Sequence alignment for CL0606

PF18338

W4YGX9_STRPU/778-802---------------------------------------------------------------------------FDARA
A0A164K583_9CRUS/1415-1439---------------------------------------------------------------------------MVDQV
A0A0R2BEA3_LACCL/152-176---------------------------------------------------------------------------TNDTV
C3Z2D3_BRAFL/420-444---------------------------------------------------------------------------VEDDT
C3Z2D3_BRAFL/877-901---------------------------------------------------------------------------LQKNV
D5ASH8_RHOCB/922-946---------------------------------------------------------------------------VDATV
H1X8V3_WEICO/870-894---------------------------------------------------------------------------LDKNV
C3Z2D3_BRAFL/582-606---------------------------------------------------------------------------LSSDA
C3Z2D3_BRAFL/1308-1332---------------------------------------------------------------------------CVEDA
W4YGX9_STRPU/1217-1241---------------------------------------------------------------------------FVADA
C3Z2D3_BRAFL/834-858---------------------------------------------------------------------------LPEDI
D5ASH8_RHOCB/1310-1334---------------------------------------------------------------------------VDDTV

PF06715

Q9I1A6_PSEAE/560-583---------------------------------------------------------------------------GNYS-
B7MC63_ECO45/500-523---------------------------------------------------------------------------KNMD-
A1B4U8_PARDP/659-682---------------------------------------------------------------------------GNRS-
A1KCD6_AZOSB/526-549---------------------------------------------------------------------------HNET-
A1KCD6_AZOSB/550-573---------------------------------------------------------------------------NNRT-
A1TNU3_ACIAC/27-50---------------------------------------------------------------------------DNRD-
A1TSV3_ACIAC/576-599---------------------------------------------------------------------------HDET-
A1TTL1_ACIAC/575-598---------------------------------------------------------------------------GDET-
Q63II0_BURPS/556-579---------------------------------------------------------------------------GNET-
A3PPG7_RHOS1/643-666---------------------------------------------------------------------------ADDG-
A3RWD5_RALSL/563-586---------------------------------------------------------------------------HDRT-
A3RWD5_RALSL/587-610---------------------------------------------------------------------------HNES-
A3TYC3_PSEBH/604-629---------------------------------------------------------------------------GNYTE
A4BPI1_9GAMM/549-572---------------------------------------------------------------------------SNEN-
A4F0Z2_9RHOB/601-626---------------------------------------------------------------------------GNMTL
A0A0E1NRT2_YERPA/604-628---------------------------------------------------------------------------KDMS-
A4XUS4_PSEMY/609-632---------------------------------------------------------------------------SNEK-
A5G0B1_ACICJ/508-531---------------------------------------------------------------------------HDET-
A5G0B1_ACICJ/532-555---------------------------------------------------------------------------GNQT-
A5UJU3_METS3/757-781---------------------------------------------------------------------------ASVP-
A6G240_9DELT/539-562---------------------------------------------------------------------------EDER-
A6G240_9DELT/571-594---------------------------------------------------------------------------GSQS-
A6GA04_9DELT/587-610---------------------------------------------------------------------------GDVT-
A6GA04_9DELT/611-634---------------------------------------------------------------------------GNVT-
A6GKL4_9DELT/588-611---------------------------------------------------------------------------TALT-
A6V8C9_PSEA7/529-552---------------------------------------------------------------------------HDET-
A7JYH9_VIBAE/616-639---------------------------------------------------------------------------ADDN-
A7MQ29_CROS8/511-534---------------------------------------------------------------------------NDET-
A7MQ29_CROS8/551-574---------------------------------------------------------------------------QNRT-
A7XF92_9CAUD/451-474---------------------------------------------------------------------------GDDY-
A7XF92_9CAUD/475-498---------------------------------------------------------------------------GDAQ-
A7XF92_9CAUD/523-546---------------------------------------------------------------------------ANLT-
A7XF92_9CAUD/547-570---------------------------------------------------------------------------GNYD-
A8APK4_CITK8/520-543---------------------------------------------------------------------------HDHN-
B2JVS1_PARP8/526-549---------------------------------------------------------------------------GKET-
B2JVS1_PARP8/558-581---------------------------------------------------------------------------GNHT-
A0A0H2WS62_SALPA/462-485---------------------------------------------------------------------------GQLS-
Q747T8_GEOSL/527-550---------------------------------------------------------------------------RNES-
Q747T8_GEOSL/631-654---------------------------------------------------------------------------NNMS-
BP5_BPT4/460-483---------------------------------------------------------------------------GSEI-
BP5_BPT4/508-531---------------------------------------------------------------------------GNAD-
Q39YZ3_GEOMG/554-577---------------------------------------------------------------------------ANHT-
A0A0H3LI12_BORBR/506-529---------------------------------------------------------------------------RDMD-
A0A0H3LI12_BORBR/530-553---------------------------------------------------------------------------GNDT-
A0A0H3LI12_BORBR/578-601---------------------------------------------------------------------------GDVT-
Q02CG3_SOLUE/554-578---------------------------------------------------------------------------HDET-
Q0JYG5_CUPNH/526-549---------------------------------------------------------------------------GNET-
Q147B8_PARXL/544-567---------------------------------------------------------------------------HDES-
Q19CN7_9CAUD/506-529---------------------------------------------------------------------------GNYT-
Q1D312_MYXXD/559-582---------------------------------------------------------------------------GNQT-
Q1D312_MYXXD/647-670---------------------------------------------------------------------------AKKS-
Q2SGF0_HAHCH/606-629---------------------------------------------------------------------------GNAS-
Q2T8N2_BURTA/513-536---------------------------------------------------------------------------HDHS-
Q396B6_BURL3/516-539---------------------------------------------------------------------------NNHT-
Q3KAQ1_PSEPF/561-584---------------------------------------------------------------------------GNYT-
Q56BJ4_9CAUD/467-490---------------------------------------------------------------------------GDAF-
Q56EM5_9CAUD/445-468---------------------------------------------------------------------------GDDF-
Q5QBY1_9CAUD/489-512---------------------------------------------------------------------------GNET-
Q665A1_YERPS/630-655---------------------------------------------------------------------------GDRTV
Q6TFK3_PHOLU/550-573---------------------------------------------------------------------------GNYV-
Q6U9G4_9CAUD/549-572---------------------------------------------------------------------------GNYV-
NEEDL_BPKVM/291-314---------------------------------------------------------------------------GDLK-
NEEDL_BPKVM/339-362---------------------------------------------------------------------------QNVT-
NEEDL_BPKVM/363-386---------------------------------------------------------------------------GDYT-
Q76YN5_9CAUD/457-480---------------------------------------------------------------------------GDDY-
Q76YN5_9CAUD/481-504---------------------------------------------------------------------------GNAE-
Q76YN5_9CAUD/505-528---------------------------------------------------------------------------GNVQ-
Q76YN5_9CAUD/537-560---------------------------------------------------------------------------GNVN-
Q7Y4Y4_BPR69/462-485---------------------------------------------------------------------------ANEI-
Q7Y4Y4_BPR69/510-533---------------------------------------------------------------------------GNAD-
Q7Y4Y4_BPR69/534-557---------------------------------------------------------------------------GNVK-
Q87PW3_VIBPA/3143-3166---------------------------------------------------------------------------GSET-
Q87PW3_VIBPA/3332-3355---------------------------------------------------------------------------DTDS-
Q8SDG3_9CAUD/500-523---------------------------------------------------------------------------GNVN-
Q8W6M9_BPT2/9-32---------------------------------------------------------------------------DNLY-
Q8W6M9_BPT2/57-80---------------------------------------------------------------------------GDET-
Q8W6M9_BPT2/105-128---------------------------------------------------------------------------GNLS-
Q8XQT0_RALSO/605-629---------------------------------------------------------------------------AQST-
Q8XQT0_RALSO/631-655---------------------------------------------------------------------------GNMS-
Q8XQT0_RALSO/657-682---------------------------------------------------------------------------GDMSE
Q98IK7_RHILO/531-554---------------------------------------------------------------------------HNLD-
Q98IK7_RHILO/563-586---------------------------------------------------------------------------ANRS-

PF09089

FIB12_BPT4/246-326--------------------------------------TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADV
Q7Y2B4_BPR69/246-324--------------------------------------TGETLNGRGATGSMRGVVKLTTQAGVAPEGDSSGALAWNADV

PF07212

Q9A0M7_STRP1/65-337-------------NKPNIDGLATKVETAQKLQQ----KADKETVYTKAESKQELDKKLNLKGGVMTGQLKFKPAATVAYS
Q99ZZ7_STRP1/93-370-------------NKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESNAKLDEKLNLKGGVMTGQLQFKPNSGIKPS

PF12219

FIBER_BPK1F/756-910PDNRVSRDFRYGAVPNRAVPVFFDTNGVRTVPAPMEFTG-----DLGLGHVTIRASTSSNIRSEVLMEGEYGFIGKSIPT
A5VW57_9CAUD/663-817QEEFVSRDFVYGATPNRTLPTFMSTSGVRTVPVPVDFTD-----DVAVQSLTVHAGTSGQVRAEVKLEGNYAIIAKKVPS
FIBER_BPK1E/546-705NDNRVSRKFTYGATPGQAIPTFMGTDGIRNIPAPLYFSDNIVTEDTKVGHLTLKASTSANIRSEMQMEGEYGFIGKSVPK
O80102_9VIRU/694-851DHPYVSRDFKYGATPNRTIPVAMGVDGVRHVEAPLTFDNDVSVYSLHVTGLEYDGTQQSAVRAR--FDGDYGLISKTVPT
A4UUQ0_9VIRU/546-705NDSRVSRKFTYGATPGQAIPTFMGTDGIRTIPAPLHLSGEVVAADMTVEHLTLKASTSANIRSEMLMEREYGFIGKTIPK

PF18338

W4YGX9_STRPU/778-802VRHDVDTTITGTK-TFSDDIT-----------------------------------------------------------
A0A164K583_9CRUS/1415-1439VLKTGNQTVVAKK-TFLGDWD-----------------------------------------------------------
A0A0R2BEA3_LACCL/152-176VHTTGDETIDGQK-KFKTDPT-----------------------------------------------------------
C3Z2D3_BRAFL/420-444LTKTGDQVITGTK-TFTGNVT-----------------------------------------------------------
C3Z2D3_BRAFL/877-901VTLTTDQVITGQF-TFQSEVN-----------------------------------------------------------
D5ASH8_RHOCB/922-946VRTTGTQSIAGTK-TFSGALT-----------------------------------------------------------
H1X8V3_WEICO/870-894VHNSGNETVAGDK-TFTGNVS-----------------------------------------------------------
C3Z2D3_BRAFL/582-606MTVATPQNITGLV-TFTNNVM-----------------------------------------------------------
C3Z2D3_BRAFL/1308-1332VMVAGETVISGSK-HFLGPVT-----------------------------------------------------------
W4YGX9_STRPU/1217-1241VMLQGDRTITGSK-TFLDDVT-----------------------------------------------------------
C3Z2D3_BRAFL/834-858VTLTGDHNITGMK-TFHGGIT-----------------------------------------------------------
D5ASH8_RHOCB/1310-1334IRDSGAQSIAGTK-TFTGTLT-----------------------------------------------------------

PF06715

Q9I1A6_PSEAE/560-583HKVSGNFELTVDG-NLTIKVS-----------------------------------------------------------
B7MC63_ECO45/500-523TEVLNNRTTDVKA-DHTETIG-----------------------------------------------------------
A1B4U8_PARDP/659-682TNVAGNETVEVAG-NRSHKAG-----------------------------------------------------------
A1KCD6_AZOSB/526-549VTVGNDRTESVGN-NETISIG-----------------------------------------------------------
A1KCD6_AZOSB/550-573ESVGANETISVGG-NRAEDVG-----------------------------------------------------------
A1TNU3_ACIAC/27-50ETVGANEDIRIGS-NRSKTVG-----------------------------------------------------------
A1TSV3_ACIAC/576-599ISIGDNRNEDVGI-DETVSIG-----------------------------------------------------------
A1TTL1_ACIAC/575-598ITIHSNRTERVDH-NETISIG-----------------------------------------------------------
Q63II0_BURPS/556-579HGVAGNRTRQVGQ-NEAVTIG-----------------------------------------------------------
A3PPG7_RHOS1/643-666WTVGGSQTVSVGA-DQSVTVG-----------------------------------------------------------
A3RWD5_RALSL/563-586ETVDNNETITVHN-NRTERVD-----------------------------------------------------------
A3RWD5_RALSL/587-610ISIGDNRTEDVGQ-NETVSIG-----------------------------------------------------------
A3TYC3_PSEBH/604-629TVKQGNFAQTVKMGNYTQSID-----------------------------------------------------------
A4BPI1_9GAMM/549-572IIIGANRTESVGG-DETVNIA-----------------------------------------------------------
A4F0Z2_9RHOB/601-626DVDTGNLTETIAKGNHEETVS-----------------------------------------------------------
A0A0E1NRT2_YERPA/604-628TTVKDNQTTTVEKGNQTVTVE-----------------------------------------------------------
A4XUS4_PSEMY/609-632ISIGNNRTEDVGS-DESITIG-----------------------------------------------------------
A5G0B1_ACICJ/508-531RTIGNNRTVTVKK-DEAITVD-----------------------------------------------------------
A5G0B1_ACICJ/532-555ETVKGNRTFEVKQ-DHSETVD-----------------------------------------------------------
A5UJU3_METS3/757-781YTVNNNDTITVKSGNQTATIK-----------------------------------------------------------
A6G240_9DELT/539-562LLVGGSRSVQVAN-NQAITVG-----------------------------------------------------------
A6G240_9DELT/571-594VTVAQDRGLSVGG-SHTETVA-----------------------------------------------------------
A6GA04_9DELT/587-610ETFAANETRTISG-NQTEDVS-----------------------------------------------------------
A6GA04_9DELT/611-634QTVTGNTEHTVTG-NQTDSIT-----------------------------------------------------------
A6GKL4_9DELT/588-611ETVGATATQLVAA-AKTTTVG-----------------------------------------------------------
A6V8C9_PSEA7/529-552VHVKHDRTETVDN-NETITVH-----------------------------------------------------------
A7JYH9_VIBAE/616-639QTVGGNLTVSVKG-NTAYKAD-----------------------------------------------------------
A7MQ29_CROS8/511-534HSVGSNRTKTIGA-NETTTVK-----------------------------------------------------------
A7MQ29_CROS8/551-574ETVDGNETITIHS-NRTETVD-----------------------------------------------------------
A7XF92_9CAUD/451-474LIVKQGRKVNVKG-NLQVVVE-----------------------------------------------------------
A7XF92_9CAUD/475-498VYYMGNVMQTVDG-NVTEFIR-----------------------------------------------------------
A7XF92_9CAUD/523-546ANVKGNAELMIEG-NTTETIK-----------------------------------------------------------
A7XF92_9CAUD/547-570LTVEGNFNMTVNG-TKSDQVN-----------------------------------------------------------
A8APK4_CITK8/520-543ETVKNNQTITVGV-GQTINVG-----------------------------------------------------------
B2JVS1_PARP8/526-549HTVKGTRTLDVTG-DETHTNH-----------------------------------------------------------
B2JVS1_PARP8/558-581HKIDGNYTLKVGG-NLVIEVS-----------------------------------------------------------
A0A0H2WS62_SALPA/462-485TKVAGAMNVDVGG-TLTEKIA-----------------------------------------------------------
Q747T8_GEOSL/527-550LTVGNNRSKTVGV-DQSESVG-----------------------------------------------------------
Q747T8_GEOSL/631-654ENVKGDRTTNTNG-NYTETIS-----------------------------------------------------------
BP5_BPT4/460-483YYNMDNRLHQIDG-SNTIFVR-----------------------------------------------------------
BP5_BPT4/508-531ITVKGDATTLVEG-NQTNTVN-----------------------------------------------------------
Q39YZ3_GEOMG/554-577EIIGANKSISVGS-NKTETVG-----------------------------------------------------------
A0A0H3LI12_BORBR/506-529CEVEANESHTVDG-NRTTLIG-----------------------------------------------------------
A0A0H3LI12_BORBR/530-553LTVRGTRTTTIDG-LDTETFN-----------------------------------------------------------
A0A0H3LI12_BORBR/578-601ETVNGVETRTVNG-DWKETIT-----------------------------------------------------------
Q02CG3_SOLUE/554-578QTVTNNETITVEQGNQAIEIK-----------------------------------------------------------
Q0JYG5_CUPNH/526-549HKVSGTRQVKADG-DETHTSG-----------------------------------------------------------
Q147B8_PARXL/544-567HWVGNNRLKTIDG-NETVKVN-----------------------------------------------------------
Q19CN7_9CAUD/506-529LKIGGNFSTEVGG-SRTDDVS-----------------------------------------------------------
Q1D312_MYXXD/559-582LAVTQNRSTTVGG-NHTEAVA-----------------------------------------------------------
Q1D312_MYXXD/647-670ETVKGARTLQVGG-DLSEEVG-----------------------------------------------------------
Q2SGF0_HAHCH/606-629DSVAGNSSLSVGG-DHSVSVT-----------------------------------------------------------
Q2T8N2_BURTA/513-536HSVGNNETMSVAN-DRQRSVG-----------------------------------------------------------
Q396B6_BURL3/516-539HTVGNDETMQVKN-NRQRSVG-----------------------------------------------------------
Q3KAQ1_PSEPF/561-584DKVTGDYSLTVDG-NLTIKVS-----------------------------------------------------------
Q56BJ4_9CAUD/467-490IYNMGNVQQTVDG-NVTEFVR-----------------------------------------------------------
Q56EM5_9CAUD/445-468YIVKNNQNVHVGG-NLKFIVD-----------------------------------------------------------
Q5QBY1_9CAUD/489-512KTVEGDGTLIVKG-NVTVIVE-----------------------------------------------------------
Q665A1_YERPS/630-655TVATGNETTDITQGSLTETIK-----------------------------------------------------------
Q6TFK3_PHOLU/550-573VQIEGDKTLQVDG-NVAQKVQ-----------------------------------------------------------
Q6U9G4_9CAUD/549-572LKVGGNFSTEVGG-TRNDQVG-----------------------------------------------------------
NEEDL_BPKVM/291-314QHVKGNVDQHVEM-NVTQTVD-----------------------------------------------------------
NEEDL_BPKVM/339-362QTVDGDVNQTVGG-NVQSNVT-----------------------------------------------------------
NEEDL_BPKVM/363-386QNISGNYTITVGG-SMSESVS-----------------------------------------------------------
Q76YN5_9CAUD/457-480LIVKNGRNLNVKG-NLKVVIE-----------------------------------------------------------
Q76YN5_9CAUD/481-504LYYMGNVTQTIDG-NMTQMVR-----------------------------------------------------------
Q76YN5_9CAUD/505-528ETVEGSVNQHVVG-NVDQFIE-----------------------------------------------------------
Q76YN5_9CAUD/537-560QKIDGNVTQGIKG-NQTSSVD-----------------------------------------------------------
Q7Y4Y4_BPR69/462-485YYNMADRLHQIDG-SDTIFIR-----------------------------------------------------------
Q7Y4Y4_BPR69/510-533ILVKGDAKSQVEG-NHDYTVN-----------------------------------------------------------
Q7Y4Y4_BPR69/534-557WTVNGNVDMTVAG-NWSETMT-----------------------------------------------------------
Q87PW3_VIBPA/3143-3166VIASGSATVQSGG-AWTSNAM-----------------------------------------------------------
Q87PW3_VIBPA/3332-3355LVVLGSATVLVDG-TWTVDLD-----------------------------------------------------------
Q8SDG3_9CAUD/500-523QTVEGTANMHVVG-DVTAQLD-----------------------------------------------------------
Q8W6M9_BPT2/9-32DITNADGNFLVAG-DKKTNVG-----------------------------------------------------------
Q8W6M9_BPT2/57-80KTVEGNGTILVKG-NVTIVVE-----------------------------------------------------------
Q8W6M9_BPT2/105-128WKVAGTVDWDVGG-DWTEKMA-----------------------------------------------------------
Q8XQT0_RALSO/605-629QVLKGDRTILVSTGNHATEVS-----------------------------------------------------------
Q8XQT0_RALSO/631-655EAIQGDRTTLVAKGNHETTVS-----------------------------------------------------------
Q8XQT0_RALSO/657-682TVSLGDRTITVAKGNQATTVS-----------------------------------------------------------
Q98IK7_RHILO/531-554EDVGNNKTVKIGV-DQTTNIG-----------------------------------------------------------
Q98IK7_RHILO/563-586LTVMANETIHVVA-NSTENID-----------------------------------------------------------

PF09089

FIB12_BPT4/246-326IQQRGGQIIYGTL-RIEDTFTIANGGANITGTVRMTGGYI----------------------------------------
Q7Y2B4_BPR69/246-324INTRGGQTINGSL-NL-DHLT-ANGIWSRGGMWKNGDQPV----------------------------------------

PF07212

Q9A0M7_STRP1/65-337SSTGGAVNIDLSSTRGAGVVVYSDNDTSDGPLMSLRTGKETFNQSALFVDYKGTTNAVNIAMRQPTTPNFSSALNITSGN
Q99ZZ7_STRP1/93-370SSVGGAINIDMSKSEGAAMVMYTNKDTTDGPLMILRSNKDTFDQSVQFVDYKGTTNAVNIVMRQPTTPNFSSALNITSAN

PF12219

FIBER_BPK1F/756-910DNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVT
A5VW57_9CAUD/663-817DDVTAQRLIVSGGETTSSADGAMITLHGSRSSTPRRAVYNALEHLFENGDVKPYLDNVNALGGPGNRFSIVYLGSNPVVT
FIBER_BPK1E/546-705DKPTGQRLIICGGEGTSSSSGAQITLHGSNSSNAKRITYNGNEHLFQGAPIMPAVDNQFAAGGPSNRFTTIYLGSDPVTT
O80102_9VIRU/694-851KTPSRQRLIVSGGDGASSSDGALLQLYGSNHATPNRAIMYASGGFYSYNNFLPYLDSQVSLGSASNRWTTVYATTGTINT
A4UUQ0_9VIRU/546-705DNPTAQRVIISGGGGTAADTGAQITLHGAGSSTSRRAVYNANEHLFQSGAIMPYNDNVYPAGGPRNRFTTIHLTSDPIIT

PF18338

W4YGX9_STRPU/778-802--------------------------------------------------------------------------------
A0A164K583_9CRUS/1415-1439--------------------------------------------------------------------------------
A0A0R2BEA3_LACCL/152-176--------------------------------------------------------------------------------
C3Z2D3_BRAFL/420-444--------------------------------------------------------------------------------
C3Z2D3_BRAFL/877-901--------------------------------------------------------------------------------
D5ASH8_RHOCB/922-946--------------------------------------------------------------------------------
H1X8V3_WEICO/870-894--------------------------------------------------------------------------------
C3Z2D3_BRAFL/582-606--------------------------------------------------------------------------------
C3Z2D3_BRAFL/1308-1332--------------------------------------------------------------------------------
W4YGX9_STRPU/1217-1241--------------------------------------------------------------------------------
C3Z2D3_BRAFL/834-858--------------------------------------------------------------------------------
D5ASH8_RHOCB/1310-1334--------------------------------------------------------------------------------

PF06715

Q9I1A6_PSEAE/560-583--------------------------------------------------------------------------------
B7MC63_ECO45/500-523--------------------------------------------------------------------------------
A1B4U8_PARDP/659-682--------------------------------------------------------------------------------
A1KCD6_AZOSB/526-549--------------------------------------------------------------------------------
A1KCD6_AZOSB/550-573--------------------------------------------------------------------------------
A1TNU3_ACIAC/27-50--------------------------------------------------------------------------------
A1TSV3_ACIAC/576-599--------------------------------------------------------------------------------
A1TTL1_ACIAC/575-598--------------------------------------------------------------------------------
Q63II0_BURPS/556-579--------------------------------------------------------------------------------
A3PPG7_RHOS1/643-666--------------------------------------------------------------------------------
A3RWD5_RALSL/563-586--------------------------------------------------------------------------------
A3RWD5_RALSL/587-610--------------------------------------------------------------------------------
A3TYC3_PSEBH/604-629--------------------------------------------------------------------------------
A4BPI1_9GAMM/549-572--------------------------------------------------------------------------------
A4F0Z2_9RHOB/601-626--------------------------------------------------------------------------------
A0A0E1NRT2_YERPA/604-628--------------------------------------------------------------------------------
A4XUS4_PSEMY/609-632--------------------------------------------------------------------------------
A5G0B1_ACICJ/508-531--------------------------------------------------------------------------------
A5G0B1_ACICJ/532-555--------------------------------------------------------------------------------
A5UJU3_METS3/757-781--------------------------------------------------------------------------------
A6G240_9DELT/539-562--------------------------------------------------------------------------------
A6G240_9DELT/571-594--------------------------------------------------------------------------------
A6GA04_9DELT/587-610--------------------------------------------------------------------------------
A6GA04_9DELT/611-634--------------------------------------------------------------------------------
A6GKL4_9DELT/588-611--------------------------------------------------------------------------------
A6V8C9_PSEA7/529-552--------------------------------------------------------------------------------
A7JYH9_VIBAE/616-639--------------------------------------------------------------------------------
A7MQ29_CROS8/511-534--------------------------------------------------------------------------------
A7MQ29_CROS8/551-574--------------------------------------------------------------------------------
A7XF92_9CAUD/451-474--------------------------------------------------------------------------------
A7XF92_9CAUD/475-498--------------------------------------------------------------------------------
A7XF92_9CAUD/523-546--------------------------------------------------------------------------------
A7XF92_9CAUD/547-570--------------------------------------------------------------------------------
A8APK4_CITK8/520-543--------------------------------------------------------------------------------
B2JVS1_PARP8/526-549--------------------------------------------------------------------------------
B2JVS1_PARP8/558-581--------------------------------------------------------------------------------
A0A0H2WS62_SALPA/462-485--------------------------------------------------------------------------------
Q747T8_GEOSL/527-550--------------------------------------------------------------------------------
Q747T8_GEOSL/631-654--------------------------------------------------------------------------------
BP5_BPT4/460-483--------------------------------------------------------------------------------
BP5_BPT4/508-531--------------------------------------------------------------------------------
Q39YZ3_GEOMG/554-577--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/506-529--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/530-553--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/578-601--------------------------------------------------------------------------------
Q02CG3_SOLUE/554-578--------------------------------------------------------------------------------
Q0JYG5_CUPNH/526-549--------------------------------------------------------------------------------
Q147B8_PARXL/544-567--------------------------------------------------------------------------------
Q19CN7_9CAUD/506-529--------------------------------------------------------------------------------
Q1D312_MYXXD/559-582--------------------------------------------------------------------------------
Q1D312_MYXXD/647-670--------------------------------------------------------------------------------
Q2SGF0_HAHCH/606-629--------------------------------------------------------------------------------
Q2T8N2_BURTA/513-536--------------------------------------------------------------------------------
Q396B6_BURL3/516-539--------------------------------------------------------------------------------
Q3KAQ1_PSEPF/561-584--------------------------------------------------------------------------------
Q56BJ4_9CAUD/467-490--------------------------------------------------------------------------------
Q56EM5_9CAUD/445-468--------------------------------------------------------------------------------
Q5QBY1_9CAUD/489-512--------------------------------------------------------------------------------
Q665A1_YERPS/630-655--------------------------------------------------------------------------------
Q6TFK3_PHOLU/550-573--------------------------------------------------------------------------------
Q6U9G4_9CAUD/549-572--------------------------------------------------------------------------------
NEEDL_BPKVM/291-314--------------------------------------------------------------------------------
NEEDL_BPKVM/339-362--------------------------------------------------------------------------------
NEEDL_BPKVM/363-386--------------------------------------------------------------------------------
Q76YN5_9CAUD/457-480--------------------------------------------------------------------------------
Q76YN5_9CAUD/481-504--------------------------------------------------------------------------------
Q76YN5_9CAUD/505-528--------------------------------------------------------------------------------
Q76YN5_9CAUD/537-560--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/462-485--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/510-533--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/534-557--------------------------------------------------------------------------------
Q87PW3_VIBPA/3143-3166--------------------------------------------------------------------------------
Q87PW3_VIBPA/3332-3355--------------------------------------------------------------------------------
Q8SDG3_9CAUD/500-523--------------------------------------------------------------------------------
Q8W6M9_BPT2/9-32--------------------------------------------------------------------------------
Q8W6M9_BPT2/57-80--------------------------------------------------------------------------------
Q8W6M9_BPT2/105-128--------------------------------------------------------------------------------
Q8XQT0_RALSO/605-629--------------------------------------------------------------------------------
Q8XQT0_RALSO/631-655--------------------------------------------------------------------------------
Q8XQT0_RALSO/657-682--------------------------------------------------------------------------------
Q98IK7_RHILO/531-554--------------------------------------------------------------------------------
Q98IK7_RHILO/563-586--------------------------------------------------------------------------------

PF09089

FIB12_BPT4/246-326--------------------------------------------------------------------------------
Q7Y2B4_BPR69/246-324--------------------------------------------------------------------------------

PF07212

Q9A0M7_STRP1/65-337ENGSAMQLRGSEKALGTLKITHENPSIGADYDKNAAALSIDIVKKTNGA-GTAAQGIYINSTSGTTGKLLRIRNLSDDKF
Q99ZZ7_STRP1/93-370EGGSAMQIRGVEKALGTLKITHENPSVDKEYDKNAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLNDDKF

PF12219

FIBER_BPK1F/756-910--------------------------------------------------------------------------------
A5VW57_9CAUD/663-817--------------------------------------------------------------------------------
FIBER_BPK1E/546-705--------------------------------------------------------------------------------
O80102_9VIRU/694-851--------------------------------------------------------------------------------
A4UUQ0_9VIRU/546-705--------------------------------------------------------------------------------

PF18338

W4YGX9_STRPU/778-802---------------------------------------------------
A0A164K583_9CRUS/1415-1439---------------------------------------------------
A0A0R2BEA3_LACCL/152-176---------------------------------------------------
C3Z2D3_BRAFL/420-444---------------------------------------------------
C3Z2D3_BRAFL/877-901---------------------------------------------------
D5ASH8_RHOCB/922-946---------------------------------------------------
H1X8V3_WEICO/870-894---------------------------------------------------
C3Z2D3_BRAFL/582-606---------------------------------------------------
C3Z2D3_BRAFL/1308-1332---------------------------------------------------
W4YGX9_STRPU/1217-1241---------------------------------------------------
C3Z2D3_BRAFL/834-858---------------------------------------------------
D5ASH8_RHOCB/1310-1334---------------------------------------------------

PF06715

Q9I1A6_PSEAE/560-583---------------------------------------------------
B7MC63_ECO45/500-523---------------------------------------------------
A1B4U8_PARDP/659-682---------------------------------------------------
A1KCD6_AZOSB/526-549---------------------------------------------------
A1KCD6_AZOSB/550-573---------------------------------------------------
A1TNU3_ACIAC/27-50---------------------------------------------------
A1TSV3_ACIAC/576-599---------------------------------------------------
A1TTL1_ACIAC/575-598---------------------------------------------------
Q63II0_BURPS/556-579---------------------------------------------------
A3PPG7_RHOS1/643-666---------------------------------------------------
A3RWD5_RALSL/563-586---------------------------------------------------
A3RWD5_RALSL/587-610---------------------------------------------------
A3TYC3_PSEBH/604-629---------------------------------------------------
A4BPI1_9GAMM/549-572---------------------------------------------------
A4F0Z2_9RHOB/601-626---------------------------------------------------
A0A0E1NRT2_YERPA/604-628---------------------------------------------------
A4XUS4_PSEMY/609-632---------------------------------------------------
A5G0B1_ACICJ/508-531---------------------------------------------------
A5G0B1_ACICJ/532-555---------------------------------------------------
A5UJU3_METS3/757-781---------------------------------------------------
A6G240_9DELT/539-562---------------------------------------------------
A6G240_9DELT/571-594---------------------------------------------------
A6GA04_9DELT/587-610---------------------------------------------------
A6GA04_9DELT/611-634---------------------------------------------------
A6GKL4_9DELT/588-611---------------------------------------------------
A6V8C9_PSEA7/529-552---------------------------------------------------
A7JYH9_VIBAE/616-639---------------------------------------------------
A7MQ29_CROS8/511-534---------------------------------------------------
A7MQ29_CROS8/551-574---------------------------------------------------
A7XF92_9CAUD/451-474---------------------------------------------------
A7XF92_9CAUD/475-498---------------------------------------------------
A7XF92_9CAUD/523-546---------------------------------------------------
A7XF92_9CAUD/547-570---------------------------------------------------
A8APK4_CITK8/520-543---------------------------------------------------
B2JVS1_PARP8/526-549---------------------------------------------------
B2JVS1_PARP8/558-581---------------------------------------------------
A0A0H2WS62_SALPA/462-485---------------------------------------------------
Q747T8_GEOSL/527-550---------------------------------------------------
Q747T8_GEOSL/631-654---------------------------------------------------
BP5_BPT4/460-483---------------------------------------------------
BP5_BPT4/508-531---------------------------------------------------
Q39YZ3_GEOMG/554-577---------------------------------------------------
A0A0H3LI12_BORBR/506-529---------------------------------------------------
A0A0H3LI12_BORBR/530-553---------------------------------------------------
A0A0H3LI12_BORBR/578-601---------------------------------------------------
Q02CG3_SOLUE/554-578---------------------------------------------------
Q0JYG5_CUPNH/526-549---------------------------------------------------
Q147B8_PARXL/544-567---------------------------------------------------
Q19CN7_9CAUD/506-529---------------------------------------------------
Q1D312_MYXXD/559-582---------------------------------------------------
Q1D312_MYXXD/647-670---------------------------------------------------
Q2SGF0_HAHCH/606-629---------------------------------------------------
Q2T8N2_BURTA/513-536---------------------------------------------------
Q396B6_BURL3/516-539---------------------------------------------------
Q3KAQ1_PSEPF/561-584---------------------------------------------------
Q56BJ4_9CAUD/467-490---------------------------------------------------
Q56EM5_9CAUD/445-468---------------------------------------------------
Q5QBY1_9CAUD/489-512---------------------------------------------------
Q665A1_YERPS/630-655---------------------------------------------------
Q6TFK3_PHOLU/550-573---------------------------------------------------
Q6U9G4_9CAUD/549-572---------------------------------------------------
NEEDL_BPKVM/291-314---------------------------------------------------
NEEDL_BPKVM/339-362---------------------------------------------------
NEEDL_BPKVM/363-386---------------------------------------------------
Q76YN5_9CAUD/457-480---------------------------------------------------
Q76YN5_9CAUD/481-504---------------------------------------------------
Q76YN5_9CAUD/505-528---------------------------------------------------
Q76YN5_9CAUD/537-560---------------------------------------------------
Q7Y4Y4_BPR69/462-485---------------------------------------------------
Q7Y4Y4_BPR69/510-533---------------------------------------------------
Q7Y4Y4_BPR69/534-557---------------------------------------------------
Q87PW3_VIBPA/3143-3166---------------------------------------------------
Q87PW3_VIBPA/3332-3355---------------------------------------------------
Q8SDG3_9CAUD/500-523---------------------------------------------------
Q8W6M9_BPT2/9-32---------------------------------------------------
Q8W6M9_BPT2/57-80---------------------------------------------------
Q8W6M9_BPT2/105-128---------------------------------------------------
Q8XQT0_RALSO/605-629---------------------------------------------------
Q8XQT0_RALSO/631-655---------------------------------------------------
Q8XQT0_RALSO/657-682---------------------------------------------------
Q98IK7_RHILO/531-554---------------------------------------------------
Q98IK7_RHILO/563-586---------------------------------------------------

PF09089

FIB12_BPT4/246-326---------------------------------------------------
Q7Y2B4_BPR69/246-324---------------------------------------------------

PF07212

Q9A0M7_STRP1/65-337YVKSDGGFYAKETSQIDGNLKLKDPTANDHAATKAYVDKAISELKKLILKK
Q99ZZ7_STRP1/93-370YVKPDGGFYAKETSQIDGNLKLKDPIANDHAATKAYVDGEVEKLKALLAAK

PF12219

FIBER_BPK1F/756-910---------------------------------------------------
A5VW57_9CAUD/663-817---------------------------------------------------
FIBER_BPK1E/546-705---------------------------------------------------
O80102_9VIRU/694-851---------------------------------------------------
A4UUQ0_9VIRU/546-705---------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window