# STOCKHOLM 1.0 #=GF ID WVELL #=GF AC PF14043.7 #=GF DE WVELL protein #=GF AU Eberhardt R;0000-0001-6152-1369 #=GF GA 27.0 27.0 #=GF NC 22.3 19.9 #=GF TC 51.0 50.8 #=GF SE Jackhmmer:O31578 #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq #=GF TP Family #=GF DR INTERPRO; IPR026952; #=GF DR SO; 0100021; polypeptide_conserved_region; #=GF CC This family includes the B. subtilis YfjH protein Swiss:O31578, #=GF CC which is functionally uncharacterised. This is not a homologue #=GF CC of E. coli YfjH, a synonym for IscX, which belongs to #=GF CC Pfam:PF04384. This family of proteins is found in bacteria. #=GF CC Proteins in this family are approximately 90 amino acids in #=GF CC length and contain a highly conserved WVELL motif. #=GF SQ 2 Q9KEC5.1/4-76 RFERLAEQLLKANNHLSYGQARTWVESLWEDFESTRAKAGRTYKGQDMTEQIVLKWIEQYGPYLHQYKPSGHK O31578.1/4-74 YIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSR-- //