Sequence alignment for CL0606

PF07212

Q9A0M7_STRP1/65-337NKPNIDGLATKVETAQKLQQ....KADKETVYTKAESKQELDKKLNLKGGVMTGQLKFKPAATVAYSSSTGGAVNIDLSS
Q99ZZ7_STRP1/93-370NKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESNAKLDEKLNLKGGVMTGQLQFKPNSGIKPSSSVGGAINIDMSK

PF06715

Q9I1A6_PSEAE/560-583--------------------------------------------------------------------------------
B7MC63_ECO45/500-523--------------------------------------------------------------------------------
A1B4U8_PARDP/659-682--------------------------------------------------------------------------------
A1KCD6_AZOSB/526-549--------------------------------------------------------------------------------
A1KCD6_AZOSB/550-573--------------------------------------------------------------------------------
A1TNU3_ACIAC/27-50--------------------------------------------------------------------------------
A1TSV3_ACIAC/576-599--------------------------------------------------------------------------------
A1TTL1_ACIAC/575-598--------------------------------------------------------------------------------
Q63II0_BURPS/556-579--------------------------------------------------------------------------------
A3PPG7_RHOS1/643-666--------------------------------------------------------------------------------
A3RWD5_RALSL/563-586--------------------------------------------------------------------------------
A3RWD5_RALSL/587-610--------------------------------------------------------------------------------
A3TYC3_PSEBH/604-629--------------------------------------------------------------------------------
A4BPI1_9GAMM/549-572--------------------------------------------------------------------------------
A4F0Z2_9RHOB/601-626--------------------------------------------------------------------------------
A0A0E1NRT2_YERPA/604-628--------------------------------------------------------------------------------
A4XUS4_PSEMY/609-632--------------------------------------------------------------------------------
A5G0B1_ACICJ/508-531--------------------------------------------------------------------------------
A5G0B1_ACICJ/532-555--------------------------------------------------------------------------------
A5UJU3_METS3/757-781--------------------------------------------------------------------------------
A6G240_9DELT/539-562--------------------------------------------------------------------------------
A6G240_9DELT/571-594--------------------------------------------------------------------------------
A6GA04_9DELT/587-610--------------------------------------------------------------------------------
A6GA04_9DELT/611-634--------------------------------------------------------------------------------
A6GKL4_9DELT/588-611--------------------------------------------------------------------------------
A6V8C9_PSEA7/529-552--------------------------------------------------------------------------------
A7JYH9_VIBAE/616-639--------------------------------------------------------------------------------
A7MQ29_CROS8/511-534--------------------------------------------------------------------------------
A7MQ29_CROS8/551-574--------------------------------------------------------------------------------
A7XF92_9CAUD/451-474--------------------------------------------------------------------------------
A7XF92_9CAUD/475-498--------------------------------------------------------------------------------
A7XF92_9CAUD/523-546--------------------------------------------------------------------------------
A7XF92_9CAUD/547-570--------------------------------------------------------------------------------
A8APK4_CITK8/520-543--------------------------------------------------------------------------------
B2JVS1_PARP8/526-549--------------------------------------------------------------------------------
B2JVS1_PARP8/558-581--------------------------------------------------------------------------------
A0A0H2WS62_SALPA/462-485--------------------------------------------------------------------------------
Q747T8_GEOSL/527-550--------------------------------------------------------------------------------
Q747T8_GEOSL/631-654--------------------------------------------------------------------------------
BP5_BPT4/460-483--------------------------------------------------------------------------------
BP5_BPT4/508-531--------------------------------------------------------------------------------
Q39YZ3_GEOMG/554-577--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/506-529--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/530-553--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/578-601--------------------------------------------------------------------------------
Q02CG3_SOLUE/554-578--------------------------------------------------------------------------------
Q0JYG5_CUPNH/526-549--------------------------------------------------------------------------------
Q147B8_BURXL/544-567--------------------------------------------------------------------------------
Q19CN7_9CAUD/506-529--------------------------------------------------------------------------------
Q1D312_MYXXD/559-582--------------------------------------------------------------------------------
Q1D312_MYXXD/647-670--------------------------------------------------------------------------------
Q2SGF0_HAHCH/606-629--------------------------------------------------------------------------------
Q2T8N2_BURTA/513-536--------------------------------------------------------------------------------
Q396B6_BURL3/516-539--------------------------------------------------------------------------------
Q3KAQ1_PSEPF/561-584--------------------------------------------------------------------------------
Q56BJ4_9CAUD/467-490--------------------------------------------------------------------------------
Q56EM5_9CAUD/445-468--------------------------------------------------------------------------------
Q5QBY1_9CAUD/489-512--------------------------------------------------------------------------------
Q665A1_YERPS/630-655--------------------------------------------------------------------------------
Q6TFK3_PHOLU/550-573--------------------------------------------------------------------------------
Q6U9G4_9CAUD/549-572--------------------------------------------------------------------------------
NEEDL_BPKVM/291-314--------------------------------------------------------------------------------
NEEDL_BPKVM/339-362--------------------------------------------------------------------------------
NEEDL_BPKVM/363-386--------------------------------------------------------------------------------
Q76YN5_9CAUD/457-480--------------------------------------------------------------------------------
Q76YN5_9CAUD/481-504--------------------------------------------------------------------------------
Q76YN5_9CAUD/505-528--------------------------------------------------------------------------------
Q76YN5_9CAUD/537-560--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/462-485--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/510-533--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/534-557--------------------------------------------------------------------------------
Q87PW3_VIBPA/3143-3166--------------------------------------------------------------------------------
Q87PW3_VIBPA/3332-3355--------------------------------------------------------------------------------
Q8SDG3_9CAUD/500-523--------------------------------------------------------------------------------
Q8W6M9_BPT2/9-32--------------------------------------------------------------------------------
Q8W6M9_BPT2/57-80--------------------------------------------------------------------------------
Q8W6M9_BPT2/105-128--------------------------------------------------------------------------------
Q8XQT0_RALSO/605-629--------------------------------------------------------------------------------
Q8XQT0_RALSO/631-655--------------------------------------------------------------------------------
Q8XQT0_RALSO/657-682--------------------------------------------------------------------------------
Q98IK7_RHILO/531-554--------------------------------------------------------------------------------
Q98IK7_RHILO/563-586--------------------------------------------------------------------------------

PF09089

FIB12_BPT4/246-326TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVI-------------------------------------
Q7Y2B4_BPR69/246-324TGETLNGRGATGSMRGVVKLTTQAGVAPEGDSSGALAWNADVI-------------------------------------

PF12219

FIBER_BPK1F/756-910PDNRVSRDFRYGAVPNRAVPVFFDTNGVRTVPAPMEFTG.....DLGLGHVTIRASTSSNIRSEVLMEGEYGFIGKSIPT
A5VW57_9CAUD/663-817QEEFVSRDFVYGATPNRTLPTFMSTSGVRTVPVPVDFTD.....DVAVQSLTVHAGTSGQVRAEVKLEGNYAIIAKKVPS
FIBER_BPK1E/546-705NDNRVSRKFTYGATPGQAIPTFMGTDGIRNIPAPLYFSDNIVTEDTKVGHLTLKASTSANIRSEMQMEGEYGFIGKSVPK
O80102_9VIRU/694-851DHPYVSRDFKYGATPNRTIPVAMGVDGVRHVEAPLTFDNDVSVYSLHVTGLEYDGTQQSAVRAR..FDGDYGLISKTVPT
A4UUQ0_9VIRU/546-705NDSRVSRKFTYGATPGQAIPTFMGTDGIRTIPAPLHLSGEVVAADMTVEHLTLKASTSANIRSEMLMEREYGFIGKTIPK

PF07212

Q9A0M7_STRP1/65-337TRGAGVVVYSDNDTSDGPLMSLRTGKETFNQSALFVDYKGTTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQLRGSEK
Q99ZZ7_STRP1/93-370SEGAAMVMYTNKDTTDGPLMILRSNKDTFDQSVQFVDYKGTTNAVNIVMRQPTTPNFSSALNITSANEGGSAMQIRGVEK

PF06715

Q9I1A6_PSEAE/560-583--------------------------------------------------------------------------------
B7MC63_ECO45/500-523--------------------------------------------------------------------------------
A1B4U8_PARDP/659-682--------------------------------------------------------------------------------
A1KCD6_AZOSB/526-549--------------------------------------------------------------------------------
A1KCD6_AZOSB/550-573--------------------------------------------------------------------------------
A1TNU3_ACIAC/27-50--------------------------------------------------------------------------------
A1TSV3_ACIAC/576-599--------------------------------------------------------------------------------
A1TTL1_ACIAC/575-598--------------------------------------------------------------------------------
Q63II0_BURPS/556-579--------------------------------------------------------------------------------
A3PPG7_RHOS1/643-666--------------------------------------------------------------------------------
A3RWD5_RALSL/563-586--------------------------------------------------------------------------------
A3RWD5_RALSL/587-610--------------------------------------------------------------------------------
A3TYC3_PSEBH/604-629--------------------------------------------------------------------------------
A4BPI1_9GAMM/549-572--------------------------------------------------------------------------------
A4F0Z2_9RHOB/601-626--------------------------------------------------------------------------------
A0A0E1NRT2_YERPA/604-628--------------------------------------------------------------------------------
A4XUS4_PSEMY/609-632--------------------------------------------------------------------------------
A5G0B1_ACICJ/508-531--------------------------------------------------------------------------------
A5G0B1_ACICJ/532-555--------------------------------------------------------------------------------
A5UJU3_METS3/757-781--------------------------------------------------------------------------------
A6G240_9DELT/539-562--------------------------------------------------------------------------------
A6G240_9DELT/571-594--------------------------------------------------------------------------------
A6GA04_9DELT/587-610--------------------------------------------------------------------------------
A6GA04_9DELT/611-634--------------------------------------------------------------------------------
A6GKL4_9DELT/588-611--------------------------------------------------------------------------------
A6V8C9_PSEA7/529-552--------------------------------------------------------------------------------
A7JYH9_VIBAE/616-639--------------------------------------------------------------------------------
A7MQ29_CROS8/511-534--------------------------------------------------------------------------------
A7MQ29_CROS8/551-574--------------------------------------------------------------------------------
A7XF92_9CAUD/451-474--------------------------------------------------------------------------------
A7XF92_9CAUD/475-498--------------------------------------------------------------------------------
A7XF92_9CAUD/523-546--------------------------------------------------------------------------------
A7XF92_9CAUD/547-570--------------------------------------------------------------------------------
A8APK4_CITK8/520-543--------------------------------------------------------------------------------
B2JVS1_PARP8/526-549--------------------------------------------------------------------------------
B2JVS1_PARP8/558-581--------------------------------------------------------------------------------
A0A0H2WS62_SALPA/462-485--------------------------------------------------------------------------------
Q747T8_GEOSL/527-550--------------------------------------------------------------------------------
Q747T8_GEOSL/631-654--------------------------------------------------------------------------------
BP5_BPT4/460-483--------------------------------------------------------------------------------
BP5_BPT4/508-531--------------------------------------------------------------------------------
Q39YZ3_GEOMG/554-577--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/506-529--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/530-553--------------------------------------------------------------------------------
A0A0H3LI12_BORBR/578-601--------------------------------------------------------------------------------
Q02CG3_SOLUE/554-578--------------------------------------------------------------------------------
Q0JYG5_CUPNH/526-549--------------------------------------------------------------------------------
Q147B8_BURXL/544-567--------------------------------------------------------------------------------
Q19CN7_9CAUD/506-529--------------------------------------------------------------------------------
Q1D312_MYXXD/559-582--------------------------------------------------------------------------------
Q1D312_MYXXD/647-670--------------------------------------------------------------------------------
Q2SGF0_HAHCH/606-629--------------------------------------------------------------------------------
Q2T8N2_BURTA/513-536--------------------------------------------------------------------------------
Q396B6_BURL3/516-539--------------------------------------------------------------------------------
Q3KAQ1_PSEPF/561-584--------------------------------------------------------------------------------
Q56BJ4_9CAUD/467-490--------------------------------------------------------------------------------
Q56EM5_9CAUD/445-468--------------------------------------------------------------------------------
Q5QBY1_9CAUD/489-512--------------------------------------------------------------------------------
Q665A1_YERPS/630-655--------------------------------------------------------------------------------
Q6TFK3_PHOLU/550-573--------------------------------------------------------------------------------
Q6U9G4_9CAUD/549-572--------------------------------------------------------------------------------
NEEDL_BPKVM/291-314--------------------------------------------------------------------------------
NEEDL_BPKVM/339-362--------------------------------------------------------------------------------
NEEDL_BPKVM/363-386--------------------------------------------------------------------------------
Q76YN5_9CAUD/457-480--------------------------------------------------------------------------------
Q76YN5_9CAUD/481-504--------------------------------------------------------------------------------
Q76YN5_9CAUD/505-528--------------------------------------------------------------------------------
Q76YN5_9CAUD/537-560--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/462-485--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/510-533--------------------------------------------------------------------------------
Q7Y4Y4_BPR69/534-557--------------------------------------------------------------------------------
Q87PW3_VIBPA/3143-3166--------------------------------------------------------------------------------
Q87PW3_VIBPA/3332-3355--------------------------------------------------------------------------------
Q8SDG3_9CAUD/500-523--------------------------------------------------------------------------------
Q8W6M9_BPT2/9-32--------------------------------------------------------------------------------
Q8W6M9_BPT2/57-80--------------------------------------------------------------------------------
Q8W6M9_BPT2/105-128--------------------------------------------------------------------------------
Q8XQT0_RALSO/605-629--------------------------------------------------------------------------------
Q8XQT0_RALSO/631-655--------------------------------------------------------------------------------
Q8XQT0_RALSO/657-682--------------------------------------------------------------------------------
Q98IK7_RHILO/531-554--------------------------------------------------------------------------------
Q98IK7_RHILO/563-586--------------------------------------------------------------------------------

PF09089

FIB12_BPT4/246-326--------------------------------------------------------------------------------
Q7Y2B4_BPR69/246-324--------------------------------------------------------------------------------

PF12219

FIBER_BPK1F/756-910DNPAGQRIIFC---------------------------------------------------------------------
A5VW57_9CAUD/663-817DDVTAQRLIVS---------------------------------------------------------------------
FIBER_BPK1E/546-705DKPTGQRLIIC---------------------------------------------------------------------
O80102_9VIRU/694-851KTPSRQRLIVS---------------------------------------------------------------------
A4UUQ0_9VIRU/546-705DNPTAQRVIIS---------------------------------------------------------------------

PF07212

Q9A0M7_STRP1/65-337ALGTLKITHENPSIGADYDKNAAALSIDIVKKTNGA.GTAAQGIYINSTSGTTGKLLRIRNLSDDKFYVKSDGGFYAKET
Q99ZZ7_STRP1/93-370ALGTLKITHENPSVDKEYDKNAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLNDDKFYVKPDGGFYAKET

PF06715

Q9I1A6_PSEAE/560-583----------------------------------------------------------------------------GNYS
B7MC63_ECO45/500-523----------------------------------------------------------------------------KNMD
A1B4U8_PARDP/659-682----------------------------------------------------------------------------GNRS
A1KCD6_AZOSB/526-549----------------------------------------------------------------------------HNET
A1KCD6_AZOSB/550-573----------------------------------------------------------------------------NNRT
A1TNU3_ACIAC/27-50----------------------------------------------------------------------------DNRD
A1TSV3_ACIAC/576-599----------------------------------------------------------------------------HDET
A1TTL1_ACIAC/575-598----------------------------------------------------------------------------GDET
Q63II0_BURPS/556-579----------------------------------------------------------------------------GNET
A3PPG7_RHOS1/643-666----------------------------------------------------------------------------ADDG
A3RWD5_RALSL/563-586----------------------------------------------------------------------------HDRT
A3RWD5_RALSL/587-610----------------------------------------------------------------------------HNES
A3TYC3_PSEBH/604-629----------------------------------------------------------------------------GNYT
A4BPI1_9GAMM/549-572----------------------------------------------------------------------------SNEN
A4F0Z2_9RHOB/601-626----------------------------------------------------------------------------GNMT
A0A0E1NRT2_YERPA/604-628----------------------------------------------------------------------------KDMS
A4XUS4_PSEMY/609-632----------------------------------------------------------------------------SNEK
A5G0B1_ACICJ/508-531----------------------------------------------------------------------------HDET
A5G0B1_ACICJ/532-555----------------------------------------------------------------------------GNQT
A5UJU3_METS3/757-781----------------------------------------------------------------------------ASVP
A6G240_9DELT/539-562----------------------------------------------------------------------------EDER
A6G240_9DELT/571-594----------------------------------------------------------------------------GSQS
A6GA04_9DELT/587-610----------------------------------------------------------------------------GDVT
A6GA04_9DELT/611-634----------------------------------------------------------------------------GNVT
A6GKL4_9DELT/588-611----------------------------------------------------------------------------TALT
A6V8C9_PSEA7/529-552----------------------------------------------------------------------------HDET
A7JYH9_VIBAE/616-639----------------------------------------------------------------------------ADDN
A7MQ29_CROS8/511-534----------------------------------------------------------------------------NDET
A7MQ29_CROS8/551-574----------------------------------------------------------------------------QNRT
A7XF92_9CAUD/451-474----------------------------------------------------------------------------GDDY
A7XF92_9CAUD/475-498----------------------------------------------------------------------------GDAQ
A7XF92_9CAUD/523-546----------------------------------------------------------------------------ANLT
A7XF92_9CAUD/547-570----------------------------------------------------------------------------GNYD
A8APK4_CITK8/520-543----------------------------------------------------------------------------HDHN
B2JVS1_PARP8/526-549----------------------------------------------------------------------------GKET
B2JVS1_PARP8/558-581----------------------------------------------------------------------------GNHT
A0A0H2WS62_SALPA/462-485----------------------------------------------------------------------------GQLS
Q747T8_GEOSL/527-550----------------------------------------------------------------------------RNES
Q747T8_GEOSL/631-654----------------------------------------------------------------------------NNMS
BP5_BPT4/460-483----------------------------------------------------------------------------GSEI
BP5_BPT4/508-531----------------------------------------------------------------------------GNAD
Q39YZ3_GEOMG/554-577----------------------------------------------------------------------------ANHT
A0A0H3LI12_BORBR/506-529----------------------------------------------------------------------------RDMD
A0A0H3LI12_BORBR/530-553----------------------------------------------------------------------------GNDT
A0A0H3LI12_BORBR/578-601----------------------------------------------------------------------------GDVT
Q02CG3_SOLUE/554-578----------------------------------------------------------------------------HDET
Q0JYG5_CUPNH/526-549----------------------------------------------------------------------------GNET
Q147B8_BURXL/544-567----------------------------------------------------------------------------HDES
Q19CN7_9CAUD/506-529----------------------------------------------------------------------------GNYT
Q1D312_MYXXD/559-582----------------------------------------------------------------------------GNQT
Q1D312_MYXXD/647-670----------------------------------------------------------------------------AKKS
Q2SGF0_HAHCH/606-629----------------------------------------------------------------------------GNAS
Q2T8N2_BURTA/513-536----------------------------------------------------------------------------HDHS
Q396B6_BURL3/516-539----------------------------------------------------------------------------NNHT
Q3KAQ1_PSEPF/561-584----------------------------------------------------------------------------GNYT
Q56BJ4_9CAUD/467-490----------------------------------------------------------------------------GDAF
Q56EM5_9CAUD/445-468----------------------------------------------------------------------------GDDF
Q5QBY1_9CAUD/489-512----------------------------------------------------------------------------GNET
Q665A1_YERPS/630-655----------------------------------------------------------------------------GDRT
Q6TFK3_PHOLU/550-573----------------------------------------------------------------------------GNYV
Q6U9G4_9CAUD/549-572----------------------------------------------------------------------------GNYV
NEEDL_BPKVM/291-314----------------------------------------------------------------------------GDLK
NEEDL_BPKVM/339-362----------------------------------------------------------------------------QNVT
NEEDL_BPKVM/363-386----------------------------------------------------------------------------GDYT
Q76YN5_9CAUD/457-480----------------------------------------------------------------------------GDDY
Q76YN5_9CAUD/481-504----------------------------------------------------------------------------GNAE
Q76YN5_9CAUD/505-528----------------------------------------------------------------------------GNVQ
Q76YN5_9CAUD/537-560----------------------------------------------------------------------------GNVN
Q7Y4Y4_BPR69/462-485----------------------------------------------------------------------------ANEI
Q7Y4Y4_BPR69/510-533----------------------------------------------------------------------------GNAD
Q7Y4Y4_BPR69/534-557----------------------------------------------------------------------------GNVK
Q87PW3_VIBPA/3143-3166----------------------------------------------------------------------------GSET
Q87PW3_VIBPA/3332-3355----------------------------------------------------------------------------DTDS
Q8SDG3_9CAUD/500-523----------------------------------------------------------------------------GNVN
Q8W6M9_BPT2/9-32----------------------------------------------------------------------------DNLY
Q8W6M9_BPT2/57-80----------------------------------------------------------------------------GDET
Q8W6M9_BPT2/105-128----------------------------------------------------------------------------GNLS
Q8XQT0_RALSO/605-629----------------------------------------------------------------------------AQST
Q8XQT0_RALSO/631-655----------------------------------------------------------------------------GNMS
Q8XQT0_RALSO/657-682----------------------------------------------------------------------------GDMS
Q98IK7_RHILO/531-554----------------------------------------------------------------------------HNLD
Q98IK7_RHILO/563-586----------------------------------------------------------------------------ANRS

PF09089

FIB12_BPT4/246-326----------------------------------------------------------------------------QQRG
Q7Y2B4_BPR69/246-324----------------------------------------------------------------------------NTRG

PF12219

FIBER_BPK1F/756-910----------------------------------------------------------------------------GGEG
A5VW57_9CAUD/663-817----------------------------------------------------------------------------GGET
FIBER_BPK1E/546-705----------------------------------------------------------------------------GGEG
O80102_9VIRU/694-851----------------------------------------------------------------------------GGDG
A4UUQ0_9VIRU/546-705----------------------------------------------------------------------------GGGG

PF07212

Q9A0M7_STRP1/65-337-SQIDGNLKL------KDPTANDHAATKAYVDKAISELKKLILKK---------------------------
Q99ZZ7_STRP1/93-370-SQIDGNLKL------KDPIANDHAATKAYVDGEVEKLKALLAAK---------------------------

PF06715

Q9I1A6_PSEAE/560-583.HKVSGNFEL------TVDG.NLTIKVS--------------------------------------------
B7MC63_ECO45/500-523.TEVLNNRTT------DVKA.DHTETIG--------------------------------------------
A1B4U8_PARDP/659-682.TNVAGNETV------EVAG.NRSHKAG--------------------------------------------
A1KCD6_AZOSB/526-549.VTVGNDRTE------SVGN.NETISIG--------------------------------------------
A1KCD6_AZOSB/550-573.ESVGANETI------SVGG.NRAEDVG--------------------------------------------
A1TNU3_ACIAC/27-50.ETVGANEDI------RIGS.NRSKTVG--------------------------------------------
A1TSV3_ACIAC/576-599.ISIGDNRNE------DVGI.DETVSIG--------------------------------------------
A1TTL1_ACIAC/575-598.ITIHSNRTE------RVDH.NETISIG--------------------------------------------
Q63II0_BURPS/556-579.HGVAGNRTR------QVGQ.NEAVTIG--------------------------------------------
A3PPG7_RHOS1/643-666.WTVGGSQTV------SVGA.DQSVTVG--------------------------------------------
A3RWD5_RALSL/563-586.ETVDNNETI------TVHN.NRTERVD--------------------------------------------
A3RWD5_RALSL/587-610.ISIGDNRTE------DVGQ.NETVSIG--------------------------------------------
A3TYC3_PSEBH/604-629ETVKQGNFAQ------TVKMGNYTQSID--------------------------------------------
A4BPI1_9GAMM/549-572.IIIGANRTE------SVGG.DETVNIA--------------------------------------------
A4F0Z2_9RHOB/601-626LDVDTGNLTE------TIAKGNHEETVS--------------------------------------------
A0A0E1NRT2_YERPA/604-628.TTVKDNQTT------TVEKGNQTVTVE--------------------------------------------
A4XUS4_PSEMY/609-632.ISIGNNRTE------DVGS.DESITIG--------------------------------------------
A5G0B1_ACICJ/508-531.RTIGNNRTV------TVKK.DEAITVD--------------------------------------------
A5G0B1_ACICJ/532-555.ETVKGNRTF------EVKQ.DHSETVD--------------------------------------------
A5UJU3_METS3/757-781.YTVNNNDTI------TVKSGNQTATIK--------------------------------------------
A6G240_9DELT/539-562.LLVGGSRSV------QVAN.NQAITVG--------------------------------------------
A6G240_9DELT/571-594.VTVAQDRGL------SVGG.SHTETVA--------------------------------------------
A6GA04_9DELT/587-610.ETFAANETR------TISG.NQTEDVS--------------------------------------------
A6GA04_9DELT/611-634.QTVTGNTEH------TVTG.NQTDSIT--------------------------------------------
A6GKL4_9DELT/588-611.ETVGATATQ------LVAA.AKTTTVG--------------------------------------------
A6V8C9_PSEA7/529-552.VHVKHDRTE------TVDN.NETITVH--------------------------------------------
A7JYH9_VIBAE/616-639.QTVGGNLTV------SVKG.NTAYKAD--------------------------------------------
A7MQ29_CROS8/511-534.HSVGSNRTK------TIGA.NETTTVK--------------------------------------------
A7MQ29_CROS8/551-574.ETVDGNETI------TIHS.NRTETVD--------------------------------------------
A7XF92_9CAUD/451-474.LIVKQGRKV------NVKG.NLQVVVE--------------------------------------------
A7XF92_9CAUD/475-498.VYYMGNVMQ------TVDG.NVTEFIR--------------------------------------------
A7XF92_9CAUD/523-546.ANVKGNAEL------MIEG.NTTETIK--------------------------------------------
A7XF92_9CAUD/547-570.LTVEGNFNM------TVNG.TKSDQVN--------------------------------------------
A8APK4_CITK8/520-543.ETVKNNQTI------TVGV.GQTINVG--------------------------------------------
B2JVS1_PARP8/526-549.HTVKGTRTL------DVTG.DETHTNH--------------------------------------------
B2JVS1_PARP8/558-581.HKIDGNYTL------KVGG.NLVIEVS--------------------------------------------
A0A0H2WS62_SALPA/462-485.TKVAGAMNV------DVGG.TLTEKIA--------------------------------------------
Q747T8_GEOSL/527-550.LTVGNNRSK------TVGV.DQSESVG--------------------------------------------
Q747T8_GEOSL/631-654.ENVKGDRTT------NTNG.NYTETIS--------------------------------------------
BP5_BPT4/460-483.YYNMDNRLH------QIDG.SNTIFVR--------------------------------------------
BP5_BPT4/508-531.ITVKGDATT------LVEG.NQTNTVN--------------------------------------------
Q39YZ3_GEOMG/554-577.EIIGANKSI------SVGS.NKTETVG--------------------------------------------
A0A0H3LI12_BORBR/506-529.CEVEANESH------TVDG.NRTTLIG--------------------------------------------
A0A0H3LI12_BORBR/530-553.LTVRGTRTT------TIDG.LDTETFN--------------------------------------------
A0A0H3LI12_BORBR/578-601.ETVNGVETR------TVNG.DWKETIT--------------------------------------------
Q02CG3_SOLUE/554-578.QTVTNNETI------TVEQGNQAIEIK--------------------------------------------
Q0JYG5_CUPNH/526-549.HKVSGTRQV------KADG.DETHTSG--------------------------------------------
Q147B8_BURXL/544-567.HWVGNNRLK------TIDG.NETVKVN--------------------------------------------
Q19CN7_9CAUD/506-529.LKIGGNFST------EVGG.SRTDDVS--------------------------------------------
Q1D312_MYXXD/559-582.LAVTQNRST------TVGG.NHTEAVA--------------------------------------------
Q1D312_MYXXD/647-670.ETVKGARTL------QVGG.DLSEEVG--------------------------------------------
Q2SGF0_HAHCH/606-629.DSVAGNSSL------SVGG.DHSVSVT--------------------------------------------
Q2T8N2_BURTA/513-536.HSVGNNETM------SVAN.DRQRSVG--------------------------------------------
Q396B6_BURL3/516-539.HTVGNDETM------QVKN.NRQRSVG--------------------------------------------
Q3KAQ1_PSEPF/561-584.DKVTGDYSL------TVDG.NLTIKVS--------------------------------------------
Q56BJ4_9CAUD/467-490.IYNMGNVQQ------TVDG.NVTEFVR--------------------------------------------
Q56EM5_9CAUD/445-468.YIVKNNQNV------HVGG.NLKFIVD--------------------------------------------
Q5QBY1_9CAUD/489-512.KTVEGDGTL------IVKG.NVTVIVE--------------------------------------------
Q665A1_YERPS/630-655VTVATGNETT------DITQGSLTETIK--------------------------------------------
Q6TFK3_PHOLU/550-573.VQIEGDKTL------QVDG.NVAQKVQ--------------------------------------------
Q6U9G4_9CAUD/549-572.LKVGGNFST------EVGG.TRNDQVG--------------------------------------------
NEEDL_BPKVM/291-314.QHVKGNVDQ------HVEM.NVTQTVD--------------------------------------------
NEEDL_BPKVM/339-362.QTVDGDVNQ------TVGG.NVQSNVT--------------------------------------------
NEEDL_BPKVM/363-386.QNISGNYTI------TVGG.SMSESVS--------------------------------------------
Q76YN5_9CAUD/457-480.LIVKNGRNL------NVKG.NLKVVIE--------------------------------------------
Q76YN5_9CAUD/481-504.LYYMGNVTQ------TIDG.NMTQMVR--------------------------------------------
Q76YN5_9CAUD/505-528.ETVEGSVNQ------HVVG.NVDQFIE--------------------------------------------
Q76YN5_9CAUD/537-560.QKIDGNVTQ------GIKG.NQTSSVD--------------------------------------------
Q7Y4Y4_BPR69/462-485.YYNMADRLH------QIDG.SDTIFIR--------------------------------------------
Q7Y4Y4_BPR69/510-533.ILVKGDAKS------QVEG.NHDYTVN--------------------------------------------
Q7Y4Y4_BPR69/534-557.WTVNGNVDM------TVAG.NWSETMT--------------------------------------------
Q87PW3_VIBPA/3143-3166.VIASGSATV------QSGG.AWTSNAM--------------------------------------------
Q87PW3_VIBPA/3332-3355.LVVLGSATV------LVDG.TWTVDLD--------------------------------------------
Q8SDG3_9CAUD/500-523.QTVEGTANM------HVVG.DVTAQLD--------------------------------------------
Q8W6M9_BPT2/9-32.DITNADGNF------LVAG.DKKTNVG--------------------------------------------
Q8W6M9_BPT2/57-80.KTVEGNGTI------LVKG.NVTIVVE--------------------------------------------
Q8W6M9_BPT2/105-128.WKVAGTVDW------DVGG.DWTEKMA--------------------------------------------
Q8XQT0_RALSO/605-629.QVLKGDRTI------LVSTGNHATEVS--------------------------------------------
Q8XQT0_RALSO/631-655.EAIQGDRTT------LVAKGNHETTVS--------------------------------------------
Q8XQT0_RALSO/657-682ETVSLGDRTI------TVAKGNQATTVS--------------------------------------------
Q98IK7_RHILO/531-554.EDVGNNKTV------KIGV.DQTTNIG--------------------------------------------
Q98IK7_RHILO/563-586.LTVMANETI------HVVA.NSTENID--------------------------------------------

PF09089

FIB12_BPT4/246-326GQIIYGTLRIEDTFTIANGGANITGTVRMTGGYI--------------------------------------
Q7Y2B4_BPR69/246-324GQTINGSLNL.DHLT.ANGIWSRGGMWKNGDQPV--------------------------------------

PF12219

FIBER_BPK1F/756-910-TSSTTGAQI------TLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVT
A5VW57_9CAUD/663-817-TSSADGAMI------TLHGSRSSTPRRAVYNALEHLFENGDVKPYLDNVNALGGPGNRFSIVYLGSNPVVT
FIBER_BPK1E/546-705-TSSSSGAQI------TLHGSNSSNAKRITYNGNEHLFQGAPIMPAVDNQFAAGGPSNRFTTIYLGSDPVTT
O80102_9VIRU/694-851-ASSSDGALL------QLYGSNHATPNRAIMYASGGFYSYNNFLPYLDSQVSLGSASNRWTTVYATTGTINT
A4UUQ0_9VIRU/546-705-TAADTGAQI------TLHGAGSSTSRRAVYNANEHLFQSGAIMPYNDNVYPAGGPRNRFTTIHLTSDPIIT

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window