# STOCKHOLM 1.0
#=GF ID   RRM_4
#=GF AC   PF10598.10
#=GF DE   RNA recognition motif of the spliceosomal PrP8
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   Chen X
#=GF GA   23.50 23.50;
#=GF TC   24.70 26.00;
#=GF NC   22.40 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cut_ga HMM metaseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   15840809
#=GF RT   Prp8 protein: at the heart of the spliceosome. 
#=GF RA   Grainger RJ, Beggs JD; 
#=GF RL   RNA. 2005;11:533-557.
#=GF RN   [2]
#=GF RM   16431982
#=GF RT   Dissection of Prp8 protein defines multiple interactions with
#=GF RT   crucial RNA sequences in the catalytic core of the spliceosome. 
#=GF RA   Turner IA, Norman CM, Churcher MJ, Newman AJ; 
#=GF RL   RNA. 2006;12:375-386.
#=GF DR   INTERPRO; IPR019582;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   The large RNA-protein complex of the spliceosome catalyses
#=GF CC   pre-mRNA splicing. One of the most conserved core proteins is
#=GF CC   PrP8 which occupies a central position in the catalytic core of
#=GF CC   the spliceosome, and has been implicated in several crucial
#=GF CC   molecular rearrangements that occur there, and has recently come
#=GF CC   under the spotlight for its role in the inherited human disease,
#=GF CC   Retinitis Pigmentosa [1]. The RNA-recognition motif of PrP8 is
#=GF CC   highly conserved and provides a possible RNA binding centre for
#=GF CC   the 5-prime SS, BP, or 3-prime SS of pre-mRNA which are known to
#=GF CC   contact with Prp8. The most conserved regions of an RRM are
#=GF CC   defined as the RNP1 and RNP2 sequences. Recognition of RNA
#=GF CC   targets can also be modulated by a number of other factors, most
#=GF CC   notably the two loops beta1-alpha1, beta2-beta3 and the amino
#=GF CC   acid residues C-terminal to the RNP2 domain [2].
#=GF SQ   7
#=GS EBR58676.1/127-217 DE [subseq from] hypothetical protein GOS_7574327 [marine metagenome]
#=GS ECR97079.1/73-163  DE [subseq from] hypothetical protein GOS_3074303 [marine metagenome]
#=GS ECS54722.1/151-241 DE [subseq from] hypothetical protein GOS_4276057 [marine metagenome]
#=GS EBS14950.1/46-136  DE [subseq from] hypothetical protein GOS_7483282 [marine metagenome]
#=GS ECH17558.1/106-196 DE [subseq from] hypothetical protein GOS_6326947 [marine metagenome]
#=GS EBP33407.1/270-319 DE [subseq from] hypothetical protein GOS_7928109 [marine metagenome]
#=GS ECP09394.1/262-297 DE [subseq from] hypothetical protein GOS_6366765 [marine metagenome]
EBR58676.1/127-217         EKVDLTMLNRLLRLIVDHNIADYCTAKNNVIIAYKDMSHTNSYGMIRGLQFASFLTQYYGLVLDLLVLGLTRASEIAGPPQMPNEFINYRD-
ECR97079.1/73-163          EKVDLTMLNRLLRLIVDHNIADYCTAKNNVIIAYKDMSHTNSYGMIRGLQFASFLTQYYGLVLDLLVLGLTRASEIAGPPQMPNEFISYRD-
ECS54722.1/151-241         EKVDLTLLNRLLRLILDHNLADYMTAKNNVNITFKDMNHTNSYGIVRGLQFASFVMQYYGLMLDLLVLGLTRASEIAGPPAVPNEFLAFRD-
EBS14950.1/46-136          EKVDLTLLNRLMRLIVDHNIADYCTAKNNVVISYKDMSHTNSYGMIRGLQFASFMTQYYGLVLDLLLLGLTRASEIAGPANMPNEFISFRD-
ECH17558.1/106-196         EKVDLTLLNRLLRLIVDHNLADYMTAKNNVVISYKDMSHTNSYGLLRGLQFASFLGQYYGLVLDLLVLGLTRSSEIAGPPNIPNDFLCFKD-
EBP33407.1/270-319         DKVDITLLNRLLRLIMDHNLADYITAKNNVSIVWKDMAHVNSYGLIRGLQ------------------------------------------
ECP09394.1/262-297         EKIDLTLLNRLLRLIMDQNIADYITAKNNVVLNYKD--------------------------------------------------------
#=GC PP_cons               89***************************************************************************************87.
#=GC RF                    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
//