# STOCKHOLM 1.0 #=GF ID L71 #=GF AC PF02448.16 #=GF DE L71 family #=GF AU Bateman A;0000-0002-6982-4660 #=GF GA 25.0 25.0 #=GF NC 22.0 17.2 #=GF TC 25.4 31.8 #=GF SE Pfam-B_1976 (release 5.4) #=GF BM hmmbuild --amino HMM.ann SEED.ann #=GF SM hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq #=GF TP Family #=GF RN [1] #=GF RM 8568884 #=GF RT Molecular characterization of the 71E late puff in Drosophila #=GF RT melanogaster reveals a family of novel genes. #=GF RA Wright LG, Chen T, Thummel CS, Guild GM; #=GF RL J Mol Biol 1996;255:387-400. #=GF DR INTERPRO; IPR003475; #=GF DR SO; 0100021; polypeptide_conserved_region; #=GF CC This family of insect proteins are each about 100 amino acids #=GF CC long and have 6 conserved cysteine residues. They all have a #=GF CC predicted signal peptide and are probably excreted. The function #=GF CC of the proteins is unknown [1]. #=GF SQ 5 Q9VUT0.1/28-94 FCDRLFANCLREQPTVGTRDDTVDLFNSYCGRNN--R-NWRKLTRCELVKASCIVTMVRCENGSCKNVAD Q9VUT2.2/31-97 ICIRTYDKCIENEARLGKQDDTSKFFNDYCRRSD--S-GWSDVSRCDLLRIACLSTVRDCETPTCKNVAH Q24077.1/24-90 NCTRLRENCRPCTRRLVDPINDLEFINSDCREKLRGRWIWRDVRRCDMQIVACENHETR---LDCENVAR Q9VUS6.1/26-94 ICRQENETCRRNERRLGVQNDVSTTFNNHCRRQSGIR-NWRNVSRCELSLATCRLTLERCAVINCKNVRN Q27364.2/25-91 ICRRIVARCESRVVRNGRNNDISNIFNENCRRTQ--R-NWREISRCELAKANCILTLERCNTLSCENVRR //