPP..----
Q92XA6_RHIME/55-318.AE--PTMIVAGSMERR............RYPLDSLDA-------KLEFLKTD.PVASLM.PAVAKGYVFAMDAQA----
R7FQC8_9FIRM/141-385AEE--ADYLIYNAT.................IDSPINS-------IAELTAKN.ELFKDF.KAVKNGNVWCTGKS.----

PF00148

B4SC77_PELPB/21-398TLANMFVSPLQ
B0UCN0_METS4/77-469SLAQVVNGALA
B2JYA8_BURP8/19-425NLIFEIANLLI
A8ML60_ALKOO/11-412YFMQCLYELQK
Q3A2R7_PELCD/48-471NILTSVANTML
A1WTQ5_HALHL/61-466IFARDMDMTLN
A0LH04_SYNFM/16-440SLLDRIVNGLI
CHLB_PROMT/11-419VIFDDWVHPLM
Q72WS7_DESVH/65-519NFARDVYAMIH
A5GAJ7_GEOUR/498-905NLVFETATIFQ
Q0RAV6_FRAAA/76-504HLLTQLVNTIL
A6UWY1_META3/60-461NFAKDVYGAIN
Q2RS09_RHORT/44-448ELVRQMDIEIN
Q3Z7D0_DEHM1/60-516NFYKDVDRLVS
Q20XD3_RHOPB/20-446WLAEQMANALF
A1WTP6_HALHL/19-436DTLFELANTLL
Q8TP84_METAC/341-740ELAKRWSTLLR
Q2J4G2_FRASC/19-525RLLIDAANRLL
Q8TJ87_METAC/15-494ELLDRITNTIL
Q8TRG0_METAC/31-443NFLENVANDWE
BCHB_CHLAA/11-419VIADEVYTTCT
A3DFR2_CLOTH/52-456NYGERILEVIE
A5USK3_ROSS1/51-447NFARDIDKALH
A6LR27_CLOB8/53-455NYASRIVETLD
Q7M8U9_WOLSU/69-488NLLTWIVNKVL
A4XMA4_CALS8/25-448WLLDLIVNTIL
A6UWY5_META3/46-455NFARDIYKAVC
Q72WT1_DESVH/16-490ALYDRIVNALI
A4XMA3_CALS8/36-422HLLIDIYKEVH
O27608_METTH/13-425EFVDSLTNLII
A5N026_CLOK5/32-415NLLRRILGVLD
Q3Z7D3_DEHM1/21-437ELFDRIVNALL
O27526_METTH/12-396NLGARMCGAVY
A4XMA5_CALS8/46-442NFARDLYKSLY
Q6NA14_RHOPA/19-430RTLFRIADLLA
Q97ME2_CLOAB/52-505VFGKELVAGAF
A5USK2_ROSS1/20-440ALVDEITNTIF
Q24QP1_DESHY/324-722VLARRWARLLK
Q2RWB8_RHORT/53-460KIADWIANPVL
NIFE_METTH/64-456NFAEEVDKAVN
Q2RL08_MOOTA/46-462NFARDIYQGIY
Q6N6J8_RHOPA/13-414TLLEAIVTASE
A5N1T7_CLOK5/17-439FLIDAVSNAML
A6LUZ4_CLOB8/44-438NFAKEINLSIN
BCHB_CHLTE/11-426VMADRVYTSAK
NIFK_CYAA5/69-490NLLNWIANGLM
A7I7F2_METB6/56-518NFANDVAHTLT
Q2FLM7_METHJ/320-717SSMKHWASILS
A0L6W2_MAGSM/19-431QALFDLANRMM
A6TTX7_ALKMQ/17-436RFLDEITNTLL
NIFN_RHILO/19-429DLIFDVANIFQ
A7I7F4_METB6/48-446RFAREVYVTTC
Q8KC88_CHLTE/24-443RLVEKILGVLM
Q6D2Z0_PECAS/69-501SILTSLVNAVL
A6UWY4_META3/30-461RFFDELVNTIL
A5N1T9_CLOK5/23-438RLIEMMCDAIL
A7I7F3_METB6/23-439RLIEQISNAFL
A4YYY7_BRASO/19-429DLVFALANLI.
A5HZN4_CLOBH/32-412VLLSRML....
A5UYB5_ROSS1/24-407ATIGFVAETL.
A6LUZ3_CLOB8/23-437RLLELMLGAL.
A6LUZ5_CLOB8/18-440NLGDQITNVM.
A9WCM1_CHLAA/32-409ASLT.......
A9WCM2_CHLAA/14-404NIMQELVNRF.
C1DH03_AZOVD/37-442ELVRQLCITL.
C1DH04_AZOVD/19-431QVLFDLANLL.
C1DI25_AZOVD/57-448NLARDMYNAVH
C1DI39_AZOVD/19-429QLLFELANLF.
C5AV88_METEA/12-413VLFDTLVHPL.
D5ARY2_RHOCB/46-446DLVRAIDRSV.
G8AJS3_AZOBR/22-428ELLFEIGNLF.
NIFD_METMP/49-457NMARDIYTAI.
NIFE_METMP/74-470NFARVVHTAV.
BCHY_RHOS4/55-446SLAQVINAAI.
Q3J0H5_RHOS4/19-424AFLFEIANAV.
Q6LYX6_METMP/15-428RLVDTITNTI.
Q72WS8_DESVH/23-443HLLSQVINTL.
Q8TJ89_METAC/23-439RLVERIGNTL.
Q8TRG2_METAC/20-444WLAENIANTI.
V6EWQ5_9PROT/19-430DLIFQLANVL.

PF01497

Q4KAK8_PSEF5/33-281-----------
A9KLK9_CLOPH/127-364-----------
A8LBT9_FRASN/61-297-----------
Q9HMG8_HALSA/70-339-----------
Q03SI0_LACBA/39-270-----------
Q8TKF6_METAC/99-361-----------
Q129U2_POLSJ/29-259-----------
Q5E5H9_VIBF1/28-260-----------
Q73TK8_MYCPA/66-308-----------
A8AWA6_STRGC/24-267-----------
Q5WC89_BACSK/255-486-----------
Q4JSY9_CORJK/57-307-----------
Q6L1D8_PICTO/51-271-----------
Q8TM94_METAC/62-323-----------
Q9HKZ6_THEAC/7-228-----------
Q2G941_NOVAD/48-274-----------
Q7MWG9_PORGI/105-345-----------
Q8FRS2_COREF/66-320-----------
A4FH22_SACEN/55-310-----------
B1HSF6_LYSSC/69-304-----------
D9QEM0_CORP2/95-325-----------
M9X349_PASHA/55-314-----------
Q0P8Q4_CAMJE/73-305-----------
Q2FWN6_STAA8/51-277-----------
Q74XT9_YERPE/44-278-----------
Q92XA6_RHIME/55-318-----------
R7FQC8_9FIRM/141-385-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window