Sequence alignment for CL0553

PF00148

B4SC77_PELPB/21-398CGLACVG.WMYQKIK---DSFFLILGTHTC...AHFLQNALGMMIF.............AKP..R.........FGIALM
A9W9E4_METEP/11-414PPHIGAM.RVATAME---GLHYVLHAPQG....DTYADLLFTMIER.............RAKRPP.........VTYTTF
B0UCN0_METS4/77-469CPAFGAL.RVGLRMR---RTATILSGSACCVYGLTFTSHFYGARRT............................VGYVPF
B2JYA8_BURP8/19-425SQPLGAS.YAAMGLD---ACMPVMHGSQGC...TSFGLVLLVRHFR.............EAI..P.........LQTTAM
B8G5R1_CHLAD/13-405SSYWGVS.WVFGCFP---DVHIVCDAPIGC...YNLLGMAVTDYTDA...........LPHM.AN.........LTPTSI
A8ML60_ALKOO/11-412SDRMGTI.WTLSTIK---DAYIIEFGPAGT...THFAIEGMMQFNA.............DHN.AN.........VYTTHI
B9LG95_CHLSY/32-416CPAFGAL.RVLTRIE---GAQPAMVTDTGCLYGLTFVTHFYAARKS............................IVAPAL
C0A2T2_9BACT/72-470CAFCGSR.VILYPIA---DALHLVHGPIGC...AAYTWDIRGAQSS............GSQLFRN.........SFSTDL
Q3A2R7_PELCD/48-471CQPLGAE.LVAHGFE---GTLPFVHGSQGC...ASYYRSALTRHFR.............EPA..A.........AVADSM
A1WTQ5_HALHL/61-466CAYAGSKGVVWGPIK---DMVHVSHGPVGC...GQLSRAGRRNYYT............GHTGVDTFG.....TINFTSDF
VNFD_AZOCH/49-447CLLRRKL.VIGGVLK---DTIQMIHGPLGC...AYDTWHTKRYPTDN...........GHFNMKY.........VWSTDM
A0LH04_SYNFM/16-440CGPLGAC.LAFRGVE---GAVPMLHGSQGC...ATYMRRYIISHFR.............EPM..D.........IASSAL
A4TZX5_9PROT/19-431SAPLGAS.MAFMGMD---GTMPLLHGSQGC...TAFALVMLVRHFR.............EAI..P.........LQTTAM
NIFK_METBA/23-440CQPIGAV.YAALGVH---NCMPHSHGSQGC...LSYLRMCLSRHYR.............EAA..L.........ATTSSF
CHLB_PROMT/11-419PPHIGAM.RIATSMK---KLHYVLHAPQG....DTYADLLFTMIER.............RGSRPP.........VTYTTF
NIFN_KLEPN/19-431GQPLGAI.LASLGIE---HSIPLVHGAQGC...SAFAKVFFIQHFH.............DPV..P.........LQSTAM
Q53U98_HELCL/38-434CAFDGAR.VVLMPVT---DAAHVVHGPIAC...AGNSWDNRGAKSS............GPQLYRR.........GLTTDL
Q0AZV9_SYNWW/62-421CGRHGAITSIQKGYK---NRLFFLH......................................................M
Q72WS7_DESVH/65-519CCYAGCKGVVIGPYG---DMVHIVHGPVGC...SFYAWLTRRNQFRARG.......EAGKNYLSY.........CFTTDM
A6VFE7_METM7/74-471CVYGGAR.VVLMPIT---DAVHLVHGPVGC...AACTWDIRGSKST............GDKLYKN.........GFTTDL
CHLB_CYAPA/11-425PAHIGTL.RIASSFK---NVHAIMHAPLG....DDYFNVMRSMLER.............ERNYTP.........VTTSVV
A5GAJ7_GEOUR/498-905SPALGAT.LAYLGID---QMLGLLHGAQGC...STFIRLQLSRHFK.............ESI..A.........LNSTSM
Q0RAV6_FRAAA/76-504CQPLGAV.LAALGFE---GTMPLVHGSQGC...VAYFRSHFARHFK.............EPV..P.........AASTSM
A7NQD8_ROSCS/24-408CPAFGSL.RILSRIE---GSHPVMATDTGCLYGLTFVTHFYGARKS............................ILAPTL
Q1NMU1_9DELT/18-469CRPLGAV.LAFRGVE---GAVPYLHGSQGC...ATYMRRYIISHFN.............EPI..D.........IASSSL
A6UWY1_META3/60-461CTFHGSKIIINSHIK---NVIHLIHSPASC...AYYSWDYR..................PDTYSF.........CFTTDI
A3CWW9_METMJ/16-374CAMTGAV.ACLSGFE---DVAVVVHGSSGC...YFYPASLVGVP..............................IHGTFL
NIFE_METBA/46-452CVYSGAR.VVLNPVT---DAVHLVHGPIGC...AGYTWDIRGAKSS............GIETNRT.........SFSTDM
Q8KAN1_CHLTE/12-392SAYWAAV.NTFCALK---DVHVIADAPVGC...YNLAGVAVMDYTDA...........IPYLEN..........LTPTSL
NIFE_RHOCA/46-447CAFDGAM.TALQPIV---DVAHLVHAPAAC...WSNGWDNRSSASS............GSELYRK.........GFTTDL
Q1JXL4_DESAC/43-440CAFEGAQ.ISLFPYA---DAAHLVHGPLTC...LSSSWETRATPTSY..........EGRDMTQM.........GFTTAV
Q0YUY4_9CHLB/15-436CNPLGAC.LAFRGIE---NCVPFLHGSQGC...ATYIRRYLISHYK.............EPI..D.........IASSNF
Q2RS09_RHORT/44-448CAFDGAK.IALQPVT---DVVHLVHGPIAC...EGNSWDTRNVGTS............GPLIYRW.........GFTTDL
Q2WGI2_SELUN/11-432PAHTGTP.RVASPFK---NAHATTHAPLG....DDHSNATRPTPER.............DRDFTP.........VTASTV
A5ZMT5_9FIRM/13-395ADVSGVC.SALYELG---G.MVVMHDPSGC..NSTYNTHDEIRWYD...................QD.....SLIYISGL
Q3Z7D0_DEHE1/60-516CAYAGCKGVILGPTR---DVLSITHGPIGC...GFYSWLTRRNQTRPPK.......PEDENFMTY.........CLSTDM
NIFK_METTM/21-446CQPFGAM.FATLGIR---RGLPLVHGSQGC...STFVRYGLNRHFR.............EPA..E.........IAVTSL
A7IA34_METB6/11-372CAMTGAA.ACLAGFD---GISVVIHGSSGC...YYYPATLLNTH..............................LYGTFI
Q20XD3_RHOPB/20-446CQPAGAQ.FASIGIK---DCIGIVHGGQGC...VMFVRLLISQHLK.............ESF..E.........IASSSV
A1WXG0_HALHL/10-395GGYWGAV.YAFTAVK---GLQVIIDGPVGC...ENLPVTAVLHYTDA...........LPPEELP.........VVVTGL
Q3M586_ANAVT/490-896SQPLGAA.LAFLGLK---GVMPLFHGSQGC...TAFAKVMLVRHFR.............EAI..P.........LSTTAM
A1WTP6_HALHL/19-436SQPVGGT.LATLGFR---GAVPLLHGAQGC...TAFGKVYFVRHFN.............EPI..P.........LQTTAI
Q9XDC2_HERSE/44-444LGLEGAK.IALQPWT---..WPLVHGPIAC...EGNFLGYPPCGLRP...........GVQTYRT.........GFTTDI
A4WU62_RHOS5/53-445CPAFGSL.RTGLRMR---RVGTIISGSACCTYGLSFVSHFYGARRS............................IGYVPF
Q53U99_HELCL/42-464CQPLGAL.LCALGIE---GCLPFVHGSQGC...AAYFRNTLNRHFR.............EPI..P.........TVSDSM
Q8TP84_METAC/341-740CAFSGAA.TATFQVS---DAATVLHGPRSC...THITADALACS..FLRGG...GINAGEVKQVP........GLLPTDM
Q56JU1_9BACL/18-428GQPLGGV.MALQGVY---RSMPLLHGAQGC...SAFSKSLLTRHFR.............EPI..A.........VQTSAL
Q2J4G2_FRASC/19-525SQPLGGA.LVFLGLA---GSLPIMHGAQGC...ASFAKALLTRHFN.............EPI..P.........LQTTAI
Q8TJ87_METAC/15-494CQPMGSA.LAFKGVE---NTMVLYHGSQGC...STYMRLHLAHHFR.............EPV..D.........IASSSL
Q8TRG0_METAC/31-443CALEGAA.GILAGIK---DISIVIHSPQGC...SSTVSVAYDTHEI.............DFTKRK.........VACTRL
BCHB_CHLAA/11-419TAHHGVG.RIANSMR---NVHAVFHAPQG....DDYVNAIFAMLDR.............TPNFPA.........MTTSVV
A3DFR2_CLOTH/52-456CATSKAA.CMTVLIQ---DAAVISHGPVGC...ASCLHEFAFTYRVNY.........PLRGIERPTP.....RRIFSTNL
NIFK_BRASP/68-492CQPLGAV.FVSVGFE---GTLPFVHGSQGC...VAYYRSHLSRHFK.............EPS..S.........CVSSSM
Q8PYX7_METMA/62-515CAFAGTKGVVFGPIK---DMVHIVHGPIGC...AFFTWGTRRNFAKAE........EGEDNYMNY.........CVCTDM
A4FXP1_METM5/15-429CQPMGAI.FALMGVK---HSMPLIHGSHGC...STYMRFQLGRHFK.............EAV..N.........VASTSM
A5USK3_ROSS1/51-447CTYAGCRGVVGGPVK---DAIQLTHGPIGC...AFFSWGYRPHLAD............SDFHMKY.........TFVTDM
A6LR27_CLOB8/53-455CNAGHAF.CQLSMIR---DAVVVNHAPIGC...AGDFFGFNFTYRV.............EQMKRELPA..TIGRYFSTCI
A4SD70_PROVI/15-398CPAFGGL.RVLTRID---GVQVCLAADQGCLYGLTFVSHFYAARKS............................IVSPEL
Q7M8U9_WOLSU/69-488CQPLGAV.MVALGFE---NTMPYVHGSHGC...VAYFRSYFTRHFK.............EPT..P.........CVSDSM
A0YNZ3_LYNSP/44-440CAFDGAS.IALVPIT---DAAHLVHGPIAC...SGNSWGSRGSLSS............GPVTYKT.........GFTTDL
CHLB_EPHAL/11-431PAHIGTL.RVANSFK---NVHAIMHAPLG....DDYFNVMRSMLER.............ERNFTP.........ATASIV
A4XMA4_CALS8/25-448CQPIGAM.YATLGID---KAVPLVQGSQGC...CTYVRYQFNRHFK.............EPV..N.........IAVTSF
A6UWY5_META3/46-455CAFAGARGVVGGPVK---DIIHMVHGPVGC...AFYTWGSRRALSD............NELHRRY.........CWTTDL
Q72WT1_DESVH/16-490CTPLGAT.LAFRGIE---GAVPFLHGSQGC...ATYMRRYVISHYR.............EPM..D.........IASSAL
A4XMA3_CALS8/36-422CTFNGAR.WVLAPIK---NSLHLVHAPADC...AFYGQNVRKKNYM............................ILSTDL
Q46243_CLOPA/49-448CAYCGAKHVIGTPMK---DVIHMSHGPIGC...TYDTWQTKRYISDN...........NNFQLKY.........TFATDV
O27608_METTH/13-425CQPLGAV.MAFLGVR---GAMPLIHGSQGC...STYMRFQITRHFR.............EPV..N.........IASSSL
A5N026_CLOK5/32-415CPMRIAS.VIVEDIK---GLSSLLVGMQEY...TTHSRLFSPNPEG...................KH....GELHWLYVL
A4ACR0_9GAMM/10-395GGYWGSV.YVFTAIK---GLQVIIDGPVGC...ENLPVTSVLHYTDA...........LPPHELP.........IVVTGL
A2SSA2_METLZ/13-379TDYSGAA.SVFYNMG---G.LVVIHEPSGC..MGNFTGFDEPRWYH...................AP.....EMVFSSFI
Q3Z7D3_DEHE1/21-437CAPLGAS.IAFSGIA---RCLPYLHGGQGC...ATYIRRYTISHFR.............EPM..D.........IASSSF
O27526_METTH/12-396CKLFGAV.RAVTGIK---NAVPLIHGPRGC...AYHIGYLLTARGG.............RRI.A..........VASTEL
A3PLS6_RHOS1/507-913SAPLGAA.MAYLGIE---GAIPLFHGAQGC...TAFAMVHMVRHFK.............EAI..P.........LQTTAM
A6UNA3_METVS/21-449CQPLGAM.FAVSGIK---RGLPLVHGSQGC...STFVRYGFARHFR.............EPA..D.........IAVTSL
Q53U97_HELCL/19-431SPALGAT.IAYMGVD---GLLALLHGSQGC...STFIRLQLSRHFK.............EPI..P.........LNSTAL
A4XMA5_CALS8/46-442CAFAGARGVVGGPVK---DVIQIVHGPVGC...AYYTWSSRRHLSD............SEFHRKY.........CFSTDM
Q6NA14_RHOPA/19-430CQPIGAS.LAFLGLA---DCLPLEHGARGC...TSFNKLFFMRHFN.............EPI..A.........LQTTAM
Q97ME2_CLOAB/52-505CCYAGCKGVVMGPIK---DMIHITHGPIGC...SYYTWGVRRNKAKAE........DGGQNFIEY.........VFSTDM
Q07LR0_RHOP5/48-419ADDVSAALRVVGEID---GLGVVIHGARGC...AGALAPRVDRP..............................WVVTNL
A5USK2_ROSS1/20-440CAPIGAM.LANYGIH---GAITINHGSQGC...ATYPRHQMSRHFR.............EPV..E.........VATTSL
Q24QP1_DESHY/324-722CAFNGAM.SVGAQIS---DAVILAHSPKSC...THIMYQTISSAGRRTLFE...RGALLPVSLAP........NLESTDM
Q2RWB8_RHORT/53-460CAGLCAT.LNLTLIE---DAVVINHAPVGC...AGDFAQLNRCRRR.............GQGKRAMEV..TNARLLSTAL
Q540N9_HELMO/11-414TALSGIT.RVAGSMQ---KVHTVIHGPQG....DGYVNVMYSMLER.............FHTIPP.........FTLSTI
Q7BKZ2_CLOBE/23-438CQPVGAM.YAALGVH---GCMPHSHGSQGC...CSYHRTVLSRHFK.............EPA..I.........ATSSSF
NIFE_METTH/64-456CVYGGAR.VVLMPIT---DAAHIVHGPVGC...AACTWDIRGSRSS............KSDLYKT.........GFSTNL
A5ENW8_BRASB/19-430SQPIGGS.FAFLGLR---GAMPLLHGSQGC...TSFGLTLFVRHFK.............EAV..P.........MQTTAM
Q2RL08_MOOTA/46-462CAFAGARGVIGGPIA---DVIAMVHAPVGC...AWYTWGTRRHLSDLYTWATPTRLTNVAFNRRY.........CVCTDM
Q46A91_METBF/20-445CQPAGAQ.FVGIGIK---DCIPLVHGGQGC...SMFVRLLFAQHFK.............ENF..D.........IASSSL
Q6N6J8_RHOPA/13-414CALHGAL.YAATAID---GVTPLVHATPGCGVQAGLWQGVGGCGVS............................WPTSNL
A5N1T7_CLOK5/17-439CMPMGGV.MAFKGIE---NNMVILHGSQGC...STYIRRHMATHYN.............EPV..D.........IASSAL
A6LUZ4_CLOB8/44-438CVYCGAR.VVLNPIT---DAYHIVHGPIGC...ASYTWDIRGSLSS............GDNLYRN.........SFSTDL
BCHB_CHLTE/11-426TALHGVS.RVTNSMK---GVHTVYHAPQG....DDYITATYTMLER.............TPEFPK.........LSISVV
NIFK_CYAA5/69-490CQPLGAL.LAAIGFE---GTLPFVHGSQGC...VAYFRTHLTRHFK.............EPV..S.........AVSSSM
A7I7F2_METB6/56-518CAYAGCKGVVVAPIK---DMITITHGPVGC...GYYSWGTRRNKARADST.....TPKDKIYSQL.........CFTTDM
NIFE_AZOVI/37-443CSFDGAQ.IALLPVA---DVAHIVHGPIAC...AGSSWDNRGTRSS............GPDLYRI.........GMTTDL
A4SCK5_PROVI/12-392SAYWASV.NTFCALS---DVHVIADAPVGC...YNLVGAAVMDYTDA...........IPYLEN..........FTPTSL
Q2FLM7_METHJ/320-717CAFAGAI.AVLSQIQ---DASIIAHCPSSC...AHIVSNLLVSSQN............RDRDKSADYGKQTSFSFIHTGM
Q7BKZ0_CLOBE/18-441CMPMGVS.NALYGIK---NCMTILHGSQGC...STYIRRHMATHYN.............EPV..D.........IASSSL
O31276_AZOVI/19-430SQPMGAA.LAFLGLS---RSLPLEHGAQGC...TAFSKVFFTRHFR.............EPI..P.........LQTTAL
A0L6W2_MAGSM/19-431SQPVGAA.LAFMGIR---DAIPMLHGSQGC...TAFAKVFFVRHFR.............EPI..P.........LQTTAM
A6TTX7_ALKMQ/17-436CMPMGAS.TAFKGIE---STMVLLHGSQGC...STYIRRHMAGHYN.............EPI..D.........IASSSL
A1Z1V8_RHILT/41-442CAFDGAK.VVLQPIT---DVAHLVHAPLAC...EGNSWDNRGAASS............GPVLWRT.........SFTTDL
NIFN_RHILO/19-429SQPLGAA.FAFLGVE---GAMPLFHGSQGC...TSFALVLFVRHFK.............EAI..P.........LQTTAM
A7I7F4_METB6/48-446CVFCGAR.VVLNPVT---DAVHLIHGPVGC...ATYTMDIRGSLSS............GSELFRT.........SFSTDM
Q8KC88_CHLTE/24-443CQPIGAM.YAALGIH---GCLPHSHGSQGC...CAYHRSTLTRHYK.............EPV..M.........AATSSF
A1VI39_DESVV/23-444CQPIGAM.YAALGIH---GCLPHSHGSQGC...CSYHRSHLTRHFR.............EPV..M.........ASTSSF
NIFN_AZOVI/19-432SQTMGAA.LAILGLA---LSMPLFHGSQGC...TAFAKVFFVRHFR.............EPV..P.........LQTTAM
Q93T90_AZOBR/22-429SQPLGAA.LAFLGVD---RCMPLFHGSQGC...TAFGLVLLVRHFR.............EAI..P.........LQTTAM
Q6D2Z0_ERWCT/69-501CQPLGSV.LCSLGFA---NTLPYVHGSQGC...VAYFRTYFNRHFK.............EPI..A.........CVSDSM
A6UWY4_META3/30-461CQPIGAM.WATLGVC---EGVPFVQGGQGC...TTYARYQFARHFR.............EPS..P.........IASASF
A7FRU8_CLOB1/32-416CPMHTAL.ALSSRVK---GMSTLVVGTPEC...GTYSRNIVSGIKS...................EE....GELHWTYIL
CHLB_NEPOL/11-429PAHLGVL.RVASSFK---NVHAIMHAPLG....DDYFNVMSSMLER.............DRDFTP.........VTASIV
A5N1T9_CLOK5/23-438CQPIGAM.YAALGIH---NCMPHSHGSQGC...CSYHRMQLTRHFK.............DPI..M.........ATTSSF
A4FXN8_METM5/48-457CAFAGVKGVITGAIK---DVLQIVHSPVGC...SAYGNGTTKRYPTNSTMPDGSTFPVENFNLKH.........IVGTDL
Q3APV8_CHLCH/12-392SAYWAAV.NTFCILR---DVHVIADAPVGC...YNLAGVAVIDYTDA...........IPYLEN..........LTPTTL
A7I7F3_METB6/23-439CQPIGAM.YASLGIH---GCLPHSHGSQGC...CAYHRMHLTRHFR.............DQV..L.........AASSSF

PF01497

Q4KAK8_PSEF5/33-281IVSTSPSVTGILLAM....DAPLVASAATTPSRLTDERGFFSQWAE----------------------------V...AR
B3EC07_CHLL2/105-346VTCENGFQVSLLQML...GRSAALAGVSGKQRVGQDDVHRKIDS..----------------------------......
A9KLK9_CLOPH/127-364VAVLFSSYAQVWQDG...GGVVSITVPDSINRGLVKKDAV......----------------------------......
B9LI46_CHLSY/56-295VLALGEE..GLLIDLIDSGMRPVAASVNLPDRVPLLSAEELA....----------------------------......
A8LBT9_FRASN/61-297IATLGRLTVSFLDLG...GEPVGVTEVDASVLDVLPEEQQAAYK..----------------------------......
A6BYB2_YERPE/44-280VVALEWLPVELLLAL...GVTPFGVADIHNYRLWVGEPALPA....----------------------------......
Q9HMG8_HALSA/70-339VAVYESGYADMVVAL...GHGDALTAVGNSDRFHTDAYDAL.....----------------------------......
Q03SI0_LACBA/39-270IVATTYAIVQIAAKL.....HLPLVGVPTTANTMPKQYQ.......----------------------------......
Q8TKF6_METAC/99-361IITTNPDNSRIVIAL...GDLEKMVSTDEATRGSSVLPKDEEGNKL----------------------------APEAWE
Q932C9_STAAM/51-279VAVLTGFYVGDFIKL...GIKPIAVSDITKDSSILKP.........----------------------------......
Q129U2_POLSJ/29-259IVCLTEEPTEWLYLL...GEERRIVGISGYTVRPPRARE.......----------------------------......
Q977T6_9ARCH/6-268IISFLPSATELIYEL...GAQEKLFGVTHECNYPSDASNKPRVI..----------------------------......
Q5E5H9_VIBF1/28-260IISAGSAVTELIYAL...GAEDSLVAVDVTSKMPQTQ.........----------------------------......
A6BFH3_9FIRM/138-386IYLAATSAMALFDSM...DGLDSIRMSGAQASDWYIDNAKKAME..----------------------------......
Q73TK8_MYCPA/66-308VSAGYTEQDDLLAVGVVPIAVTNWFGDQPFAVWPWAADKLGGA...----------------------------......
A6UGV8_SINMW/54-318TVSIGQSSTEILYLL...GLADKVVGTALWVGQVLKGYEEIN....----------------------------......
A8AWA6_STRGC/24-267VITNNLSTTEILIEL...RLKDKIAGMLNPDNDVTDKYKADIA...----------------------------......
Q5WC89_BACSK/255-486LAAYDLDSLGDLLALRQIPFAAPMHPKWTKHYYELYQHEVPVH...----------------------------......
Q4JSY9_CORJK/57-307VVALDNRSFEILNEW...GVELSAAPKKLVPATVTDYKDNE.....----------------------------......
Q9EZ57_CORUL/91-327ALDIYGTYTKTLEGL...GLTKNIVGRTVSSTENALKD........----------------------------......
A4EIG7_9RHOB/58-301ISGHDLVITIPMIEL.......GVFPVGSHGRGETLEEAFIRGSAP----------------------------LTGVDF
Q6L1D8_PICTO/51-271IVSLSPAFTATLYGI...GALNDVVGISTCTFYPEPVK........----------------------------......
A3I5B7_9BACI/81-317IASLWYFYPEILVAL...GEPPAASTDKEYLSSLAYLNGKLA....----------------------------......
Q8TM94_METAC/62-323IAYTHYSVAEVLKAI...GAWDRVVARDGYISDENFYPNLDEI...----------------------------......
Q9HKZ6_THEAC/7-228IVSLSPAVTEILYMI...GESDNIAGNSAFCVHPEEAR........----------------------------......
Q2G941_NOVAD/48-274LVSLNPCTDAILAEV...ADPAQILAISHYSKDPRSSSMDS.....----------------------------......
Q06Q20_PASHA/55-315IAVTGVENFDKVV.....GISREFWEKFNPGSWALFAEKMPNL...----------------------------......
A4WEC6_ENT38/44-298VVVLQHQTLNLLVQM...NATDKIVGILANWKQQLGEGYVRLAPE.----------------------------......
Q7MWG9_PORGI/105-345IACLSTTQIGSLPLL...DQTDKLVGCINLKNICNADIRNRIKK..----------------------------......
A3YPU4_CAMJU/72-305VVILDLGILDTFDAL...KLNDKVAGVPAKNLPKYLQQFK......----------------------------......
Q8FRS2_COREF/66-320VATVAWSNHEVPLAL...GVTP..VGFEKATWGDDDGDGVLPWVAE----------------------------QLAVLG
A3UEI5_9RHOB/3-265IASLLASSTEIVAAL...DLTDDLVAVSHCCDWPPQVRDLPAL...----------------------------......
A4FH22_SACEN/55-310IAQVSAAGALKDFGVDVVGTFGPLVKDDGTTENEAGSVNPAEV...----------------------------......

PF00148

B4SC77_PELPB/21-398EEGD---------LSKQ..EPSLQD----------------IISEIMADHHP..SVIFLLSSC-----TPEVMKVDFKGL
A9W9E4_METEP/11-414QAQD---------LGRD.TAAIFKD----------------AVAAAYERFQP..QAMIVGASC-----TAELIQDDPGGL
B0UCN0_METS4/77-469NSET---------LVTGKLFEDIRD----------------AVRAVADPAQC..DAVVVINLC-----VPTASGVPLRLL
B2JYA8_BURP8/19-425NEVT---------TILG.GYENVET----------------ALLNIRRRAAP..KIIVLCSTG-----LTETNGEDIVGH
B8G5R1_CHLAD/13-405REED---------VING.TAKALIR----------------TIDDLRTMGMLAGKRLLVVSTA-----ESEMISADHAQL
A8ML60_ALKOO/11-412NETD---------ISFG.KQDRLEN----------------AILEIDGQYGP..KYIFVMASS-----ISAIIGTDIESV
B9LG95_CHLSY/32-416GTAE---------LSSGKVQEAANA----------------AIAEAASAANT..TFIPVISLC-----VAETAGLAEELL
C0A2T2_9BACT/72-470QEMD---------VIYG.GEKKLGA----------------ALRELIARHSP..KAAFVYSTC-----IVGVIGDDVEAI
Q3A2R7_PELCD/48-471TEDG---------AVFG.GQNNLHE----------------GLENALKLYKP..KMMAIFTSC-----MPEIIGDDLNAF
A1WTQ5_HALHL/61-466QERD---------IVFG.GDPKLEK----------------IVDEIEMLF.PLNKGITVQSEC-----PIGLIGDDIDSV
VNFD_AZOCH/49-447KESH---------VVFG.GEKRLEQ----------------RMHEAFDEM.PDIKRMIVYTTC-----PTALIGDDIKAV
A0LH04_SYNFM/16-440GEKH---------AVYG.GGANLKQ----------------GLKNVMTKFGA..RLIGIATTC-----LTETIGEDVPMI
A4TZX5_9PROT/19-431NEVS---------TILG.GMDQVEA----------------ALLNIAKRTKP..KIIGLISTA-----LTETRGEDMKGD
NIFK_METBA/23-440SEGT---------AVFG.VSANLKE----------------ALVNLTTIYKP..EVIAIHTTC-----VAETIGDDVGVI
CHLB_PROMT/11-419QARD---------LGGD.TAELVKG----------------HIKEAVDRFKP..ETLLVGESC-----TAELIQDQPGSL
NIFN_KLEPN/19-431DPTS---------TIMG.ADGNIFT----------------ALDTLCQRNNP..QAIVLLSTG-----LSEAQGSDISRV
Q53U98_HELCL/38-434MEMD---------VVYG.GEKKLIQ----------------AIIDVARKHQP..KAVFVYATC-----VSALIGDDLETA
Q0AZV9_SYNWW/62-421SESD---------IVNGQHLDKIFA----------------ATANILAEVDPRPKAMMICASC-----IDDLLGSDYEAI
Q72WS7_DESVH/65-519QDED---------IIFG.GEKKLAQ----------------AIREAAAIFRP..EAISVHATC-----PVGLIGDDIQAV
A6VFE7_METM7/74-471QESD---------IVFG.GEKKLYE----------------SILEVHKLYSP..GAIFVYSTC-----VVGLIGDDIKAV
CHLB_CYAPA/11-425DRNV---------LARG.SQEKVID----------------NILRKDKEEQP..DLIVLTPTC-----TSSILQEDLQNF
A5GAJ7_GEOUR/498-905SEDT---------AIFG.GWENLKK----------------GIKRVIEKFGP..QVVGVMTSG-----LTETMGDDVRSA
Q0RAV6_FRAAA/76-504TEDA---------AVFG.GINNLVE----------------AMENITALYKP..KHIAVSTTC-----MAEVIGEDLFAY
A7NQD8_ROSCS/24-408GSAE---------LYSGEVVEGTRM----------------AIEAAAREPGC..RLVPVVSLC-----VAETAGMPEELL
Q1NMU1_9DELT/18-469GEKN---------AIYG.GGPNLKL----------------GLQNVTTKYRP..KLIGIGTTC-----LTETIGDDLPSL
A6UWY1_META3/60-461KEED---------VVFG.GEKKLYD----------------AILKICEEFNP..DAIFVYETC-----QTALIGDDISAV
A3CWW9_METMJ/16-374VENE---------VIFG.TESRLAE----------------VIRELAGRY....ARIAVVNTC-----VPAIMGEDMGDL
NIFE_METBA/46-452KEID---------VVFG.GEKKLSN----------------AIDELVEVYHP..PVILVYSTC-----IVGIIGDDLESV
Q8KAN1_CHLTE/12-392TERE---------ISSSGSSQIVQE----------------TIEKLMGSG....KQLILVSSA-----ESEMIGSDHQHM
NIFE_RHOCA/46-447SELD---------IVMGHGEKKLYR----------------ALRPVIEAESP..AAVFVYATC-----VTALIGDDLGAV
Q1JXL4_DESAC/43-440TTND---------VIFG.GEDKLYD----------------GIVYVMEHYDP..KAIFVYSTC-----VTAMIGDDIDVV
Q0YUY4_9CHLB/15-436HEES---------AVFG.GSHNLQV----------------GLKNVTAQYKP..EVIGIATTC-----LSETIGDDVPMI
Q2RS09_RHORT/44-448SEMD---------VIHG.GEKKLYR----------------AIKEAVAKYAP..PAIFVYQTC-----VPALIGDDIDQV
Q2WGI2_SELUN/11-432DRHV---------LARG.SQEKVVE----------------NTTRKGKEERP..DPIAPTPTR-----TSSILQEDPQNL
A5ZMT5_9FIRM/13-395TEID---------AVMG.NDAKFIH----------------DIEETARELKP..RFIALAGSP-----IPFMNGTDFPAI
Q3Z7D0_DEHE1/60-516QESE---------IVFG.GEKKLAQ----------------AIEEAYQLFKP..KTIVVHATC-----PVGLIGDDIHQV
NIFK_METTM/21-446HEDA---------AVFG.GRSNIIN----------------GVKNLVKRFRP..DLVGIVTTC-----SSEIIGDDVDGF
A7IA34_METB6/11-372LENE---------VIFG.SGDRLRE----------------VISDLSGKG....DRIAVVTTC-----VPSALGEDIREM
Q20XD3_RHOPB/20-446HEDG---------AVFG.ALDRVET----------------AVDVLLMRY.PHVKVVPIITTC-----STEVIGDDVDGL
A1WXG0_HALHL/10-395SEEE---------L....NREGTEG----------------AMKRAHGTLDP.QQPSVVVTGS-----IAEMIGGGVTPE
Q3M586_ANAVT/490-896TEVT---------TILG.GEDNIEQ----------------AILTLVEKSKP..EIIGLLTTG-----LTETRGDDMEGI
A1WTP6_HALHL/19-436DPIS---------AVLG.ADDNVLG----------------ALDTLCGKSAP..ALITLLTTG-----LSEAEGTDIERL
Q9XDC2_HERSE/44-444NELD---------VIYG.GEFRLYK----------------AVKEIIEKYEP..PAVFVYQTC-----VTALTGDDIDAV
A4WU62_RHOS5/53-445NSES---------LVTGKLFEDIRE----------------AVHEMADPERY..DAIVVTNLC-----VPTASGVPLRLL
Q53U99_HELCL/42-464TEDS---------AVFG.GQNNLIE----------------GLKNAYQVYKP..SMMAVFTTC-----MAEVIGDDLNAF
Q8TP84_METAC/341-740EEED---------VIFG.GIEKLER----------------KIEEALSA.GW..QTVFVVSTC-----PGGIIGDDVKRA
Q56JU1_9BACL/18-428QEMD---------VIFD.ADRNLEE----------------ALDSIWSKHHP..DVIGVLSTA-----LTEVAGVDFQSR
Q2J4G2_FRASC/19-525TEVT---------AVLG.SGEAMVE----------------TLDAIRKKQRP..EIIGLLTTG-----VTEVSGEDVGGQ
Q8TJ87_METAC/15-494SEKG---------AVYG.GRENLKK----------------GLRNVINRYKP..KVIGVATTC-----LAETIGDDVPAI
Q8TRG0_METAC/31-443FETD---------IVMG.ASDKLKE----------------LIREVDSKFKT..RAIFVIGTC-----AADIIGEDLEGL
BCHB_CHLAA/11-419SGTD---------LARG..TIRLPD----------------TLRQVEERVHP..DLIVVVASC-----STILLQENLEIA
A3DFR2_CLOTH/52-456KEKD---------TVYG.GNIKLAN----------------TIREVYERTHA..NAIFVLTTC-----AAGIIGDDVESV
NIFK_BRASP/68-492TEDA---------AVFG.GLNNMID----------------GLANSYNMYKP..KMI.CSTTC-----MAEVIGDDLNAF
Q8PYX7_METMA/62-515KETD---------IVFG.GEKKLKK----------------AIDEVVKIFNP..EAVTICATC-----PVGLIGDDIEAV
A4FXP1_METM5/15-429SEAN---------AVLG.GEENLKH----------------AIRNVSKIYGP..EIIGVTTSC-----LSETIGDDVEGI
A5USK3_ROSS1/51-447NETN---------IVFG.GEKKLLQ----------------SIIEANAEF.PNAKAVFVYNTC-----STALIGDDGRDV
A6LR27_CLOB8/53-455EEKD---------TVFG.AAKKLED----------------TVREAYKRTKP..NAIFVTTSC-----ASGIIGEDVDAI
A4SD70_PROVI/15-398MNVQ---------ISGGSMIDDLRR----------------TIEEIARDPSI..RFIPVVSTC-----VAETAGIAEELL
Q7M8U9_WOLSU/69-488TEDA---------AVFG.GLQNMID----------------GLANCYAMYKP..EMIAVSTTC-----MAEVIGDDLQAF
A0YNZ3_LYNSP/44-440SEND---------IIFG.GEKRLYK----------------AIAQIVKSHQP..AAIFVYSTC-----VTALIGDDLDAV
CHLB_EPHAL/11-431DRRV---------LGRG.SQKKVVD----------------NLLRKDKEENP..DLIILTPTC-----TSSILQEDLQNF
A4XMA4_CALS8/25-448HEDA---------AVFG.GRRNLIE----------------GIRNLVLRYSP..TVIGVITTC-----SSETIGDDIEAF
A6UWY5_META3/46-455QESD---------IVYG.GEKTLEK----------------ACMEAIDEF.PEANGMMIYTNC-----PTALIGDNIDAV
Q72WT1_DESVH/16-490GEKH---------AIHG.GGPNLKK----------------GLLNVMKKYHP..RLVGVATTC-----LTETIGDDVGRI
A4XMA3_CALS8/36-422IEKD---------IVFG.AARKLEE----------------SIVEADKIFDS.YDLVFVYATC-----TAAQIGEDIEWS
Q46243_CLOPA/49-448KEKN---------IVFG.AEKVLKQ----------------NIIEAFKVF.PHIKRMTIYQTC-----GTALIGDDIEAV
O27608_METTH/13-425NEAT---------VVYG.GEKNLLK----------------AIRTVEENYKP..EVIGVISGC-----LSETIGDDINRI
A5N026_CLOK5/32-415DAQE---------VVFG.CRNSLMG----------------ALRKMDKA.GA..KAILMIVTC-----VPELIGEDIEGI
A4ACR0_9GAMM/10-395AEEE---------L....GQKGTEG----------------ALRRAHKSLDP.KRPSVVVTGS-----IAEMIGGGVTPR
A2SSA2_METLZ/13-379REEE---------ATMG.DESILLN----------------KILQECASHHP..KFVAILGTP-----VPALIGCDISGI
Q3Z7D3_DEHE1/21-437GEEA---------TVFG.GKDNLFC----------------GLKNVISQYQP..DLIGIASTC-----LSETIGENVPAL
O27526_METTH/12-396SESD---------VVFG.ASEKLRD----------------RIIEVDRTRKP..DIIVIMSSC-----ATSIIGEDIGRV
A3PLS6_RHOS1/507-913NEVS---------AILG.GGEQIEE----------------AIENLRKRASP..KFIGIASTA-----LVETRGEDIAGE
A6UNA3_METVS/21-449HEDA---------AVFG.GRKNLIS----------------GIGNLAARFKP..DVMGVVTTC-----SSEIIGDDVGGF
Q53U97_HELCL/19-431LEDT---------AIFG.GWEHLKK----------------GIAKAADKFQP..RIIGVMSSG-----LTETFGDDMVSA
A4XMA5_CALS8/46-442QEKD---------IVFG.GEKKLYN----------------AIIEANQEF.PEAKAVFIYATC-----PTALIGDDLEAV
Q6NA14_RHOPA/19-430DQIT---------TVIG.ADSNVIE----------------ALATICERDKP..KVIGLISTG-----LSSMQGADLPRT
Q97ME2_CLOAB/52-505QERD---------IVFG.GEGKLRK----------------AIKEAVEIFHP..KAIGIYATC-----PVGLIGDDINAV
Q07LR0_RHOP5/48-419NQRD---------TILG.ADGALAR----------------TLRQLHRRHRP..WAIIIVATP-----VVAINNDDIQAV
A5USK2_ROSS1/20-440TEKT---------TVYG.GKQNLLA----------------ALKNIWERFHP..TMIMVCSTC-----LSETIGDDIPAI
Q24QP1_DESHY/324-722GEAE---------MIFG.GMEKLEE----------------KILELKAR.QP..RAIVVVSAC-----PAGIIGDDIGR.
Q2RWB8_RHORT/53-460TEHD---------TIFG.GAQKLAE----------------TIDQAVARYHP..RAIFVTASC-----ASGIVGEDIDSV
Q540N9_HELMO/11-414GRRE---------MAQG.SRARLVE----------------TVRRVDAQHQP..DVIVITPTC-----SSTLLQEDLLAV
Q7BKZ2_CLOBE/23-438SEGA---------CVFG.GGSNIKT----------------AVKNIFDMYDP..EIIAVHTTC-----LSETIGDDLKGF
NIFE_METTH/64-456EEKD---------VVFG.GEDRLLK----------------CILEVDEIYSP..SAIFVYSTC-----VSGVIGDDITAV
A5ENW8_BRASB/19-430SEVA---------TVLG.GYENVEQ----------------AILNIYKKQKP..EIIGICSTG-----VTETKGDDVDGY
Q2RL08_MOOTA/46-462QEKD---------VVFG.GIKKLEQ----------------ACLEAIRLF.PEAKGLIIFTTC-----TTGLIGDDVQAV
Q46A91_METBF/20-445HESA---------AVFG.GAIRVEE----------------AVEALVARY.PQLRIIPIITTC-----STETIGDDIEGI
Q6N6J8_RHOPA/13-414SEKH---------IVFG.GASRLRE----------------QIKNTRGVVSS..EITVVLTGC-----PAEMIGDDVEAM
A5N1T7_CLOK5/17-439TEQG---------TVYG.GADNLKK----------------GLNNMIKMYNP..TTIGILTTC-----LAETIGEDINRI
A6LUZ4_CLOB8/44-438SEQN---------VIFG.GEKKLIA----------------AIEGIMENHNP..KLIFVYATC-----IVGVIGDDVKAV
BCHB_CHLTE/11-426RGQD---------LARG..TSRLPG----------------TVEQVDKHYKP..ELIVVAPSC-----STALLQEDLGQM
NIFK_CYAA5/69-490TENA---------AVFG.GLKNMVD----------------GLQNSYALYKP..KMIAVCTTC-----MAEVIGDDLGAF
A7I7F2_METB6/56-518QEPD---------IVFG.GDKKLAR----------------MIDEIVAAFHP..RGINICSTC-----PIGLIGDDIGAV
NIFE_AZOVI/37-443TEND---------VIMGRAEKRLFH----------------AIRQAVESYLP..PAVFVYNTC-----VPALIGDDVDAV
A4SCK5_PROVI/12-392TEKE---------IASSGSSEIVRD----------------TITKLQEPG....RQLILVSSA-----ESEMIGSDHERM
Q2FLM7_METHJ/320-717DEKM---------MVFG.GIEGLKK----------------TIIKSVESGN...RVIFIVSGC-----TPGITGDDIVGC
Q7BKZ0_CLOBE/18-441TEEG---------TVYG.GENNLIK----------------GLENLIKLYNP..EVIGIATTC-----LAETIGEDVVRL
O31276_AZOVI/19-430DMAS---------TVLG.SDERLQE----------------GLATVIDGHHP..EVVGLITTG-----LVEMQGADIRRV
A0L6W2_MAGSM/19-431DQVS---------TVMG.GDESITE----------------GLDVLSGGAKT..RVVGLISTG-----LTECQGADIHRV
A6TTX7_ALKMQ/17-436NEKE---------TVHG.GAANLKK----------------GLKNILRLYNP..KMIGISTTC-----LAETIGEDIQRL
A1Z1V8_RHILT/41-442TELE---------IVTGDSERKLLK----------------AIREIKEGYAP..AAIFVYGTC-----VTELIGDDIAAV
NIFN_RHILO/19-429DEVA---------TILG.GADHLEE----------------AILNLKTRTKP..KLIGVCTTA-----LVETRGEDCASD
A7I7F4_METB6/48-446KEKD---------VIFG.GEKKLAA----------------CIDEVVEKYHP..PAVFVYATC-----VSGMIGDDIVAV
Q8KC88_CHLTE/24-443TEGA---------SVFG.GQANLLS----------------AIETIFTVYDP..EVIAVHSTC-----LSETIGDDLQQI
A1VI39_DESVV/23-444TEGA---------SVFG.GGPNLRQ----------------ALKTIFQVYDP..DMVAVHTTC-----LSETIGDDIPTI
NIFN_AZOVI/19-432DQVS---------SVMG.ADENVVE----------------ALKTICERQNP..SVIGLLTTG-----LSETQGCDLHTA
Q93T90_AZOBR/22-429DQVS---------TILG.GYENLEQ----------------AVRTIHERNAP..ALIGVATTG-----VTETKGEDMAGQ
Q6D2Z0_ERWCT/69-501TEDA---------AVFG.GNNNLNA----------------GLENASALYKP..EVIAVSTTC-----MAEVIGDDLQAF
A6UWY4_META3/30-461HEHA---------AVYG.GMKNLVD----------------GLTNLVSRYDP..NLIAVITTC-----SSETIGDDIESF
A7FRU8_CLOB1/32-416DSNE---------VVFG.CRRGLIN----------------TIKEMDKS.GA..KAIMIILTC-----VPEIIGEDIEGI
CHLB_NEPOL/11-429DRHV---------LATG.SQRKVVA----------------TIHRKDQEDEP..DLILVTPTC-----TSSILQEDLGNY
A5N1T9_CLOK5/23-438TEGA---------SVFG.GGANFKT----------------AMKNIFSIYNP..DIVAVHTTC-----LSETVGDDLVTY
A4FXN8_METM5/48-457TESD---------VVFG.GMNKLKK----------------VIREGAKEY.PFVNAIYVYATC-----TTGLIGDDLDAV
Q3APV8_CHLCH/12-392TEQE---------ISSSGSTAVVRK----------------AIEGLQGSG....KHLILASSA-----ESEMIGSNHARM
A7I7F3_METB6/23-439TEGA---------SVFG.GASNLKT----------------SIKNIFKIYNP..DIIAVHTTC-----LSETIGDDIPNI

PF01497

Q4KAK8_PSEF5/33-281QRGV.........AVLY-RNLQFDI...................EAVIAADP--DLLVVSATGA.....DSVVAHRSELQ
B3EC07_CHLL2/105-346.GEL.........AVTG-FMRGMNM...................ERLLKTAP--DMVFVNTTG.......VASDVPGKLR
A9KLK9_CLOPH/127-364..TV.........IGNG-DGRSINV...................ERLLKLKP--DLVILTNDF......PEHVELAEILR
B9LI46_CHLSY/56-295..GI.........ELFP-SAGDISL...................ETLSTYQP--DFIIGTEFF........IDQIGYRQL
A8LBT9_FRASN/61-297.AAK.........LLGS-GASEADL...................ELLATLKP--DLILFSAPD.......SDFEQMKSQL
A6BYB2_YERPE/44-280..DV.........INVG-QRTEPNL...................ELLQQMAP--SLILLSQGY..........GPSPEKL
Q9HMG8_HALSA/70-339..DG.........VSVD-TSGLVDLVDA............GVTRETLLDLDP--DVYLMDPNW.........LTSTFELD
Q03SI0_LACBA/39-270..HV.........TKVG-SPMNPSV...................EKIAALKP--TVVYSVTTL......DDQFGAAFKTQ
Q8TKF6_METAC/99-361ALQIYGGGQLDELPETN-TRREIDY...................ETMALLKP--DVVFDSLGY.........NRGDLVEE
Q932C9_STAAM/51-279..YL.........KGVD-YIGENDV...................EKVAKAKP--DLIVVDAMD...........KNIKKY
Q129U2_POLSJ/29-259..EK.........PKVS-AFLSAKI...................DKIVELQP--DCVIGFSDL........QADIASQLV
Q977T6_9ARCH/6-268.ESV.........FEPE-KMSSQEIDDKICELSERGEEIYKLITENVSNAKP--DLIISQEICEVCSAYTNQVKNAIDIL
Q5E5H9_VIBF1/28-260..SL.........PKIG-YHRQLST...................EGLLALQP--TQIIGSNEM.......GPQSTLDLLS
A6BFH3_9FIRM/138-386EGRI.........LFAG-KYSEPDY...................EMLVDEDC--DLAIESTMI......LHTPKVQEMIE
Q73TK8_MYCPA/66-308..QP.........TVLN-LDNGIPV...................DQIAGLKP--DLIVAINAG........LDADTYQKL
A6UGV8_SINMW/54-318..AK.........VERL-ADNDPSF...................ESVLAKKP--DMVAVQFQWQV..GPEGVVARPEQFE
A8AWA6_STRGC/24-267..TI.........PQVG-DKKTVSQ...................ETVLSYEP--DALLGRNMMF....SEKSLGTVSAWN
Q5WC89_BACSK/255-486.LSA.........YRAN-HDWQANM...................ERLIDWKP--DVLIAKRKL.........HEEERNAF
Q4JSY9_CORJK/57-307..EI.........KDLG-NHKEPDF...................EALVAAQP--DLVISGQRF.......KDRDEEIKEL
Q9EZ57_CORUL/91-327..LP.........VVTE-GGHTINV...................EAVLNLRP--SLVIVDHSI.......GPRDRIDQIR
A4EIG7_9RHOB/58-301DNSD.........IEWV-GNRPIEV...................ERIAAQNL--DLIITTAWQ..........PADVEQL
Q6L1D8_PICTO/51-271..NI.........TVVG-SYDSINT...................EEILNLSA--QVIIGCSMP.........ASLISKVD
A3I5B7_9BACI/81-317..ST.........EELG-DKLSPSI...................EKTLSIEP--DFILATEHH..........EKLYESL
Q8TM94_METAC/62-323.PAI.........CPAR-NPMDINY...................EKTVEVQP--DVLILPKFEW.....YDDTDEIINRL
Q9HKZ6_THEAC/7-228..KK.........KKVG-SYGTVSW...................DILSKIDP--DAVFLISGY.........PHALYEKL
Q2G941_NOVAD/48-274..AL.........ASSL-PATRGTV...................EEVLALRP--DLVLGSTFI......DPATASAYRRL
Q06Q20_PASHA/55-315.KNI.........ADLG-YVNSGTFS.................TEKTIALKP--DVLVLPEIQY.....QALASEISRIE
A4WEC6_ENT38/44-298LNQK.........ATLG-DLTHVDP...................EKLIALHP--QVVFVTNYA........PQEMIDKIS
Q7MWG9_PORGI/105-345.GYV.........QEIG-TGMTKNI...................EQIAGLRP--EILLQDLFH........VSDKDEELI
A3YPU4_CAMJU/72-305..NK.........PSVG-GVQQVDF...................EAINALKP--DLIIISGRQ..........SKFYDKL
Q8FRS2_COREF/66-320APEP.........VLFD-ATDSLPF...................ESIANTQP--DVILAAYSG........LTQEDYDQL
A3UEI5_9RHOB/3-265..TS.........ALFE-AQTARDIDEAVRAKLQGQDAIYALDAQALAALKP--DLVISQALCDVCAVSGAEVSTVLSDL
A4FH22_SACEN/55-310..TD.........VTGP-AYGELNM...................ERVASLHP--DLLVSGKYAEFP.GLWHLTQDQEETA

PF00148

B4SC77_PELPB/21-398AHLL.....STPDV....................PVLFVPASGL.VYNFTQAEDSVLAALVPFC................
A9W9E4_METEP/11-414AKAL.....ALPIP.....................VIPLELPAY.QKKENWGASETFYRLVRALAGSP............
B0UCN0_METS4/77-469PREI.....DGVR......................IIGIDVPGFGVPTHAEAKDVLAGAMLRVARAEAER.......GPV
B2JYA8_BURP8/19-425LAMV.....RRRKPELN...............DTELVYVSTPDY.VGAFEDGYRHALTAIVKTLVK..............
B8G5R1_CHLAD/13-405VAQI.....DPE.......................ARFFWSQSL.EQDEWTGRERALLFAWEQY.GKP............
A8ML60_ALKOO/11-412CYEL.....QPKVKA...................KLIPITTGGY.HGDHTLGIEATMDMLCKEVVQ..............
B9LG95_CHLSY/32-416PKEI.....DGKP......................VILVRVPAYAIHSHPEAKDVALAAVMRRFID..............
C0A2T2_9BACT/72-470CKSV.....ARDTGI...................PVIPVASEGF.KGTKKTGYRAACDAVYRLVGT..............
Q3A2R7_PELCD/48-471IINA.....RNAGIVPQ...............DYPIPYANTPSF.NGTHINGYDSMLKSVVSYLAT..............
A1WTQ5_HALHL/61-466GRQA.....TERLGK...................PVIPVRCEGFRGVSQSLGHHIANDTIRDHVLE..............
VNFD_AZOCH/49-447AKKV.....MKERPD..................VDVFTVECPGFSGVSQSKGHHVLNIGWINEKVE..............
A0LH04_SYNFM/16-440VEEF.....RREIRRKGG............EEPPAFVSVRTPSY.SGTHMEGFHGAVRAVVEQL................
A4TZX5_9PROT/19-431LKLI.....LARN.PEL..............ADIKVIPVSAPDF.TGSLETGWGKAVTAIINAL................
NIFK_METBA/23-440LEDV.....EAEELIDP...............SIKICAASTPSY.VGSHITGYDNMVKSFVTTF................
CHLB_PROMT/11-419AKGMG..FDIP........................IVSLELPAY.SKKENWGGSETFYQIVRTLLK..............
NIFN_KLEPN/19-431VRQF.....REEY.PRH..............KGVAILTVNTPDF.YGSMENGFSAVLESVIEQWVP..............
Q53U98_HELCL/38-434CKEA.....QKDVSV...................PVIPVNAPGF.MGDKNIGNRVAGEVLFRQIIG..............
Q0AZV9_SYNWW/62-421AEEL.....ERKH......................NIPIKACHM.DPIAMEGSKPPVRTIQQAI................
Q72WS7_DESVH/65-519AREL.....SKETGI...................PVMAFNCEGYKGVSQSAGHHIANNKIFDMALG..............
A6VFE7_METM7/74-471CKQA.....EEATGC...................RVIPVQSEGFKSFNKSAGHKLACDAMLDYLIG..............
CHLB_CYAPA/11-425VEQAS..LNSMAD......................VLLADVNHY.RINELQACDKTLEQIVRFYIE..............
A5GAJ7_GEOUR/498-905IVHF.....RQEN.PEF..............AHVPVIHASTPDY.CGSMQEGYAAAVEAIVATI................
Q0RAV6_FRAAA/76-504IGAA.....REQEAITQ...............DFPVSYAHTPSF.VGSHITGYDVMLKGIIEMLAK..............
A7NQD8_ROSCS/24-408PRKVG..DAE.........................VVLVRVPAYAIHSHPEAKDVALEALLRRL................
Q1NMU1_9DELT/18-469LAEY.....HREFTAGDD.............APPLLTRVSTPSY.AGSHMEGFHGAVRALVEQLAV..............
A6UWY1_META3/60-461VKEV.....KKKLKNTNHK...........NKDTPILAFECAGFKGKTQNKGHMIANKKLFELIAT..............
A3CWW9_METMJ/16-374ADEG....Q..........................IIVVDSPGF.LGDLEAGYRRALDTIAPVV................
NIFE_METBA/46-452CKTA.....SQKHTI...................HVTPVKSEGF.NGNKSDGYKAACDALKRLIKR..............
Q8KAN1_CHLTE/12-392LAMKY..PS..........................VRFFASDSL.GENEWQGRDRALAWLFDQF................
NIFE_RHOCA/46-447CGAA.....TAKWGA...................PCVPVGVPGF.AGSKNLGNKLGGEALLDRVVG..............
Q1JXL4_DESAC/43-440CRHA.....EKKFNI...................PIVPVHAPGF.VGGKNLGSRLGGEAVLKNLIG..............
Q0YUY4_9CHLB/15-436LREY.....TKTYRNGT..............PMPIMIHASTPSY.QGSHIDGFHAAVRATVVTL................
Q2RS09_RHORT/44-448CKVA.....SERLGL...................PVVPVNAPGF.VGSKNLGNKLGAEALLAHVIG..............
Q2WGI2_SELUN/11-432VRGAS..ITSDSD......................AIPADVNHH.RVDEPQAADGTSEQVVRHHLN..............
A5ZMT5_9FIRM/13-395AQVI.....ETET.G..................IPAFAIPTNGM..HDYTYGAGIALARIAERF................
Q3Z7D0_DEHE1/60-516TRAA.....QEKLGI...................KVFGFSCEGYKGVSQSAGHHIANNQIFKHMVG..............
NIFK_METTM/21-446MRVA.....ETELREELGD...........RFQTKLVHISTPSF.VENHFRGYGNAIKSFIETLSR..............
A7IA34_METB6/11-372VSGS....E..........................LIVVDSPGF.AGDLEAGYQAALAALGPSV................
Q20XD3_RHOPB/20-446ITKLEEGLLAEKYADR................EVHLLAIHSPSF.VGSMVSGYDVAVRDFVKKF................
A1WXG0_HALHL/10-395GTG................................IRRFLPRTI.DEDQWQASDRALRWLWEQF................
Q3M586_ANAVT/490-896LRSI.....RKRH.PEL..............YDLPIIFASTPDF.QGALQDGFATAVESIVKEI................
A1WTP6_HALHL/19-436VRTF.....REAH.PEH..............AGTAVVPVNTPDF.VGSLESGYAATVEAIIEHLVP..............
Q9XDC2_HERSE/44-444CKAA.....SAKFGK...................PVIPVNSPGF.AGVKNLGNKLAGEALLDYVIG..............
A4WU62_RHOS5/53-445PSEIN..GVR.........................IVGIDVPGFGVPTHAEAKDVLAGAMLKYA................
Q53U99_HELCL/42-464INNA.....RAAESIPK...............DFPIAFAQTPSF.VGSHITGFDNMLKALLQSLAD..............
Q8TP84_METAC/341-740TSRV.....ETRFPG..................ARVIPVPVEGVLTGDFSTGLLEGYKRVA.DLID..............
Q56JU1_9BACL/18-428VKTF.....KRER.SMK...............DSLLFPVSLPDF.QGSLETGYGSTVEAMIDAVIG..............
Q2J4G2_FRASC/19-525LRKY.....LSAWNETDSSGPEAGANGSAPGRAPLIVGVSTPDF.IGGLSDGWSAALEALVRAVVPAEHSETEPSEARYF
Q8TJ87_METAC/15-494IREF.....KEEEGIGDDL...........EKDIIIIPVSTPSY.GESHVSGYIKALDAVVRKFTE..............
Q8TRG0_METAC/31-443CRNLQ..PQINAK......................LIPLMAGGF.RGDSYAGIDMGLKVLFPFI................
BCHB_CHLAA/11-419AQHA....GLQCE......................VMVYDANPY.RMQEIVAAESLFTDLVKRF................
A3DFR2_CLOTH/52-456CNEA.....EEEL.G..................IPVVAIFCEGFRSKVWTTGFDAAYHGIARKL................
NIFK_BRASP/68-492IKTS.....KEKGSVR................RSSTPFAHTPAF.VGSHVTGYDNALKGILEHFWN..............
Q8PYX7_METMA/62-515SREA.....EKEHGI...................KVIPARCEGYRGVSQSAGHHIASNALMENLIG..............
A4FXP1_METM5/15-429LRLF.....KAQNDDL.................PEIVPISTPSY.KHTHVEGYDSTVKALVEHL................
A5USK3_ROSS1/51-447AKQA.....EAIIGK...................PVVFFECEGFRGVSQSMGHHVGNETIFRQLVG..............
A6LR27_CLOB8/53-455TENL.....SKEL.G..................IPVISCSCEGFRSKIWTTGFDAAYHSILRKL................
A4SD70_PROVI/15-398PKKAG..NAE.........................VLLVRLPAFQIRTHPEAKDVAAATLLKRF................
Q7M8U9_WOLSU/69-488VENA.....RSAGSIPA...............DYPVPYANTPSF.KGSHITGYDNMMYSIITQLSN..............
A0YNZ3_LYNSP/44-440CQAA.....AKKHGT...................PVIPVHAAGF.VGSKNLGNRLAGEALLDHVVG..............
CHLB_EPHAL/11-431VDRAS..VISDSN......................IILADVDHY.QVNEIQAADRTLEQVVRFYLS..............
A4XMA4_CALS8/25-448IKEA.....YKKLSEELSSE.........AANSVYIVPIHTPSY.AGTHVKGYDTATISYVKYFA...............
A6UWY5_META3/46-455GNKV.....EEYMKK...................PVFPVNCPGFAGVSQSKGHHVFNTMFYRWLKK..............
Q72WT1_DESVH/16-490LREF.....RNEFGDLD...............LPDIVHVSTPSF.AGTHMDGWYDAVRAVTEQLVE..............
A4XMA3_CALS8/36-422IKMV.....KDRVNK...................ILIPVIVPGFSGYSQADGHYIAQRAIASYILK..............
Q46243_CLOPA/49-448TKQV.....KAEMPD..................VDIFVCNSPGFAGPSQSGGHHKITIGWVNQKVG..............
O27608_METTH/13-425VRIY.....RDAGSE..................SRIIPVSTPGF.KGSHVDGYDMAVTSILRSIAG..............
A5N026_CLOK5/32-415VHEIQ..PELSAQ......................VTFVLLGQFKNISYPPGSWKTMEALGVLM................
A4ACR0_9GAMM/10-395DTN................................IERFLPRTI.DEDQWQSADRAMFWLWDRY................
A2SSA2_METLZ/13-379ATEV.....FDTT.K..................IPAFGLNTTGF..QYYDDGIKKALLMIEEQL................
Q3Z7D3_DEHE1/21-437IEEF.....RQSVDLG................ETQLVFASTPSY.AGSHLTGFHKAVLATAKAL................
O27526_METTH/12-396ADETS..ELVDAE......................LITVSAGGF.ESSQGEGYEEVMMALIHKF................
A3PLS6_RHOS1/507-913LREM.....LARR.RDF..............ADTAVVYAATPDF.AGGLEEGWARAVEAIIEAL................
A6UNA3_METVS/21-449IKMA.....KDEIVKKMGVT.........AAEKIKIVQINTPSF.VEQHYKGYDNAIKAIVDTLAE..............
Q53U97_HELCL/19-431LASL.....RQERPDLI...............EKPVVLAKTPDY.IGSLQEGYQRTVLALLDTL................
A4XMA5_CALS8/46-442AKKA.....SKAIGK...................PVIAFNSPGFCGVSQSKGHHIANHTIFEKIVG..............
Q6NA14_RHOPA/19-430IVEF.....YAKL.PEY..............ADVKVIAAAATDT.LGCLESGFALAVEAIIEAV................
Q97ME2_CLOAB/52-505ARES.....TEKYGI...................QVIAFSCEGYKGVSQSAGHHIANNNILDTVIG..............
Q07LR0_RHOP5/48-419AEEL.....SDEL.A..................IPVIELRTDGFRSRVAATGIDIAAQAVAALV................
A5USK2_ROSS1/20-440IDEF.....LDKHPDV................TIPILSVKTPSY.IGNHTTGFDNFLKEIALNLPD..............
Q24QP1_DESHY/324-722TRRF.....SE..PG..................LPVVTLKTDGNLAGDYLQGMLMAYTSLARQVIR..............
Q2RWB8_RHORT/53-460VTEA.....EERH.A..................IPVVAIDCVGFRTQVWATGFDMAYDALLRKI................
Q540N9_HELMO/11-414ARTLG..KQTKAK......................LIVPNVNAF.RDLEHRAMDDFLTQIVAEF................
Q7BKZ2_CLOBE/23-438IDAI.........DIPE...............GKYVLHANTPSY.VGSHITGFSNMVTGFIKGLSK..............
NIFE_METTH/64-456CRNA.....EYKTGK...................WVIPVQSEGFRSFNKSLGHQLACDVLLDHVIG..............
A5ENW8_BRASB/19-430IRLI.....REKH.PEL..............ANYPLVYVSTPDF.KDAFQDGWDKTVAKMVEVL................
Q2RL08_MOOTA/46-462ARSV.....EKKTGR...................LVFTAESPGCSGVSQSKGHHDFNIQFYRQVRS..............
Q46A91_METBF/20-445IRKVNK.DIKEKHPDR................DVKLIAVHTPSY.SGSQVTGYDTAINAVVQAL................
Q6N6J8_RHOPA/13-414AQEAR..DAGDE.......................VLDLATAGF.RGSAYHGYQSFLLAAVERT................
A5N1T7_CLOK5/17-439VEEF.....YREQEKNEN............MKDIKIITASTPGY.GNTQAEGYFSVLRKIVEQV................
A6LUZ4_CLOB8/44-438CKMA.....EEKYNV...................PVIPVMSPGF.SGNKSKGYKLACNALMNLF................
BCHB_CHLTE/11-426ARASG...VDQSK......................IMVYAVNPF.RVAENEAAEGLFTELVRRF................
NIFK_CYAA5/69-490LGNA.....RQDGVIPD...............DLPVPFAHTPSF.VGSHITGYDSMMKSILSTLTE..............
A7I7F2_METB6/56-518AKAA.....TERHGI...................QVLAYACEGYKGVSQSAGHHIANNTIMQNVIG..............
NIFE_AZOVI/37-443CKAA.....AERFGT...................PVIPVDSAGF.YGTKNLGNRIAGEAMLKYVIG..............
A4SCK5_PROVI/12-392LAMQF..PL..........................VRFFPSHSL.GENEWQGRDRALEWLFKNF................
Q2FLM7_METHJ/320-717ASEM.....SQNL.G..................IPIIPVSVNGIGEGDFSAGIMAGYHASLQLV................
Q7BKZ0_CLOBE/18-441SKIF.....YEKHPDS................KVKLIPIQSPGY.GGTQYGGYFTALRAVVENV................
O31276_AZOVI/19-430LRSF.....HAER.CE................SASVVAVNTPDT.LGGLESGYALAVEAIIEALVP..............
A0L6W2_MAGSM/19-431VRQF.....RDSH.PQH..............ANKEVIAVNAADF.KGCLESGYAHAVGSFIKAWLP..............
A6TTX7_ALKMQ/17-436IIEF.....KEEEPQYK...............EVSFVPVSTPGY.GGTNYEGYYFTIREIVKNI................
A1Z1V8_RHILT/41-442CRHA.....AQKFAI...................PVVPVKSPGF.GGSKNLGSRLAGEALLEHVIG..............
NIFN_RHILO/19-429IANV.....KLKHVEEL..............AGTEVVLANTPDF.DGAIEEGWAKAVAAMIEGI................
A7I7F4_METB6/48-446CKAA.....SARHNT...................DIIPVESSGFISGNKVVGYRAAAEALLRLI................
Q8KC88_CHLTE/24-443TKKA.....SDDGKIPE...............GKYVIYASTPSY.VGSHITGYANMVTSMTEQFAV..............
A1VI39_DESVV/23-444TKVA.....MEDGTVPQ...............GKKVIHCNTPSY.VGSHVTGFSNMVEGMVNYLAA..............
NIFN_AZOVI/19-432LHEF.....RTQY.EEY..............KDVPIVPVNTPDF.SGCFESGFAAAVKAIVETLVP..............
Q93T90_AZOBR/22-429YSLF.....RQRN.PAL..............AGLKLVFANTPDF.SGGFEDGFSAAVTGIVEEV................
Q6D2Z0_ERWCT/69-501IANA.....KKDGFVDA...............DMPIPYAHTPSF.IGSHITGWDNMFEGFARTFTV..............
A6UWY4_META3/30-461IRAA.....RKNIAKEVGE..........EKAELPIIPVHCPAY.KGSHATGYDNASKAYFQYLAK..............
A7FRU8_CLOB1/32-416VHEMQ..PEVSAQ......................LTFVLMAHFKCNSYPSGYWKTLVAFGNLM................
CHLB_NEPOL/11-429VARAA..PYTKSE......................VLLADVQHY.RIHELQAQDRILEQVVRHIMD..............
A5N1T9_CLOK5/23-438IASS.........EIPE...............GKIVIHANTPSY.VGSHITGFSSMVKAMVAYLSK..............
A4FXN8_METM5/48-457CKEM.....QAELGK...................DVVAFNAPGFAGPTQSKGHHVGNYTIFSKLVG..............
Q3APV8_CHLCH/12-392LSTHY..PN..........................VRFFASNSL.GENEWQGRDRALAWLYEMF................
A7I7F3_METB6/23-439IKQS.........EIPE...............GKIVIHTNTPSY.VGSHITGFSNMCKSMVAYLAE..............

PF01497

Q4KAK8_PSEF5/33-281AQGL------------------------------ETLVVDYSN.------------------------------------
B3EC07_CHLL2/105-346SCGL------------------------------TPGMFSASLE------------------------------------
A9KLK9_CLOPH/127-364DNEI------------------------------KTLLFQVDSF------------------------------------
B9LI46_CHLSY/56-295SQIA------------------------------PTVALSG...------------------------------------
A8LBT9_FRASN/61-297ESIA------------------------------PTIFFGFS..------------------------------------
A6BYB2_YERPE/44-280APIA------------------------------PTMSFAFNEQ------------------------------------
Q9HMG8_HALSA/70-339RGDI------------------------------DFLTQRSAPF------------------------------------
Q03SI0_LACBA/39-270HVTP------------------------------HFLDLTSV..------------------------------------
Q8TKF6_METAC/99-361KVGC------------------------------PCVDAETGFT------------------------------------
Q932C9_STAAM/51-279QKIA------------------------------PTVPYTYNK.------------------------------------
Q129U2_POLSJ/29-259KKGI------------------------------QVTIFNQRSV------------------------------------
Q977T6_9ARCH/6-268EEKP------------------------------EIYSMSPHDI------------------------------------
Q5E5H9_VIBF1/28-260QSNV------------------------------KVNIVNTTPT------------------------------------
A6BFH3_9FIRM/138-386DLDI------------------------------PVFIDRSSYE------------------------------------
Q73TK8_MYCPA/66-308SAIA------------------------------PTVAQSDGDA------------------------------------
A6UGV8_SINMW/54-318ELGI------------------------------PVYTSPADCT------------------------------------
A8AWA6_STRGC/24-267ENKI------------------------------PVYTQKASLS------------------------------------
Q5WC89_BACSK/255-486TVSI------------------------------PTFIDLSNA.------------------------------------
Q4JSY9_CORJK/57-307VPDA------------------------------AVVELEPRED------------------------------------
Q9EZ57_CORUL/91-327AAGV------------------------------TTVVMEPTRT------------------------------------
A4EIG7_9RHOB/58-301RLIA------------------------------PTFVVDIST.------------------------------------
Q6L1D8_PICTO/51-271SLGI------------------------------KYLEYVPCNI------------------------------------
A3I5B7_9BACI/81-317EKIA------------------------------PVITLKSQDI------------------------------------
Q8TM94_METAC/62-323EPDI------------------------------PVVFVDTLNP------------------------------------
Q9HKZ6_THEAC/7-228SEKY------------------------------HVVEFELPST------------------------------------
Q2G941_NOVAD/48-274GLHL------------------------------ETLGMANTV.------------------------------------
Q06Q20_PASHA/55-315QAGI------------------------------PVVVDFNKQT------------------------------------
A4WEC6_ENT38/44-298SLGI------------------------------PVVAISLRHD------------------------------------
Q7MWG9_PORGI/105-345ASGI------------------------------NTVLYNEWKE------------------------------------
A3YPU4_CAMJU/72-305KEIA------------------------------PTLFVGLDNA------------------------------------
Q8FRS2_COREF/66-320SQIA------------------------------PVVAYPEQPW------------------------------------
A3UEI5_9RHOB/3-265DPQP------------------------------TLVNLEPYSL------------------------------------
A4FH22_SACEN/55-310KSIV------------------------------QTVGVQQSGV------------------------------------

PF00148

B4SC77_PELPB/21-398....................................................................PEAPAGQK....
A9W9E4_METEP/11-414AER.................................................................SPRDGRRP....
B0UCN0_METS4/77-469AAP.................................................................RQGRDGRP....
B2JYA8_BURP8/19-425.....................................................................PLPTVHR....
B8G5R1_CHLAD/13-405FVP.................................................................ADVQPRPR....
A8ML60_ALKOO/11-412....................................................................ETVQKKPN....
B9LG95_CHLSY/32-416....................................................................TSGDHEPG....
C0A2T2_9BACT/72-470..G.................................................................DISDIPPV....
Q3A2R7_PELCD/48-471...D...............................................................KKVEGKDNG....
A1WTQ5_HALHL/61-466.....................................................................NREGDG.RQA.
VNFD_AZOCH/49-447.....................................................................TMEKEI.TS..
A0LH04_SYNFM/16-440....................................................................AGEGHAAR....
A4TZX5_9PROT/19-431...AE.............................................................PASARAQECN....
NIFK_METBA/23-440....................................................................TKKSKPNG....
CHLB_PROMT/11-419...DHSN........................................................ESKHTWQEEKRRP....
NIFN_KLEPN/19-431...P...............................................................APRPAQRNR....
Q53U98_HELCL/38-434.....................................................................T..AEP.ETV.
Q0AZV9_SYNWW/62-421...YD.............................................................FIPRVSKKDN....
Q72WS7_DESVH/65-519.....................................................................T..RER.EA..
A6VFE7_METM7/74-471.....................................................................T..EEP.EEE.
CHLB_CYAPA/11-425...KNRA.........................................................SLTLEKVKTLLP....
A5GAJ7_GEOUR/498-905...................................................................PEGGEKIKG....
Q0RAV6_FRAAA/76-504...SPD..........................................................ADASKVAKSDKV....
A7NQD8_ROSCS/24-408...G...............................................................DRESPREER....
Q1NMU1_9DELT/18-469...PPVN.........................................................GQKSAGKEPSRA....
A6UWY1_META3/60-461.....................................................................KEVEEV.LEQP
A3CWW9_METMJ/16-374.......................................................................DPDVF....
NIFE_METBA/46-452.....................................................................P..SED.EIKK
Q8KAN1_CHLTE/12-392...D..............................................................DGQPSQIEPG....
NIFE_RHOCA/46-447.....................................................................A..LEP.ETV.
Q1JXL4_DESAC/43-440.....................................................................R..KEP.QGD.
Q0YUY4_9CHLB/15-436....................................................................AEKGERQN....
Q2RS09_RHORT/44-448.....................................................................T..IEP.SDA.
Q2WGI2_SELUN/11-432...KARG.........................................................QGTLGRSLANIP....
A5ZMT5_9FIRM/13-395...TGESETVS................................................KTAESAIDRESSVNQPH....
Q3Z7D0_DEHE1/60-516.....................................................................T..DNT.ASP.
NIFK_METTM/21-446.....................................................................EDGDCNH....
A7IA34_METB6/11-372.......................................................................NPEQS....
Q20XD3_RHOPB/20-446....................................................................AKKGEPSG....
A1WXG0_HALHL/10-395...GMRRG......................................................RPPRPREREAGAPP....
Q3M586_ANAVT/490-896...................................................................PQPGETRLD....
A1WTP6_HALHL/19-436...EAA...........................................................SAGTRPGRAAR....
Q9XDC2_HERSE/44-444.....................................................................R......SNL.
A4WU62_RHOS5/53-445...RAEVEA.....................................................GPVQAPVSGRSDRP....
Q53U99_HELCL/42-464...................................................................TRHGKWTNG....
Q8TP84_METAC/341-740....................................................................PSVTPEKG....
Q56JU1_9BACL/18-428...HV............................................................GGRLPKKKRNG....
Q2J4G2_FRASC/19-525TGRTAFIAASAPVTHLTTPGSAGSAEAARSTRSTRSTRSARSLGSAEAARSTRSARSLGSAARRVAAADGGALDPR....
Q8TJ87_METAC/15-494...KPESPEESKSPEDVELMDCMENMEIM............EYTEILEKEKAKANVREAKKPDMEEETDAIEASNG....
Q8TRG0_METAC/31-443...................................................................KKQSEKIPN....
BCHB_CHLAA/11-419...A...............................................................KPQPRTERP....
A3DFR2_CLOTH/52-456...I...............................................................QKPRRRRDD....
NIFK_BRASP/68-492...GKA..........................................................GTAPKLERKPNE....
Q8PYX7_METMA/62-515.....................................................................T..EDI.KNP.
A4FXP1_METM5/15-429....................................................................ATPSKPNS....
A5USK3_ROSS1/51-447.....................................................................SVEPEGDF...
A6LR27_CLOB8/53-455...................................................................VKPPRKKTN....
A4SD70_PROVI/15-398...G...............................................................AFGEPRKPK....
Q7M8U9_WOLSU/69-488...................................................................VSQSADKKD....
A0YNZ3_LYNSP/44-440.....................................................................T..AEP.EYT.
CHLB_EPHAL/11-431...KQK..........................................................KEKLDRFLTDVP....
A4XMA4_CALS8/25-448.....................................................................KKKEENG....
A6UWY5_META3/46-455.....................................................................K..KEQYPEKC
Q72WT1_DESVH/16-490...STPGAMSGTMSGTMSGVISGAPHEAA.............PGAAARGPATAGATVSDTTPGAISGTTSGTVSTG....
A4XMA3_CALS8/36-422.....................................................................NFEKTE.EI..
Q46243_CLOPA/49-448.....................................................................T..YEP.EIT.
O27608_METTH/13-425.....................................................................DPSDQIE....
A5N026_CLOK5/32-415....................................................................KAKKTEPA....
A4ACR0_9GAMM/10-395...GKAKR......................................................KKAKETPRTEGAKP....
A2SSA2_METLZ/13-379...M...............................................................KDSEVKEPK....
Q3Z7D3_DEHE1/21-437....................................................................AVKKEEHG....
O27526_METTH/12-396...C...............................................................WRMEPSSKP....
A3PLS6_RHOS1/507-913...................................................................VTEGPRRLR....
A6UNA3_METVS/21-449.....................................................................PKDEQNE....
Q53U97_HELCL/19-431...T...............................................................VDPSPRESN....
A4XMA5_CALS8/46-442.....................................................................T..KEL.EDP.
Q6NA14_RHOPA/19-430...A..............................................................PGRSSVRLPR....
Q97ME2_CLOAB/52-505.....................................................................TGDWKH.K...
Q07LR0_RHOP5/48-419...................................................................SPGGERRSN....
A5USK2_ROSS1/20-440...R...............................................................RKKKGETNG....
Q24QP1_DESHY/324-722....................................................................KDVPTLPD....
Q2RWB8_RHORT/53-460...V...............................................................KPAVTKRPE....
Q540N9_HELMO/11-414...A...............................................................TEQPKTEQF....
Q7BKZ2_CLOBE/23-438.....................................................................TTGVKNG....
NIFE_METTH/64-456.....................................................................R..GDA.EV..
A5ENW8_BRASB/19-430...VD.............................................................KPTSIRRDPA....
Q2RL08_MOOTA/46-462.....................................................................L..RERRPELK
Q46A91_METBF/20-445....................................................................AKKDEPSG....
Q6N6J8_RHOPA/13-414...................................................................VVPGPTRAG....
A5N1T7_CLOK5/17-439....................................................................CKECENTG....
A6LUZ4_CLOB8/44-438........................................................................SRN.ILP.
BCHB_CHLTE/11-426...A...............................................................AEQPKTEKP....
NIFK_CYAA5/69-490...................................................................GKKKETTNG....
A7I7F2_METB6/56-518.....................................................................K..GNE.RKP.
NIFE_AZOVI/37-443.....................................................................T..REP.DPLP
A4SCK5_PROVI/12-392...D..............................................................DGRPAAVEPG....
Q2FLM7_METHJ/320-717...................................................................KQEAGKNER....
Q7BKZ0_CLOBE/18-441....................................................................EMYTDKNE....
O31276_AZOVI/19-430...D..............................................................SVVPAAQRAR....
A0L6W2_MAGSM/19-431...E...............................................................RPATKGDAK....
A6TTX7_ALKMQ/17-436....................................................................AKDTTPID....
A1Z1V8_RHILT/41-442.....................................................................T..VGA.DDS.
NIFN_RHILO/19-429...T..............................................................RSGERTRQPK....
A7I7F4_METB6/48-446.....................................................................RPKEGG.TIE.
Q8KC88_CHLTE/24-443.....................................................................STGEKKD....
A1VI39_DESVV/23-444....................................................................GTGKQAAG....
NIFN_AZOVI/19-432...E..............................................................RRDQVGKRPR....
Q93T90_AZOBR/22-429...V...............................................................QPSETTVKG....
Q6D2Z0_ERWCT/69-501...................................................................GEDKHYQPGS...
A6UWY4_META3/30-461....................................................................KDPEVEPH....
A7FRU8_CLOB1/32-416....................................................................KKGKKSTD....
CHLB_NEPOL/11-429...PERQ.........................................................KGTLDTTPTPTP....
A5N1T9_CLOK5/23-438.....................................................................NTGVENG....
A4FXN8_METM5/48-457.....................................................................T..KEP.LET.
Q3APV8_CHLCH/12-392...D..............................................................NGKPAAIQQS....
A7I7F3_METB6/23-439....................................................................AQGETKKE....

PF01497

Q4KAK8_PSEF5/33-281--------------------------------------------------------------------------------
B3EC07_CHLL2/105-346--------------------------------------------------------------------------------
A9KLK9_CLOPH/127-364--------------------------------------------------------------------------------
B9LI46_CHLSY/56-295--------------------------------------------------------------------------------
A8LBT9_FRASN/61-297--------------------------------------------------------------------------------
A6BYB2_YERPE/44-280--------------------------------------------------------------------------------
Q9HMG8_HALSA/70-339--------------------------------------------------------------------------------
Q03SI0_LACBA/39-270--------------------------------------------------------------------------------
Q8TKF6_METAC/99-361--------------------------------------------------------------------------------
Q932C9_STAAM/51-279--------------------------------------------------------------------------------
Q129U2_POLSJ/29-259--------------------------------------------------------------------------------
Q977T6_9ARCH/6-268--------------------------------------------------------------------------------
Q5E5H9_VIBF1/28-260--------------------------------------------------------------------------------
A6BFH3_9FIRM/138-386--------------------------------------------------------------------------------
Q73TK8_MYCPA/66-308--------------------------------------------------------------------------------
A6UGV8_SINMW/54-318--------------------------------------------------------------------------------
A8AWA6_STRGC/24-267--------------------------------------------------------------------------------
Q5WC89_BACSK/255-486--------------------------------------------------------------------------------
Q4JSY9_CORJK/57-307--------------------------------------------------------------------------------
Q9EZ57_CORUL/91-327--------------------------------------------------------------------------------
A4EIG7_9RHOB/58-301--------------------------------------------------------------------------------
Q6L1D8_PICTO/51-271--------------------------------------------------------------------------------
A3I5B7_9BACI/81-317--------------------------------------------------------------------------------
Q8TM94_METAC/62-323--------------------------------------------------------------------------------
Q9HKZ6_THEAC/7-228--------------------------------------------------------------------------------
Q2G941_NOVAD/48-274--------------------------------------------------------------------------------
Q06Q20_PASHA/55-315--------------------------------------------------------------------------------
A4WEC6_ENT38/44-298--------------------------------------------------------------------------------
Q7MWG9_PORGI/105-345--------------------------------------------------------------------------------
A3YPU4_CAMJU/72-305--------------------------------------------------------------------------------
Q8FRS2_COREF/66-320--------------------------------------------------------------------------------
A3UEI5_9RHOB/3-265--------------------------------------------------------------------------------
A4FH22_SACEN/55-310--------------------------------------------------------------------------------

PF00148

B4SC77_PELPB/21-398...........KVVFL.GSVNDV......TADDLRAEA.EELGI..........................PVGG--FLPE
A9W9E4_METEP/11-414...........ACNIL.GPTALG.FRHRDDLIEVRRLL.DGLGI.........................AVNVV--APLG
B0UCN0_METS4/77-469...........TVTLL.GEMFPA......DPVQIGALL.EPLGL.........................SPGPV--V.PT
B2JYA8_BURP8/19-425...........QVNLL.PGSHLS.P...GDIDELREIV.SAFGLDPIILPDIS.......RSLDGHLSPVWRGT--TLGG
B8G5R1_CHLAD/13-405...........TVNII.GPS.LGCFNAPSDLYELKRLI.TGIGA.........................EINLV--YPYE
A8ML60_ALKOO/11-412...........TYNIV.GNNGDV.FNFLSDVEEIKNLMKSAFNF.........................DVNTT--FTAY
B9LG95_CHLSY/32-416...........TLALI.GEVFPA......DPLLIDGVV.RRMGG.........................RVVTT--L.PG
C0A2T2_9BACT/72-470...........SINLL.GDFNIA.....GETWVIRDYF.RRMGV.........................NVVST--LTGD
Q3A2R7_PELCD/48-471...........KLNLI.PGFDAN.T...GNYREYKRIC.EEFGIPVNLLADIS.......ETFDSPLDGTYRTY--P.GG
A1WTQ5_HALHL/61-466........GPYDVAIV.GDYNIG.....GDCWASRILL.EEMGL.........................NVVAQ--WSGD
VNFD_AZOCH/49-447.........EYTMNFI.GDFNIQ.....GDTQLLQTYW.DRLGI.........................QVVAH--FTGN
A0LH04_SYNFM/16-440...........MLNLL.PGF.LS.P...EDLRHLKEIL.AAFRCAATILPDIS.......MTLDGPALDDYPKI--PGGG
A4TZX5_9PROT/19-431...........RINIL.PGVHLT.P...GDIEHLVELV.EEFGLKANVLPDLS.......GSVDGHVPDHFIPT--TLGG
NIFK_METBA/23-440...........KLNII.PGF.VE.P...GDIREIKRIL.SIMEISSIVFPDTT.......DVFGAPLTGEPGMY--PKGG
CHLB_PROMT/11-419...........RVNLL.GPTLLG.FRCRDDVLEIQKLL.GQYGI.........................DVNVV--APLG
NIFN_KLEPN/19-431...........RVNLL.VSHLCS.P...GDIEWLRRCV.EAFGLQPIILPDLA......QSMDGHLAQGDFSPL--TQGG
Q53U98_HELCL/38-434........HPFAINFI.GEYNIA.....GDLWGIQPSL.EAIGI.........................KLQAC--ISGD
Q0AZV9_SYNWW/62-421...........AINII.GSFPPL.....DKDSEFKKIM.SAAGI.........................EKIRH--IAEC
Q72WS7_DESVH/65-519........GRFSVNVL.GEYNIG.....GDAYEIERVL.EKCGI.........................EVVAT--FSGN
A6VFE7_METM7/74-471........HPYSINII.GEFNVA.....GDLWGIIPLY.EKMGV.........................KVHTA--ITGD
CHLB_CYAPA/11-425...........SVNLI.GISSLG.FHNNHDTRELKKLF.ELYEI.........................ILNCS--LPQG
A5GAJ7_GEOUR/498-905...........QVTIL.PGCHLT.P...ADVEEVAEIC.EAFGLTPLVIPDIS.......NALDGHIDETVSPL--SVGG
Q0RAV6_FRAAA/76-504...........RLNVI.PGFDTY.V...GNHREYKRIL.ELMGVDPLILGDHS.......SALDSPANGEYELY--P.GG
A7NQD8_ROSCS/24-408...........TVVVL.GEVFPA......DQLAIDAIL.RRMGV..........................EATI--ALPG
Q1NMU1_9DELT/18-469...........GVNLF.PGL.VS.P...ADLRLLKDVL.AEFNLPATVLPDFS.......DTLDGPALDDYPLI--PAGG
A6UWY1_META3/60-461.......PTPYDVNII.GDFS.T.....GSSNSIEQIF.NKMGV.........................RVLCS--FTGN
A3CWW9_METMJ/16-374...........GVNI..DGVCRTDPFCRGNALEARRLL.SLAGV..............................--....
NIFE_METBA/46-452KAPRVPETIKPKINIL.GDFNVA.....GDVWLVNPLF.EQMGI.........................EVIVS--MTGD
Q8KAN1_CHLTE/12-392...........TVSII..GPTYGCFNSPADLAEVKRLV.TGAGG.........................RVAHV--YPFE
NIFE_RHOCA/46-447........TPCDVNII.GDYGLS.....GELWQVKPLL.DKLGI.........................RILGS--IAGD
Q1JXL4_DESAC/43-440........VSHAINLI.GDYNVT.....GDMWQYKPIL.DELGI.........................RILST--LSGD
Q0YUY4_9CHLB/15-436...........LVNMF.PNM.VS.P...ADLRYLKEIF.TDFRLPCMLLPDYS.......QTMDGGPWGEYHRI--PPGG
Q2RS09_RHORT/44-448........GPTDINII.GEYNVA.....GEFALVKPLF.DELGI.........................RIRAC--ITGN
Q2WGI2_SELUN/11-432...........SANTT.GTPTPG.SHNQHDCRESERSS.RDIGT.........................RTHQI--IPEG
A5ZMT5_9FIRM/13-395...........TLNLL.GVTPLD.FGPQTNVDIMKKNL.QKYGW.........................EVVSS--WAMG
Q3Z7D0_DEHE1/60-516........SPYRVNLL.GEYNIG.....GDAFVIEDLF.ARCGF.........................ELVST--FCGN
NIFK_METTM/21-446...........KLNII.PGI.VN.P...GDIREIGHML.GLMDITPIILTDTSDP...FDSPLRPSKTEQMPFY--PPGG
A7IA34_METB6/11-372...........GVNI..DGISLADPFHEGNIQEITRLL.YRAGI..............................--....
Q20XD3_RHOPB/20-446...........RINLL.TGW.VN.P...GDVKELKHLV.SELGIEANVLFEI........ESFDSPLMPDGAGI--SHGN
A1WXG0_HALHL/10-395...........RVNII..GPAYGMFNMPSDLAEVRRLV.EGIGA.........................EVNLV--FPLS
Q3M586_ANAVT/490-896...........QINIL.VSSAFT.P...GDIQEIKEIV.SAFGLETIVVPDHS.......TSLDGHLDDSYSAV--TGGG
A1WTP6_HALHL/19-436...........QVNLL.LSDAVS.P...GDAEALCELL.EAFGLEPVAIPDLG......ASMDGHLEDGDFSPV--TTDG
Q9XDC2_HERSE/44-444........TPCDISII.GEYNLS.....GEWWQTTPWP.DAVAV.........................RAPSC--ISGG
A4WU62_RHOS5/53-445...........TVALL.GEMFPA......DPVMIGALL.APLGL..........................AAGP--VVPC
Q53U99_HELCL/42-464...........RLYLV.PGFDTY.P...GNLREYKKLV.HAMGIPLTVLPDAE.......EAMDAPHTGEYNMY--P.KG
Q8TP84_METAC/341-740...........LVNII.GERSFS.LREEEHFRTIEGLI.KKLGY.........................GVNCR--FLKG
Q56JU1_9BACL/18-428...........QVNLL.PGSHLT.A...GDVMEIKDII.ASFGLEVITLPDLS.......TSLSGHLLTGFSPL--TRGG
Q2J4G2_FRASC/19-525...........QLAVL.VGPSLT.A...ADLDELGELI.RAFGLDPVLVPDLS.......GSVDGHLAPAWQPT--TTGG
Q8TJ87_METAC/15-494...........KLNLI.PVESIS.P...ADVRELKEILAETAG.DYIFLPDIS.......ETFDAPLGEELPKI--APGG
Q8TRG0_METAC/31-443...........TVNLIAPQANLN.PTWWADLKWIREVL.EKIGI.........................RVLAV--LPHE
BCHB_CHLAA/11-419...........TVNIL.GPASLG.FHARHDLISLRRML.KTLGL.........................EVNVV--APWG
A3DFR2_CLOTH/52-456...........MINVI....NFW......GSDVFYEWF.APFGA..........................KPNY--IIPF
NIFK_BRASP/68-492...........AINII.GGFDGNTV...GNLREIKRIL.ALMGIKHTILADNS.......EVFDTPTDGEFRMY--D.GG
Q8PYX7_METMA/62-515........TPFDINIF.GEYNIG.....GDLWEIKPIL.EKIGY.........................RIVST--FTGD
A4FXP1_METM5/15-429...........KLNVI.TGM.VS.P...GDIAETKKIL.REMGIDSIILTDTS.......ESMDAPYDGEVSFV--MSAG
A5USK3_ROSS1/51-447.........SRSINII.GDYNIK.....NDIRTFEYLF.EALGL.........................RIIAR--FTGN
A6LR27_CLOB8/53-455...........KINVA....NFW......GSHIFDEFL.NRLGY..........................EAQY--IVPF
A4SD70_PROVI/15-398...........SLVVL.GEIFPL......DAMTIGTIL.QKIGV..........................ESVV--TLPG
Q7M8U9_WOLSU/69-488...........RINII.PGFEPY.I...GSLREVKEIV.EAFGADYIMLGDH........SEQWDMPAGKYQMF--S.GG
A0YNZ3_LYNSP/44-440........TPFDINLI.GEYNIA.....GEMWNVLPLF.EKVGI.........................RVLAK--ITGD
CHLB_EPHAL/11-431...........SVNII.GIFTLG.FHHQHDCRELKRLF.QDLNI.........................QINQV--IPEG
A4XMA4_CALS8/25-448...........KAYII.PGM.IN.P...GDIEEIKHIL.DLMKIDYSVLFDIS.......KTLNSPLMPPKPLY--PEGG
A6UWY5_META3/46-455LK..EENKTPYDIALI.GDYNMD.....WDVAVINDLF.EKIGV.........................RNVVT--FTGN
Q72WT1_DESVH/16-490...........RTCLL.PGL.LS.P...ADIRHLRDVM.EAFGLAPVILPDIS.......ETLDAPCLEAYAPI--PAGG
A4XMA3_CALS8/36-422.........EDSVNII.GEYNVA.....GESQVIERLL.EKIGI.........................NVICT--YTGD
Q46243_CLOPA/49-448........SPYVINYI.GEYNIQ.....GDQEIMQDYF.KRMGI.........................QVLST--FTGN
O27608_METTH/13-425...........RVNVI.NGI.MS.P...ADTYELKSIL.RSMGTEFLMITDTS.......ESLDEPFNGDPYFI--TRHG
A5N026_CLOK5/32-415...........RINIL.GRSPEE..K.HIPMPSLLPEL.VKRSF..........................ALRY--LAPG
A4ACR0_9GAMM/10-395...........RVNII..GPIYGCFNTWSDVAEIQRLV.EGIGA.........................EINLT--FPMG
A2SSA2_METLZ/13-379...........TVNIL.GYTPID.FFLSGDDRRLASFV.ESCGF..........................RILC--SLPG
Q3Z7D3_DEHE1/21-437...........GINIM.PGM.IS.P...ADIRYIKRIC.QDLGISAALLPDYS.......DTLDGVSWPEYHCF--PEGG
O27526_METTH/12-396...........SVNII.GEFRGG.....ADLREVRESL.SLMGV.........................DVNCV--LTSG
A3PLS6_RHOS1/507-913...........QVNLL.PGANMT.A...ADIEEIAGLI.RAFGLHPVILPDLS.......LSLDGHLAEDWRGH--SLGG
A6UNA3_METVS/21-449...........KINIV.PGI.VN.P...GDIREIKHLL.SLMKTEGIMLTDTSDP...FDSPLRPSKAEKNPYY--QKGG
Q53U97_HELCL/19-431...........TVALF.PGAHFT.P...ADVEELKDTV.SLFGLTPLVLPDIS.......TSLDGHFELEPAPV--VQGG
A4XMA5_CALS8/46-442........TPYDVNII.GEYNID.....GDYWVLEKLF.TKIGL.........................RIITA--FTGN
Q6NA14_RHOPA/19-430...........QVNVL.ASAMLT.P...GDVEAIKAWI.EAYGLTPIVLPDIA......DSLDGHLIDAGFSTL--TYGG
Q97ME2_CLOAB/52-505.........KYSVNIL.GEYNIG.....GDAWEIERIL.KKIGY.........................TVVGR--LSGD
Q07LR0_RHOP5/48-419...........LINLL.ALEQGP......GLTSLVAQL.AAVGI..........................EVNV--LPAG
A5USK2_ROSS1/20-440...........RINII.PGW.VN.P...GDIRELKHML.REMGLHGLWITDYS.......ETLDGGYYDPRPHV--PRGG
Q24QP1_DESHY/324-722...........TVNIV.FEKFIV.TNTNDNFQTIGSLL.SRLGV.........................RVNCR--FLCE
Q2RWB8_RHORT/53-460...........VVNIV....CFS.....GKKAYFSELL.EPLGL..........................VANP--IVQF
Q540N9_HELMO/11-414...........SVNLI.GPSYLG.FHQLHDMQEIRSML.ESLGV.........................AVNAV--IPYG
Q7BKZ2_CLOBE/23-438...........KMCVI.PGF.VN.P...GDMREVKRLL.KLMGVDFTMFQIQL.......EFLMPPMTGKYEMY--SKGG
NIFE_METTH/64-456........GERSVNLV.GEFNVA.....GDLWEIKRLL.EKMGV.........................KVVAS--ITGD
A5ENW8_BRASB/19-430...........RVNVL.PGCHLT.P...GDIEELRTIF.EDFGLEPSFLPDIG.......GSLDGHIPDEFTPT--TIGG
Q2RL08_MOOTA/46-462MP..ETEKTPYDICLI.GDYNMD.....WDLKAIRPLF.EKMGL.........................RIVAV--FSGN
Q46A91_METBF/20-445...........KLNVF.TGW.VN.P...GDVSEIKHIL.SEMQVDGNILLDT........ETFDSPIMPDKSAF--AYGN
Q6N6J8_RHOPA/13-414...........LVNIL.GPVPHQDATWLAEIEELSRLI.AGVGL.........................IPNPI--FGPF
A5N1T7_CLOK5/17-439...........KLNIV..CANLN.P...GDVRNIKKIL.DDFKIEYTILPDVS.......NTLDSSHNEKYRRI--PKGG
A6LUZ4_CLOB8/44-438........KRKGINML.GDFNLA.....GEIWIVKEYL.KKIGV.........................DVIST--ITGD
BCHB_CHLTE/11-426...........SVNLL.GFTSLG.FHLRSNLTSLRRML.KTLGI.........................EVNVV--APWG
NIFK_CYAA5/69-490...........KINFI.AGFETY.I...GNVRAIKNII.SAFDLEGTLLSDTE.......MYLDSPNLGEFKMY--H.EG
A7I7F2_METB6/56-518........GKHVINVL.GEYNIG.....GDGWEQERIL.KDCGY.........................TVNCV--MTGD
NIFE_AZOVI/37-443VGSERPGIRVHDVNLI.GEYNIA.....GEFWHVLPLL.DELGL.........................RVLCT--LAGD
A4SCK5_PROVI/12-392...........TVSII..GPTYGCFNSPSDLAEIKRLI.AGAGG.........................RLKHV--FPFE
Q2FLM7_METHJ/320-717...........SVILV.GEKILA.NNTTANFNELSQYL.STLDI.........................QVSCR--FLAY
Q7BKZ0_CLOBE/18-441...........KVNVI.AGPMSS.....ADMREIKEIL.EDFKIDYILLPDLS.......ENLDGVHSKKYNRL--PSNG
O31276_AZOVI/19-430...........QVNLL.AGSMLT.P...ADVEAIREWI.EGFGLQAVILPDLA......DSLDGHLTPQGITTL--TTGG
A0L6W2_MAGSM/19-431...........RINLL.VGPHLT.P...GDLERLLDTV.ERFGLKAVLLPDLS......RSLDGHLAPDDFSPI--TTGG
A6TTX7_ALKMQ/17-436...........SINLI.AGS.LT.P...ADVRKVKEMM.DLFAIKYTIVPDIS.......KTLDAPFTTEYKKL--SSEG
A1Z1V8_RHILT/41-442........GPHDINIL.GEFNLS.....GEFWLVKPLL.DRLGI.........................RVRAC--IPGD
NIFN_RHILO/19-429...........KIAIL.PGCNLT.V...ADVEHLRDMV.ESFGLKPVILPDVS.......GSLDGTVPDRWVTT--TYGG
A7I7F4_METB6/48-446........KTQKINFL.GEYNLG.....GEKWLAERYL.REIGI.........................EINVA--FTGD
Q8KC88_CHLTE/24-443...........QVNVI.AGW.ME.P...SDMREIKSLA.SRLGVKIVLFPDTS.......DVLDAPQTGKHEFY--PKGG
A1VI39_DESVV/23-444...........QVNVI.PGF.VE.P...SDMRKIKGML.AQMGVDGVVFPDTS.......DVLDTPQTGEYRMY--PAGG
NIFN_AZOVI/19-432...........QVNVL.CSANLT.P...GDLEYIAESI.ESFGLRPLLIPDLS......GSLDGHLDENRFNAL--TTGG
Q93T90_AZOBR/22-429...........QINVL.AGCHLS.P...GDVEELRDII.ESFGLSPIFLPDLS.......LSMSGRQPDDFTAT--SLGG
Q6D2Z0_ERWCT/69-501.........LPRLNLV.TGFETY.L...GNYRVLKRMM.ADMGVPCAILSDPS.......EVLDTPADGHYRMY--A.GG
A6UWY4_META3/30-461...........KINII.SGFGTN.P...GDILEIKRML.KMMGLEEGKDFSIIFDISENLYKPLREPLDEVPYY--PDAG
A7FRU8_CLOB1/32-416...........TINIL.GRSPRE..K.HVPMPGLLTAL.EKRGF..........................YLRM--LAPK
CHLB_NEPOL/11-429...........SANLI.GFFDLG.FHHRDDSRELRRLL.HGLGI.........................EINSV--LPKG
A5N1T9_CLOK5/23-438...........KVNIL.PGF.VG.P...ADMREYKRIL.KIMGIPYIIMPDTS.......GVVDSPMTEGFKMF--PKGG
A4FXN8_METM5/48-457........TDYDINLI.GEYNID.....GDYWVLEKYF.DAMGI.........................RVLSK--FTGD
Q3APV8_CHLCH/12-392...........TVSII..GPTYGCFNSPADLAEIKRLI.AGIGG.........................NLRHV--YPAE
A7I7F3_METB6/23-439...........QVNVI.PGF.VN.P...GDMREIRRIV.TALGVKLVMFPDTS.......GVLDAPLTSKYQMY--PEGG

PF01497

Q4KAK8_PSEF5/33-281-----------....................QSWQDIA-TALGQ-------------------------RTGLE..QQAR
B3EC07_CHLL2/105-346-----------EH.................PLGAFEWI-RFMGA-------------------------FFDRD..SLAD
A9KLK9_CLOPH/127-364-----------....................LDYLTML-KSCTT-------------------------ILNTQ..DRYH
B9LI46_CHLSY/56-295-----------....................ATPLTQY-IETLT-------------------------VFGRA..EEAL
A8LBT9_FRASN/61-297-----------....................SDWKTRL-SVTAD-------------------------ATELT..DALN
A6BYB2_YERPE/44-280-----------GSS...............PLAVGKNSL-QTLGQ-------------------------RLGLE..TAAQ
Q9HMG8_HALSA/70-339-----------LGNTIFRRT...DAWHDYDYYSLYEAF-ETVAE-------------------------LFDET..DRFD
Q03SI0_LACBA/39-270-----------....................GHLQTTL-TQLGQ-------------------------RYQRQ..SAAA
Q8TKF6_METAC/99-361-----------F...................EENYVQI-RLLGE-------------------------VLDRE..AEAE
Q932C9_STAAM/51-279-----------....................YNHKEIL-KEIGN-------------------------LTNNE..DKAK
Q129U2_POLSJ/29-259-----------....................AEIFSMM-YQLAA-------------------------MVGQE..ARGL
Q977T6_9ARCH/6-268-----------....................QGILKCV-KDIAE-------------------------KIDEV..KRGE
Q5E5H9_VIBF1/28-260-----------V...................QGLLNRI-DEIAS-------------------------ITQHQ..SQAE
A6BFH3_9FIRM/138-386-----------SH.................PLGRTEWI-KAYAA-------------------------MLNKE..DVAD
Q73TK8_MYCPA/66-308-----------F..................FEPWKEQA-AAVGQ-------------------------AVFAA..EKMK
A6UGV8_SINMW/54-318-----------GKENSAASD..GVRRQPFTMDLVYREI-RELAQ-------------------------IYDVQ..DTGA
A8AWA6_STRGC/24-267-----------NIK..............QDLGNIVEDV-KNIGT-------------------------IFNVQ..DKAN
Q5WC89_BACSK/255-486-----------....................GSWKDQF-IVVAE-------------------------ALHEQ..NEAQ
Q4JSY9_CORJK/57-307-----------KP................MDEELIRQI-TTLGE-------------------------IFDKK..DEAD
Q9EZ57_CORUL/91-327-----------I...................DSVSEDI-KNLGG-------------------------VVGLN..DEAA
A4EIG7_9RHOB/58-301-----------....................RDEWSVF-DLLAD-------------------------LTGTD..ASLE
Q6L1D8_PICTO/51-271-----------....................NEIENMT-LQLGI-------------------------LTGNE..RNAS
A3I5B7_9BACI/81-317-----------Y...................EDWQYGL-RTVAE-------------------------IIGKE..NEAE
Q8TM94_METAC/62-323-----------....................DSFCDTV-QIIGT-------------------------IVGNE..DEAQ
Q9HKZ6_THEAC/7-228-----------V...................AGILDLV-MKVGF-------------------------EVDSL..DASR
Q2G941_NOVAD/48-274-----------....................EASRDQI-RQIAR-------------------------LAGHP..ARGE
Q06Q20_PASHA/55-315-----------I...................ENHTKSV-RVFGQ-------------------------LTGTE..ERAE
A4WEC6_ENT38/44-298-----------AAGEKAKMNPTLADEEKAYDQGLREGI-TLIGE-------------------------IVNKP..QEAK
Q7MWG9_PORGI/105-345-----------RD.................LLGRAEWM-KLTAM-------------------------LLSCN..RRAH
A3YPU4_CAMJU/72-305-----------NF.................LSSFENNV-LSVAK-------------------------LYGLE..KEAL
Q8FRS2_COREF/66-320-----------G...................TTLEDQI-LMNAT-------------------------ALGLE..NEGE
A3UEI5_9RHOB/3-265-----------....................RDILETI-TMIGV-------------------------AAGVA..DRAA
A4FH22_SACEN/55-310-----------ALP..............ESIRKYEELA-RALGG-------------------------DVDSPRVRADE

PF00148

B4SC77_PELPB/21-398SRFDKMPAIGPDTVLAPIQPY.LSR....VAVKLSRERGCSVLH..SLFPFGPDGTRAFWEDLARE-FG...........
A9W9E4_METEP/11-414ATPADLVRLGEADFNVVLYPE.VAR...SAAQYLEKTFHQPFVD...VVPIGVGATTRFVEAVAAL-AG...........
B0UCN0_METS4/77-469REWRELYAALDCAAVAAIHPF.YTA....AIREFEAA.GRTVLG...SAPVGHEGTAAWLDAVGEA-CG...........
B2JYA8_BURP8/19-425TTLDQIRMAGGSAFTIGVGEQ.TRE....GAQTLESIAGTPFEI..FERLTGLEPNDRFLQRLAQL-SG...........
B8G5R1_CHLAD/13-405GSIATTPKLAEAAVNVVMYRE........FGQGLAEALGRPYLF....APFGVFGTTAFLRELGQL-LGI..........
A8ML60_ALKOO/11-412TSMEEIEKAGEAQFNLVLRGE.GLK....AADTLKKNHGMGYHY...GRPYGLEGTTFWLKSLEKA-LG...........
B9LG95_CHLSY/32-416RHVDEIRQAGRAAAVAALHPF.YRE....TIGVLRER.GVAVIS...GAPIGADGSAAWLRAIGAA-LE...........
C0A2T2_9BACT/72-470GRVDDIRRCHGAKLNLVQCSG.SMT...SLAKMLEKDHGIPFKR...VSFFGIEDMSSALYEVAGH-FSAQD........
Q3A2R7_PELCD/48-471TPLEDAADSLNAHATLSMQLH.ATK...ETIKWFKSETEAPVEV..MPSPIGVANTDAFLMKLSEL-FG...........
A1WTQ5_HALHL/61-466GTLAEMENTPKVQLNLLHCYR.SMN...YICEHMEKTHGIPWME...FNFFGPTRIAQSLREIAAQ-FDE..........
VNFD_AZOCH/49-447GTYDDLRCMHQAQLNVVNCAR.SSG...YIANELKKRYGIPRLD...IDSWGFSYMAEGIRKICAF-FG...........
A0LH04_SYNFM/16-440TPIEDIWRMGGAGATFELGRT.LHGDPQSTGKLLKERFEVALHS..MGVPIGLRETDTFFGALEQL-TG...........
A4TZX5_9PROT/19-431ATVENARNLGRAKLTIAIGEH.MRI....SAETLQERTGVPYVL..FDRLTGLEASDRLMVCLSTA-AG...........
NIFK_METBA/23-440TPIGDIEDSANSVGTIALCRM.AGG...SAAKILEGRYKVPAKI..GPTPIGIRNTDRFVMNAAKL-AN...........
CHLB_PROMT/11-419ASPADILRIPNADVNVCLYPE.IAE...STCIWLERNLNIPFTT...TVPLGVGATQDFLKELHKV-LE...........
NIFN_KLEPN/19-431TPLRQIEQMGQSLCSFAIGVS.LHR....ASSLLAPRCRGEVIA..LPHLMTLERCDAFIHQLAKI-SG...........
Q53U98_HELCL/38-434ARFDDIRTAHRAKLNVLVCSK.SLT...NLVKQMEQKYGIPYIE...GSFYGIHDTSATLRAIAKA-FGDA.........
Q0AZV9_SYNWW/62-421STLEEFYQMGCSSYNIVIKPR.GLM....AAEYMKKRLDIPFCY..APAAYSIETINRTYKKLEEF-LG...........
Q72WS7_DESVH/65-519SVYEDMCTAHSANLNLVMCHR.SIN...YLAEMMETKFGIPWMK...VNFIGMRSMSQSLRKIARY-FDDA.........
A6VFE7_METM7/74-471STVKKVASAHRSKLNIVQCQK.SSN...YLAAQMQKKYGIPNLK...VNFFGIDETTKSLRAVAEF-FGDE.........
CHLB_CYAPA/11-425TTVKTLINLPKAWLNILPYRE.LGL...LTSKYLNKEFGLLSLV...ILPMGNINLNRFLKKLLFS-LK...........
A5GAJ7_GEOUR/498-905VTLDKVRLAGRSEATLYLGDS.LAK....AAEILKENFAIPCYG..FTSITGLAETDSLMETLSAI-AG...........
Q0RAV6_FRAAA/76-504TPLKEGALAKFSRASLLLQES.TLR...RTAEYIEKDWKQETIT..LETPLGVKGTDAFLTAVAKV-AD...........
A7NQD8_ROSCS/24-408RSIDDLRRAGRAAVLAPLHPF.YKG....VTRLYREW.GASVAG...GAPVGISGAYAWLKSIGAL-LD...........
Q1NMU1_9DELT/18-469TEIAAIAQMGQAAASLEFGRT.IPAA.LSAADWLEKHHGVPRLR..LGLPLGIRETDRFMARLAEL-ANPEATPPRTPAT
A6UWY1_META3/60-461ATIDRIRIMDSAKLNIVHCMK.SSI...QFANMMEKVYEVPYIV...SNFFGIQNCCDALENIGKI-LDI..........
A3CWW9_METMJ/16-374.PIATTFCLDRYAATRRAAPF.......TVGTNLDLASGVGTSC...GSLLGLDAVRETFERLDAE-ID...........
NIFE_METBA/46-452STPKAISRAAEADLNLVQCSG.SMT...YLPKWMQAEYGIPYLN...ASFFGIEDISLALRRTADY-FGSE.........
Q8KAN1_CHLTE/12-392SKAAEITKLKNSAAIVVMYRE........FGAALAEKLGRPVLY....APFGIEETDRFIGKIGRL-CG...........
NIFE_RHOCA/46-447ARYKQVAMAHRAKVTMLVCSQ.ALI...NVARKMQERYGIPYFE...GSFYGISDTSQSLRRICEL-LVDQGA.......
Q1JXL4_DESAC/43-440GRIDEICTAHRAKLNVIVCAK.SLV...TFTRKMKERYGIPFVS...VSFYGQRDTTNAIMAIAEG-IGDP.........
Q0YUY4_9CHLB/15-436TPASAIANAGKATASIEFTSTLAAS..KSAAGYLEEAFGVPRHQ..LSLPIGIKESDKFFDLLETL-TE...........
Q2RS09_RHORT/44-448SRYRDLAGAHTARVNMMVCSQ.AMI...NLGRGMRERWGIPYFE...GSFYGIGDTSQTLRTIATL-LVERGA.......
Q2WGI2_SELUN/11-432GFVGNLHNPPKARFNPVPHRE.VGL...MTAVYSDEESGMPCVS...TTPAGIVDTAECIRQTQER-VGKRAPAL...PE
A5ZMT5_9FIRM/13-395DTLENLSRTGEVEMNLVVSSV.GLP....AAKILREKFGTPYVI...GTPI.....SGFTEELIQI-MN...........
Q3Z7D0_DEHE1/60-516SDHDSMCRSHTAELNLVMCHR.SIN...YMADMMETKYGIPWIK...VNFIGAEATAKSLRKIARY-FGDE.........
NIFK_METTM/21-446TAVPEIEDSSNSMGTLSLTMY.GDE....ALNTLEKRFRVPGEY...SMPIGVRNTDDFVRRAARI-SE...........
A7IA34_METB6/11-372.PVGTVFCRDRADKVKTASPF.......TIGTNEDFGSGVGTSL...GGTLGIPSLRTTLGKLAGI-FD...........
Q20XD3_RHOPB/20-446TTVADLEATGSAIHTFALNRY.EGG...KAAQLLEKKFKIPSTI..GPTPIGIRNTDALLKKLSQV-TG...........
A1WXG0_HALHL/10-395CHVDQIPRLIDADVNICMYRE........YGRGLCEALGRPYLQ....APVGLHSTTRFLRALGEQ-LG...........
Q3M586_ANAVT/490-896TTLAELRQMGSSVFTLALGES.MRR....AAESLQTQFGIPYEV..FPQLTGLDAVDNFLQGLVDI-SG...........
A1WTP6_HALHL/19-436TPLDALRECGNAAATVVVGAS.LHA....AADRLRARTGVPDYR..FDHLMGLHATDRLVMVLCAI-AG...........
Q9XDC2_HERSE/44-444GRCRENACSPPARASKT.CSK.AMI...NGGAQEWRSVMGFLFE...GSFYGIGDVSESLRQIARL-LVQQGG.......
A4WU62_RHOS5/53-445RDWRELYAALDSGVAAAIHPF.YTA....SVREFQAA.GRAIVG...SAPVGHDGTAAWLAAIGEA-YG...........
Q53U99_HELCL/42-464TTMAELADALNASGFIFTQKF.STS...GTYKFVKNVQKINTEM..VTMPIGIKNTDNFLMALSEM-TG...........
Q8TP84_METAC/341-740ADTLSLRSFKKAEINMLACDDPETR...ALQAYLSDRFGLEFFE..LPFPVGFRESSLWVKALTAR-LL...........
Q56JU1_9BACL/18-428VPLDSMCQMLESSCTIVIGAS.MER....SARRLENSAGIPYQT..FAGLSGLAASDEFMCFLQHI-SR...........
Q2J4G2_FRASC/19-525TGLARLRALGRSRAVLVAGAT.AAA....AGDLLAARTGARILR..HRHLSGLTEMDTLVTELIEL-TG...........
Q8TJ87_METAC/15-494TPLSEIADMPNSKASLGLGIV.STN...LAVKYLEASHGVPGHN..VPIPIGLLNNDLFFTELVRI-LG...........
Q8TRG0_METAC/31-443TSLEELGSAGLASADILLSHD.AGY...EFGLKMQEVHGIPLILSDIPLPVGLKNTARWLRALGKY-FG...........
BCHB_CHLAA/11-419ASIADLRRLPAAWLTIAPYRE.LGL...RAAIYLEEQFGVPALL...DAPIGVQPTLRWIERLREL-LAQAGADV...PM
A3DFR2_CLOTH/52-456STVNGLKYASEAAATVQACST.LGS...YLGAVLEQDFGVPEIP..AAPPYGIAQTDRWFRALGKI-LG...........
NIFK_BRASP/68-492THVEDTANAIHAKATISMQQW.CTE...KTLPFVSE.HGQDVVS..FNYPVGVSATDDLLVALSRI-SG...........
Q8PYX7_METMA/62-515GSFHKLAQAHRAKLSILLCHR.SIN...YTNRMMEEKYGIPWLK...VNYIGTKATEKSLKKMAEF-FDDP.........
A4FXP1_METM5/15-429TTVEELKDTANSFATISLCKH.ANS....AAKFLHDAYGIESVS..PYLPIGLQSTDEFMNELCKL-TN...........
A5USK3_ROSS1/51-447VSVDDLKIMHKAALNIVHCQR.SAT...YIADMMKDKYGTPYIN...VTLWGMKNMAKALRDTAAF-FG...........
A6LR27_CLOB8/53-455STVAELEYISEAAATIHICPS.LST...YLGAALEQEYGVKEIK..APPAYGIEGTDIWMREIGRV-LG...........
A4SD70_PROVI/15-398RALEDYVDAGQAEACAVLHPF.YGK....TVDLFREH.GVKIVG...GNPIGANATAEWIRDIGAA-LD...........
Q7M8U9_WOLSU/69-488TKLDDARDAGASKVTITLQKY.TTP...RTMKSFAKKFKQETLE..LN.PIGLAGTDAFVSAISKL-TG...........
A0YNZ3_LYNSP/44-440ARYQEVCQAHRAKLNVMICSK.ALI...NMARKMEEQYNIPFIE...ESFYGIDDMNRCLRNIADH-FGDA.........
CHLB_EPHAL/11-431GSVEDLQNLPKAWLNLVPYRE.IGL...MTAFFLKKEFGMPYLS...ITPMGVIDNAECIRRIEKS-VNPFASIF...GE
A4XMA4_CALS8/25-448TPYSELEDSANGKVAVSLCPH.AGG...SAAKYLESEFGVKSIL..GPFPVGIANTDKFIENLSQV-YG...........
A6UWY5_META3/46-455AAMDDLFKLTDVKLNVVHCQR.SAE...YIAHMVQDGFNVPFTR...VSFFGITKTSEALYDVAER-LNI..........
Q72WT1_DESVH/16-490TPLDDIRALGRARAVVEMGDPLGSR..PSAGAALHARHGVPLFR..VGVPVGLRETDTFMEALERI-SG...........
A4XMA3_CALS8/36-422CSLSQMEKSVNARLNLLLCKS.SGL...LLAQFMKERFSIPYME...VSFYGIENTIASIKKIAKF-FG...........
Q46243_CLOPA/49-448GSYDDLRGMHLAHLNVLECAR.SAE...YLANELRQRYGTPRLD...IDGFGFKALGESLRKIGIF-FG...........
O27608_METTH/13-425TPISKIEGASNSMATLSLGGC.......KGGRVLEGRYGIKNIG..LEIPAGLENTDRFIGKLTEL-FD...........
A5N026_CLOK5/32-415ASLTDFQSAPDAALNLVVCPF.MQP....LAVKMEREFSVPYIA..LHTLYDVKRIHRTYEGIAKH-FG...........
A4ACR0_9GAMM/10-395VQLDDVPKLADADVNVCMYRE........FGRKLCEALDKPYLQ....APIGLHSTTAFLESLGEL-LG...........
A2SSA2_METLZ/13-379DELETIIKAPNAEKNIVVSAA.AIP....LAEKMREKYGIPFCAMLPGTTNGKERMQAFLQDYTPQ-LP...........
Q3Z7D3_DEHE1/21-437TPVSVLKGMGGAKASIELCRF..SDPQLSAASFLEKCHGLPAYR..IGLPVGVRAADEFMDLLSGY-AG...........
O27526_METTH/12-396CSIRDMTMIPAGHLNCSFCDV.SGI...APCRFLEENFGTPFIH..HPIPIGFSNSLRFYREVLGY-LN...........
A3PLS6_RHOS1/507-913TRLADIAAMGGSIATLALGEA.MRP....AAEKLAA.LGVPAHV..FPSVTGLKAVDAFVATLMRL-SG...........
A6UNA3_METVS/21-449TPLEEIKDSANSLGTISLCSY.ANT....GAQSLERKYKIPSKV..GGTPIGVQNTDEFVRTVKKF-TG...........
Q53U97_HELCL/19-431ITLEDIRRIPGCIASFSFGPS.MAV....VGESLQKRHSVPHIA..VPSLTGLEAVDTFYLKLCQL-SG...........
A4XMA5_CALS8/46-442ASYDNLCKMHHAKLNIVHCQR.SAT...YIARLMKEKYGTPFIR...VTLFGITETINSLREIGEF-FG...........
Q6NA14_RHOPA/19-430TTLDDIGRMSQSAATLVIGRS.LDR....AADRLRERTGVPDHR..FDSLMGLDASDAFSGALGSI-AN...........
Q97ME2_CLOAB/52-505GSYERVKNADTADLNLVQCHR.SIN...YIAEMMYTKYGIPWIK...TNFIGVTSTIQTLRDMAKV-FDDP.........
Q07LR0_RHOP5/48-419ANQAAFGRAAQAVASVAVFDDEADV....LGIDLERLHAVPFLH..LSPPIGTAATDRFVSELAAF-AG...........
A5USK2_ROSS1/20-440TTIEELRSSSKSLATIALQRH.VGG...EAARIYERRYNVPAHV..LTMPIGLKNTDAFVNTLIEI-TD...........
Q24QP1_DESHY/324-722TTFDSLETFCTAQLNLLAYKDYTGK...LLEDFFTREYGSVFLD..RAFPVGFAETEDWLRDVAAF-FG...........
Q2RWB8_RHORT/53-460LTVAEIETLSEAGATAHMCPT.LGT...WLGAGLERRFGVPEVK..APPPYGLAGTDHWLRALAAL-TG...........
Q540N9_HELMO/11-414ASIKTLQELTKAHLNICLYHE.YGQ...SACELLKEKFGIDYIV...ATPIGIRLTSQFVKAIGER-AG...........
Q7BKZ2_CLOBE/23-438TKIQDIIELGDCEKTLALGSF.ASE...AGAATLEKSFKIPYST..LKMPIGIGSTDELIMELSKF-SK...........
NIFE_METTH/64-456STVAEISAAHKAQLNLVQCSK.SSG...YIAEEMEKRHGTPHIN...VNFFGMRETMDSLISISEF-FG...........
A5ENW8_BRASB/19-430IGLEEIATMGSASWTIAIGAQ.MKR....AAEAMQARTGVPYRL..FERLCGLLPNDEFMTFLSEI-SG...........
Q2RL08_MOOTA/46-462ERIENLVKMPDVKLNVVHCQR.SAE...YIAHIEKDGYNIPFIR...VSLYGIEQTCKALRETAAF-FG...........
Q46A91_METBF/20-445TTIEEIADSANAIGSIALSRY.EGA...NAATYLKNKFGVPSVV..TPTPIGINNTDIFLKNISKL-TG...........
Q6N6J8_RHOPA/13-414GGLSSLRATAQAELSVSLSPW.GGA....AVRALDDRFGIPWIE.SAGLPVGAAATGALLERIVAA-AGE..........
A5N1T7_CLOK5/17-439TKIEDIKKMAGAAATIEMGLT.IQDE.DSPGVYLRDKFKVPLYK..CGIPVGIRNTNKFISLVSKI-TG...........
A6LUZ4_CLOB8/44-438SSYDKLIKASSASFNVVQCAG.SMT...YLAKRMEAEMDIPFVK...ISFVGLEDTKNSLLRIASL-FGDE.........
BCHB_CHLTE/11-426AGIDDLKKLPAAWVNIAPFRE.IGC...QAAGYLKEKFGMPSIT...EAPLGVNATLRWLRAIIAE-VNKIGAEKGMAPM
NIFK_CYAA5/69-490TSLEDAADSINAEATVTLQTY.TTP...KTREYIEKKWGQKTYT..YR.PWGVKGTDEFLMGLSEL-TG...........
A7I7F2_METB6/56-518ASYEDIKNLHLADLNLVQCHR.SIN...YIAEMMETKYGTPWLK...VNFVGVEATNESLRQMAKC-FSDP.........
NIFE_AZOVI/37-443ARYREVQTMHRAEVNMMVCSK.AML...NVARKLQETYGTPWFE...GSFYGITDTSQALRDFARL-LDDP.........
A4SCK5_PROVI/12-392SRLSDISDLKNSEVIILMYHE........FGSRLGKLLNRPVLY....GPFGIDETSTFIMELARL-LG...........
Q2FLM7_METHJ/320-717TSVNEVQSMSEQSLILPVSSDKITL...EISKIISEKTGSEIFN..HAFPYTFNETVRWIQDLADR-FR...........
Q7BKZ0_CLOBE/18-441TSIEEIKFMGGAKATIELTTF.IKEE.YSVGSYLEENFGVKNFR..INVPRGLRDTDNFLKVLAKI-SG...........
O31276_AZOVI/19-430TTRQEIAAMGRSALTLVIGDS.LGR....AADLLQARTGVPDLR..LPGLTALADCDAFVQALADV-SG...........
A0L6W2_MAGSM/19-431ATVEDFQTIGDACATLVVGDI.MNI....CADLIQERCGLADYR..FSSLMGIEAWDRLLMVLMNL-SG...........
A6TTX7_ALKMQ/17-436TKLSEIEKMAGASATIEMGML.VADH.LSPGKYLEDQFGIPLYR..CPLPIGLENTDKFVSILRKI-SG...........
A1Z1V8_RHILT/41-442ARYAEVASAHRSRAAMIVCST.ALI...NLARKMEERWDIPFFE...GSFYGISSTSESLRRIAQL-LVKKGA.......
NIFN_RHILO/19-429TSVEEIRELGTAAQCIVIGEH.MRH....PAKTLHGLTGVPYAV..FQSLTGLKAVDRFVSLLSAV-SG...........
A7I7F4_METB6/48-446STVAALKRAPSACLNLVQCTG.SMH...WVAQNLERTFGTPYMD...VNFFGPENTAESLRRIAAF-YDDT.........
Q8KC88_CHLTE/24-443ITINELKSAGDSKCSLAVGCI.SAE...PAAIALEKKCKVPFET..VDMPIGLSATDRFIMALSKA-GS...........
A1VI39_DESVV/23-444TTQADFARSGDSMATLALGAW.ASE...AGAKALEKKCGVPYRL..LDTPIGVLATDRFLTALQET-TG...........
NIFN_AZOVI/19-432LSVAELATAGQSVATLVVGQS.LAG....AADALAERTGVPDRR..FGMLYGLDAVDAWLMALAEI-SG...........
Q93T90_AZOBR/22-429VTVEQIASMGASELTLVVGEH.MRV....AAAALELKTDVRSVF..FDRLTGLEASDRLVRTLSEL-SG...........
Q6D2Z0_ERWCT/69-501TTQQEMRDAPNAIDTLLLQPW.HLI...KTKKMVQDVWNQPATE..VSVPIGLNATDKLLMTISAL-TD...........
A6UWY4_META3/30-461TTIEEFVDAGNGKATFALCQS.AGG...AGALFLKKKFKIPDFY...GQPIGVKNTDEFLINVAQL-TG...........
A7FRU8_CLOB1/32-416SDVEDFIVSPDAALNIVLSPF.MNP....LAEMMWEKFKVPFIS..LHEIYDVFEVDSLYEDVEKS-LK...........
CHLB_NEPOL/11-429GSIPDLHQLAKAWFNIIPYRE.AGL...MTAKYLEESFHIPYID...RTPIGLIETRKFIGEIEAI-LQTRG........
A5N1T9_CLOK5/23-438TKIEEIKDTGNSKRTFAFGSV.SSQ...DAAIELEKKCKVPFDT..LPIPIGIDATDEFLMKLVKL-AG...........
A4FXN8_METM5/48-457ACHDELCWMHKAKLSLVRCQR.SAT...YVAKLIEEKYGVPYIK...VDFFGPEYCAENLRTVGKF-FG...........
Q3APV8_CHLCH/12-392SAAADVADLKNSDVVVVLYRE........FGYTLAEQLGRPVLQ....APFGLAETEHFIKELGRL-LH...........
A7I7F3_METB6/23-439TTIAEIRDSGNSEVTLALGAF.ASN...AAADLLQEKCGVTGIP..LKLPIGLKATDDFIMAVKDW-FG...........

PF01497

Q4KAK8_PSEF5/33-281AAIQRFDQYTAQTAARITPP.-------....PGPVSVVGYNIA....GSYSIGRLNSPQARLLGA.LG-----------
B3EC07_CHLL2/105-346ALFRERERAYLDVQARAAAV.-------...KRRPSLIAGYSRK....GAWSTMGSSRWFATMLDH.AG-----------
A9KLK9_CLOPH/127-364TYGTEVLDTVEHIVEDTSNV.-------...KNPPKVLFLLASL....QGIKVKGTNHFVGDMLNE.MK-----------
B9LI46_CHLSY/56-295REVDALRAEIQRVAIARGTA.-------...TQRVSLVTVYPGM....NVALWFDGPSPIPLLVRA.LG-----------
A8LBT9_FRASN/61-297EQKTEYEEKLAEFQNKYPEII-------KTTKFGEVNRGSWQDA....GMFTLNGSQCSEIARADIPLD-----------
A6BYB2_YERPE/44-280QHLADFDHFMLAARARLSGD.-------...TQTPLLMFSLLDP....RHALIIGNGSLFQDVLST.LN-----------
Q9HMG8_HALSA/70-339AFQSFHDSALDRLETALPSE.-------...GPRGALVWGGSNEPTSFSPYLLSGAGTNKKPFHD..LN-----------
Q03SI0_LACBA/39-270KQNRLINQAKQRVKQRAQRQ.-------...KAPRVLVLMGLPG....ASYMIATNRSYVGDLVRL.AG-----------
Q8TKF6_METAC/99-361DLENFIQSKVDMVKSVTDQL.-------...DDSEIPTVYFAPR....GAKKGFYDSVEGRDFTRTEAV-----------
Q932C9_STAAM/51-279KWIEEWEDKTRKDKKEIQSK.-------..IGQATASVFEPDEK....QIYIYNSTWGRGLDIVHD.AF-----------
Q129U2_POLSJ/29-259ELMQGMQRRLLEIEQAAATL.-------...KRRPRVYFEEWYD.......PQISGIAWVSEVIGI.AG-----------
Q977T6_9ARCH/6-268EIVNSLNTRINKIKKVPISN.-------...RPKVLGIE.........WIKPFFAAGHWVPEMIEN.SG-----------
Q5E5H9_VIBF1/28-260AIKDQVNKKVALLNSSIPSK.-------..AKQKKVIYLLLHEG....RAPYVAGSDTTMDELIHL.AG-----------
A6BFH3_9FIRM/138-386TFFEKQTKVIENLKDFKNTG.-------.....KTVAYFFVNAD....GTVVVRSSKDYIPKMIDI.AG-----------
Q73TK8_MYCPA/66-308SLVAGVDQKFTDIGKKNPQW.-------...TGKKALLMHGALW....QGTVVATMAGWRTDFLNQ.MG-----------
A6UGV8_SINMW/54-318AVVAGLKSREEAARAKVASVE-------..GKLSAVFWFSSAAD....ADPYVAGSNGAPGYIMAA.LG-----------
A8AWA6_STRGC/24-267QYANQLQKRIDTVKKANKAS.-------..QGEKKKALIMCAYN....DETFGAYKSALQESLLNQ.LG-----------
Q5WC89_BACSK/255-486RFLSHYEETAVACKQSIEKE.-------..NTASPVILRIAGEG.......IYLYTNPGISSLFHD.VG-----------
Q4JSY9_CORJK/57-307KMVQDFNDAKDRAKKAYDKLD-------..GDKKVMAVNVSGGE....IGYVAPHIGRVWGPVFDW.LG-----------
Q9EZ57_CORUL/91-327KLAERSINEINSARETIKNIA-------PKDPMKMAFLYARGNG....GVFFIMGDGTGAKDLDEG.LS-----------
A4EIG7_9RHOB/58-301LLKRRYQIHIDAIRDEINTG.-------....AMTISTIHAYEG....QLFAYNPYGTIGKVLIDAGFD-----------
Q6L1D8_PICTO/51-271IIVKWMNSAIDSFSNISDLE.-------......KTCIFYYLDS....DPVYTAGNNTFMNQIFNI.ID-----------
A3I5B7_9BACI/81-317KVIEKMMQAITTGRQDLKTI.-------...EGETVALIVSWDG....KTFNVLGEDNPVYTLAFDKER-----------
Q8TM94_METAC/62-323EYIEFYSGIYDPIVAKTSQI.-------..AQEDSLNVFYKAFSDTPEQIKTYGKEMPGGNELFNA.AG-----------
Q9HKZ6_THEAC/7-228DLYHKLLRSIPEATNDVMTG.-------..........YIELDL....GGPVSFGSYSYITDALSL.MR-----------
Q2G941_NOVAD/48-274ALVARIDAALAAAAPPAGAS.-------....PVPTVVWQ........SGGMVPGDGTLIADLLRR.TG-----------
Q06Q20_PASHA/55-315KIAKEYEEGIADIQSCIDNAK-------.VSKPKIYAEFGNKGP....KEHSFTFGKNMWGAIAET.VR-----------
A4WEC6_ENT38/44-298ALIDATVKGRKRVSDRLKDI.-------....PEQKRIRAYMAN....PELTTYGSGKYTGLMMAH.AG-----------
Q7MWG9_PORGI/105-345EVFEQIESEYAEARKLVAEK.-------...TDTIAIMYGQDYN....GTWYLPGEYSYSTAMFRD.AR-----------
A3YPU4_CAMJU/72-305EKISDIKNEIEKAKSIVDED.-------....KKALIILTNSNK......ISAFGPQSRFGIIHDV.LG-----------
Q8FRS2_COREF/66-320QLVAKLDGEVAAAMDAHPQL.-------....RETTPVFAFFDESDLSQIGVYTALDPRMGFLLDAGMR-----------
A3UEI5_9RHOB/3-265ELRASLQARIDAVAARSQALP-------.GPRPRTVLLDWTSPP.........FIGGHWMHELLTL.AG-----------
A4FH22_SACEN/55-310EAFNAAAQRLRGLGERLRSQ.-------...NRSILAVGGTPQE....YFVVVPARNPDLGYYVRE.LG-----------

PF00148

B4SC77_PELPB/21-398.....IT..V...DLRD....RE.KAAWEKIRS.QT....ELLK...G.KK.........IFLTAD..T.MMELPLARFL
A9W9E4_METEP/11-414.....VD..PAPVLADA....PSRLPWYSRSVD..S....TYLT...G.KR.........VFVFGD..A.THALALARVA
B0UCN0_METS4/77-469.........VARLTVEA....AK.NRILPAIRGALA....ANPI...R.GR.........ITLSGY..E.GSELIVARLL
B2JYA8_BURP8/19-425.....QA..V.PAKYRR....QR.SQLVDAMLD.GH....FYTG...G.IK.........VAVGAE..P.DLLLAIGSLL
B8G5R1_CHLAD/13-405....EPE..RVEAFINH....EK.RTTLQPVWDLWRGPQSDWFA...T.VD.........CAIVAA..R.SYADGLRSFL
A8ML60_ALKOO/11-412.....IP..ADEQYIAK....KT.AEIRKHLMN.YR....FMTRGLNK.KN.........VLLVGD..Y.DVVVGLAALV
B9LG95_CHLSY/32-416....LDE..DVVERVAA....EE.EAAARGFLA..S....KPLQ...G.AT.........ILVSGY..E.GNEMLYARLL
C0A2T2_9BACT/72-470..PGLTG..RTQAVVRE....EI.EKIMPELRR.HR....EKLT...G.KK.........AAIYVG..GAFKAFSLVRAL
Q3A2R7_PELCD/48-471.....KE..V.PASLKA....ER.GRLVDAMTD.AH....QYLH...N.KK.........FAIWGD..P.DFLAGMISFL
A1WTQ5_HALHL/61-466...TIQA..NAEQVIAK....YQ.PTMEAVIAK.YR....PRLE...G.KK.........VMLYVG..G.LRSRHVIGAY
VNFD_AZOCH/49-447....IEE..KGERLIAE....EY.AKWKPKLDW.YK....ERLQ...G.KK.........MAIWTG..G.PRLWHWTKSV
A0LH04_SYNFM/16-440.....ME..R.SPRFAM....ER.GRLVDSYVD.AH....KYLF...G.KR.........AVVYGE..E.DLAVGLTAFL
A4TZX5_9PROT/19-431.....KP..V.PAKIRR....AR.SQLIDAMLD.GH....FYFG...G.RK.........FAIAGE..P.DFLWSWAKLI
NIFK_METBA/23-440.....VA..I.PPELED....ER.GRLVDMMTD.AH....PHYH...G.KK.........VAIYGD..P.DILTGLTSLV
CHLB_PROMT/11-419........MEIPQSVNES..NNSKLTWYSNSVD..S....NYLT...G.KR.........VFIFGD..G.THALAAARIA
NIFN_KLEPN/19-431.....RA..V.PEWLER....QR.GQLQDAMID.CH....MWLQ...G.QR.........MAIAAE..G.DLLAAWCDFA
Q53U98_HELCL/38-434...GLIE..RTEAHILQ....KE.AETRAVIEP.LK....AQLS...G.KR.........AVLFTG..G.VKTWSMVTTL
Q0AZV9_SYNWW/62-421............MKLDT....DRYSEKARQVIDRHY....ATLG.....PL.........TVVVGEIIENDSTYELARAL
Q72WS7_DESVH/65-519...ALTA..RIESVIAE....EE.ARAETALAA.YM....PGLE...G.KT.........AMLFVG..G.SRAHHYMHLM
A6VFE7_METM7/74-471...EMIK..KTEELIKS....EV.KNLRDEISE.YK....KDLA...G.ST.........VAIYSG..A.HKSWALVSAF
CHLB_CYAPA/11-425.....LENNTITKVINIKLLKLLNLNWIKKEAI..K....SKLK...R.KK.........AIIFGS..S.NHVATLTKLL
A5GAJ7_GEOUR/498-905.....RP..V.PEKLRR....WR.SRLMDAMVD.CH....YQFG...L.KR.........ISLALE..A.DLLKTMTLFL
Q0RAV6_FRAAA/76-504.....VE..V.PAELTA....ER.GRLVDAITD.SH....AYVH...G.KR.........VAIAGD..P.DLVVALTRFV
A7NQD8_ROSCS/24-408.........LDPALVDR....VAEEEREKAQAVLAA....KSLK...G.AR.........VLVTGY..E.GTELAYARLL
Q1NMU1_9DELT/18-469AEGNHQPPPLLPPRQAA....AR.GRLLDAMVD.GH....KYLA...G.QK.........AVVYGE..E.DLVVGLVALL
A6UWY1_META3/60-461....DKK..VVDNTIDY....YL.NKNEKELEY.YK....KELK...G.KK.........VFICHG..A.QRALNYMGPT
A3CWW9_METMJ/16-374.........GADPRPVM....DEIAWADARIRKACE....KYLRRFDP.PR.........AVIAGG..H.AYAAFAADLL
NIFE_METBA/46-452...EIKK..RAEQILET....EI.NRIMPEISR.VR....EKVK...G.KK.........AAIYMG..GPAKALTLIKGF
Q8KAN1_CHLTE/12-392.....TP..EQATRFIA....EEKRTTLSPVWDLWR....GPQSEWFPTIR.........FGVVAS..K.SYADGIKHVL
NIFE_RHOCA/46-447.PKDLLN..RCEVLVAR....EE.AKAWAALKP.FR....PRVA...G.RR.........VLLYTG..G.HKSWSVASAL
Q1JXL4_DESAC/43-440...ELIE..RTRKVLAR....EE.QRLDEQLTP.YR....ELFK...G.KK.........AVLNTG..G.NKSWSIASAL
Q0YUY4_9CHLB/15-436.....QP..R.PEKYED....ER.RRLVDAYAD.GH....KYVF...E.KK.........VILYGE..E.DLVVAMTAFL
Q2RS09_RHORT/44-448.TADLIA..RTEALIAR....EE.AKAWAAMAA.YR....PRLA...G.KR.........VLLYTG..G.VKSWSVVHAL
Q2WGI2_SELUN/11-432EEVDHEP..YIDRQTRS....VSQAARSSRSTD..R....QNST...G.KR.........AVIPGD..A.THATAMTKIP
A5ZMT5_9FIRM/13-395............KKIPY....ETEGRNEEKNNDSTA....YLANRLSGVPE.........ITLIGE..A.VTMGSLAAFI
Q3Z7D0_DEHE1/60-516...KLIE..QTERVIEE....EM.PAVSEARQL.YQ....ERCR...G.KK.........VMLFVG..G.SRAHHYQELF
NIFK_METTM/21-446.....KD..V.SDELLD....ER.GILIDSMADLSS....RYLF...G.RT.........AAVYGD..P.DMVAGISRFL
A7IA34_METB6/11-372.........HADTDPVL....KELDLQEERLIHAGD....KFLRRYEP.PR.........VAIFAG..A.AYALFAADTL
Q20XD3_RHOPB/20-446.....KP..I.PASLVK....ER.GIALDAISDVAH....MFLA...D.KK.........VAIYGN..A.DLVIGLAEFC
A1WXG0_HALHL/10-395.........LDPEPFIE....KEKHTTLKPLWDLWR....SVTQDFYATAS.........FGIVAA..Q.THAQGIQKFL
Q3M586_ANAVT/490-896.....NA..V.PEKYRH....QR.RQLQDAMLD.TH....FYFG...R.KR.........VSLALE..P.DLLWSIASFL
A1WTP6_HALHL/19-436.....RE..VPPPRVQR....QR.RQLQDALLD.TH....SVLG...T.TP.........VGVAAE..A.DLLAGLTTLL
Q9XDC2_HERSE/44-444.ASELMD..RTEALIAV....EE.ARAWSRLAH.YK....KRLA...G.KRVLEKDRRCEVLVSGG..GLAGGRHRKGCC
A4WU62_RHOS5/53-445.........IAPERVAA....AQNAFLPAIKGALAG....APIK.....GR.........ITLSGY..E.GSELIVARLL
Q53U99_HELCL/42-464.....KP..I.PAELEK....ER.GRAVDSATD.AH....QYIH...G.KR.........FAMFGD..P.DLLLGLTGFL
Q8TP84_METAC/341-740.....PG..EDPSPLLE....EQ.EELYRAGVVKYA....PQLS...G.KR.........VLVVSY..TEDIGWVLDTIR
Q56JU1_9BACL/18-428.....ET..T.PVRFRW....QR.ENLLDSMLD.AH....FYYM...G.AS.........AVVALE..P.DHLLSTADWL
Q2J4G2_FRASC/19-525.....AS..A.PARVRQ....AR.ARLADGLLD.TH....FVLG...G.AR.........VALAME..P.ETLVAVGSLL
Q8TJ87_METAC/15-494.....CP..I.PEKYQK....ER.GRLLDSMVD.VH....KYLY...G.VK.........AAVYGD..P.DTVFSLTTFM
Q8TRG0_METAC/31-443.....IE..ENVETIIK....EGEDLTIDVLRRRGL....MMIQRYRN.CR.........VAVSAD..A.TLGIGLTRML
BCHB_CHLAA/11-419PPLTA....FSLDGMSA....PSAVPWFARTAD..M....DSFS...G.KP.........AFVFGD..A.THVVGVTRFL
A3DFR2_CLOTH/52-456.....KE..EIAEKIIA....EKKKEYLPKIEA.LR....EKLA...G.KT.........AYVTAG..A.AHGHALLDVL
NIFK_BRASP/68-492.....KE..I.PEQLAR....ER.GRLVDAIAD.SS....AHIH...G.KK.........FAIYGD..P.DLCYGLAAFL
Q8PYX7_METMA/62-515...EITR..KTEEIIAE....ET.AKYRDEIEK.YR....KKLQ...G.KT.........AFIYAG..G.SRSHHYTNLF
A4FXP1_METM5/15-429.....KE..I.PEQITR....ER.GKLIDAMID.AH....QHNF...G.RK.........VVIYGD..P.DVVVGFTRFV
A5USK3_ROSS1/51-447....LEA..RAEEVIAR....EV.ARIQPYIDA.YR....QRLQ...G.KR.........VFIYQG..G.PRVWHWIELL
A6LR27_CLOB8/53-455.....KE..EEIEEIIK....EEHERVLPKLEE.YR....EKLK...G.KI.........AYVTAG..A.AHGHAIIAML
A4SD70_PROVI/15-398.........LDSAAVEA....VALEESEKVREVLGR...FGGLS.....GR.........VIVAGY..E.GNELPVVRLL
Q7M8U9_WOLSU/69-488.....KS..V.PQKLKD....ER.GRLVDAMQD.SY....PYMH...G.KS.........FAIWGD..P.DFLIGAVSFL
A0YNZ3_LYNSP/44-440...ELKQ..RVEKLIAS....EN.AALDQKLAP.YR....ARLG...G.KR.........VVLYTG..G.VKSWSIISAA
CHLB_EPHAL/11-431KGVNYES..YIDRQTRF....ISQAVWFSRSID..C....QNFT...G.KQ.........TVVFGD..A.THAASITKIL
A4XMA4_CALS8/25-448.....TE..I.PYELKV....ER.GLLLDAMAD.TC....QYTM...M.KK.........AAVFGD..P.DIVIGVTRFL
A6UWY5_META3/46-455....PKE..TVDEVIEK....EL.KPINEELEF.YK....SKLN...G.KK.........CMVYVG..G.PRTWHWIMAM
Q72WT1_DESVH/16-490.....TA..M.PPRMML....ER.GRLVDALVD.GH....KYVA...G.KR.........AVVYGD..A.DMVTGLCAML
A4XMA3_CALS8/36-422.....KE..KAAEIVAE....EEFSKIKNKIQF.FK....SQLQ...G.KK.........AIVLLG..A.SRIGFMTNAF
Q46243_CLOPA/49-448....IEE..RAQQIIDE....EI.ARWKPELDW.YK....ERLK...V.KK.........VCLWPG..G.SKLWHWAHAI
O27608_METTH/13-425.....AS..I.SQSLMR....DR.GRLIDAMID.AH....QYTY...G.RN.........VAIFTD..P.GYAVAITSMV
A5N026_CLOK5/32-415.........FSWDNAFE....EERQEALTLQNQ.AK....ERLD...GLRY.........VFCLRI....DIPIPMAIYL
A4ACR0_9GAMM/10-395.........LDPQPFIE....QEKHTTIKPMWDLWR....SVTQDFFGTAN.........FGVAAS..E.TYSRGLRNFL
A2SSA2_METLZ/13-379...........ASCVCS................................GK.........ALVIGE..Q.ISANTIRDFL
Q3Z7D3_DEHE1/21-437.....RP..L.PEGYTR....ER.GRLLDAYVD.AH....KYVF...G.RK.........ALVYGD..A.DFVMGIGRFL
O27526_METTH/12-396...........LDYPIN....EEFSAFIEERDR.IR....AELE...G.LR.........VAVVSG..P.TRAVALTEFI
A3PLS6_RHOS1/507-913.....AE..V.PAAVRR....DR.ARLADAMLD.AH....FHIG...G.LK.........VAMGLD..P.DLGLALGSTL
A6UNA3_METVS/21-449.....NE..V.SDDLLD....ER.GLLIDAMADLSS....RYLF...G.RK.........VAIYGD..P.ALTAGLARFV
Q53U97_HELCL/19-431.....RP..I.PERLLR....QR.SRLLDTLAD.YH....DQLG...Q.KR.........IAIALE..S.DLLISLANCL
A4XMA5_CALS8/46-442....IQK..KVEEVIEE....EL.ESIMPRLQF.YR....EKLR...G.KR.........AMIYVG..A.PRVWHWIPLM
Q6NA14_RHOPA/19-430.....CA..M.PAKIAR....KR.AQFLDAMVD.TQ....FQIG...G.AR.........VAIAAD..A.GLCAALVSFF
Q97ME2_CLOAB/52-505...YIYK..KTEEVISE....EL.SNIEGEMAY.FK....ERLE...G.KT.........ACLFVG..G.SRAHHYQMLL
Q07LR0_RHOP5/48-419..............LPE....PASSRTGHEVAS.........LA...G.RQ.........VVVALP..P.SQAFAAADLV
A5USK2_ROSS1/20-440.....HT..I.PESLEV....ER.ARLLDALVD.TH....MYTT...G.LR.........VALYGD..P.DLLEGLVGLI
Q24QP1_DESHY/324-722.....RP..AAAEGIIE....EH.KELYAREVEALK....ADLA...G.KR.........LMIITY..NHELDWILKTAL
Q2RWB8_RHORT/53-460.....RS..DRVEAYIA....AERAAIAPDLAD.LR....AQLA...G.RT.........AFVAAG..S.AQGHSFMTVL
Q540N9_HELMO/11-414........LPVESYIRQNLAPSGTIARFTKSVDSLS....ALFG.....KR.........AVVFGD..Y.SHAVGMTHLL
Q7BKZ2_CLOBE/23-438.....QQ..V.PYELEE....ER.GQLVDIMID.SH....PYYD...G.KK.........VALYGD..P.DVLIALSKFL
NIFE_METTH/64-456.....LE..LAEKWVLG....MV.EETKRKVAR.YR....NTLE...G.KK.........VAIYVG..G.NKAWSLIRAF
A5ENW8_BRASB/19-430.....RP..V.PAKYRR....QR.GQLADAMLD.AH....FHIG...G.RK.........LAIGAE..P.DLLFDVASML
Q2RL08_MOOTA/46-462....LEE..RAEAVIAE....EM.ARVEKSLAF.YR....EKLQ...G.KR.........VAIYVG..G.PRVWHWIKLM
Q46A91_METBF/20-445.....KP..I.PESLVI....ER.GKAIDAIVDLAH....MFFA...N.KK.........VAIFGN..P.DLVFGLAQFC
Q6N6J8_RHOPA/13-414...VD....DAAARIFI....DRERQREAYFIDRLL....ETLYRQGGARG.........FAVALP..S.LHVGGIVRFL
A5N1T7_CLOK5/17-439.....KA..I.PEEYII....QK.GRYLDAMID.NH....KYTG...E.AR.........VVLYGE..P.ELLLSTARLC
A6LUZ4_CLOB8/44-438...EMLA..KAKAFVKE....EE.EKILPILEK.YK....ENLR...G.KK.........AAIYVG..GGFKAISLIKQF
BCHB_CHLTE/11-426AMPELRD..FSLDGQSA....PSSVPWFARTAD..M....ESFS...N.KR.........AFVFGD..A.TQVVGVTKFL
NIFK_CYAA5/69-490.....KP..I.PKEFEI....AR.GRAVDAMTD.TQ....AWVH...G.KR.........AAVYGD..P.DLVMGLLQFM
A7I7F2_METB6/56-518...ELEK..QTEEVIAR....ET.ARIEPALEQ.FR....KICR...G.KK.........AFAFVG..G.SRSHHYQHLL
NIFE_AZOVI/37-443...DLTA..RTEALIAR....EE.AKVRAALEP.WR....ARLE...G.KR.........VLLYTG..G.VKSWSVVSPL
A4SCK5_PROVI/12-392.....CE..QTGEAFIA....KEKQTVLAPIWDLWR....GPQAEWFPTVR.........FGVVAA..A.SYANGLKKFL
Q2FLM7_METHJ/320-717.....IQ..DKGSALIA.....RNEKIYRKEIALIM....LMTA...G.KR.........VIIASS..GPDISWVLEAVR
Q7BKZ0_CLOBE/18-441.....NP..I.PEKYKK....QR.GRYLDAMID.SH....KYNA...E.AR.........IAIFGE..P.DFVYSTARLA
O31276_AZOVI/19-430.....RP..V.PARILR....QR.EQLLDAMVD.SY....VPVG...G.TR.........IAIGAD..A.DQLVAIGRFL
A0L6W2_MAGSM/19-431.....QP..V.PERFGH....QR.RQLQDAMLD.TH....FFLN...Q.RK.........LALAGD..P.DFLSNWLPLF
A6TTX7_ALKMQ/17-436.....KE..M.PQSLME....DR.GRMLDGMID.SH....KYNA...E.GR.........AAIFGE..P.DTVYAASKLC
A1Z1V8_RHILT/41-442.GFALLH..HVEALLAE....EE.ERAWKKLEV.YR....RRLE...G.KR.........VHLNTG..G.VKSWSIVHAL
NIFN_RHILO/19-429.....AA..V.PDRVRR....HR.AQLEDALLD.GH....FHFG...G.KK.........IAIAAE..P.DQLYQLATFF
A7I7F4_METB6/48-446...AMME..RAEALIAR....EM.ARIRPAIEK.YR....ARLR...G.KR.........AAIYVG..GAYKAIAIIRQL
Q8KC88_CHLTE/24-443.....VK..V.PDEITA....ER.GRLVDVMVD.ME....QYFY...G.KK.........VALFGD..P.DQLIPLTEFL
A1VI39_DESVV/23-444.....MT..V.PRSLKD....ER.GKLVDMMTD.YQ....SLLF...G.KR.........VAAWGD..P.DIVIPLVEFL
NIFN_AZOVI/19-432.....NP..V.PDRYKR....QR.AQLQDAMLD.TH....FMLS...S.AR.........TAIAAD..P.DLLLGFDALL
Q93T90_AZOBR/22-429.....RP..V.PAKLRR....QR.ETLVDGMLD.GH....FFYS...R.KR.........IAVALE..P.DLLYAVTSFL
Q6D2Z0_ERWCT/69-501.....VP..I.GEALTL....ER.GRLVDMMLD.SH....TWLH...G.KR.........FGLYGD..P.DFVMGLTQFL
A6UWY4_META3/30-461.....KG..I.PDELLD....ER.GKLIDAIADTVH.....YTM...D.KK.........VGIFGD..P.DHVIAVARFC
A7FRU8_CLOB1/32-416.........IRFNNEFD....ESREKAIALQKQ.AK....DVFK...GKSY.........ILTHIG..A.MMPLPLVLYL
CHLB_NEPOL/11-429..VDRHE..YYEKFIIHHETIVSQAAWFARSID..C....QNLL...G.KR.........VIVFGD..C.THAATITKLL
A5N1T9_CLOK5/23-438.....GE..V.PYEIEE....ER.GQLVDLMLD.TH....QYFH...G.KK.........VAIIGD..P.DTVIPFTQFA
A4FXN8_METM5/48-457....KEI..EAEAVIKK....EM.EKIQPELDF.YK....SKLQ...G.KK.........VWISAG..G.PKSWHLSKPL
Q3APV8_CHLCH/12-392.....RE..AEAADFLK....REKESTLRPLWDLWR....GPQAEWFPTIR.........FGVTAT..A.TYAQGLATFL
A7I7F3_METB6/23-439.....AD..I.PKEIAI....ER.GQVIDTLID.TH....FHYQ...G.KT.........VAIFGD..P.DHVIAMTEFV

PF01497

Q4KAK8_PSEF5/33-281---------FKVAELPE-----------------------ALAG----------------KVTRAS--D-FQFISRENLP
B3EC07_CHLL2/105-346---------ADYL.FKG-----------------------KP..----------------....FE--R-GHLIGQEAGL
A9KLK9_CLOPH/127-364---------AINI.ASE-----------------------S...----------------....SI--L-SDKLNPEIFS
B9LI46_CHLSY/56-295---------LQIR.PDP-----------------------TTTT----------------DLNIRN--G-RAFISLEQLS
A8LBT9_FRASN/61-297---------IPDL....-----------------------....----------------....GE--G-GEERSFEQIG
A6BYB2_YERPE/44-280---------IENAWQGE-----------------------TN..----------------....FW--G-SAVVGIERLA
Q9HMG8_HALSA/70-339---------VRDA.IAD-----------------------SGID----------------.ALSQS--Q-RSEIDAETLL
Q03SI0_LACBA/39-270---------GQNV.FTS-----------------------Q...----------------....HQ--E-YQQPNDEAIQ
Q8TKF6_METAC/99-361---------YEPLTIAG-----------------------GNNL----------------AKDCTG--E-NINVAPEQIV
Q932C9_STAAM/51-279---------GMPM.TKQ-----------------------YKDK----------------LQEDKK--G-YASISKENIS
Q129U2_POLSJ/29-259---------GDDC.FPE-----------------------LAAK----------------..AMGK--D-RIIADGSEIV
Q977T6_9ARCH/6-268---------GINM.ITK-----------------------N...----------------....GE--H-SRKMDITEIE
Q5E5H9_VIBF1/28-260---------ANNP.ASS-----------------------S...----------------....IS--S-FKPISMEAMI
A6BFH3_9FIRM/138-386---------GKYI.FSD-----------------------LKNT----------------..ESKS--A-SVELSMEEFY
Q73TK8_MYCPA/66-308---------LVIA.DSI-----------------------KPF.----------------...GTD--Q-RAVIPRDHIK
A6UGV8_SINMW/54-318---------IENI.IKT-----------------------....----------------....ED--E-WPTVGWETIA
A8AWA6_STRGC/24-267---------YTNV....-----------------------....----------------....AT--G-TSDLTLENLV
Q5WC89_BACSK/255-486---------FEGW....-----------------------....----------------....QQ--S-AAPLSLLELK
Q4JSY9_CORJK/57-307---------MDPA.LEV-----------------------DNA.----------------..SSNH--E-GDDISVEAIA
Q9EZ57_CORUL/91-327---------AVDL.AAE-----------------------HK..----------------....LS--Y-AEPANAEALA
A4EIG7_9RHOB/58-301---------RPDL.IEN-----------------------AK..----------------....QN--V-IEEFSAELMP
Q6L1D8_PICTO/51-271---------LKNV.AAF-----------------------....----------------....HN--G-YFPISMEYIL
A3I5B7_9BACI/81-317---------GLGL.TPD-----------------------TTF.----------------...NGK--S-NQFSAFEGIS
Q8TM94_METAC/62-323---------GKNI.AET-----------------------L...----------------....SF--A-YGDVDREWIL
Q9HKZ6_THEAC/7-228---------IQSI.YQR-----------------------E...----------------....RR--E-WLQPDFGYVK
Q2G941_NOVAD/48-274---------FANF.AAA-----------------------RG..----------------....LG--Q-ADLLPLERML
Q06Q20_PASHA/55-315---------GDNI.SAP-----------------------F...----------------....VE--N-WGQINPEQVL
A4WEC6_ENT38/44-298---------AINV.AAA-----------------------T...----------------....LQ--G-FKTVAMEQVI
Q7MWG9_PORGI/105-345---------VSFD.YAA-----------------------G...----------------....KV--S-SQPCSFEYIF
A3YPU4_CAMJU/72-305---------INAV.DEN-----------------------IK..----------------...VGT--H-GKSINSEFIL
Q8FRS2_COREF/66-320---------QASI.LEE-----------------------YAG.----------------...SDS--F-YEQISAENPE
A3UEI5_9RHOB/3-265---------AEDA.GNT-----------------------A...----------------....DR--P-SWMTSWNNLH
A4FH22_SACEN/55-310---------LPIT.TPA-----------------------HPDT----------------..AGGG--Y-FERLSWENAN

PF00148

B4SC77_PELPB/21-398H.S.AGADVVECSSAYINKKFH..........................................................
A9W9E4_METEP/11-414AHE.LGFKLVGLGTYTREFARE..V.......................................................
B0UCN0_METS4/77-469V.E.SGAELPYVGTACPRTRFAEDD.......................................................
B2JYA8_BURP8/19-425Q.E.MGAELSVCVSTTTSASHA..........................................................
B8G5R1_CHLAD/13-405GDE.LGMKIAWISGRPRRDDEP..........................................................
A8ML60_ALKOO/11-412E.E.LGLTVEAIILKHKMNR............................................................
B9LG95_CHLSY/32-416I.E.GGAHVPYVSTSIGPSALTAAD.......................................................
C0A2T2_9BACT/72-470R.T.LGMTTALVGTQTGDKDDY..E.......................................................
Q3A2R7_PELCD/48-471L.E.MGAKPYHVICSRGNKKVA..K.......................................................
A1WTQ5_HALHL/61-466E.D.LGMEVIGTGYEFAHDDDY..D.......................................................
VNFD_AZOCH/49-447E.DDLGIQVVAMSSKFGHEEDF..E.......................................................
A0LH04_SYNFM/16-440A.E.VGITPVLCATGGRSGRFR..S.......................................................
A4TZX5_9PROT/19-431N.D.MGGELAAAITSVHAPHLT..........................................................
NIFK_METBA/23-440M.E.MGMEPVVVLTGTKSSEFE..K.......................................................
CHLB_PROMT/11-419NEE.LGFKVVGLGTYSREMARKVRP.......................................................
NIFN_KLEPN/19-431N.S.QGMQPGPLVAPTGHPSLR..........................................................
Q53U98_HELCL/38-434R.E.LGIDVLAGGTQNSTPDDF..L.......................................................
Q0AZV9_SYNWW/62-421I.E.YGFKVPYI....................................................................
Q72WS7_DESVH/65-519R.D.LGMEPLVAGFEFAHRDDY..EGRRVIPTIRVDADSKNIEELKVTAD.....PERYRPRLDPAYREQLEREGLLSSY
A6VFE7_METM7/74-471G.E.LDMEIIMSGTQNGKPEDY..Q.......................................................
CHLB_CYAPA/11-425SKE.IGLEIILCGTYCKSESKWFSE.......................................................
A5GAJ7_GEOUR/498-905A.G.MGCRIQAAISATRVRGLD..........................................................
Q0RAV6_FRAAA/76-504L.E.LGMIPVHIVSTNADTSFK..A.......................................................
A7NQD8_ROSCS/24-408V.E.AGAEVPYVSTSIGVDPLSLPD.......................................................
Q1NMU1_9DELT/18-469A.E.LGVKPVLCASGGKSGQLA..A.......................................................
A6UWY1_META3/60-461M.EELEMEVVGVATYFANKENY..E.......................................................
A3CWW9_METMJ/16-374D.RYLGAEIACVAARNGSGSSGDGT.......................................................
NIFE_METBA/46-452D.E.LGMEVVIIGTQTGKKEDY..E.......................................................
Q8KAN1_CHLTE/12-392GDE.LGMQCLFSLDSAE...............................................................
NIFE_RHOCA/46-447Q.E.LGMEVVGTSMRKVTANDR..D.......................................................
Q1JXL4_DESAC/43-440Q.D.LGIEVVATSVRKATEADK..E.......................................................
Q0YUY4_9CHLB/15-436R.E.IGMMPVLCASGGKSGQLK..Q.......................................................
Q2RS09_RHORT/44-448Q.E.MGMEVVGTSVRKSTEDDK..A.......................................................
Q2WGI2_SELUN/11-432SRE.MGTRACRAGTHRKHDAEWSNE.......................................................
A5ZMT5_9FIRM/13-395EKK.YQKPVRVICPLETHENLLATN.......................................................
Q3Z7D0_DEHE1/60-516K.E.LGMEVVAAGYEFAHRDDY..EGRRVLPSITVDADSRNIEELTVEKDP....ERYKERVSPEKCAELAANGVEFKDY
NIFK_METTM/21-446C.E.LGITPLHTCTGTDNELFI..D.......................................................
A7IA34_METB6/11-372K.RYLDAEILIVGTRNDLPEQPGGQ.......................................................
Q20XD3_RHOPB/20-446L.D.LEMKPQLLLLGDDNAGYVNDP.......................................................
A1WXG0_HALHL/10-395END.LGMPCNFAFSRAPGVK............................................................
Q3M586_ANAVT/490-896A.S.MGAEIHAAVTTTKSPLLE..........................................................
A1WTP6_HALHL/19-436H.D.AGAEVTTAVAPERSPVLD..........................................................
Q9XDC2_HERSE/44-444K.K.RTPEVRGSAFWQTRGGEE..P.......................................................
A4WU62_RHOS5/53-445I.E.SGADVPYVGTAAGKTPWSAAD.......................................................
Q53U99_HELCL/42-464L.E.MGGIPVHIVCTNGTEAFR..K.......................................................
Q8TP84_METAC/341-740D...LGMEIVKVGISVSFFGRGSPG.......................................................
Q56JU1_9BACL/18-428G.E.MGVQLKRLIAPCRTSAIL..N.......................................................
Q2J4G2_FRASC/19-525H.D.VGAEVVAAVSPTA.APVL..A.......................................................
Q8TJ87_METAC/15-494L.E.LGINPVLVATGSKSRDFE..K.......................................................
Q8TRG0_METAC/31-443FEE.LEMIPELLLFRSSMPDSQSLL.......................................................
BCHB_CHLAA/11-419RDE.LGMPIAGAGTYVKHQADWVRE.......................................................
A3DFR2_CLOTH/52-456G.E.LGIKAVGAAIFHHDPIYDSGR.......................................................
NIFK_BRASP/68-492L.E.LGAEPTHVLSTNGNNVAG..........................................................
Q8PYX7_METMA/62-515E.E.LGMKVVVAGYQFAHRDDY..EGRQIIPHMQEKALGSILEDIHYEKD......ENVKPAVSPERIEELKKKIGLMDY
A4FXP1_METM5/15-429L.E.LGMIPSIVCTGSESKTFV..E.......................................................
A5USK3_ROSS1/51-447R.E.LGMETETAATTFGHTDDY..E.......................................................
A6LR27_CLOB8/53-455R.E.LGLIVQGAAIFHHDPLYDNKD.......................................................
A4SD70_PROVI/15-398L.E.AGLEVPYASTSIARTVLGEDD.......................................................
Q7M8U9_WOLSU/69-488I.E.MGAEPKHVLCHNAPDGWE..E.......................................................
A0YNZ3_LYNSP/44-440K.D.LGIDVVATSTKKSTEEDK..A.......................................................
CHLB_EPHAL/11-431ARE.MGIRVSCTGTYCKHDAEWFKE.......................................................
A4XMA4_CALS8/25-448C.E.LGMDVKVVETATPSPTFT..D.......................................................
A6UWY5_META3/46-455K.E.LGIDYVVACCTFSHEDDY..E.......................................................
Q72WT1_DESVH/16-490A.E.TGIRPVLVATGARGCGLA..A.......................................................
A4XMA3_CALS8/36-422K.E.AGLEILVCGSQFGCSNDY..E.......................................................
Q46243_CLOPA/49-448H.EEMGVEVVSVYTKFGHQGDM..E.......................................................
O27608_METTH/13-425L.E.MGMTPSAVFTGSESIYFN..E.......................................................
A5N026_CLOK5/32-415A.R.LGMEPLLLHLEEYYPEDRSYA.......................................................
A4ACR0_9GAMM/10-395EDE.MGMPCSFSFSRCAGAK............................................................
A2SSA2_METLZ/13-379IED.LNYSNVNVATFFAFSRTIARE.......................................................
Q3Z7D3_DEHE1/21-437A.E.IGMVPVLCTADKGGNLAG..........................................................
O27526_METTH/12-396T.E.LRMKPVLVSMDMIGDYTLENL.......................................................
A3PLS6_RHOS1/507-913A.A.MGAKLT.VVASTASPAVE..........................................................
A6UNA3_METVS/21-449T.E.LGMIPSVVCVGVKNPEFV..K.......................................................
Q53U97_HELCL/19-431V.E.VGAVIQVALAATALHENV..........................................................
A4XMA5_CALS8/46-442R.D.LGIEVVACATTFGHEDDY..E.......................................................
Q6NA14_RHOPA/19-430T.E.MGAEVIAAVAAAKAPQLA..........................................................
Q97ME2_CLOAB/52-505K.D.YGVKTVLAGYEFGHRDDY..EGREVIPTIKADADSKNIPELHVEKD.....PKKYRIIIPEDRYEVLKQEIPLEYY
Q07LR0_RHOP5/48-419K.S.FGGQLAGLSMDWIDALHLGAL.......................................................
A5USK2_ROSS1/20-440A.E.MGMTPAYILTAADNRPWG..E.......................................................
Q24QP1_DESHY/324-722D...VGIDIVKIGVFNFSQDEGFRT.......................................................
Q2RWB8_RHORT/53-460R.D.LGIDVIGGCALHHDPVLDHGH.......................................................
Q540N9_HELMO/11-414R.E.IGVRVVWAGTYMKTMEKAFQA.......................................................
Q7BKZ2_CLOBE/23-438L.E.LGMIPKYVITGTPSNVFE..K.......................................................
NIFE_METTH/64-456E.D.LGMEVIMSGTQNGLPNDY..L.......................................................
A5ENW8_BRASB/19-430H.D.MGAEIAVAITTTQSPVLE..........................................................
Q2RL08_MOOTA/46-462E.E.LGMQVVAVACTFAHEDDY..E.......................................................
Q46A91_METBF/20-445L.E.CELEPVLLLLGDDNTLYKIDP.......................................................
Q6N6J8_RHOPA/13-414NRT.LGWSPAAIVVTDNPPAEHRST.......................................................
A5N1T7_CLOK5/17-439V.E.NGILVKVAGTGSRNSILK..K.......................................................
A6LUZ4_CLOB8/44-438N.E.LGIDTVMVGTQTGKKDDY..E.......................................................
BCHB_CHLTE/11-426KDE.LGMKIIGAGTYLPKQADWVRE.......................................................
NIFK_CYAA5/69-490L.E.MGIEPVHVLVNNSTKEFE..E.......................................................
A7I7F2_METB6/56-518K.D.LGMEVVVAGYEFAHRDDY..EGRQVIPTIKSDADSKNIPELHLKADEKLYREGNEYLNLSKEQFEALKKEVPLNYY
NIFE_AZOVI/37-443Q.D.LGMKVVATGTKKSTEEDK..A.......................................................
A4SCK5_PROVI/12-392ADE.MGMQCLFSHTTEE...............................................................
Q2FLM7_METHJ/320-717E...CGMEIIRAGYFSSPYTTKNNQ.......................................................
Q7BKZ0_CLOBE/18-441V.E.NGAVPVLIASGDVCKKLE..P.......................................................
O31276_AZOVI/19-430D.D.VGARLVAAVSPCRSAALE..........................................................
A0L6W2_MAGSM/19-431Q.E.NGLQPVAVVSPVGTDYLQ..K.......................................................
A6TTX7_ALKMQ/17-436L.E.NGIRPLVIATGTRAGKLK..E.......................................................
A1Z1V8_RHILT/41-442I.E.IGMEIVGTSVRKSTVRDK..E.......................................................
NIFN_RHILO/19-429T.G.MGCDIAAAVTTTDMSKIL..Q.......................................................
A7I7F4_METB6/48-446R.G.LGMEIALTGTQTGKADEY..E.......................................................
Q8KC88_CHLTE/24-443L.D.LGMIPAHIVSGTPGLRFE..K.......................................................
A1VI39_DESVV/23-444V.S.AGMRPTVVVTGTPGKAFE..R.......................................................
NIFN_AZOVI/19-432R.S.MGAHTVAAVVPARAAALV..........................................................
Q93T90_AZOBR/22-429A.D.MGAEVIAAVSPTQTAVLE..........................................................
Q6D2Z0_ERWCT/69-501L.E.LGCEPTVILCHNGNKRWQ..K.......................................................
A6UWY4_META3/30-461C.E.IGMKPVVVSTQTPSRIYK..K.......................................................
A7FRU8_CLOB1/32-416T.K.FEMEPVILHMDEFYPDDRKWA.......................................................
CHLB_NEPOL/11-429VRE.LGIHVVCAGTYCKYDEAWFRE.......................................................
A5N1T9_CLOK5/23-438I.S.LGMNPRYVVTGTPGDKFE..K.......................................................
A4FXN8_METM5/48-457E.EYLGMDVVALSGLFEHEDGY..E.......................................................
Q3APV8_CHLCH/12-392GKE.MGMQCLFSHNSAT...............................................................
A7I7F3_METB6/23-439I.T.MGMVPKYVLTGTPGKEFE..A.......................................................

PF01497

Q4KAK8_PSEF5/33-281A.A-ITGDSVFLLSA..........-------------------------------------------------------
B3EC07_CHLL2/105-346SAG-MSADFWVNTHF..........-------------------------------------------------------
A9KLK9_CLOPH/127-364T..-SNVDQIYISIMED........-------------------------------------------------------
B9LI46_CHLSY/56-295M..-ADGDMIFLLQTA.........-------------------------------------------------------
A8LBT9_FRASN/61-297G.L-SEYDVLLYPVD..........-------------------------------------------------------
A6BYB2_YERPE/44-280TIK-TARAVCFGHGN..........-------------------------------------------------------
Q9HMG8_HALSA/70-339N..-VDPDVLFVRGHED........-------------------------------------------------------
Q03SI0_LACBA/39-270K..-ANPQVILRLAHA.........-------------------------------------------------------
Q8TKF6_METAC/99-361A..-WAPEYIFVAWS..........-------------------------------------------------------
Q932C9_STAAM/51-279K..-YAGDYIFLSKP..........-------------------------------------------------------
Q129U2_POLSJ/29-259R..-RNPDIIFGSWC..........-------------------------------------------------------
Q977T6_9ARCH/6-268N..-ADPDVLILMPC..........-------------------------------------------------------
Q5E5H9_VIBF1/28-260S..-MQPDVVLVSNR..........-------------------------------------------------------
A6BFH3_9FIRM/138-386SKA-EEADYLIYNAT..........-------------------------------------------------------
Q73TK8_MYCPA/66-308SVL-ESADVVIWTTQ..........-------------------------------------------------------
A6UGV8_SINMW/54-318K..-AEPSMIVAGSMERR.......-------------------------------------------------------
A8AWA6_STRGC/24-267S..-MDPEVIIYVTSD.........-------------------------------------------------------
Q5WC89_BACSK/255-486E..-LAPRWLWVLCL..........-------------------------------------------------------
Q4JSY9_CORJK/57-307D..-AKPDWMLVMDRDGA.......-------------------------------------------------------
Q9EZ57_CORUL/91-327K..-INPEAIIMMSG..........-------------------------------------------------------
A4EIG7_9RHOB/58-301E..-FDGDFIITTYRS.........-------------------------------------------------------
Q6L1D8_PICTO/51-271NDS-SNIRYIIMSPY..........-------------------------------------------------------
A3I5B7_9BACI/81-317T..-IHADHIFLIGD..........-------------------------------------------------------
Q8TM94_METAC/62-323E..-QDIDAVVVMCWDQHYPETFGY-------------------------------------------------------
Q9HKZ6_THEAC/7-228S..-MDPDIIIFEPK..........-------------------------------------------------------
Q2G941_NOVAD/48-274A..-DPPALILVAGQ..........-------------------------------------------------------
Q06Q20_PASHA/55-315V..-SKPDVIMISGTELGNDTNPEI-------------------------------------------------------
A4WEC6_ENT38/44-298A..-WNPQVIFVQDR..........-------------------------------------------------------
Q7MWG9_PORGI/105-345SRH-RHAEIWICTMM..........-------------------------------------------------------
A3YPU4_CAMJU/72-305E..-KNPDYIFVVDRN.........-------------------------------------------------------
Q8FRS2_COREF/66-320A.F-DDVDLLITYGSG.........-------------------------------------------------------
A3UEI5_9RHOB/3-265A..-LNPERLVIAPC..........-------------------------------------------------------
A4FH22_SACEN/55-310A..-YSGDILLWDTR..........-------------------------------------------------------

PF00148

B4SC77_PELPB/21-398.ARELEALDG.........VRVVEQ.PNF.HRQLED.VRRIK..PDLI.....ITSLM.TANPFVGN.............
A9W9E4_METEP/11-414.RAEAALHGI.........EATITD..DY.LDVEAA.IQAAA..PELV.....LGTQM.ERHIAKRL.......SIPCAV
B0UCN0_METS4/77-469.RAWLEARGT..........RVQFR.ASL.EQDLAA.LEEFR..PDLA.....VGTTP.VVQRAKER.............
B2JYA8_BURP8/19-425.LLPA..............SRVVLG..DL.EDME...RAANG..CDLL.....ITHSH.GRQMAARL.......DKPLMR
B8G5R1_CHLAD/13-405...........................DN.IEIRKR.LHAKA..PAFV.....FGSINEKIYLAEANA.....RGTHYIP
A8ML60_ALKOO/11-412.KAKKHLPEKW.......ERVMKLD.YSE.REMEAY.LSETP..SYLL.....LADEA.TLKLENKS........KLHFQ
B9LG95_CHLSY/32-416.EAWLKAHGT.........QAVIYR.KTL.EDDKAA.MERWS..FDLI.....IGTTT.LAAYAKEK.............
C0A2T2_9BACT/72-470.MLRQMCDPG.........TVIVDD.SNP.LELAKF.CLEKD..VDLF.....IGGVK.ERPIAYKL.............
Q3A2R7_PELCD/48-471.YLQALLDESVY....GEGCKLWMN.KDL.WHLRSL.VMTDP..VDGL.....IGSTH.GKFIARDA.......NIPHIR
A1WTQ5_HALHL/61-466.RTYPELKEG........T.LVYDD.ANA.FELERF.IERAR..PDLV.....AAGIK.EKYVFQKM.............
VNFD_AZOCH/49-447.KVIARGKEG........T.YYIDD.GNE.LEFFEI.IDLVK..PDVI.....FTGPR.VGELVKKL.............
A0LH04_SYNFM/16-440.AVEQVTADILP.....EAPAVGEG.MDF.RQIEEQ.AEILS..PDIM.....IGHSK.GYSIARKL.......GIPLVR
A4TZX5_9PROT/19-431.QLPC..............QQVIIG..DF.QDMEDQILEAGG..ADLV.....ISNTN.ARLSCQSL.......GIPHFR
NIFK_METBA/23-440.EVEGLIGPEH......PEADVISG.GDM.FTLHQI.IKRKP..VDLL.....IGNTY.GKFISRAE.......DVPLVR
CHLB_PROMT/11-419.AAKALGLEA............LIT.NDY.LEVEDA.IKETS..PELV.....LGTQM.ERHSAKRL.......GIPCAV
NIFN_KLEPN/19-431.QLPV..............ERVVPG..DL.EDLQTL.LCAHP..ADLL.....VANSH.ARDLAEQF.......ALPLVR
Q53U98_HELCL/38-434.RMKALMDPT........A.HIIED.TSA.AGFLTL.IKEKS..PDLI.....VAGGK.TKYLAHKT.............
Q0AZV9_SYNWW/62-421.....................IANRILDIDLEHINW.LKTHA..PDIV....VFTNAHPSMTDFLQNNLKVDIAIGMDAA
Q72WS7_DESVH/65-519EGMWDDMGEG........T.LVIDD.VSH.VEIEKL.IHRMN..PDII.....CSGIK.DKYVIEKF.............
A6VFE7_METM7/74-471.KIREHVNEG........T.LIVDD.ASS.MELVQL.LKEYK..PDIL.....ISGAK.EKYLSLKS.............
CHLB_CYAPA/11-425.QVQNYCNK............ILIT.EDH.TMISNE.ISKLK..PDVI.....FGTQM.ERHIGKRL.......GIPCGV
A5GAJ7_GEOUR/498-905.RLPT..............DNIFVG..DL.EDLE...NSAQG..SDLL.....VANSN.GRQAAARL......GGIPLLR
Q0RAV6_FRAAA/76-504.RMEKVLSASKF....GDEATVWPE.KDL.WHLRSL.VFTEP..VDVL.....IGSMQ.LKYISREA.......NVPLVR
A7NQD8_ROSCS/24-408.ELWLKARGT.........QEVAYR.KAL.EEDMAA.LDRYA..PDFV.....LGTTP.FAAAAKER.............
Q1NMU1_9DELT/18-469.AVREVTAELLP.....DSPEVHED.CDF.FDIAEQ.TRQLQ..PDLL.....IGHSK.GYSLAREL.......EIPLIR
A6UWY1_META3/60-461.KIVKQLPKG........A.VIIDN.PNT.YELENA.IIDCK..PDIF.....ISDSK.TKELVHKL.............
A3CWW9_METMJ/16-374.TRTTDFS.......................VIREA.ILDAE..PDLI.....LGSTY.EAAIAPGA.........AFVG
NIFE_METBA/46-452.QISYSVRDG........T.VIVDD.ANP.LELAEL.LIRQK..ADLM.....VAGVK.ERFIAYKL.............
Q8KAN1_CHLTE/12-392..........................VDN.NAVRKE.IVQKQ..PQFL.....YGRMPDKIYLAEAD......AKSRFIP
NIFE_RHOCA/46-447.RVIEIMGDD........K.HMCEN.MAP.REMYQE.CCARR..ADVL.....LSGGR.SQFVALKA.............
Q1JXL4_DESAC/43-440.KAREYLGEN........G..VLMT.NPG.AEQAKM.IDKFK..ADLL.....LAGGR.SLYTAIKK.............
Q0YUY4_9CHLB/15-436.RLIELIPDLEE.....QGIKVREG.VDF.MDIEDE.AKILK..PDFL.....IGNSK.GYTMSRKN.......NIPLLR
Q2RS09_RHORT/44-448.RARAALDQNTG....KVG.ELFGA.IAN.PEMYRM.FRDGE..ADIM.....LSGGR.SQFVALKA.............
Q2WGI2_SELUN/11-432.QVRGSRDK............ALVT.DDH.TEAGDM.IGREE..PPAI.....FGTQT.ERHVGKRP.......DTPCGV
A5ZMT5_9FIRM/13-395.......................DCTANGEEEMEKL.LRD....ADII.....VADPL......................
Q3Z7D0_DEHE1/60-516AGMMPEMEAG........S.LTIDE.PSH.HETFRL.LELYK..PDLY.....CAGVK.EKYAVQKT.............
NIFK_METTM/21-446.RMKTVAAEAD......ERINVMVK.SDL.RALEER.LSEEP..VDLM.....IGNSD.GRLIAQDL.......GIPLVR
A7IA34_METB6/11-372.YRVEKLAGL....................EAVGRR.ITESD..PDLV.....IGSSF.ERSLCPDR.........AFVG
Q20XD3_RHOPB/20-446.RIKALQENVD......YPMEIITN.ADF.WELENR.IKNEGLELDLI.....LGHSK.GRFISIDY.......NIPMVR
A1WXG0_HALHL/10-395..........................IDN.DAIRAA.IRGNP..PLVL.....FGSYNERMYLAEVG......GHARYIP
Q3M586_ANAVT/490-896.KLPV..............EKVTIG..DL.EDFE...RLAVG..SDLV.....IANSH.GKAISRRL.......QTSFYR
A1WTP6_HALHL/19-436.GLPA..............GRVAVG..DL.EALEHH.GREDG..VELI.....LGSGH.AAATAGRL.......GVPILQ
Q9XDC2_HERSE/44-444....................HLIDD.MKPRRDVFHV.ERGAL..PDYLGRLSRIAG.R.SQFIALKA.............
A4WU62_RHOS5/53-445.REWLESKGV..........VVKYR.ASL.EDDLAA.MEGFE..PDLA.....IGTTP.VVQKAKAM.............
Q53U99_HELCL/42-464.ELQKVLDGSPF....GKEATVHTG.RDL.WHLRSL.LMTEP..VDML.....LGDSH.GKFDAKDA.......NIPLVR
Q8TP84_METAC/341-740.LLSCE............AFPVERD.YTD.EKRARD.VRILM..PDLV.....LSNYA.PSVPEDGV...........HY
Q56JU1_9BACL/18-428.SS................LDIWIG..DL.DDAE...DAAPS..ADLR.....ISNSH.GKKGAMRS.......DTAFVQ
Q2J4G2_FRASC/19-525.DAPW..............DEVVVG..DL.TDLAER.ARAGG..AHLV.....LGSSH.AREVADRI.......GAAHLP
Q8TJ87_METAC/15-494.RIKQIFEEIRP....ELEPVVLNG.IDF.DTLNDA.VGECS..PEIL.....IGNSN.GRYIAKAR.......NIPLVR
Q8TRG0_METAC/31-443.ENELKAMGI........SPRVVFS.ADG.YQVKQS.LMDSN..VDAV.....FGSSW.EYYMAEEL.......GIKFAF
BCHB_CHLAA/11-419.QLTGYVDE............VLVT.DEF.QVVADR.IAALR..PELV.....CGTQM.ERHTSRRY.......DLNCMV
A3DFR2_CLOTH/52-456.EENDQLAQRVADYGNVFNYNVCNK.QEF..ELVNA.LNRLR..PDVL.....LARHGGMTLWGAKL.............
NIFK_BRASP/68-492.ENATLFAGSPF.....GELPAYPG.RDL.WHMRSL.LFTEP..VDFL.....IGNTH.GKYLERDT.......GTPLIR
Q8PYX7_METMA/62-515EGLFPEMKDG........T.IVIDD.LNH.HETEAL.LKTLK..PDIF.....CSGIK.DKYWAQKH.............
A4FXP1_METM5/15-429.DIKAVTKDSK......HKPVILAP.GDL.YDLHEE.IKKSK..VDLL.....IGNSY.GSRIAGAE.......NIPLIR
A5USK3_ROSS1/51-447.KIFNQIGEG........A.LVIDN.PNV.PEIEEI.LTRRR..PDLF.....ISGNK.ERYLAYKM.............
A6LR27_CLOB8/53-455.KTSDALAQTVNIYGDIKHYNVCNK.QAY..ELVNI.LNRVK..PDLM.....IARHGGMTMWGAKL.............
A4SD70_PROVI/15-398.HRVLSMLGT..........EICYR.KYL.EDDMEA.VVRLK..PDLV.....IGTTS.LDSFAKER.............
Q7M8U9_WOLSU/69-488.EMKALLATSPA.....KDLHVWAG.KDL.WHMRSL.LFTEP..VDFM.....IGNTY.GKELERDT.......GIPLIR
A0YNZ3_LYNSP/44-440.RIKKLLGKD........G.ITIEK.GSP.QELLKV.IEQTG..ADLL.....IAGGR.NQYTALKA.............
CHLB_EPHAL/11-431.QVQDFSNE............ILIT.EDH.AKVGKK.IACVE..PSAI.....FGTQM.ERHIGKRF.......DISCGV
A4XMA4_CALS8/25-448.EIKAIFDEYN......IEGEILVD.SDL.YEFEYL.AKEAG..VDVV.....LGNSK.GVEVTKSI.......KCPLVR
A6UWY5_META3/46-455.KMNINLEKAGL....TNV.LVMDS.PNE.PELEEA.AEIYK..PDFM.....LVGLK.ERYLFRKF.............
Q72WT1_DESVH/16-490.RVAAVCGGLMP.....DLPEVREG.VDF.HEIAER.AGTLA..PDLL.....VGNSK.GYRYARAW.......GIPLVR
A4XMA3_CALS8/36-422.MARCILPDS..........MLVDD.FNC.AEVEEI.ILRFS..PDLF.....IGGTR.EWYLSHKF.............
Q46243_CLOPA/49-448.KGISRCEAG........A.LAIDD.PNE.LESLES.MRTLK..PDCI.....FTGKR.PGEFAKKV.............
O27608_METTH/13-425.KISQLQKEYG......FKCMAMSG.ADI.FDLQSY.ISEKP..IDVL.....IGNSYCGRAAEEN........GIPLMR
A5N026_CLOK5/32-415.KELVSMGYN..........PWICRMVNAEADLLV..LEKLA..PDLC.....FGYLSDINK..................
A4ACR0_9GAMM/10-395..........................TDN.EAVRAA.IADSA..PLIV.....FGSYNERMYIAETQ......ARTMYIP
A2SSA2_METLZ/13-379..........G.......DIKLSNE.....GHLQKL.IEEGC..YDII.....VGDPLFERFTNRQQ...........IF
Q3Z7D3_DEHE1/21-437.QAEDLLAGVE.......KAVVLEG.ADF.ADIETL.ATELK..PDIF.....IGSSK.GYKLARLL.......GVPLVR
O27526_METTH/12-396.RGVPGLRSE...........ILVG.VDV.SDIEEA.IIRTE..PELI.....LGGLA.ETRISEVS.............
A3PLS6_RHOS1/507-913.RLPV..............EEVLIG..DL.GDLERL.AEASG..ARLL.....LTHAH.GRMMAERL.......HLPHVR
A6UNA3_METVS/21-449.EMEKVAKESE......DDVDVLLG.QDL.RALDVY.IKENP..VDIM.....IGNSD.GRLMAKDH.......KIPLYR
Q53U97_HELCL/19-431..LPNFTFSS........QYTVEVG..DL.EHLE...ERAPG..SHLI.....IANSN.ARQAALPL.......KIPHLR
A4XMA5_CALS8/46-442.KINARADDG........V.LVIDN.PNE.LELEEV.IQKYK..PDIF.....LTGLK.EKYLAHKL.............
Q6NA14_RHOPA/19-430.NLPL..............DSVVIG..DL.EDLEWL.ASDRG..ADLI.....VTNSH.GADIAKRT.......GAALLR
Q97ME2_CLOAB/52-505GGMFKDMEEG........A.VAVDD.LNH.HETEQF.IKLLK..PDMF.....FSGVK.DKYVIQKM.............
Q07LR0_RHOP5/48-419.KAIAGRHPA.........LPVHVA.AGQPFELVNW.LGRLK..PDLV.....IGTPI.TAAIAARG.............
A5USK2_ROSS1/20-440.RMVELTGELG......VESEIILK.GDL.HELHKR.IKQQP..VDLL.....IGHSK.GRFIAEAE.......NIPLVR
Q24QP1_DESHY/324-722.RLD.A............AFNVVEN.YDR.GERDQD.IAAYK..PDIL.....LTNYA.SSLADEPF...........VA
Q2RWB8_RHORT/53-460.QEEDTLAHATRDK.AEVPYGVCNK.QSF..ELINL.VGKLK..PDIL.....LIRHPGLVVWGAKL.............
Q540N9_HELMO/11-414.SIGGLADE............VFVC.DDF.QEISHK.IRDTH..PDIV.....LGTQM.ERHSAARF.......NFPCIV
Q7BKZ2_CLOBE/23-438.QMQALFDEFGV.....EGCIAKQD.ADL.FELHQL.IKNES..VDLL.....MGGTH.GKYIARAE.......DIPLIR
NIFE_METTH/64-456.RIMEKSGRE........L.ILFDD.ANP.VELSRL.LNKYR..PDLF.....VSGAK.EKYLSYKL.............
A5ENW8_BRASB/19-430.RMPC..............AEVLIG..DL.EDLETQ.AKARD..CGLM.....MTHSH.GRQAAARL.......KIPFYR
Q2RL08_MOOTA/46-462.KINARAPEG........M.LVIDA.PNE.FELEEM.LTSTK..PDLF.....LTGLK.EKYLGRKM.............
Q46A91_METBF/20-445.RLEALKEKAN......CDIKVIWN.ADL.WELESR.VKNKSIDIDLI.....LGHSK.GRYIAIDN.......DIPMVR
Q6N6J8_RHOPA/13-414..........LE.....DDLPVVHYSEDD.DEIAAL.IGGSG..AEIL.....FGSSL.ERAVADRL.......AVPLIE
A5N1T7_CLOK5/17-439.MLKEELKAQK......EDSIVLDD.TDF.ETMESY.AKRFN..VNLM.....IGNSD.GRRMAKKL.......GVKLIR
A6LUZ4_CLOB8/44-438.VINSLVKDG........T.VVLDD.ANP.SELEKF.MIEQD..VDIL.....VGGVK.ERPLAYKL.............
BCHB_CHLTE/11-426.QLEGYLPGE...........LMVT.DKF.QEVSAF.IEEEM..PELV.....CGTQM.ERHSCRKL.......DVPCMV
NIFK_CYAA5/69-490.EAKALLAASPY....GQQATVWGG.KDL.WHMRSL.LFTEP..VDFL.....VGNSY.AKYLQRDT.......KTPLIR
A7I7F2_METB6/56-518EGMYPDMKNG........D.IMIDD.CNH.YELEEL.IKKLR..PDLI.....FTGVR.DKYIAEKM.............
NIFE_AZOVI/37-443.RIRELMGDD........V.KMLDE.GNA.RVLLKT.VDEYQ..ADIL.....IAGGR.NMYTALKG.............
A4SCK5_PROVI/12-392..........................TDN.TALRDQ.LASVQ..PQFF.....FGRIVDKIYLAELD......AKTRFIP
Q2FLM7_METHJ/320-717..........KE.....SEPSIVMD.YTP.DALYDD.IKTYR..PDLV.....LTTIWLDYKKADVR............Y
Q7BKZ0_CLOBE/18-441.SLREEVNELSNQL.FAGECKIIDE.ADF.KEIEKL.ALDLK..VNVM.....IGSSD.GRRIEEKH.......KIPLIR
O31276_AZOVI/19-430.ALNI..............KEVMIG..DF.EDLEER.ARETS..AQLL.....IGNSH.ALQSAERL.......GIPLLR
A0L6W2_MAGSM/19-431.SLY...............ETIKIG..DL.EDLQDL.AREAD..AELF.....IGNSH.VAALAQRL.......GRPILR
A6TTX7_ALKMQ/17-436.LLEEDLKKVD......ENCMVIDD.TDL.QTIQKY.VRELN..INVL.....IGSSE.GKFITEKD.......GVPLVR
A1Z1V8_RHILT/41-442.RIKLMLKDE........N.QLHQS.MAA.SELYVM.LREHK..PDIM.....LSGGR.TQFVALEA.............
NIFN_RHILO/19-429.KVPA..............EWVQIG..DL.GDLE...ALAAG..ADLL.....VTHSH.GRQASRRL.......EIPLMR
A7I7F4_METB6/48-446.SMSRILSEG........T.IIIDD.ANP.AELEKF.LLEKH..VDVM.....IGGVK.ERVLAYKL.............
Q8KC88_CHLTE/24-443.RMKEILERAPG.....ANFRNGPQ.ADM.FLMHQW.IKNEP..VDLL.....IGNTY.GKYIARDE.......DIPFVR
A1VI39_DESVV/23-444.RIAEVMEKAGA....TWDYEVRAA.NDL.FHLHQR.VKAAP..VDLL.....VGNSY.GKYIAQAE.......DTPLVR
NIFN_AZOVI/19-432.DSPL..............PSVRVG..DL.EDLEHA.ARAGQ..AQLV.....IGNSH.ALASARRL.......GVPLLR
Q93T90_AZOBR/22-429.KLKA..............ATVMVG..DH.SDVE...TLARD..ADLI.....VSNSH.GRQGAARI.......GVPLHR
Q6D2Z0_ERWCT/69-501.AMKKILEASPY....GQESDVYIN.SDL.WHFRSL.MFTKQ..PDFM.....IGNSY.GKFIQRDTLAKGEQFEVPLIR
A6UWY4_META3/30-461.EMEKIAKEF........NVDIEVQFSDL.WDFEKK.VKEIG..VDLI.....IGHPRGGTAIAKDM.......GIGLLR
A7FRU8_CLOB1/32-416.KAINEKGYD..........PMICHMVNNDADIEL..LEGIK..ADFS.....LGKLLKDSS..................
CHLB_NEPOL/11-429.QVNGYVDE............ILIT.EDH.TQVADT.ISRLE..PAAI.....FGTQM.ERHVGKRL.......DIPCGV
A5N1T9_CLOK5/23-438.TINGMMEKAGV.....QGAKVKSS.GDF.FEMHQW.IKNEP..VDLI.....VGNSH.AKYIARAE.......NTPLIR
A4FXN8_METM5/48-457.KMQERAKDG........T.IIIDD.LNT.LEMEEV.VEKYH..PEIV.....LGGIK.EKYFFHKL.............
Q3APV8_CHLCH/12-392..........................SDN.SAIRQE.IQQQQ..PQFL.....FGRIVDKIYLAEID......AKTRFIP
A7I7F3_METB6/23-439.TVTKMLDEAGI.....TGSRVKAE.GDL.FELHEW.IREEK..VDLM.....IGTTY.GKYIARTE.......DIPLVR

PF01497

Q4KAK8_PSEF5/33-281--------------------------..........-.TDGD--VQAF-----LAD..----------------------
B3EC07_CHLL2/105-346--------------------------..........-.RALS--IDDL-----TGE..----------------------
A9KLK9_CLOPH/127-364--------------------------......NIEE-TKKLV--DQEF-----IKN..----------------------
B9LI46_CHLSY/56-295--------------------------.......DVE-GEASA--VAEM-----MDH..----------------------
A8LBT9_FRASN/61-297--------------------------.......AEG-KVTEG--FAPV-----AES..----------------------
A6BYB2_YERPE/44-280--------------------------..........-..NEM--LQQV-----ART..----------------------
Q9HMG8_HALSA/70-339--------------------------.....KTAAE-FQDTV--VSFL-----QNH..----------------------
Q03SI0_LACBA/39-270--------------------------......MPTM-VTKQF--NQEF-----KSN..----------------------
Q8TKF6_METAC/99-361--------------------------........SW-DNQTG--KDFV-----MET..----------------------
Q932C9_STAAM/51-279--------------------------..........-..SYG--KFDF-----EKT..----------------------
Q129U2_POLSJ/29-259--------------------------..........-GRKFR--PEHV-----VAR..----------------------
Q977T6_9ARCH/6-268--------------------------........GF-DVQRT--VSEY-----EKYLR----------------------
Q5E5H9_VIBF1/28-260--------------------------........SI-KKLKG--IDKI-----IES..----------------------
A6BFH3_9FIRM/138-386--------------------------.......IDS-PINSI--AELT-----AKN..----------------------
Q73TK8_MYCPA/66-308--------------------------..........-.NPDD--QKAL-----LAD..----------------------
A6UGV8_SINMW/54-318--------------------------.....RYPLD-SLEAK--LEFL-----KGD..----------------------
A8AWA6_STRGC/24-267--------------------------......RNKS-MDEQA--VDLM-----KAN..----------------------
Q5WC89_BACSK/255-486--------------------------.......HDS-QTKTF--YEHV-----RQS..----------------------
Q4JSY9_CORJK/57-307--------------------------....INADKP-DYSPA--ADVI-----KRS..----------------------
Q9EZ57_CORUL/91-327--------------------------........GL-ESTGG--IDGL-----LSR..----------------------
A4EIG7_9RHOB/58-301--------------------------.......SAG-YTPDA--VRGY-----FEGV.----------------------
Q6L1D8_PICTO/51-271--------------------------........VN-YTNLK--TKAF-----EAT..----------------------
A3I5B7_9BACI/81-317--------------------------........IT-KKETL--MSEL-----NQN..----------------------
Q8TM94_METAC/62-323--------------------------AVNDSELATK-SGKEI--QEEI-----MGQ..----------------------
Q9HKZ6_THEAC/7-228--------------------------.........M-FRSVS--PDDI-----IRE..----------------------
Q2G941_NOVAD/48-274--------------------------........GA-ETGRG--DDRV-----LSH..----------------------
Q06Q20_PASHA/55-315--------------------------MSMGINIEEA-DAQKR--LKGF-----IER..----------------------
A4WEC6_ENT38/44-298--------------------------..........-.YPSV--VDEI-----KNS..----------------------
Q7MWG9_PORGI/105-345--------------------------.........G-NIKTM--DEFL-----ALN..----------------------
A3YPU4_CAMJU/72-305--------------------------.......VIV-GNKER--AQGI-----LDN..----------------------
Q8FRS2_COREF/66-320--------------------------.......DAA-VNAAL--LAKL-----QAD..----------------------
A3UEI5_9RHOB/3-265--------------------------........GF-PAART--LEDI-----AGDLE----------------------
A4FH22_SACEN/55-310--------------------------..........-RASMN--PEQM-----KQN..----------------------

PF00148

B4SC77_PELPB/21-398.GFVVKWSM-EFM.LMSIHSWSGVI....TLANMFVSPLQ
A9W9E4_METEP/11-414ISAPIHVQD-FPARHSPQMGFEGAN....VLFDTLVHPLM
B0UCN0_METS4/77-469.AIPALYFT-NLISARPLMGIAGAG....SLAQVVNGALA
B2JYA8_BURP8/19-425VGFPVFDRI-GNA.HRCQIGYRGTM....NLIFEIANLLI
B8G5R1_CHLAD/13-405ATFPGPVVR-RTT.GTPFMGYAGAA....NLMQELVNRFY
A8ML60_ALKOO/11-412IANPNFSKH-SIYPYTPFVGYHGAL....YFMQCLYELQK
B9LG95_CHLSY/32-416.GIPAVYYT-NILSVRPLFLAGGMI....ASLTFVRDLLN
C0A2T2_9BACT/72-470.GIGFCDHN-HER.KEALAGYVGML....NFAREVYASVM
Q3A2R7_PELCD/48-471LGFPILDRV-NLH.RVPYIGYQGTM....NILTSVANTML
A1WTQ5_HALHL/61-466.GLPFRQMH-SWDYSGPYHGYDGFA....IFARDMDMTLN
VNFD_AZOCH/49-447.HIPYVNGH-GYH.NGPYMGFEGFV....NLARDTYNAVH
A0LH04_SYNFM/16-440VGFPIHDRF-GGQ.RTLHVGYRGTQ....SLLDRIVNGLI
A4TZX5_9PROT/19-431AGFPVYDRL-GGA.HRVHVGYRGTR....DLIFQLANVLI
NIFK_METBA/23-440VGFPIMDRA-NLH.YFPIMGYAGAA....RLVERIANTLL
CHLB_PROMT/11-419ISTPMHVQD-VPARYSPQMGWEGAN....VIFDDWVHPLM
NIFN_KLEPN/19-431AGFPLFDKL-GEF.RRVRQGYSGMR....DTLFELANLIR
Q53U98_HELCL/38-434.RTPFLDIN-HGR.SLPYAGYAGMI....TFANAVARTVF
Q0AZV9_SYNWW/62-421YFFPHAKPI-PLRLDTQLYGYKGIE....SLLELICQAFD
Q72WS7_DESVH/65-519.GVPCKQLH-NYDYSGPYAGYEGAV....NFARDVYAMIH
A6VFE7_METM7/74-471.GVPHCDFN-HDR.ITAFSGFQGFI....NFARVVHTAVM
CHLB_CYAPA/11-425ISSPIHIQN-FPLSYKPMVGYEGVK....TIMDLLFNSLN
A5GAJ7_GEOUR/498-905AGLPVFDRL-GAH.QKMYVGYRGTM....NLVFETATIFQ
Q0RAV6_FRAAA/76-504VGFPIFDRH-HLH.RFPIIGYTGGL....HLLTQLVNTIL
A7NQD8_ROSCS/24-408.GIPAMYFT-NQLASRPFFLSGGMA....ATIGFVAETLE
Q1NMU1_9DELT/18-469VGFPIHDRM-GGQ.RLLHLGYLGAQ....QLFDTLVNTVM
A6UWY1_META3/60-461.GIPYINGR-AP..STVYIGFDGFV....NFAKDVYGAIN
A3CWW9_METMJ/16-374LTPPLRDRV-ALS.SHAVAGVEGAL....RLMEEVLNACI
NIFE_METBA/46-452.GIAFCDFN-HDR.VVEFEGFDGFV....NFAREVDASIS
Q8KAN1_CHLTE/12-392AGFPGPIVR-RAL.GTPFMGHSGVV....WLVQEIVNALY
NIFE_RHOCA/46-447.LVPSVDVN-QEK.HEPYAGYMGMV....DLVRAIDRSVN
Q1JXL4_DESAC/43-440.GISFIDVN-QEK.KKSYGAYNGLL....SLAEDVKNALE
Q0YUY4_9CHLB/15-436IGFPIHDRF-GGQ.RAHHIGYRGTQ....ELFDRIVNTVI
Q2RS09_RHORT/44-448.RTAWMDIN-QER.HHGYAGYDGML....ELVRQMDIEIN
Q2WGI2_SELUN/11-432TSPPVHIQN-FPSGYRPSSGHEGTN....QIADSVHNSYT
A5ZMT5_9FIRM/13-395.YRPICPKQ-SQFYELPHIAFSGRI.....FLKDIKRKYP
Q3Z7D0_DEHE1/60-516.GIPCLQLH-SYDYGGPFAGFEGAI....NFYKDVDRLVS
NIFK_METTM/21-446VGYPVYDRV-GYQ.RVPITGYRGAV....NLLNRITNTVL
A7IA34_METB6/11-372IIPPFRGQV-RLA.HYPLAGLGGSL....YFVENVLNACM
Q20XD3_RHOPB/20-446VGFPTYDRA-GLY.RHPVVGYGGAT....WLAEQMANALF
A1WXG0_HALHL/10-395ASFPGAVIR-RHT.GTPFMGYGGAC....YIVQEVCNALF
Q3M586_ANAVT/490-896LGFPIFDRL-GNG.QRCTVGYRGTT....QLLFDIGNLFL
A1WTP6_HALHL/19-436CGYPIWERV-GLH.ARPRVGYRGSR....DTLFELANTLL
Q9XDC2_HERSE/44-444.RMPWLDVN-QER.HHAHAGYEGMI....TLVSEIDRRSV
A4WU62_RHOS5/53-445.GLPSLYFT-NLISARPLMGPAGAG....SLAQVINAAIG
Q53U99_HELCL/42-464IGFPIVDRV-NMH.RSPIVGYEGAI....NLVTMIANTFM
Q8TP84_METAC/341-740DTIP.....-....FSPQVGFLSGL....ELAKRWSTLLR
Q56JU1_9BACL/18-428AGFPVYDEL-GAH.TSISVGYRGTM....SLVNKVGNSLL
Q2J4G2_FRASC/19-525VGFPIFDRL-GAA.LAGTAGYAGSL....RLLIDAANRLL
Q8TJ87_METAC/15-494VGLPIHDRV-GAQ.RILTVGYRGAL....ELLDRITNTIL
Q8TRG0_METAC/31-443DVFNPTNRV-NYL.NKSYFGYEGML....NFLENVANDWE
BCHB_CHLAA/11-419ISPPTHIEN-HLLAYRPFLGFDGAD....VIADEVYTTCT
A3DFR2_CLOTH/52-456.GIPSLLIG-DEHYS...MGYEGLV....NYGERILEVIE
NIFK_BRASP/68-492IGFPIFDRH-HHH.RFPVWGYQGGL....NVLVKILDKIF
Q8PYX7_METMA/62-515.GIPSRQIH-SYDYSGRYTGFSGVV....NFARDIDMAMH
A4FXP1_METM5/15-429MGFPIYDRV-GAQ.RITCVGYTAGI....RLVDTITNTIL
A5USK3_ROSS1/51-447.GVPFVNGH-TYD.TGPYAGFVGMV....NFARDIDKALH
A6LR27_CLOB8/53-455.GIPTLLIG-DEQFG...FGYQGVL....NYASRIVETLD
A4SD70_PROVI/15-398.GIAAIYYT-NNISARPLFFATGAA....AVLGMISGLLN
Q7M8U9_WOLSU/69-488VGFPIFDRH-HLH.RYSISGYKGTL....NLLTWIVNKVL
A0YNZ3_LYNSP/44-440.RIPFLDIN-QER.HHAYAGYEGMI....EMAKELEEALY
CHLB_EPHAL/11-431ISAPVHIQN-FPLGYRPFMGYEGTN....QIADLVYNSFA
A4XMA4_CALS8/25-448IGFPVYDRV-GYF.RYGITGYKGSI....WLLDLIVNTIL
A6UWY5_META3/46-455.GIPTVNSH-SYE.EGPYAGYRGFV....NFARDIYKAVC
Q72WT1_DESVH/16-490TGFPVHDRF-GGQ.RLLHVGYTGAL....ALYDRIVNALI
A4XMA3_CALS8/36-422.GVPFLVLP-QE..TKPYACFEGFL....HLLIDIYKEVH
Q46243_CLOPA/49-448.GVPYLNAH-AYH.NGPYKGFEGWV....RFARDIYNAIY
O27608_METTH/13-425VGFPVYDRL-GSQ.RIRIAGYSGGI....EFVDSLTNLII
A5N026_CLOK5/32-415.NIPCVLDM-FD..FYGQVGYGRTS....NLLRRILGVLD
A4ACR0_9GAMM/10-395ASLPGSIVR-RHT.GTPFMGYAGAC....YVLQEVCNALF
A2SSA2_METLZ/13-379VSLPHPAVS-SKLHWQSYVSLLSN.....DFSKYLYEKIN
Q3Z7D3_DEHE1/21-437LGFPVHDRL-GGA.RLRCVGYAGTQ....ELFDRIVNALL
O27526_METTH/12-396.GAPLIDVM-HG..SSLTAGFRGAV....NLGARMCGAVY
A3PLS6_RHOS1/507-913AGFPIFDRL-GTM.DACRTGYRGTR....AFLFEIANALL
A6UNA3_METVS/21-449VGYPVYDRV-GTA.RRPIVGYNGGL....NLIDGITNTIL
Q53U97_HELCL/19-431AGLPVFDRA-GMS.QKVWIGYRGTQ....QFLYDCLNAMA
A4XMA5_CALS8/46-442.GVPSLNSH-SYE.NGPYVAFEGLV....NFARDLYKSLY
Q6NA14_RHOPA/19-430AGFPIYDSY-GAY.AESFIGYGGGR....RTLFRIADLLA
Q97ME2_CLOAB/52-505.GILSKQLH-SYDYTGPYAGFKGAV....VFGKELVAGAF
Q07LR0_RHOP5/48-419.GIASVAVQ-....SDELLGTEGEV....RLAKRIERALG
A5USK2_ROSS1/20-440VGFPVEDRF-GHH.RRSIVGYNGAI....ALVDEITNTIF
Q24QP1_DESHY/324-722DTIP.....-....MCPDVGFHSGL....VLARRWARLLK
Q2RWB8_RHORT/53-460.GIPTLYVE-DEHAG...IGYRGLIRYGRKIADWIANPVL
Q540N9_HELMO/11-414ISSPAHILN-FPLFPAPVLGYQGMT....RMLDTINSTIK
Q7BKZ2_CLOBE/23-438IGFPVLDRY-VHS.YMPNVGYRGAM....RLLELMLGALM
NIFE_METTH/64-456.GIPFCEFN-HDR.IKPFSCFRGFL....NFAEEVDKAVN
A5ENW8_BRASB/19-430IGFPMFDRL-GAG.HLLTVGYRGTR....DLIFALANLII
Q2RL08_MOOTA/46-462.GIPTVNSH-SYE.KGPYEGFAGMV....NFARDIYQGIY
Q46A91_METBF/20-445VGFPTFDRA-GLW.KYPAIGYKGAE....WLAETIANTIF
Q6N6J8_RHOPA/13-414CAAPTRRLS-L...TSGFGGFRGGL....TLLEAIVTASE
A5N1T7_CLOK5/17-439TGFPIHDRV-GGQ.RQVITAYNGSS....FLIDAVSNAML
A6LUZ4_CLOB8/44-438.GVAFCDHN-HER.KHPLGGFVGAV....NFAKEINLSIN
BCHB_CHLTE/11-426ISAPTHIEN-HLLGYYPFFGFDGAD....VMADRVYTSAK
NIFK_CYAA5/69-490IGYPIFDRH-HLH.RYSTIGYEGAI....NLLNWIANGLM
A7I7F2_METB6/56-518.GIPAKQMH-SYDYAGPYAGYNGAI....NFANDVAHTLT
NIFE_AZOVI/37-443.RVPFLDIN-QER.EFGYGGYDRML....ELVRHVCITLE
A4SCK5_PROVI/12-392AGFPGPIVR-RAL.GTPFMGHSGAV....FLLQEIVNSLY
Q2FLM7_METHJ/320-717GMIP.....-....FCPNVGFFGAL....SSMKHWASILS
Q7BKZ0_CLOBE/18-441LSFPIHDRI-GGQ.RILSIGYEGSL....NLGDQITNVML
O31276_AZOVI/19-430AGFPQYDHY-GAA.ARLWVGYRGAR....QLLFELANLFA
A0L6W2_MAGSM/19-431AGYPLYDQI-GSQ.SRCWIGYTGSR....QALFDLANRMM
A6TTX7_ALKMQ/17-436IGFPIHDRV-GAQ.RKTYSGYEGSM....RFLDEITNTLL
A1Z1V8_RHILT/41-442.KIPWLDVN-QER.QHAYAGYEGMV....ELARQIDLAIH
NIFN_RHILO/19-429VGFPIFDRL-GSQ.HKLTILYRGTR....DLIFDVANIFQ
A7I7F4_METB6/48-446.GIGFVDHN-HDR.KDGLAGFEGAV....RFAREVYVTTC
Q8KC88_CHLTE/24-443FGFPILDRI-GHS.YFPNVGYSGSL....RLVEKILGVLM
A1VI39_DESVV/23-444FGFPILDRV-GHS.HFPKVGYMGGM....HLLSQVINTLL
NIFN_AZOVI/19-432AGFPQYDLL-GGF.QRCWSGYRGSS....QVLFDLANLLV
Q93T90_AZOBR/22-429MGLPMFDRL-GAG.LKVHVGYRGTR....ELLFEIGNLFL
Q6D2Z0_ERWCT/69-501LGFPLFDRH-HLH.RQTTWGYEGAM....SILTSLVNAVL
A6UWY4_META3/30-461TGFPVYDRV-GYS.RWPIMGYMGSL....RFFDELVNTIL
A7FRU8_CLOB1/32-416.LIPCVPYL-ED..LYGQIGYERIA....VLLSRMLKVYS
CHLB_NEPOL/11-429ISAPAHIQN-FPLSFRPFLGYEGTN....VVADLIYNTFR
A5N1T9_CLOK5/23-438LGFPVLDRY-GYY.YNPKIGYRGSM....RLIEMMCDAIL
A4FXN8_METM5/48-457.GVSSVMIH-SYE.NGPYIGFEGFV....NLAKDIYTAIY
Q3APV8_CHLCH/12-392AAFPGPIVR-RAL.GTPFMGHSGAI....YLLQEIVNALY
A7I7F3_METB6/23-439FGFPILDRA-VHP.LMPVVGYRGCL....RLIEQISNAFL

PF01497

Q4KAK8_PSEF5/33-281-..PVLANL.PAVINRRVYALGPSS---------------
B3EC07_CHLL2/105-346-..DSRYGLFRSVRERRVYNNNGSC---------------
A9KLK9_CLOPH/127-364-..PAYQNL.KAIKENKIYYLPKDL---------------
B9LI46_CHLSY/56-295-..PLWQQL.PAVQAQRVVEL.DRI---------------
A8LBT9_FRASN/61-297-..GAWKAL.PAVTSGKALGV..YC---------------
A6BYB2_YERPE/44-280-..PLWQSL.SFVRENQLRLLPPVW---------------
Q9HMG8_HALSA/70-339-..DTAGRI.TAVENGDVYRGGPIY---------------
Q03SI0_LACBA/39-270-..RMWSKM.AAVKHHRVYDLTEPT---------------
Q8TKF6_METAC/99-361-..PELSEI.PAVKNGNVYDC.FYP---------------
Q932C9_STAAM/51-279-..HTWQNI.EAVKKGHVISYKAED---------------
Q129U2_POLSJ/29-259-..PGWENV.NAVRNRQLFEIKSAE---------------
Q977T6_9ARCH/6-268-NDSRWNKL.RAVRERKVFAVDANS---------------
Q5E5H9_VIBF1/28-260