Sequence alignment for CL0030

PF02386

TRKG_ECOLI/38-485--------------------------------------------------------------------------------
TRKH_HAEIN/35-487--------------------------------------------------------------------------------
Q9HPA9_HALSA/77-556--------------------------------------------------------------------------------
O83176_TREPA/103-567--------------------------------------------------------------------------------
Y460_MYCPN/24-557--------------------------------------------------------------------------------
TRK1_SCHPO/316-816--------------------------------------------------------------------------------
TRK2_YEAST/301-846--------------------------------------------------------------------------------
TRK2_SCHPO/354-857--------------------------------------------------------------------------------
TRK1_YEAST/624-1180--------------------------------------------------------------------------------

PF03814

E3GJV8_9FIRM/5-557--------------------------------------------------------------------------------
R4KGK3_CLOPA/7-555--------------------------------------------------------------------------------
X4ZCZ5_9BACL/10-554--------------------------------------------------------------------------------
I2BB55_SHIBC/11-556--------------------------------------------------------------------------------
D2B153_STRRD/14-551--------------------------------------------------------------------------------
A7I6Q1_METB6/235-800--------------------------------------------------------------------------------
Q6F8C8_ACIAD/9-565--------------------------------------------------------------------------------
KDPA_BACCR/7-552--------------------------------------------------------------------------------
KDPA_PARD8/9-566--------------------------------------------------------------------------------
T0LA52_9EURY/11-544--------------------------------------------------------------------------------
Q4JUS0_CORJK/12-549--------------------------------------------------------------------------------
I4D2C5_DESAJ/10-560--------------------------------------------------------------------------------
D3F9I8_CONWI/10-571--------------------------------------------------------------------------------
B8GER2_METPE/14-556--------------------------------------------------------------------------------
E3JBQ1_FRAIE/12-552--------------------------------------------------------------------------------
R4TDT9_9PSEU/13-552--------------------------------------------------------------------------------
A0A6N4SSD6_CYTH3/25-575--------------------------------------------------------------------------------
G8X3F4_STREN/12-552--------------------------------------------------------------------------------
KDPA_DESVH/10-561--------------------------------------------------------------------------------
F9ZTB8_ACICS/11-575--------------------------------------------------------------------------------
A4FMI7_SACEN/14-552--------------------------------------------------------------------------------
KDPA_MAGSA/10-548--------------------------------------------------------------------------------
L0DLW9_SINAD/14-575--------------------------------------------------------------------------------
KDPA_METPP/10-570--------------------------------------------------------------------------------
H8KMI0_SOLCM/10-568--------------------------------------------------------------------------------
F0S640_PSESL/9-559--------------------------------------------------------------------------------
A0LLJ6_SYNFM/11-602--------------------------------------------------------------------------------
KDPA_PECAS/12-556--------------------------------------------------------------------------------
KDPA_THEAC/28-571--------------------------------------------------------------------------------
R6BHA4_9CLOT/5-583--------------------------------------------------------------------------------
KDPA_DEIRA/9-559--------------------------------------------------------------------------------
K9Q855_9NOSO/9-574--------------------------------------------------------------------------------
K9V7P3_9CYAN/9-555--------------------------------------------------------------------------------
F8L2P0_PARAV/10-555--------------------------------------------------------------------------------
KDPA_LISMO/10-557--------------------------------------------------------------------------------
Q6L2R0_PICTO/23-567--------------------------------------------------------------------------------
D1Z017_METPS/13-542--------------------------------------------------------------------------------
E3GWW4_METFV/10-558--------------------------------------------------------------------------------
I3THP9_TISMK/10-558--------------------------------------------------------------------------------
C6VYG5_DYAFD/9-559--------------------------------------------------------------------------------
KDPA_PSESM/10-560--------------------------------------------------------------------------------
U5QJ68_9CYAN/10-567--------------------------------------------------------------------------------
D9R2J7_CLOSW/10-558--------------------------------------------------------------------------------
G7M3P7_9CLOT/7-555--------------------------------------------------------------------------------
F4KRB0_HALH1/9-568--------------------------------------------------------------------------------
J7QUT1_METSZ/10-561--------------------------------------------------------------------------------
T0N7P9_9EURY/29-575--------------------------------------------------------------------------------
I4ETN2_9ACTN/13-566--------------------------------------------------------------------------------
KDPA_LEPIN/9-549--------------------------------------------------------------------------------
C7Q1T1_CATAD/12-560--------------------------------------------------------------------------------
F5XJD1_MICPN/12-552--------------------------------------------------------------------------------
A7HRV4_PARL1/16-556--------------------------------------------------------------------------------
KDPA_STAA8/4-555--------------------------------------------------------------------------------
R5UVN1_9BACT/10-563--------------------------------------------------------------------------------
C7LZF2_ACIFD/8-557--------------------------------------------------------------------------------
I3TDE3_THEC1/12-531--------------------------------------------------------------------------------
J7U1A2_MORMO/10-556--------------------------------------------------------------------------------
KDPA_METNO/10-559--------------------------------------------------------------------------------
K7WVS0_9NOST/9-560--------------------------------------------------------------------------------
KDPA_CAUVC/10-560--------------------------------------------------------------------------------
S5Z0Q6_PARAH/9-553--------------------------------------------------------------------------------
KDPA_SOLUE/10-559--------------------------------------------------------------------------------
E0UCQ4_GLOV7/9-555--------------------------------------------------------------------------------
D7BJD8_MEISD/5-565--------------------------------------------------------------------------------
T0LT74_9EURY/28-573--------------------------------------------------------------------------------
B1WPS5_CROS5/10-555--------------------------------------------------------------------------------
D7A9S5_STAND/10-561--------------------------------------------------------------------------------
KDPA_RHOCS/10-561--------------------------------------------------------------------------------
V6F0K6_MAGGM/10-558--------------------------------------------------------------------------------
KDPA_GLOVI/10-566--------------------------------------------------------------------------------
A0JW40_ARTS2/13-553--------------------------------------------------------------------------------
KDPA_AGRVS/10-560--------------------------------------------------------------------------------
K9PBZ4_CYAGP/8-552--------------------------------------------------------------------------------
D2UFZ8_XANAP/7-575--------------------------------------------------------------------------------
E8U851_DEIML/5-570--------------------------------------------------------------------------------
J9Z8M5_LEPFM/10-559--------------------------------------------------------------------------------
KDPA_STRCO/12-552--------------------------------------------------------------------------------
I0K505_9BACT/9-568--------------------------------------------------------------------------------
C8XB13_NAKMY/15-551--------------------------------------------------------------------------------
E4T7V0_PALPW/11-556--------------------------------------------------------------------------------
KDPA_CLOAB/7-555--------------------------------------------------------------------------------
KDPA_LARHH/11-562--------------------------------------------------------------------------------
KDPA_ACIC5/10-582--------------------------------------------------------------------------------
E3I291_RHOVT/10-561--------------------------------------------------------------------------------
E4NDZ7_KITSK/13-552--------------------------------------------------------------------------------
F8AWS9_9ACTN/16-552--------------------------------------------------------------------------------
V5XHA6_MYCNE/12-554--------------------------------------------------------------------------------
W0PFX0_9BURK/11-559--------------------------------------------------------------------------------
G8TYY4_SULAD/10-560--------------------------------------------------------------------------------
KDPA_YERPE/10-556--------------------------------------------------------------------------------
E6STC1_BACT6/10-566--------------------------------------------------------------------------------
A9HGI8_GLUDA/24-574--------------------------------------------------------------------------------
KDPA_KINRD/13-552--------------------------------------------------------------------------------
KDPA_KORVE/10-583--------------------------------------------------------------------------------
G7ZDN7_AZOL4/10-561--------------------------------------------------------------------------------
KDPA_SORC5/10-576--------------------------------------------------------------------------------
B7J712_ACIF2/10-575--------------------------------------------------------------------------------
H1YB12_9SPHI/10-568--------------------------------------------------------------------------------
C7PUT0_CHIPD/9-567--------------------------------------------------------------------------------
KDPA_DESDA/9-579--------------------------------------------------------------------------------
K9RWG4_SYNP3/9-555--------------------------------------------------------------------------------
KDPA_STAEQ/4-554--------------------------------------------------------------------------------
KDPA_CLAMS/12-556--------------------------------------------------------------------------------
KDPA_SYNY3/9-555--------------------------------------------------------------------------------
KDPA_KLEP7/11-556--------------------------------------------------------------------------------
K9Z7H8_CYAAP/9-557--------------------------------------------------------------------------------
D1CGX3_THET1/8-561--------------------------------------------------------------------------------
E2Q1F7_STRCL/12-553--------------------------------------------------------------------------------
W8EUK3_9BACT/12-563--------------------------------------------------------------------------------
K9TR50_9CYAN/9-555--------------------------------------------------------------------------------
W0EX99_9BACT/9-563--------------------------------------------------------------------------------
C6D691_PAESJ/7-556--------------------------------------------------------------------------------
B3EAQ3_GEOLS/13-570--------------------------------------------------------------------------------
K9VVM6_9CYAN/9-559--------------------------------------------------------------------------------
K9X7N8_9CHRO/9-556--------------------------------------------------------------------------------
I3Y5A2_THIV6/11-568--------------------------------------------------------------------------------
W5WRB9_9PSEU/12-552--------------------------------------------------------------------------------
F4C4K6_SPHS2/10-559--------------------------------------------------------------------------------
D9QG06_BRESC/10-560--------------------------------------------------------------------------------
A8HY16_AZOC5/10-561--------------------------------------------------------------------------------
Q186E7_CLOD6/11-560--------------------------------------------------------------------------------
KDPA_TOLAT/12-560--------------------------------------------------------------------------------
U5LJM5_9BACI/9-555--------------------------------------------------------------------------------
KDPA_BEII9/10-560--------------------------------------------------------------------------------
KDPA_ANADE/10-573--------------------------------------------------------------------------------
E8X5C7_GRATM/10-587--------------------------------------------------------------------------------
C5C4A0_BEUC1/16-557--------------------------------------------------------------------------------
K8GCZ3_9CYAN/9-558--------------------------------------------------------------------------------
D0IYN9_COMT2/9-559--------------------------------------------------------------------------------
E0SEX9_DICD3/10-555--------------------------------------------------------------------------------
R6RMK4_9FIRM/8-574--------------------------------------------------------------------------------
F4F4Y7_VERMA/14-551--------------------------------------------------------------------------------
A8KYG3_FRASN/13-567--------------------------------------------------------------------------------
E1VQU5_9GAMM/5-576--------------------------------------------------------------------------------
C6XZL6_PEDHD/9-568--------------------------------------------------------------------------------
B7J714_ACIF2/9-575--------------------------------------------------------------------------------
E8RRM4_ASTEC/14-564--------------------------------------------------------------------------------
K0CGH7_ALCDB/5-555--------------------------------------------------------------------------------
K8E2F1_CARML/9-558--------------------------------------------------------------------------------
D3EAK4_GEOS4/7-556--------------------------------------------------------------------------------
D5WU10_KYRT2/12-563--------------------------------------------------------------------------------
G8TDF8_NIAKG/9-568--------------------------------------------------------------------------------
KDPA_HYDS0/11-568--------------------------------------------------------------------------------
D7DKK2_METV0/11-584--------------------------------------------------------------------------------
R6PVD9_9CLOT/5-571--------------------------------------------------------------------------------
F2IFU1_FLUTR/9-571--------------------------------------------------------------------------------
F7QKE7_9BRAD/10-559--------------------------------------------------------------------------------
KDPA_MICAN/9-574--------------------------------------------------------------------------------
S0EVD3_CHTCT/10-589--------------------------------------------------------------------------------
KDPA_RHIME/11-561--------------------------------------------------------------------------------
D5AKZ2_RHOCB/10-560--------------------------------------------------------------------------------
C9R8E6_AMMDK/12-560--------------------------------------------------------------------------------
C6W8P0_ACTMD/12-539--------------------------------------------------------------------------------
Q09AH8_STIAD/10-563--------------------------------------------------------------------------------
C4KYL4_EXISA/11-542--------------------------------------------------------------------------------
KDPA_PSEAE/10-560--------------------------------------------------------------------------------
A0KED5_AERHH/10-553--------------------------------------------------------------------------------
E9T4H3_RHOHA/12-565--------------------------------------------------------------------------------
Q31MM1_SYNE7/10-552--------------------------------------------------------------------------------
KDPA_NOSS1/9-555--------------------------------------------------------------------------------
K9UDW3_CHAP6/9-563--------------------------------------------------------------------------------
KDPA_HALSA/11-578--------------------------------------------------------------------------------
W0A4I8_9SPHN/10-559--------------------------------------------------------------------------------
KDPA_RHORT/10-561--------------------------------------------------------------------------------
R6NNJ3_9FIRM/5-564--------------------------------------------------------------------------------
D3RSD8_ALLVD/5-565--------------------------------------------------------------------------------
I0H1S8_ACTM4/10-547--------------------------------------------------------------------------------
KDPA_GEOKA/9-557--------------------------------------------------------------------------------
KDPA_CALS4/9-558--------------------------------------------------------------------------------
D2Q289_KRIFD/12-553--------------------------------------------------------------------------------
K9RK69_9CYAN/10-555--------------------------------------------------------------------------------
KDPA_ALIAD/10-559--------------------------------------------------------------------------------
B6JA58_OLICO/10-557--------------------------------------------------------------------------------
D3PV93_STANL/12-552--------------------------------------------------------------------------------
H1ZCI8_MYROD/9-559--------------------------------------------------------------------------------
H9ZZC9_FERFK/11-532--------------------------------------------------------------------------------
KDPA_FLAPJ/10-570--------------------------------------------------------------------------------
A5FU08_ACICJ/10-556--------------------------------------------------------------------------------
K9Y0M2_STAC7/9-555--------------------------------------------------------------------------------
C0ZIZ1_BREBN/7-554--------------------------------------------------------------------------------
D6ZE64_SEGRD/12-555--------------------------------------------------------------------------------
H7C701_ENTFA/10-555--------------------------------------------------------------------------------
F4CT92_PSEUX/12-552--------------------------------------------------------------------------------
E8V6X7_TERSS/10-579--------------------------------------------------------------------------------
KDPA_PHOLL/10-561--------------------------------------------------------------------------------
KDPA_MYCTU/10-568--------------------------------------------------------------------------------
J7J1Q1_DESMD/10-560--------------------------------------------------------------------------------
D5UVP7_TSUPD/12-549--------------------------------------------------------------------------------
U5RTG7_9CLOT/7-555--------------------------------------------------------------------------------
D1BAQ9_SANKS/14-555--------------------------------------------------------------------------------
L0ABX1_CALLD/9-533--------------------------------------------------------------------------------
KDPA_GRABC/10-560--------------------------------------------------------------------------------
C9A6Y5_ENTCA/10-555--------------------------------------------------------------------------------
W0I187_9GAMM/10-555--------------------------------------------------------------------------------
B8ESF4_METSB/10-566--------------------------------------------------------------------------------
KDPA_METB6/11-574--------------------------------------------------------------------------------
D5SYH3_PLAL2/10-576--------------------------------------------------------------------------------
D7B3X9_NOCDD/11-556--------------------------------------------------------------------------------
E3EDK0_PAEPS/7-556--------------------------------------------------------------------------------
B8GSR6_THISH/5-564--------------------------------------------------------------------------------
A5N882_CLOK5/5-568--------------------------------------------------------------------------------
H6NGX7_9BACL/8-552--------------------------------------------------------------------------------
KDPA_ECOLI/10-556--------------------------------------------------------------------------------
R5W702_9BACT/12-563--------------------------------------------------------------------------------
KDPA_HERA2/10-575--------------------------------------------------------------------------------

PF08016

PKD1_MOUSE/3701-4103SQAFLAITRSDEFWPWMSHVFLPYV-----HGNQS------------SPELGPPRLRQVRLQEA----FCPDPSSSEHM-
PKD2_MOUSE/265-685KTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHT-QADNRSFIFYENLLLGVPRLRQLRVRNG--SCSIPQDLRDEIKE
Q8T8Z2_DROME/169-596TFGLSQVYFIYQVHSYMKITLVEAF-----YAQKT-NGYEGWWAMEQWQKIGVVRLRQMRPVD-----------------
PKDRE_MOUSE/1621-2051SVDLATVMKLGDIYTWLHGVFLPLL-----HNDPNPTFLPDS----SSKILGLPLVRQVRARPSNKTCLLAKKFVQSSVA
Q95V80_STRPU/2211-2645NKDYHLMNDFRSFLKWADSTLLPGL-----LSENRWGAEKQS-----TLIGGGLRLRQVRVKPS--SCETHPLFVDLIND
PKD2_CAEEL/119-538APAFGSCTSMDNIWDWLSQVLIPGIYW-TETSNST---DNENMIYYENRLLGEPRIRMLKVTND--SCTVMKSFQREIKE
Q9VVZ8_DROME/165-591AFGLLSVGDVPDIYFFVVSSLVLAF-----TDGKNTSGGAPWIHAEGTRLLGVVRLRQLRTES-----------------
PKDRE_HUMAN/1748-2178SMDLATVTKLEDIYRWLNSVLLPLL-----HNDLNPTFLPES----SSKILGLPLMRQVRAKSSEKMCLPAEKFVQNSIR
Q9VK95_DROME/402-803VSGNYLKDDSDSI-----------------QANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKE--SCYVNDAFIRYFNT
PK2L1_MOUSE/147-567--SFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRND--SCVVHEDFREDILN
Q9W4X5_DROME/170-595-TGLQEVYFLNQLFDFIESTLVLAF-----NSNSTESGSPGWAHAEQSVLLGVMRLRQLRVSN-----------------

PF00520

TRPV2_MOUSE/387-652--------------------------------------------------------------------------------
TRPC5_RABIT/372-636--------------------------------------------------------------------------------
O46129_LOLFO/351-636--------------------------------------------------------------------------------
TRPG_DROME/361-664--------------------------------------------------------------------------------
TRPL_DROME/382-680--------------------------------------------------------------------------------
Q94447_CALVI/372-670--------------------------------------------------------------------------------
TRPC2_MOUSE/670-932--------------------------------------------------------------------------------
TRPC3_HUMAN/379-670--------------------------------------------------------------------------------
TRPC6_MOUSE/447-738--------------------------------------------------------------------------------
TRPM2_HUMAN/801-1060--------------------------------------------------------------------------------
TRPM1_HUMAN/833-1087--------------------------------------------------------------------------------
Q20766_CAEEL/902-1141--------------------------------------------------------------------------------
TRPG_CAEEL/1312-1567--------------------------------------------------------------------------------
TRPV5_RABIT/332-590--------------------------------------------------------------------------------
Q9VUD5_DROME/475-730--------------------------------------------------------------------------------
O61220_CAEEL/519-775--------------------------------------------------------------------------------
Q9W3W0_DROME/459-665--------------------------------------------------------------------------------
PAIN_DROME/494-746--------------------------------------------------------------------------------
TRPA1_DROME/793-1039--------------------------------------------------------------------------------
TRPA1_HUMAN/720-972--------------------------------------------------------------------------------
TRPA1_CAEEL/813-1080--------------------------------------------------------------------------------
Q9VHY7_DROME/551-812--------------------------------------------------------------------------------
PYX_DROME/496-735--------------------------------------------------------------------------------
O13054_MAKNI/4778-4992--------------------------------------------------------------------------------
O61567_HOMAM/1212-1418--------------------------------------------------------------------------------
O96310_HELVI/229-436--------------------------------------------------------------------------------
ITPR_DROME/2408-2692--------------------------------------------------------------------------------
O77089_PANAR/2326-2624--------------------------------------------------------------------------------
ITPR1_MOUSE/2315-2600--------------------------------------------------------------------------------
ITPR2_HUMAN/2270-2552--------------------------------------------------------------------------------
Q9VW35_DROME/351-581--------------------------------------------------------------------------------
CCH1_YEAST/769-1010--------------------------------------------------------------------------------
NALCN_RAT/35-333--------------------------------------------------------------------------------
CCH1_SCHPO/514-755--------------------------------------------------------------------------------
TPC1_ARATH/429-683--------------------------------------------------------------------------------
TPC1_HUMAN/440-698--------------------------------------------------------------------------------
TPC1_ARATH/103-316--------------------------------------------------------------------------------
CCH1_SCHPO/1272-1517--------------------------------------------------------------------------------
CCH1_YEAST/1529-1779--------------------------------------------------------------------------------
CCH1_YEAST/1209-1484--------------------------------------------------------------------------------
CCH1_SCHPO/941-1224--------------------------------------------------------------------------------
CCH1_SCHPO/184-493--------------------------------------------------------------------------------
TPC1_HUMAN/105-331--------------------------------------------------------------------------------
NALCN_RAT/1209-1458--------------------------------------------------------------------------------
NALCN_RAT/383-610--------------------------------------------------------------------------------
NALCN_RAT/885-1167--------------------------------------------------------------------------------
CAC1E_DIPOM/1104-1385--------------------------------------------------------------------------------
Q17354_CAEEL/340-623--------------------------------------------------------------------------------
M9NDV1_DROME/768-1051--------------------------------------------------------------------------------
P91744_HETBL/894-1174--------------------------------------------------------------------------------
O02038_CYACP/868-1147--------------------------------------------------------------------------------
O97017_STYPI/849-1127--------------------------------------------------------------------------------
O96057_HALRO/803-1082--------------------------------------------------------------------------------
CAC1D_DROME/1343-1621--------------------------------------------------------------------------------
CAC1S_CYPCA/814-1092--------------------------------------------------------------------------------
CAC1S_HUMAN/798-1076--------------------------------------------------------------------------------
CAC1C_HUMAN/899-1197--------------------------------------------------------------------------------
CAC1D_HUMAN/885-1163--------------------------------------------------------------------------------
CAC1G_RAT/1254-1527--------------------------------------------------------------------------------
Q9W433_DROME/2144-2418--------------------------------------------------------------------------------
O44930_EXADI/1046-1318--------------------------------------------------------------------------------
O62604_POLPE/908-1178--------------------------------------------------------------------------------
Q17314_CYACP/963-1231--------------------------------------------------------------------------------
P97706_RAT/954-1225--------------------------------------------------------------------------------
SCN7A_HUMAN/933-1204--------------------------------------------------------------------------------
SCN1_HETBL/781-1052--------------------------------------------------------------------------------
O02037_BDECA/985-1259--------------------------------------------------------------------------------
SCNBA_RAT/1033-1299--------------------------------------------------------------------------------
SCNBA_HUMAN/1055-1319--------------------------------------------------------------------------------
Q25150_HALRO/1260-1547--------------------------------------------------------------------------------
SCNAA_CANLF/1158-1436--------------------------------------------------------------------------------
SCNA_ELEEL/999-1275--------------------------------------------------------------------------------
SCN4A_HORSE/1027-1303--------------------------------------------------------------------------------
SCN8A_RAT/1195-1473--------------------------------------------------------------------------------
P90670_APLCA/1177-1452--------------------------------------------------------------------------------
Q25377_DOROP/1022-1296--------------------------------------------------------------------------------
SCNA_DROME/1300-1571--------------------------------------------------------------------------------
Q9XZC1_RHIMP/461-733--------------------------------------------------------------------------------
Q9W433_DROME/300-623--------------------------------------------------------------------------------
CAC1I_RAT/76-407--------------------------------------------------------------------------------
CAC1G_RAT/80-406--------------------------------------------------------------------------------
CAC1H_HUMAN/99-430--------------------------------------------------------------------------------
CAC1E_DIPOM/101-374--------------------------------------------------------------------------------
M9NDV1_DROME/37-324--------------------------------------------------------------------------------
P91744_HETBL/64-348--------------------------------------------------------------------------------
O02038_CYACP/112-392--------------------------------------------------------------------------------
O97017_STYPI/80-362--------------------------------------------------------------------------------
O96057_HALRO/46-328--------------------------------------------------------------------------------
CAC1D_DROME/614-889--------------------------------------------------------------------------------
CAC1S_CYPCA/69-362--------------------------------------------------------------------------------
CAC1F_HUMAN/91-383--------------------------------------------------------------------------------
CAC1D_CHICK/120-412--------------------------------------------------------------------------------
CAC1S_HUMAN/50-345--------------------------------------------------------------------------------
CAC1S_LITCT/50-343--------------------------------------------------------------------------------
P97706_RAT/117-405--------------------------------------------------------------------------------
SCN7A_HUMAN/117-405--------------------------------------------------------------------------------
O02037_BDECA/134-418--------------------------------------------------------------------------------
SCNBA_RAT/128-406--------------------------------------------------------------------------------
SCNBA_HUMAN/128-411--------------------------------------------------------------------------------
SCNA_DROME/152-440--------------------------------------------------------------------------------
P90670_APLCA/137-431--------------------------------------------------------------------------------
Q25377_DOROP/131-412--------------------------------------------------------------------------------
Q25150_HALRO/130-477--------------------------------------------------------------------------------
SCNAA_CANLF/129-417--------------------------------------------------------------------------------
SCNA_ELEEL/121-413--------------------------------------------------------------------------------
SCN4A_HUMAN/130-458--------------------------------------------------------------------------------
SCN5A_HUMAN/130-424--------------------------------------------------------------------------------
Q90518_TAKRU/128-427--------------------------------------------------------------------------------
SCN1_HETBL/54-345--------------------------------------------------------------------------------
O44930_EXADI/112-392--------------------------------------------------------------------------------
Q17314_CYACP/142-419--------------------------------------------------------------------------------
CAC1G_RAT/1578-1830--------------------------------------------------------------------------------
Q17354_CAEEL/666-920--------------------------------------------------------------------------------
P91744_HETBL/1217-1468--------------------------------------------------------------------------------
M9NDV1_DROME/1094-1348--------------------------------------------------------------------------------
CAC1B_DIPOM/1467-1716--------------------------------------------------------------------------------
CAC1E_DIPOM/1428-1674--------------------------------------------------------------------------------
CAC1E_HUMAN/1477-1734--------------------------------------------------------------------------------
O02038_CYACP/1188-1437--------------------------------------------------------------------------------
O97017_STYPI/1168-1422--------------------------------------------------------------------------------
CAC1M_MUSDO/1108-1378--------------------------------------------------------------------------------
O96057_HALRO/1123-1384--------------------------------------------------------------------------------
CAC1S_CYPCA/1133-1413--------------------------------------------------------------------------------
CAC1S_RABIT/1117-1392--------------------------------------------------------------------------------
CAC1C_HUMAN/1238-1535--------------------------------------------------------------------------------
O02037_BDECA/1306-1555--------------------------------------------------------------------------------
SCN7A_HUMAN/1250-1507--------------------------------------------------------------------------------
P90670_APLCA/1499-1743--------------------------------------------------------------------------------
Q25377_DOROP/1343-1600--------------------------------------------------------------------------------
SCNA_DROME/1618-1871--------------------------------------------------------------------------------
Q9XZC1_RHIMP/780-1031--------------------------------------------------------------------------------
SCNBA_RAT/1345-1595--------------------------------------------------------------------------------
SCNBA_HUMAN/1365-1615--------------------------------------------------------------------------------
Q25150_HALRO/1593-1850--------------------------------------------------------------------------------
SCNA_ELEEL/1321-1578--------------------------------------------------------------------------------
SCN1A_HUMAN/1540-1797--------------------------------------------------------------------------------
SCN5A_HUMAN/1527-1783--------------------------------------------------------------------------------
SCN1_HETBL/1100-1362--------------------------------------------------------------------------------
O44930_EXADI/1367-1619--------------------------------------------------------------------------------
O62604_POLPE/1225-1481--------------------------------------------------------------------------------
Q17314_CYACP/1278-1536--------------------------------------------------------------------------------
O62604_POLPE/486-725--------------------------------------------------------------------------------
Q17314_CYACP/509-745--------------------------------------------------------------------------------
P97706_RAT/526-760--------------------------------------------------------------------------------
SCN7A_HUMAN/504-739--------------------------------------------------------------------------------
SCNBA_RAT/571-809--------------------------------------------------------------------------------
SCNBA_HUMAN/576-822--------------------------------------------------------------------------------
Q25150_HALRO/798-1033--------------------------------------------------------------------------------
SCNAA_CANLF/673-910--------------------------------------------------------------------------------
SCNA_ELEEL/565-801--------------------------------------------------------------------------------
SCN5A_RAT/717-953--------------------------------------------------------------------------------
SCN4A_HORSE/571-807--------------------------------------------------------------------------------
SCN1A_RAT/767-1003--------------------------------------------------------------------------------
P90670_APLCA/753-995--------------------------------------------------------------------------------
Q25377_DOROP/591-824--------------------------------------------------------------------------------
SCN1_HETBL/410-640--------------------------------------------------------------------------------
O44930_EXADI/622-858--------------------------------------------------------------------------------
CAC1G_RAT/743-976--------------------------------------------------------------------------------
Q9W433_DROME/1230-1471--------------------------------------------------------------------------------
Q17354_CAEEL/9-248--------------------------------------------------------------------------------
P91744_HETBL/480-720--------------------------------------------------------------------------------
CAC1A_RAT/488-727--------------------------------------------------------------------------------
M9NDV1_DROME/440-678--------------------------------------------------------------------------------
O02038_CYACP/496-738--------------------------------------------------------------------------------
O97017_STYPI/468-710--------------------------------------------------------------------------------
CAC1D_DROME/984-1226--------------------------------------------------------------------------------
O96057_HALRO/428-670--------------------------------------------------------------------------------
CAC1S_CYPCA/446-687--------------------------------------------------------------------------------
O73697_TAKRU/439-680--------------------------------------------------------------------------------
CAC1C_HUMAN/523-764--------------------------------------------------------------------------------
CAC1S_LITCT/430-671--------------------------------------------------------------------------------
CAC1S_HUMAN/431-672--------------------------------------------------------------------------------
CNGC3_ARATH/80-406--------------------------------------------------------------------------------
CNGC6_ARATH/111-443--------------------------------------------------------------------------------
CNGC7_ARATH/98-431--------------------------------------------------------------------------------
CNG16_ARATH/52-386--------------------------------------------------------------------------------
CNG14_ARATH/84-410--------------------------------------------------------------------------------
HCN4_MOUSE/262-525--------------------------------------------------------------------------------
O96385_PARTE/140-383--------------------------------------------------------------------------------
Q27170_PARTE/142-388--------------------------------------------------------------------------------
SKOR_ARATH/82-334--------------------------------------------------------------------------------
KAT3_ARATH/86-336--------------------------------------------------------------------------------
Q9XH40_SAMSA/77-327--------------------------------------------------------------------------------
Q9SM12_MAIZE/69-319--------------------------------------------------------------------------------
AKT2_ARATH/75-324--------------------------------------------------------------------------------
O04703_SOLTU/88-338--------------------------------------------------------------------------------
O24538_VICFA/55-305--------------------------------------------------------------------------------
AKT5_ARATH/78-324--------------------------------------------------------------------------------
O04242_MAIZE/64-310--------------------------------------------------------------------------------
O24382_SOLTU/63-309--------------------------------------------------------------------------------
AKT1_ARATH/57-300--------------------------------------------------------------------------------
KAT2_ARATH/59-307--------------------------------------------------------------------------------
Q41461_SOLTU/60-311--------------------------------------------------------------------------------
KCNH5_RAT/214-479--------------------------------------------------------------------------------
O44164_CAEEL/216-496--------------------------------------------------------------------------------
KCNAE_DROME/236-500--------------------------------------------------------------------------------
KCNH6_RAT/256-523--------------------------------------------------------------------------------
Q23974_DROME/267-516--------------------------------------------------------------------------------
KCNH3_RAT/224-515--------------------------------------------------------------------------------
KCNH8_RAT/221-481--------------------------------------------------------------------------------
Q9U5E2_DROME/125-365--------------------------------------------------------------------------------
CNG_CAEEL/165-422--------------------------------------------------------------------------------
CNGA4_RAT/34-277--------------------------------------------------------------------------------
CNGA_DROME/107-358--------------------------------------------------------------------------------
CNG_ICTPU/138-376--------------------------------------------------------------------------------
CNGA1_BOVIN/163-406--------------------------------------------------------------------------------
CNG1_CHICK/210-453--------------------------------------------------------------------------------
CNGA2_BOVIN/140-383--------------------------------------------------------------------------------
CNGB1_BOVIN/770-1005--------------------------------------------------------------------------------
Q9W2D5_DROME/468-704--------------------------------------------------------------------------------
KCMA1_RAT/178-400--------------------------------------------------------------------------------
SLO_DROME/126-348--------------------------------------------------------------------------------
SLO1_CAEEL/138-363--------------------------------------------------------------------------------
KCNQ1_HUMAN/122-359--------------------------------------------------------------------------------
Q9XWG9_CAEEL/76-313--------------------------------------------------------------------------------
KCNQ3_HUMAN/122-363--------------------------------------------------------------------------------
KCNQ2_HUMAN/92-324--------------------------------------------------------------------------------
KCNQ4_HUMAN/98-330--------------------------------------------------------------------------------
Q9RW39_DEIRA/33-252--------------------------------------------------------------------------------
Q16976_APLCA/213-469--------------------------------------------------------------------------------
KVS4_CAEEL/229-477--------------------------------------------------------------------------------
KCNG2_CHICK/216-464--------------------------------------------------------------------------------
G1R5R7_NOMLE/226-471--------------------------------------------------------------------------------
KCNAL_DROME/184-417--------------------------------------------------------------------------------
P91784_POLPE/201-427--------------------------------------------------------------------------------
KCNV1_RAT/212-442--------------------------------------------------------------------------------
KCNS3_HUMAN/184-417--------------------------------------------------------------------------------
KCNS1_MOUSE/188-439--------------------------------------------------------------------------------
KCNS2_MOUSE/186-421--------------------------------------------------------------------------------
A0A0D9S9T6_CHLSB/181-417--------------------------------------------------------------------------------
KCNAB_DROME/434-670--------------------------------------------------------------------------------
Q26344_APLSP/314-551--------------------------------------------------------------------------------
KCNAG_CAEEL/203-453--------------------------------------------------------------------------------
O76457_APLCA/173-421--------------------------------------------------------------------------------
KCNAW_DROME/173-424--------------------------------------------------------------------------------
KCNSK_CAEEL/274-519--------------------------------------------------------------------------------
O76266_HIRME/209-446--------------------------------------------------------------------------------
Q26094_POLPE/173-409--------------------------------------------------------------------------------
Q26095_POLPE/181-410--------------------------------------------------------------------------------
KCNA6_RAT/230-470--------------------------------------------------------------------------------
Q25376_DOROP/169-415--------------------------------------------------------------------------------
KCNA1_HUMAN/166-419--------------------------------------------------------------------------------
KCNAS_DROME/226-489--------------------------------------------------------------------------------

PF07885

W5K2Z9_ASTMX/448-526--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
A0A6H3AGI5_BACAN/22-99--------------------------------------------------------------------------------
A0A6L7HBD1_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q9A7V3_CAUVC/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------

PF01007

H2TFE7_TAKRU/11-151--------------------------------------------------------------------------------
F6SPD2_XENTR/38-178--------------------------------------------------------------------------------
F7FJC1_MONDO/46-187--------------------------------------------------------------------------------
U3II41_ANAPP/30-170--------------------------------------------------------------------------------
H2MFJ0_ORYLA/31-168--------------------------------------------------------------------------------
H2T950_TAKRU/46-187--------------------------------------------------------------------------------
H2Q537_PANTR/43-185--------------------------------------------------------------------------------
B4KG98_DROMO/102-248--------------------------------------------------------------------------------
H2ZYX1_LATCH/30-171--------------------------------------------------------------------------------
W5M8R3_LEPOC/3-142--------------------------------------------------------------------------------
T1EE13_HELRO/114-252--------------------------------------------------------------------------------
H3B1J1_LATCH/31-172--------------------------------------------------------------------------------
H3BAR9_LATCH/36-174--------------------------------------------------------------------------------
U3JLS4_FICAL/37-181--------------------------------------------------------------------------------
H3A9C1_LATCH/46-186--------------------------------------------------------------------------------
Q1L8I6_DANRE/24-166--------------------------------------------------------------------------------
W4YAR4_STRPU/79-219--------------------------------------------------------------------------------
M3XYC0_MUSPF/50-188--------------------------------------------------------------------------------
Q5TQ25_ANOGA/25-171--------------------------------------------------------------------------------
U3KL94_FICAL/39-177--------------------------------------------------------------------------------
A0A0R4IAU4_DANRE/50-186--------------------------------------------------------------------------------
K1QHC7_CRAGI/79-221--------------------------------------------------------------------------------
B0W1P8_CULQU/118-264--------------------------------------------------------------------------------
I3K6N4_ORENI/30-172--------------------------------------------------------------------------------
H9JWA7_BOMMO/187-325--------------------------------------------------------------------------------
W4YRL0_STRPU/65-213--------------------------------------------------------------------------------
B0W1P7_CULQU/12-158--------------------------------------------------------------------------------
B0XCY9_CULQU/27-172--------------------------------------------------------------------------------
IRK1_CAEEL/76-216--------------------------------------------------------------------------------
K1QR55_CRAGI/39-179--------------------------------------------------------------------------------
Q7PX90_ANOGA/25-165--------------------------------------------------------------------------------

PF00060

IR93A_DROME/574-841--------------------------------------------------------------------------------
GLR31_ARATH/591-843--------------------------------------------------------------------------------
Q9VVU7_DROME/386-644--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
GLR34_ARATH/613-869--------------------------------------------------------------------------------
GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
NMDZ1_HUMAN/559-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
A0A4W1TXG3_ANAPP/168-431--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
B7ZPS4_XENLA/162-426--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
B4II60_DROSE/545-823--------------------------------------------------------------------------------
GRIK2_HUMAN/560-831--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
GLR1_DROME/610-907--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
G1R3B7_NOMLE/543-824--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
Q9U0T0_DOROP/568-841--------------------------------------------------------------------------------

PF02386

TRKG_ECOLI/38-485----------------------SLFVFFITFVIFFCIGGGAWY-TT----------------------------------
TRKH_HAEIN/35-487----------------------GGKAFMQAFMLSLIAGTLLWW-PC----------------------------------
Q9HPA9_HALSA/77-556----------------------HGMVIAAGGWFAIAVVGALPF-LF----------------------------------
O83176_TREPA/103-567----------------------HIQNITLGIFALIAFKAQKKF-A-----------------------------------
Y460_MYCPN/24-557----------------------ISQRIFHFYIYCILLGAVLLF-L-----------------------------------
TRK1_SCHPO/316-816----------------------LRPANTIDGIVRSSLSSSSLS-KD----------------------------------
TRK2_YEAST/301-846----------------------PSSQELNKLAQTKSFQKLLGL-RR----------------------------------
TRK2_SCHPO/354-857----------------------AHQNVVRGSAITIAPTPVPRH-NR----------------------------------
TRK1_YEAST/624-1180----------------------KKPNFRKRGWNNKIFEHGPYA-SD----------------------------------

PF03814

E3GJV8_9FIRM/5-557-----------------------ALTLALFVIIIFPLGTYIYH-IA---------TNK--KT-------------F-ADP
R4KGK3_CLOPA/7-555-----------------------GIILLVFVLLCILVGKYIYK-VS---------EHE--RT-------------F-LDP
X4ZCZ5_9BACL/10-554-----------------------AVTVLIALLLARPAGLYIAE-VF---------NYE--RT-------------G-LDR
I2BB55_SHIBC/11-556------------------------SYLALLLALAKPLGSLLAR-QI---------EGI-------------------PLP
D2B153_STRRD/14-551-------------------------LVLALVLTHRPLGDYMYR-VY---------TGT--K------------------H
A7I6Q1_METB6/235-800-----------------------LLFIVIVALISIPLGAWMAK-IF---------TGK--PN-------------F-LSP
Q6F8C8_ACIAD/9-565-----------------------ITVFVLALILAYPLGHYLAD-VM---------QAK--PM-------------K-SDR
KDPA_BACCR/7-552-----------------------IITMLLFILVAKPTGIYLEK-AF---------QGS--KT---------------LDK
KDPA_PARD8/9-566-----------------------ALQILLLLVISYPLGKHIAK-VY---------KEG--ND-------------C-MR-
T0LA52_9EURY/11-544-----------------------AVVWGTVIVLSWFLSSYLLG-VF---------TGR--KS-------------R-LDR
Q4JUS0_CORJK/12-549-----------------------IMVIIALAACYVPLGNYMAA-TF---------TSK--K------------------H
I4D2C5_DESAJ/10-560-----------------------LFYVLILTVLAIPLGRYMAK-VF---------SQE--NT-------------W-VDP
D3F9I8_CONWI/10-571-----------------------LVFFAVLTALTPLIGAYMHK-VF---------RGD--A--------------I-LAP
B8GER2_METPE/14-556-----------------------IVFVLLLTAVAFPLGKYMSR-LF---------FQD--RP-------------P-A--
E3JBQ1_FRAIE/12-552-----------------------AILVVALVLTYRPFGDYMAR-VF---------TSD--K------------------H
R4TDT9_9PSEU/13-552------------------------LLLVALAVVYRPLGDYMAR-VF---------STE--K------------------H
A0A6N4SSD6_CYTH3/25-575-----------------------LLMYALVIALAIPLGRYIGK-IF---------NYE--HT-------------W-LDI
G8X3F4_STREN/12-552-----------------------LALVVALALVHRPLGDYMAA-VY---------TSR--R------------------H
KDPA_DESVH/10-561-----------------------ALFLGLLALMSPVLGRFIGRAVL---------RGE--QT-------------W-MHS
F9ZTB8_ACICS/11-575-------------------------TIALSIVLAWPLGIYMRR-IY---------SDE--HC-------------L-AKR
A4FMI7_SACEN/14-552-------------------------LVLAVVAVYRPFGDYMAR-VY---------TGA--E------------------H
KDPA_MAGSA/10-548-----------------------LLFLALVLALTPILGRFMTW-LF---------QAP----------------------
L0DLW9_SINAD/14-575------------------------------IAASLPIGWSMFR-TLDVPTDRAGRGLD----------------------
KDPA_METPP/10-570-----------------------AVFLALLMLLAWPLGRWLAA-VA---------EGH--LP-------------Q-GLA
H8KMI0_SOLCM/10-568------------------------FTYAITVLLAIPLGKYIAK-VF---------GGE--KT-------------W-SD-
F0S640_PSESL/9-559-----------------------IAMFGVTLLLAIPLGKYIAK-VY---------AGE--RT-------------F-LDP
A0LLJ6_SYNFM/11-602------------------------LLLATATLAAFPLSRYLAW-IM---------DGK--YR------------------
KDPA_PECAS/12-556-------------------------LLLTVLIVAQPLGSGLAR-LI---------EGE-------------------TGT
KDPA_THEAC/28-571-----------------------LIYLIIASVLAYILSFHIAK-IY---------LDE--KT-------------V-FSK
R6BHA4_9CLOT/5-583-----------------------VLTILIYLIMVIPVGSYLYH-IA---------AGK--HT-------------F-ADP
KDPA_DEIRA/9-559-----------------------VVLLGVMAALVVPVGNWLYG-VA---------TGQ--KD-------------T----
K9Q855_9NOSO/9-574-----------------------GLTLLILVAITPFFGRYMAR-VY---------QEQ--RT-------------F-FDP
K9V7P3_9CYAN/9-555-----------------------GLTLLIVIAIAPFFGKYLAK-VF---------LGE--NT-------------P-FDF
F8L2P0_PARAV/10-555-----------------------LVFLALLLIVTPLLGQYIAA-IF---------SEK--DP-------------L-MKR
KDPA_LISMO/10-557------------------------FFVVLLLVLAVPLGIYMYK-VM---------IGE--KV-------------F-LSR
Q6L2R0_PICTO/23-567-----------------------FIYIFLALLFGYLISNYISK-LY---------MDEEDKT-------------W-LYP
D1Z017_METPS/13-542-------------------------IILLALILAIPLGEYLAL-VF---------SGK--RA-------------P-LEP
E3GWW4_METFV/10-558-----------------------IAFYILLTFLAWPLGKYMAR-VF---------TGK--KT-------------F-ITP
I3THP9_TISMK/10-558-----------------------ALYLAILALIAVPLGRWT---VA---------AAS--SSG------------R-LGR
C6VYG5_DYAFD/9-559-----------------------IALFVGTVALAVPFGKYIAK-VY---------GGE--KT-------------L-LDP
KDPA_PSESM/10-560-----------------------LAFLVLLLAPAPWLGRFFYR-VM---------EGE--RT-------------W-LSP
U5QJ68_9CYAN/10-567-----------------------AVTIALMVAIVPLFGTYMAR-VF---------QFE--RT-------------W-LDP
D9R2J7_CLOSW/10-558------------------------IYMAVLVGLSIPLGIYIYK-VM---------TGQ--RV-------------F-LTP
G7M3P7_9CLOT/7-555-----------------------IITLLLFMLIVVPLGKYLYY-VS---------TGE--KT-------------V-VDK
F4KRB0_HALH1/9-568-----------------------VATLILTIVLAIPLGRYLAK-VY---------QGE--RV-------------W-TD-
J7QUT1_METSZ/10-561-----------------------AIVLVAVIVAAIPLGGYVAR-VL---------AGE--QN-------------L-LTP
T0N7P9_9EURY/29-575-----------------------ALYLIIISFFGYMIAPYIKK-LY---------TGE--NT-------------K-LRK
I4ETN2_9ACTN/13-566------------------------LLVLALALVHRPLGDAMAR-AFSTDPPLPPKARS--RRN------------S-GGH
KDPA_LEPIN/9-549-----------------------LIFLFALLIFSPLFGLGLYK-VY---------LYK--TS------------------
C7Q1T1_CATAD/12-560-----------------------AALVLMLAVSYRPLGDYMAH-IL---------TSR--K------------------H
F5XJD1_MICPN/12-552-----------------------AALIVLLALAYVPLGDYLAA-VL---------TPT--R------------------H
A7HRV4_PARL1/16-556-----------------------------TALLSWPLGRYMKW-AMD-PAASASRSAD----------------------
KDPA_STAA8/4-555-----------------------ILFLTMMVMITYVFSGYLYR-VA---------LVQ--SS-------------R-VDL
R5UVN1_9BACT/10-563------------------------LQVVAMVVLAYPLGRYMAK-VY---------KGE--RT-------------W-SD-
C7LZF2_ACIFD/8-557-----------------------IVLAVALAVTWRVLGAYMAG-VY---------EGR--------------------YS
I3TDE3_THEC1/12-531-------------------------IFLVTVMTGYVLSGVIRKMVV---------EWH--KK-------------P-P--
J7U1A2_MORMO/10-556-----------------------AGFLIVLLIAAKLLSNLLVC-FI---------DGT-------------------PLP
KDPA_METNO/10-559-----------------------TLYGAVVLALVKPLGWYMTR-VF---------TGE--RT-------------L-LSP
K7WVS0_9NOST/9-560-----------------------ALTLIIVIATTPLLGRYIAC-VF---------LGE--ST-------------L-LDS
KDPA_CAUVC/10-560-----------------------ALTLSLAVAIGWPLGVFLSR-VW---------NGE--KT-------------F-LDP
S5Z0Q6_PARAH/9-553-----------------------ALFLAGLTVVGLGLGAYMER-VF---------TGR--------------------FM
KDPA_SOLUE/10-559-----------------------LAFTAIIWALAKPIGGFMAK-VF---------AGE--RT-------------W-LHR
E0UCQ4_GLOV7/9-555-----------------------VLTLIILVVIVPFLGNYLAR-VF---------LFK--KT-------------I-LDP
D7BJD8_MEISD/5-565-----------------------ILILLLVLLLAWPLGGYLAR-VF---------SGE--RT---------------LLD
T0LT74_9EURY/28-573-----------------------LIYLIVISIFGFIIADHIKK-IY---------LGQ--RT-------------I-LTG
B1WPS5_CROS5/10-555------------------------FTLLILIIIVPIFGNYMAK-VY---------LRE--KT-------------I-LDS
D7A9S5_STAND/10-561-----------------------ATILALVVAAAVPLGNYMAR-VY---------AGE--RT-------------L-LST
KDPA_RHOCS/10-561-----------------------LLYLGLLAAVTPLLGRYMAR-VF---------EGE--RT-------------L-PGI
V6F0K6_MAGGM/10-558-----------------------LIYILLIVAVTPLLGGFMAR-LF---------GGE--RV-------------L-LSP
KDPA_GLOVI/10-566-----------------------VATLVLMVAIVPFFGTYMAR-VF---------QGE--ST-------------W-LDR
A0JW40_ARTS2/13-553-----------------------AALILALTAAHKPLGVYLAR-VF---------EGK--T------------------S
KDPA_AGRVS/10-560-----------------------GLLLALVFLTIKPLGLYIAC-VF---------EGQ--RT-------------F-LSP
K9PBZ4_CYAGP/8-552-----------------------ALTLTVAVLTAFPLGRHLWQ-VF---------DDR--PQ-------------PGWDP
D2UFZ8_XANAP/7-575-------------------------VYALALLLGWPLGLYLAK-VM---------RGA--PM-------------C-GDA
E8U851_DEIML/5-570------------------------FTYLLVFALAWPLGGYIAR-VF---------RGE--RT---------------LTD
J9Z8M5_LEPFM/10-559-----------------------LVSLGLIVLLSPLVGRYLAW-IF---------QSP--HL------------------
KDPA_STRCO/12-552-----------------------LALTAALALAHVPLGNYLAR-VY---------SSP--K------------------H
I0K505_9BACT/9-568-----------------------VATYLITMLLAIPLGKLYAK-VF---------ANK--PN-------------A-LD-
C8XB13_NAKMY/15-551--------------------------VLALALAHRPVGDYLYR-VL---------EPG--R------------------P
E4T7V0_PALPW/11-556-----------------------IIFLGLLIGLTPVLGNYMYK-VF---------TGE--KH-------------L-MSA
KDPA_CLOAB/7-555-----------------------AIILIVFVLLCIPIGRYMYK-VS---------EHK--KT-------------L-LDP
KDPA_LARHH/11-562------------------------LYLLVLLALAWPLGRYLAA-LL---------EGR--LA-------------Q-RFA
KDPA_ACIC5/10-582-----------------------GIFIAAVLLGAKPLGVYMAA-VF---------ERR--HT-------------W-LDP
E3I291_RHOVT/10-561-----------------------LVFCAIVVASAKPLGAYMTH-VF---------AGE--RT-------------F-LSF
E4NDZ7_KITSK/13-552------------------------ALVGALALCYRPLGDHIAK-LL---------TSA--R------------------H
F8AWS9_9ACTN/16-552---------------------------VALGLTYRPFGDYLAR-VY---------TSE--R------------------H
V5XHA6_MYCNE/12-554-----------------------AALVLVLALTHVPLGDYMYR-VY---------TRA--E------------------D
W0PFX0_9BURK/11-559-------------------------ILVLTTCLAVVLGKWIAR-VF---------TGE--KD-------------T----
G8TYY4_SULAD/10-560-----------------------AVLLVLMMGIGLGVGTYLER-VL-------PVQGE-----------------VRPRS
KDPA_YERPE/10-556-----------------------ASFMLVLFVLSRPLGGFLAR-LI---------EGE-------------------PFS
E6STC1_BACT6/10-566------------------------LQILLMVALSYPLGKYIAK-IY---------KGE--KT-------------W-SD-
A9HGI8_GLUDA/24-574-----------------------AAFLFATVLLAPVAGNAMTR-VM---------GGA--RG-------------A-IGR
KDPA_KINRD/13-552------------------------LLLLLLAAVHVPLGDFLAR-TF---------AGT--R------------------H
KDPA_KORVE/10-583-----------------------LLFLGLILAVTKPLGVFMAR-VF---------NRE--RT-------------F-LDP
G7ZDN7_AZOL4/10-561-----------------------LVFLALVVAVTRPLGGFMTR-VF---------TGE--RT-------------L-LSP
KDPA_SORC5/10-576-----------------------ALYLAVLIGLSVPLGTYMAR-VY---------QGE--RG-------------L-MAS
B7J712_ACIF2/10-575------------------------AVLLLTILLALPLGRYMHR-VY---------AGE--RF-------------W-ATR
H1YB12_9SPHI/10-568------------------------LTYLLTLIIAVPLGLYMAK-VF---------KGE--KT-------------W-LD-
C7PUT0_CHIPD/9-567-----------------------ILTFILTLVIAFPLGKYIAR-VF---------QGE--RT-------------F-TD-
KDPA_DESDA/9-579-----------------------LLYLSLLTALAWPLGKYIGK-VM---------DGE--PF-------------W-LQR
K9RWG4_SYNP3/9-555-----------------------SLILIILVLVAPPLGYYMAG-VF---------SGE--QA-------------K-LGR
KDPA_STAEQ/4-554-----------------------VLFLIVFILLSLIVSRYLYS-VA---------LNV--PS-------------K-IDV
KDPA_CLAMS/12-556------------------------SVVLVLVLVHRPLGDLMAR-MY---------ESR--H------------------D
KDPA_SYNY3/9-555-----------------------ALILAILVATAPLLGRYMAR-VF---------LGQ--ST-------------W-LDK
KDPA_KLEP7/11-556------------------------SYLLVLLVLARPLGMCLAR-MV---------NDI-------------------PLP
K9Z7H8_CYAAP/9-557-----------------------ILTLVLVVIITPILGNYMAC-VF---------LGK--PT-------------F-LDR
D1CGX3_THET1/8-561------------------------AFLLVLLAITKPLGSYMAR-VY---------QGE--RT-------------F-LSP
E2Q1F7_STRCL/12-553-----------------------LALVAALALSHRPLGDHIAR-CL---------TDG--R------------------H
W8EUK3_9BACT/12-563--------------------------YLITLVLALPLGAYLAR-VF---------RGE--KN-------------L-LD-
K9TR50_9CYAN/9-555-----------------------TLTLGILVAIVPFFGRYMAA-VY---------LEE--RT-------------F-LDG
W0EX99_9BACT/9-563-----------------------ILMYGLAVLLAIPLGRYIGK-VY---------SND--KT-------------W-SDR
C6D691_PAESJ/7-556-----------------------IIVVGVLILLVKPLGTYVYH-VY---------SDQ--PN-------------R-TDR
B3EAQ3_GEOLS/13-570------------------------FLLLILLALVRPLGSFMAR-VY---------QGE--RN-------------L-FLP
K9VVM6_9CYAN/9-559-----------------------VLTLLILIAIVRPFGSYIAH-IF---------LGE--KT-------------F-LDS
K9X7N8_9CHRO/9-556-----------------------ALTLVILVAITPIFGKYMAR-VF---------LEK--SV-------------L-LNR
I3Y5A2_THIV6/11-568------------------------LYLLVLLLAAKPLGSYIAA-VM---------EGR--PI-------------L-ALR
W5WRB9_9PSEU/12-552-----------------------ALLLAALAVVYRPLGDYMAR-AF---------TSK--G------------------H
F4C4K6_SPHS2/10-559------------------------FMFLLTCVLAIPLGKYIAK-VY---------SGE--RT-------------W-LDF
D9QG06_BRESC/10-560-----------------------ALTLGLSVALGWPLGLYLSR-VW---------NGE--RT-------------W-LDP
A8HY16_AZOC5/10-561-----------------------IVLFAVVIATAIPLGRFMAR-VY---------AGE--RT-------------F-LSP
Q186E7_CLOD6/11-560-----------------------VIVLAIFMILVIPMGKYLYH-IA---------TNQ--KT-------------F-GDR
KDPA_TOLAT/12-560-------------------------YMLVLLLLAWPLGIALTR-LV---------DDR-------------------LPL
U5LJM5_9BACI/9-555-----------------------IVTMAAVILIAKPAGIYLAK-AF---------DYS--QT-------------G-LDK
KDPA_BEII9/10-560-----------------------AFILGLTVALGWPLGLFLAR-LW---------EGE--QT-------------W-LDP
KDPA_ANADE/10-573-----------------------AAFFGLLTAAAVPLGAYAAR-VL---------STA--PP-------------H-GRG
E8X5C7_GRATM/10-587-----------------------LFFFALVLVSAKPVGVYMAR-VF---------ERE--RT-------------L-VDI
C5C4A0_BEUC1/16-557-----------------------ALVLAVLAAVHVPFGAYMAR-VY---------SSP--K------------------H
K8GCZ3_9CYAN/9-558-----------------------AITLLIVVVITPFLGRYMAR-VF---------MGQ--QT-------------L-LDP
D0IYN9_COMT2/9-559-----------------------AAVLTAATLLTIPMGQWLAR-CF---------TSE--RH-------------G----
E0SEX9_DICD3/10-555-----------------------VSLFAILLVLAQPLGQFMAR-LV---------EGE--------------------TG
R6RMK4_9FIRM/8-574-----------------------VLYLVILAALAIPLGKYIGK-IM---------DGE--KV-------------F-LSR
F4F4Y7_VERMA/14-551-------------------------LVVALAVVHRPLGDYLYR-VV---------CAE--R------------------H
A8KYG3_FRASN/13-567------------------------LLVGALATTYRPFGDYMFR-VY---------TSE--K------------------H
E1VQU5_9GAMM/5-576-----------------------LLFLALLVALAWPLGRYLAA-VM---------RGA--PM-------------R-SDA
C6XZL6_PEDHD/9-568-----------------------VATYLLTLVIAIPLGKYLAK-VF---------AGE--KV-------------W-TD-
B7J714_ACIF2/9-575-----------------------VAVLALSVFLALPLGHYMYR-VV---------EGH--RF-------------W-ATR
E8RRM4_ASTEC/14-564-----------------------VLFMAALTALAVPLGDYVAR-VL---------SGQ--RT-------------W-LSP
K0CGH7_ALCDB/5-555-----------------------ALIYLVTLGLAWPLGRYLSW-LF----------GE--RS---------------VSG
K8E2F1_CARML/9-558-----------------------ILFLVILIGLGIPLGIYSYR-VM---------SGK--KV-------------F-LSR
D3EAK4_GEOS4/7-556-----------------------AIVILVLVLLVKPLGTYLYQ-VF---------RYE--SN-------------G-TDR
D5WU10_KYRT2/12-563-----------------------VLLLAAVLLAAWPLGRYMAR-VF---------QGE--RT-------------F-LDP
G8TDF8_NIAKG/9-568-----------------------IITFLLTVLLAWPLGKYIAR-VF---------KGE--RT-------------I-TD-
KDPA_HYDS0/11-568-----------------------ILFFGILTIISPILGKYMAD-IY---------EGR--VH-------------P-SLK
D7DKK2_METV0/11-584------------------------LYLTVLLLLTKPMGLWIAK-VM---------NGE--SV-------------I-ANK
R6PVD9_9CLOT/5-571-----------------------IATLAIFLILVIPMGKYMYH-IA---------TYQ--KT-------------F-ADK
F2IFU1_FLUTR/9-571-----------------------IAMFILTVAIAIPLGRYIGK-VY---------LGE--KT-------------L-LDP
F7QKE7_9BRAD/10-559-----------------------FVFCAIIVALTPVVGGYMTR-VF---------AGE--RT-------------F-LSP
KDPA_MICAN/9-574-----------------------ALTILIIVAITPFFGRYMAR-VF---------MER--RT-------------L-LDP
S0EVD3_CHTCT/10-589-----------------------LLFFLLILVFTKPLGSYMAR-VF---------QGE--RT-------------L-LHP
KDPA_RHIME/11-561------------------------LLFLAVLVVVKPLGLYMAG-VL---------SGE--PN-------------V-LSP
D5AKZ2_RHOCB/10-560-----------------------AAVLLFTLATAVPLGRYMAR-LF---------SGE--RT-------------F-LHP
C9R8E6_AMMDK/12-560-------------------------FAAVLTALAVPLGFYMAR-VF---------EGE--RT-------------L-LSP
C6W8P0_ACTMD/12-539-----------------------ALLIAALAAAYRPFGDYMAR-VY---------TDA--K------------------H
Q09AH8_STIAD/10-563-----------------------LVFFALVLALTKPLGGYLYR-VF---------EG---RP-------------P-LPQ
C4KYL4_EXISA/11-542------------------------LLIAITMTASALLGGYVGR-RFVPIQERPNYVGK----------------------
KDPA_PSEAE/10-560-----------------------LAFFALVLVPAPFLGRYCFK-VM---------EGQ--RN-------------L-LSA
A0KED5_AERHH/10-553------------------------AFVLLVLLPAPLLGNYLYR-VF---------EGK--------------------SR
E9T4H3_RHOHA/12-565-----------------------ALVVAVLAILYVPVGDYMAK-VY---------TTD--T------------------D
Q31MM1_SYNE7/10-552-------------------------TLLPVILMTPLLGNYLWR-VF---------SDQ--SS-------------L-LDR
KDPA_NOSS1/9-555-----------------------GLTLCIVIAITPVLGRYIAR-VF---------LGE--RT-------------I-LDR
K9UDW3_CHAP6/9-563-----------------------GLTLVLIVAITPIFGGYIAR-VY---------LGQ--RT-------------L-LDR
KDPA_HALSA/11-578-----------------------AVFFTILAVLVFVAGEYLAW-VY---------REQ--ANSDHRPPGYLSWFER-LDE
W0A4I8_9SPHN/10-559-----------------------LVFVAILIALAKPMGLWLHA-LY---------EGR--RT-------------P-LHV
KDPA_RHORT/10-561-----------------------VLFCAIILGLTPLLGGYMAR-VF---------SGE--RV-------------L-LSV
R6NNJ3_9FIRM/5-564-----------------------VLTLAIFMILVIPMGTYMYH-IA---------TKQ--KT-------------F-ADK
D3RSD8_ALLVD/5-565-----------------------LLIYAAALLLAWPLGRYLAA-IY---------SAT--PT-------------A-LDQ
I0H1S8_ACTM4/10-547-------------------------LVAAIVVVHRPFGDYMYR-VV---------SGT--R------------------H
KDPA_GEOKA/9-557-----------------------TLIFLLLIVIAVPLGKYLYV-AF----------FE--KG-------------K-IDR
KDPA_CALS4/9-558------------------------TMIAIIVLLTKPLGTYMYN-IF---------EYK--PM-------------R-SDK
D2Q289_KRIFD/12-553-----------------------ALLLLLLAAAYRPLGGYLAR-VY---------TAG--R------------------D
K9RK69_9CYAN/10-555------------------------LTLLLVLIVTPTFGKYIAK-VF---------MGR--TT-------------L-LDR
KDPA_ALIAD/10-559-----------------------FLVVLALVACAWPLGGYIYR-TF---------VGE--RV-------------R-PDA
B6JA58_OLICO/10-557-----------------------LVFLGIVIALVKPLGGYITR-VM---------NGE--RT-------------F-LSP
D3PV93_STANL/12-552-----------------------VAMVVALAIVHRPLGDYVYR-VV---------TRK--R------------------D
H1ZCI8_MYROD/9-559-----------------------LVTFLVAIGISIPLGKYIAK-VY---------AGQ--PT-------------F-LDT
H9ZZC9_FERFK/11-532------------------------AIFIAVSLLGYELSRLLKKMVL---------EWN--FE-------------P-P--
KDPA_FLAPJ/10-570------------------------SIFIVSIVLAIPLGRYIAK-IY---------SND--KT-------------L-LDP
A5FU08_ACICJ/10-556-----------------------ALALALVFGAAFPLGAYLAR-LY---------RGD--L------------------R
K9Y0M2_STAC7/9-555-----------------------ALTLLIVVLIVPWFGNYMAR-IF---------LAQ--KT-------------I-LEP
C0ZIZ1_BREBN/7-554-----------------------ALVLVVLFVLAIPMGRYLAR-SF---------SLE--TT-------------R-LDR
D6ZE64_SEGRD/12-555-----------------------LFILGVLAAVYVPLGDFMAR-VY---------TST--E------------------D
H7C701_ENTFA/10-555------------------------FFLFILLLLAVPLGWYIKE-IM---------QGE--IP-------------K-GVS
F4CT92_PSEUX/12-552-----------------------AALLVLLGVCYVPLGDYMAR-VF---------TAE--R------------------H
E8V6X7_TERSS/10-579-----------------------VLFIAAVLLLAKPMGSYLTR-VF---------ERR--RT-------------F-LDP
KDPA_PHOLL/10-561-----------------------TSFLLILMLLAKPLGNIIAN-LI---------DGD-------------------IPR
KDPA_MYCTU/10-568-----------------------AALIAVLLLTAPALGGYLAK-IY---------GDE--AKK------------P-GDR
J7J1Q1_DESMD/10-560-----------------------IVFFVVLFALAIPLGLYMAK-VF---------QGE--KT-------------F-LDP
D5UVP7_TSUPD/12-549-----------------------VTLVAALAICYRPLGDYLAH-VV---------TTT--R------------------H
U5RTG7_9CLOT/7-555-----------------------GIILVIFVLLCIPTGKYIYK-VA---------EHE--KT-------------F-LDP
D1BAQ9_SANKS/14-555-----------------------SLLVAALAAVHLPLGAYLAH-VY---------TSP--R------------------H
L0ABX1_CALLD/9-533-----------------------VIIVAISLMVSYLLSMPI-SYFI---------KYE--KD-------------L-PNT
KDPA_GRABC/10-560-----------------------GIFFLCVLALTRPLGGFLVS-VL---------EGR--RT-------------F-LSP
C9A6Y5_ENTCA/10-555------------------------LFLLILLAAAVPLGWYIKE-IM---------QGK--TP-------------R-FVR
W0I187_9GAMM/10-555-----------------------ASFLAVLLLLAQPLGRLMTG-LV---------LDR-------------------PLP
B8ESF4_METSB/10-566-----------------------VILLVVLVLTIRPLGGYMAW-VF---------AGR--HT-------------S-IHP
KDPA_METB6/11-574------------------------LIGVILALLLIPTGEFMFR-VY---------TGK--KT-------------F-LSP
D5SYH3_PLAL2/10-576-----------------------AIYLGVLLACVKPLGFYMAR-VY---------SGS--AT-------------F-LDR
D7B3X9_NOCDD/11-556-----------------------AALALILALLYRPVGDYTAR-VF---------TSP--K------------------D
E3EDK0_PAEPS/7-556-----------------------GVVIVILLLLVKPVGTYMYH-VF---------SNE--PN-------------R-TDR
B8GSR6_THISH/5-564-----------------------LLVFALAIGLGWPLGRYLAA-VM---------RGA--PM-------------R-GDR
A5N882_CLOK5/5-568-----------------------ILTLAIFIVLVIPMGKYLYH-IA---------ARK--HT-------------F-LDP
H6NGX7_9BACL/8-552-----------------------VVTLLLVLVLARPVGLYMAQ-VF---------DYE--KS-------------K-WDK
KDPA_ECOLI/10-556-----------------------ATFLLVLMVLARPLGSGLAR-LI---------NDI-------------------PLP
R5W702_9BACT/12-563--------------------------WVCLVVLCYPLGRHIAK-VY---------KGE--KN-------------I-MD-
KDPA_HERA2/10-575-----------------------GIFLVVLMACVVPLGRYMAK-VY----------GE--NP-------------P-LQG

PF08016

PKD1_MOUSE/3701-4103----CSAAGSLSTSD---YGIGW----QSVVQNGSETWAYSA-----------PDLL--------------GAWYWGYCA
PKD2_MOUSE/265-685----CYDVYSVSSEDR-----------APFGPRNGTAWMYTS-----------EKELN-------------GSSHWGIIA
Q8T8Z2_DROME/169-596----CHIGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLL-------------NYDHYGYLL
PKDRE_MOUSE/1621-2051GEIHCHPQYGIDPEDTQHYSSVWSKAGKQSTDKASHGFTYKP-----------PGKRW-------------VYHSYGVLN
Q95V80_STRPU/2211-2645----CRALFTPESEDRELYNASWS---QPIVNMSALLNSSQT-----------VEEWSLSNYSPWHFYPDKAVGMWGHAT
PKD2_CAEEL/119-538----CFANYEEKLEDK-----------TMVGDGSVDAFIYAT-----------AKELE-------------NLKTVGTIA
Q9VVZ8_DROME/165-591----NRLGLSLPVFTERDFSESWTLPYERVPYTDKYWPIYTPWLPS--VSVARDNLLM-------------GINHVGHMF
PKDRE_HUMAN/1748-2178REIHCHPKYGIDPEDTKNYSGFWNEVDKQAIDESTNGFTYKP-----------QGTQW-------------LYYSYGLLH
Q9VK95_DROME/402-803----CYAAYSSGAEDR-----------KPMHKGSP----FRT-----------MHDLD-------------STPIWTVLA
PK2L1_MOUSE/147-567----CYDVYSPDKEDQ-----------LPFGPQNGTAWTYHS-----------QNELG-------------GSSHWGRLT
Q9W4X5_DROME/170-595----PQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKMGFEFLDALLM-------------NFDHVGSLN

PF00520

TRPV2_MOUSE/387-652--------------------------------------------------------------------------------
TRPC5_RABIT/372-636--------------------------------------------------------------------------------
O46129_LOLFO/351-636--------------------------------------------------------------------------------
TRPG_DROME/361-664--------------------------------------------------------------------------------
TRPL_DROME/382-680--------------------------------------------------------------------------------
Q94447_CALVI/372-670--------------------------------------------------------------------------------
TRPC2_MOUSE/670-932--------------------------------------------------------------------------------
TRPC3_HUMAN/379-670--------------------------------------------------------------------------------
TRPC6_MOUSE/447-738--------------------------------------------------------------------------------
TRPM2_HUMAN/801-1060--------------------------------------------------------------------------------
TRPM1_HUMAN/833-1087--------------------------------------------------------------------------------
Q20766_CAEEL/902-1141--------------------------------------------------------------------------------
TRPG_CAEEL/1312-1567--------------------------------------------------------------------------------
TRPV5_RABIT/332-590--------------------------------------------------------------------------------
Q9VUD5_DROME/475-730--------------------------------------------------------------------------------
O61220_CAEEL/519-775--------------------------------------------------------------------------------
Q9W3W0_DROME/459-665--------------------------------------------------------------------------------
PAIN_DROME/494-746--------------------------------------------------------------------------------
TRPA1_DROME/793-1039--------------------------------------------------------------------------------
TRPA1_HUMAN/720-972--------------------------------------------------------------------------------
TRPA1_CAEEL/813-1080--------------------------------------------------------------------------------
Q9VHY7_DROME/551-812--------------------------------------------------------------------------------
PYX_DROME/496-735--------------------------------------------------------------------------------
O13054_MAKNI/4778-4992--------------------------------------------------------------------------------
O61567_HOMAM/1212-1418--------------------------------------------------------------------------------
O96310_HELVI/229-436--------------------------------------------------------------------------------
ITPR_DROME/2408-2692--------------------------------------------------------------------------------
O77089_PANAR/2326-2624--------------------------------------------------------------------------------
ITPR1_MOUSE/2315-2600--------------------------------------------------------------------------------
ITPR2_HUMAN/2270-2552--------------------------------------------------------------------------------
Q9VW35_DROME/351-581--------------------------------------------------------------------------------
CCH1_YEAST/769-1010--------------------------------------------------------------------------------
NALCN_RAT/35-333--------------------------------------------------------------------------------
CCH1_SCHPO/514-755--------------------------------------------------------------------------------
TPC1_ARATH/429-683--------------------------------------------------------------------------------
TPC1_HUMAN/440-698--------------------------------------------------------------------------------
TPC1_ARATH/103-316--------------------------------------------------------------------------------
CCH1_SCHPO/1272-1517--------------------------------------------------------------------------------
CCH1_YEAST/1529-1779--------------------------------------------------------------------------------
CCH1_YEAST/1209-1484--------------------------------------------------------------------------------
CCH1_SCHPO/941-1224--------------------------------------------------------------------------------
CCH1_SCHPO/184-493--------------------------------------------------------------------------------
TPC1_HUMAN/105-331--------------------------------------------------------------------------------
NALCN_RAT/1209-1458--------------------------------------------------------------------------------
NALCN_RAT/383-610--------------------------------------------------------------------------------
NALCN_RAT/885-1167--------------------------------------------------------------------------------
CAC1E_DIPOM/1104-1385--------------------------------------------------------------------------------
Q17354_CAEEL/340-623--------------------------------------------------------------------------------
M9NDV1_DROME/768-1051--------------------------------------------------------------------------------
P91744_HETBL/894-1174--------------------------------------------------------------------------------
O02038_CYACP/868-1147--------------------------------------------------------------------------------
O97017_STYPI/849-1127--------------------------------------------------------------------------------
O96057_HALRO/803-1082--------------------------------------------------------------------------------
CAC1D_DROME/1343-1621--------------------------------------------------------------------------------
CAC1S_CYPCA/814-1092--------------------------------------------------------------------------------
CAC1S_HUMAN/798-1076--------------------------------------------------------------------------------
CAC1C_HUMAN/899-1197--------------------------------------------------------------------------------
CAC1D_HUMAN/885-1163--------------------------------------------------------------------------------
CAC1G_RAT/1254-1527--------------------------------------------------------------------------------
Q9W433_DROME/2144-2418--------------------------------------------------------------------------------
O44930_EXADI/1046-1318--------------------------------------------------------------------------------
O62604_POLPE/908-1178--------------------------------------------------------------------------------
Q17314_CYACP/963-1231--------------------------------------------------------------------------------
P97706_RAT/954-1225--------------------------------------------------------------------------------
SCN7A_HUMAN/933-1204--------------------------------------------------------------------------------
SCN1_HETBL/781-1052--------------------------------------------------------------------------------
O02037_BDECA/985-1259--------------------------------------------------------------------------------
SCNBA_RAT/1033-1299--------------------------------------------------------------------------------
SCNBA_HUMAN/1055-1319--------------------------------------------------------------------------------
Q25150_HALRO/1260-1547--------------------------------------------------------------------------------
SCNAA_CANLF/1158-1436--------------------------------------------------------------------------------
SCNA_ELEEL/999-1275--------------------------------------------------------------------------------
SCN4A_HORSE/1027-1303--------------------------------------------------------------------------------
SCN8A_RAT/1195-1473--------------------------------------------------------------------------------
P90670_APLCA/1177-1452--------------------------------------------------------------------------------
Q25377_DOROP/1022-1296--------------------------------------------------------------------------------
SCNA_DROME/1300-1571--------------------------------------------------------------------------------
Q9XZC1_RHIMP/461-733--------------------------------------------------------------------------------
Q9W433_DROME/300-623--------------------------------------------------------------------------------
CAC1I_RAT/76-407--------------------------------------------------------------------------------
CAC1G_RAT/80-406--------------------------------------------------------------------------------
CAC1H_HUMAN/99-430--------------------------------------------------------------------------------
CAC1E_DIPOM/101-374--------------------------------------------------------------------------------
M9NDV1_DROME/37-324--------------------------------------------------------------------------------
P91744_HETBL/64-348--------------------------------------------------------------------------------
O02038_CYACP/112-392--------------------------------------------------------------------------------
O97017_STYPI/80-362--------------------------------------------------------------------------------
O96057_HALRO/46-328--------------------------------------------------------------------------------
CAC1D_DROME/614-889--------------------------------------------------------------------------------
CAC1S_CYPCA/69-362--------------------------------------------------------------------------------
CAC1F_HUMAN/91-383--------------------------------------------------------------------------------
CAC1D_CHICK/120-412--------------------------------------------------------------------------------
CAC1S_HUMAN/50-345--------------------------------------------------------------------------------
CAC1S_LITCT/50-343--------------------------------------------------------------------------------
P97706_RAT/117-405--------------------------------------------------------------------------------
SCN7A_HUMAN/117-405--------------------------------------------------------------------------------
O02037_BDECA/134-418--------------------------------------------------------------------------------
SCNBA_RAT/128-406--------------------------------------------------------------------------------
SCNBA_HUMAN/128-411--------------------------------------------------------------------------------
SCNA_DROME/152-440--------------------------------------------------------------------------------
P90670_APLCA/137-431--------------------------------------------------------------------------------
Q25377_DOROP/131-412--------------------------------------------------------------------------------
Q25150_HALRO/130-477--------------------------------------------------------------------------------
SCNAA_CANLF/129-417--------------------------------------------------------------------------------
SCNA_ELEEL/121-413--------------------------------------------------------------------------------
SCN4A_HUMAN/130-458--------------------------------------------------------------------------------
SCN5A_HUMAN/130-424--------------------------------------------------------------------------------
Q90518_TAKRU/128-427--------------------------------------------------------------------------------
SCN1_HETBL/54-345--------------------------------------------------------------------------------
O44930_EXADI/112-392--------------------------------------------------------------------------------
Q17314_CYACP/142-419--------------------------------------------------------------------------------
CAC1G_RAT/1578-1830--------------------------------------------------------------------------------
Q17354_CAEEL/666-920--------------------------------------------------------------------------------
P91744_HETBL/1217-1468--------------------------------------------------------------------------------
M9NDV1_DROME/1094-1348--------------------------------------------------------------------------------
CAC1B_DIPOM/1467-1716--------------------------------------------------------------------------------
CAC1E_DIPOM/1428-1674--------------------------------------------------------------------------------
CAC1E_HUMAN/1477-1734--------------------------------------------------------------------------------
O02038_CYACP/1188-1437--------------------------------------------------------------------------------
O97017_STYPI/1168-1422--------------------------------------------------------------------------------
CAC1M_MUSDO/1108-1378--------------------------------------------------------------------------------
O96057_HALRO/1123-1384--------------------------------------------------------------------------------
CAC1S_CYPCA/1133-1413--------------------------------------------------------------------------------
CAC1S_RABIT/1117-1392--------------------------------------------------------------------------------
CAC1C_HUMAN/1238-1535--------------------------------------------------------------------------------
O02037_BDECA/1306-1555--------------------------------------------------------------------------------
SCN7A_HUMAN/1250-1507--------------------------------------------------------------------------------
P90670_APLCA/1499-1743--------------------------------------------------------------------------------
Q25377_DOROP/1343-1600--------------------------------------------------------------------------------
SCNA_DROME/1618-1871--------------------------------------------------------------------------------
Q9XZC1_RHIMP/780-1031--------------------------------------------------------------------------------
SCNBA_RAT/1345-1595--------------------------------------------------------------------------------
SCNBA_HUMAN/1365-1615--------------------------------------------------------------------------------
Q25150_HALRO/1593-1850--------------------------------------------------------------------------------
SCNA_ELEEL/1321-1578--------------------------------------------------------------------------------
SCN1A_HUMAN/1540-1797--------------------------------------------------------------------------------
SCN5A_HUMAN/1527-1783--------------------------------------------------------------------------------
SCN1_HETBL/1100-1362--------------------------------------------------------------------------------
O44930_EXADI/1367-1619--------------------------------------------------------------------------------
O62604_POLPE/1225-1481--------------------------------------------------------------------------------
Q17314_CYACP/1278-1536--------------------------------------------------------------------------------
O62604_POLPE/486-725--------------------------------------------------------------------------------
Q17314_CYACP/509-745--------------------------------------------------------------------------------
P97706_RAT/526-760--------------------------------------------------------------------------------
SCN7A_HUMAN/504-739--------------------------------------------------------------------------------
SCNBA_RAT/571-809--------------------------------------------------------------------------------
SCNBA_HUMAN/576-822--------------------------------------------------------------------------------
Q25150_HALRO/798-1033--------------------------------------------------------------------------------
SCNAA_CANLF/673-910--------------------------------------------------------------------------------
SCNA_ELEEL/565-801--------------------------------------------------------------------------------
SCN5A_RAT/717-953--------------------------------------------------------------------------------
SCN4A_HORSE/571-807--------------------------------------------------------------------------------
SCN1A_RAT/767-1003--------------------------------------------------------------------------------
P90670_APLCA/753-995--------------------------------------------------------------------------------
Q25377_DOROP/591-824--------------------------------------------------------------------------------
SCN1_HETBL/410-640--------------------------------------------------------------------------------
O44930_EXADI/622-858--------------------------------------------------------------------------------
CAC1G_RAT/743-976--------------------------------------------------------------------------------
Q9W433_DROME/1230-1471--------------------------------------------------------------------------------
Q17354_CAEEL/9-248--------------------------------------------------------------------------------
P91744_HETBL/480-720--------------------------------------------------------------------------------
CAC1A_RAT/488-727--------------------------------------------------------------------------------
M9NDV1_DROME/440-678--------------------------------------------------------------------------------
O02038_CYACP/496-738--------------------------------------------------------------------------------
O97017_STYPI/468-710--------------------------------------------------------------------------------
CAC1D_DROME/984-1226--------------------------------------------------------------------------------
O96057_HALRO/428-670--------------------------------------------------------------------------------
CAC1S_CYPCA/446-687--------------------------------------------------------------------------------
O73697_TAKRU/439-680--------------------------------------------------------------------------------
CAC1C_HUMAN/523-764--------------------------------------------------------------------------------
CAC1S_LITCT/430-671--------------------------------------------------------------------------------
CAC1S_HUMAN/431-672--------------------------------------------------------------------------------
CNGC3_ARATH/80-406--------------------------------------------------------------------------------
CNGC6_ARATH/111-443--------------------------------------------------------------------------------
CNGC7_ARATH/98-431--------------------------------------------------------------------------------
CNG16_ARATH/52-386--------------------------------------------------------------------------------
CNG14_ARATH/84-410--------------------------------------------------------------------------------
HCN4_MOUSE/262-525--------------------------------------------------------------------------------
O96385_PARTE/140-383--------------------------------------------------------------------------------
Q27170_PARTE/142-388--------------------------------------------------------------------------------
SKOR_ARATH/82-334--------------------------------------------------------------------------------
KAT3_ARATH/86-336--------------------------------------------------------------------------------
Q9XH40_SAMSA/77-327--------------------------------------------------------------------------------
Q9SM12_MAIZE/69-319--------------------------------------------------------------------------------
AKT2_ARATH/75-324--------------------------------------------------------------------------------
O04703_SOLTU/88-338--------------------------------------------------------------------------------
O24538_VICFA/55-305--------------------------------------------------------------------------------
AKT5_ARATH/78-324--------------------------------------------------------------------------------
O04242_MAIZE/64-310--------------------------------------------------------------------------------
O24382_SOLTU/63-309--------------------------------------------------------------------------------
AKT1_ARATH/57-300--------------------------------------------------------------------------------
KAT2_ARATH/59-307--------------------------------------------------------------------------------
Q41461_SOLTU/60-311--------------------------------------------------------------------------------
KCNH5_RAT/214-479--------------------------------------------------------------------------------
O44164_CAEEL/216-496--------------------------------------------------------------------------------
KCNAE_DROME/236-500--------------------------------------------------------------------------------
KCNH6_RAT/256-523--------------------------------------------------------------------------------
Q23974_DROME/267-516--------------------------------------------------------------------------------
KCNH3_RAT/224-515--------------------------------------------------------------------------------
KCNH8_RAT/221-481--------------------------------------------------------------------------------
Q9U5E2_DROME/125-365--------------------------------------------------------------------------------
CNG_CAEEL/165-422--------------------------------------------------------------------------------
CNGA4_RAT/34-277--------------------------------------------------------------------------------
CNGA_DROME/107-358--------------------------------------------------------------------------------
CNG_ICTPU/138-376--------------------------------------------------------------------------------
CNGA1_BOVIN/163-406--------------------------------------------------------------------------------
CNG1_CHICK/210-453--------------------------------------------------------------------------------
CNGA2_BOVIN/140-383--------------------------------------------------------------------------------
CNGB1_BOVIN/770-1005--------------------------------------------------------------------------------
Q9W2D5_DROME/468-704--------------------------------------------------------------------------------
KCMA1_RAT/178-400--------------------------------------------------------------------------------
SLO_DROME/126-348--------------------------------------------------------------------------------
SLO1_CAEEL/138-363--------------------------------------------------------------------------------
KCNQ1_HUMAN/122-359--------------------------------------------------------------------------------
Q9XWG9_CAEEL/76-313--------------------------------------------------------------------------------
KCNQ3_HUMAN/122-363--------------------------------------------------------------------------------
KCNQ2_HUMAN/92-324--------------------------------------------------------------------------------
KCNQ4_HUMAN/98-330--------------------------------------------------------------------------------
Q9RW39_DEIRA/33-252--------------------------------------------------------------------------------
Q16976_APLCA/213-469--------------------------------------------------------------------------------
KVS4_CAEEL/229-477--------------------------------------------------------------------------------
KCNG2_CHICK/216-464--------------------------------------------------------------------------------
G1R5R7_NOMLE/226-471--------------------------------------------------------------------------------
KCNAL_DROME/184-417--------------------------------------------------------------------------------
P91784_POLPE/201-427--------------------------------------------------------------------------------
KCNV1_RAT/212-442--------------------------------------------------------------------------------
KCNS3_HUMAN/184-417--------------------------------------------------------------------------------
KCNS1_MOUSE/188-439--------------------------------------------------------------------------------
KCNS2_MOUSE/186-421--------------------------------------------------------------------------------
A0A0D9S9T6_CHLSB/181-417--------------------------------------------------------------------------------
KCNAB_DROME/434-670--------------------------------------------------------------------------------
Q26344_APLSP/314-551--------------------------------------------------------------------------------
KCNAG_CAEEL/203-453--------------------------------------------------------------------------------
O76457_APLCA/173-421--------------------------------------------------------------------------------
KCNAW_DROME/173-424--------------------------------------------------------------------------------
KCNSK_CAEEL/274-519--------------------------------------------------------------------------------
O76266_HIRME/209-446--------------------------------------------------------------------------------
Q26094_POLPE/173-409--------------------------------------------------------------------------------
Q26095_POLPE/181-410--------------------------------------------------------------------------------
KCNA6_RAT/230-470--------------------------------------------------------------------------------
Q25376_DOROP/169-415--------------------------------------------------------------------------------
KCNA1_HUMAN/166-419--------------------------------------------------------------------------------
KCNAS_DROME/226-489--------------------------------------------------------------------------------

PF07885

W5K2Z9_ASTMX/448-526--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
A0A6H3AGI5_BACAN/22-99--------------------------------------------------------------------------------
A0A6L7HBD1_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q9A7V3_CAUVC/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------

PF01007

H2TFE7_TAKRU/11-151--------------------------------------------------------------------------------
F6SPD2_XENTR/38-178--------------------------------------------------------------------------------
F7FJC1_MONDO/46-187--------------------------------------------------------------------------------
U3II41_ANAPP/30-170--------------------------------------------------------------------------------
H2MFJ0_ORYLA/31-168--------------------------------------------------------------------------------
H2T950_TAKRU/46-187--------------------------------------------------------------------------------
H2Q537_PANTR/43-185--------------------------------------------------------------------------------
B4KG98_DROMO/102-248--------------------------------------------------------------------------------
H2ZYX1_LATCH/30-171--------------------------------------------------------------------------------
W5M8R3_LEPOC/3-142--------------------------------------------------------------------------------
T1EE13_HELRO/114-252--------------------------------------------------------------------------------
H3B1J1_LATCH/31-172--------------------------------------------------------------------------------
H3BAR9_LATCH/36-174--------------------------------------------------------------------------------
U3JLS4_FICAL/37-181--------------------------------------------------------------------------------
H3A9C1_LATCH/46-186--------------------------------------------------------------------------------
Q1L8I6_DANRE/24-166--------------------------------------------------------------------------------
W4YAR4_STRPU/79-219--------------------------------------------------------------------------------
M3XYC0_MUSPF/50-188--------------------------------------------------------------------------------
Q5TQ25_ANOGA/25-171--------------------------------------------------------------------------------
U3KL94_FICAL/39-177--------------------------------------------------------------------------------
A0A0R4IAU4_DANRE/50-186--------------------------------------------------------------------------------
K1QHC7_CRAGI/79-221--------------------------------------------------------------------------------
B0W1P8_CULQU/118-264--------------------------------------------------------------------------------
I3K6N4_ORENI/30-172--------------------------------------------------------------------------------
H9JWA7_BOMMO/187-325--------------------------------------------------------------------------------
W4YRL0_STRPU/65-213--------------------------------------------------------------------------------
B0W1P7_CULQU/12-158--------------------------------------------------------------------------------
B0XCY9_CULQU/27-172--------------------------------------------------------------------------------
IRK1_CAEEL/76-216--------------------------------------------------------------------------------
K1QR55_CRAGI/39-179--------------------------------------------------------------------------------
Q7PX90_ANOGA/25-165--------------------------------------------------------------------------------

PF00060

IR93A_DROME/574-841--------------------------------------------------------------------------------
GLR31_ARATH/591-843--------------------------------------------------------------------------------
Q9VVU7_DROME/386-644--------------------------------------------------------------------------------
Q19693_CAEEL/134-404--------------------------------------------------------------------------------
GLR11_ARATH/540-781--------------------------------------------------------------------------------
GLR14_ARATH/568-810--------------------------------------------------------------------------------
GLR37_ARATH/578-833--------------------------------------------------------------------------------
GLR34_ARATH/613-869--------------------------------------------------------------------------------
GLR27_ARATH/582-833--------------------------------------------------------------------------------
GLR29_ARATH/566-820--------------------------------------------------------------------------------
GLR28_ARATH/577-828--------------------------------------------------------------------------------
GLR21_ARATH/574-835--------------------------------------------------------------------------------
GLR22_ARATH/580-842--------------------------------------------------------------------------------
NMD3B_HUMAN/574-842--------------------------------------------------------------------------------
NMD3A_RAT/674-942--------------------------------------------------------------------------------
O76903_DROME/477-751--------------------------------------------------------------------------------
NMDE1_RAT/554-828--------------------------------------------------------------------------------
NMDE3_RAT/552-826--------------------------------------------------------------------------------
Q9W365_DROME/518-818--------------------------------------------------------------------------------
NMDZ1_HUMAN/559-824--------------------------------------------------------------------------------
NMDA1_DROME/573-843--------------------------------------------------------------------------------
GRID1_HUMAN/562-842--------------------------------------------------------------------------------
GRID2_RAT/566-842--------------------------------------------------------------------------------
A0A4W1TXG3_ANAPP/168-431--------------------------------------------------------------------------------
GLRK_LITBE/161-425--------------------------------------------------------------------------------
B7ZPS4_XENLA/162-426--------------------------------------------------------------------------------
Q90278_CARAU/149-409--------------------------------------------------------------------------------
Q90279_CARAU/144-405--------------------------------------------------------------------------------
O01623_CAEEL/566-855--------------------------------------------------------------------------------
Q9VMP4_DROME/554-829--------------------------------------------------------------------------------
O45028_DROME/553-829--------------------------------------------------------------------------------
Q9TVI0_DROME/547-823--------------------------------------------------------------------------------
B4II60_DROSE/545-823--------------------------------------------------------------------------------
GRIK2_HUMAN/560-831--------------------------------------------------------------------------------
Q9V4A0_DROME/553-829--------------------------------------------------------------------------------
Q25412_LYMST/545-818--------------------------------------------------------------------------------
GLR1_CAEEL/591-867--------------------------------------------------------------------------------
GLR2_CAEEL/619-910--------------------------------------------------------------------------------
GLR1_DROME/610-907--------------------------------------------------------------------------------
Q9VSV5_DROME/630-967--------------------------------------------------------------------------------
G1R3B7_NOMLE/543-824--------------------------------------------------------------------------------
GLRK_LYMST/556-830--------------------------------------------------------------------------------
Q9U0T0_DOROP/568-841--------------------------------------------------------------------------------

PF02386

TRKG_ECOLI/38-485------KKSG--IQL-----RTR--------DGFIIIVMFWILFSVISAFPLWID----SE-LNLTF----IDALFEG--
TRKH_HAEIN/35-487------HHHK--QEL-----RSR--------DGFLIVVAFWLVLGSLATLPLLLF----DS-PHLTI----ASAVFEA--
Q9HPA9_HALSA/77-556------TAWL--TPP-----AAM--------ARFVPTDATWTAVSVGNTTTL----------SSLAYFRQPLHALFES--
O83176_TREPA/103-567-------------ER-----AVS--------NPSQTLIVSFLVVIFIGTHLLMFPGATPHS-QPLPM----LTALFTA--
Y460_MYCPN/24-557-------------PF-----ALK--------TDYQKVISYEVDLQGHTISKQT---------ASYGF----LDALFLA--
TRK1_SCHPO/316-816------TEPS---TV-----DMH--------IAFTGLNKPTIERERNLKLR-----------KKSRFYKKSLRSRFSR--
TRK2_YEAST/301-846------DEGDHDYFD-----GAP--------HKYMVTKKKKISRTQSCNIPTYT-----AS-PSPKT----SGQVVEN--
TRK2_SCHPO/354-857------R------PI-----YFA--------DDTNGAEQEKGAHRLDGRGRKR-------G-KSFAV----TPTLHRN--
TRK1_YEAST/624-1180------SDRN--YPD-----NSN--------TGNSILHYAESILHHDGSHKNGS-----EE-ASSDS----NENIYST--

PF03814

E3GJV8_9FIRM/5-557VFD---RVDNAIYKV-C---GVD--MD----RQMNWKQYAVALVVTNAFMIFIGYIILRIQ-FLPVF----NPNGIEG--
R4KGK3_CLOPA/7-555VLD---RVDNFIYRI-S---GIK---K----EDMSWKQYIFALISCNAVAAFLAFLILRLQ-SIPIL----NPNHIGS--
X4ZCZ5_9BACL/10-554WFG---WLEKPVYAL-G---GIR---K----ENQSWKEYALALLLSNSVMILLVYLIFRFQ-GVLPL----NPTRIAS--
I2BB55_SHIBC/11-556GTA---WLERPLLRL-V---GAD--N-----REMDWRQYLLAIVLFNLLGLVVLFTLLTSQ-ASLPL----NPQHFPG--
D2B153_STRRD/14-551T-----AVERVVYRA-I---GVR--PD----TEQRWSVYARGVLAFSLISVLFLYGLQRLQ-DKLFL----S-LGVPP--
A7I6Q1_METB6/235-800LIS---WVETKVLTA-C---GIA--PG----EEMDWKEFAVAVMVFTVPCIAAVFILQEIQ-QFLPL----NPSGLGA--
Q6F8C8_ACIAD/9-565LFR---WIEQPLYRV-L---GVR---Q----TGMNWRQYLGAFVISNVVLFVVSVVILMTQ-AWLPL----NPDHVPN--
KDPA_BACCR/7-552VFG---PFEKLIFKI-T---GVK---A----YNQTWKQYALSLVLLNGFMIVVVYFIFRLQ-GVLPL----NPAHIEG--
KDPA_PARD8/9-566FMA---PIERFIYKL-A---GIN--PN----EEMDWKAFLKSLLIINVFWFFWGMILLVSQ-GYLPL----NPDGNSG--
T0LA52_9EURY/11-544ILV---PVENFIYLL-A---GID--SS----KNMGWKEYFKTLLYLNAGEAILAFFILMFQ-QSLPL----NPMHYSG--
Q4JUS0_CORJK/12-549N-----AFERGFYRL-I---GVN--PD----GQQKWTRYCASLLAFSAISVVFVYLLQRVQ-QALPL----N-HGKEP--
I4D2C5_DESAJ/10-560LFR---PLEKLIYRL-T---GTD--EQ----SEMDWKSYAGALLIFNFCGFFVLFLLQLLQ-KYLPL----NPQGFGA--
D3F9I8_CONWI/10-571VLG---PVERGFYKL-L---RVD--PR----QEQDWKAYARAVLFFSLGSWLLLYAILRLQ-GSLPF----NPAGFGA--
B8GER2_METPE/14-556IIR---TLEAPVYRL-L---GVD--PT----AEETWRGYARDLLIFNGIGVAFLFVLLLLQ-GFLPL----NPAGVSG--
E3JBQ1_FRAIE/12-552L-----RVERGIYRL-V---GVD--PD----SEQRWPVYARSVLAFSAVSVLFLYLFQRLQ-NHLWL----A-LGFPA--
R4TDT9_9PSEU/13-552T-----KAERGLYRL-F---RVN--PG----SEQHWKTYASAVIGFSFVSVVLLYLLQRLQ-AILPW----S-LGKEP--
A0A6N4SSD6_CYTH3/25-575IFD---PLDKLFFKL-S---AID--PT----KEMNWKQHLIALLTINLVWFIMAMLVLTNM-SWLPL----NPDGNPS--
G8X3F4_STREN/12-552L-----RAERWIYRC-I---GAD--PD----AEMRWPAYLRGVLAFSVVSVLFLYLLQRVQ-NHLPG----S-LGFAA--
KDPA_DESVH/10-561VLG---PVERLIYRA-S---GIR--PE----ARQSWRQYAASLCAFSAAGFLMTFGVLMLQ-DKLPL----NPQGFPG--
F9ZTB8_ACICS/11-575LLG---PVERAIYVV-A---GID--AK----ADMGWKQYALLWILFNVVGGVFLYVLLYFQ-NYLPL----DPMHFGS--
A4FMI7_SACEN/14-552W-----RVERALYRA-V---RID--GD----APQRWTTYAAGVLGFSFVSIVLLYLLQRLQ-HLLPL----S-FGRGP--
KDPA_MAGSA/10-548-VG---RVEDGFYRL-L---GID--PT----REQGWAAYAVSLLIFHLLAVFGLYALQRFQ-GMLPL----NPAGQGA--
L0DLW9_SINAD/14-575------ALPMFLCRL-I---GRR--EP----ARMDWKKYAVAFIVFNLALFILTFGLLYAQ-PRMPL----NPDGKGS--
KDPA_METPP/10-570PFC---RVETALYRA-A---GID--AA----VGMGWKAYALALLAFNALGALAVYALQRLQ-GGLPL----NPQGLPG--
H8KMI0_SOLCM/10-568FMA---PMESLFFKL-S---GIN--PK----QEMNWKQFLKALLTINMVWFVFGFLLLLFQ-GALPL----NPDGNPS--
F0S640_PSESL/9-559VFN---PIERLFYKV-S---GIN--PD----NEMNWKQHLVALLTINLLWFLMSMGILMNM-ESLPL----NPDGNPN--
A0LLJ6_SYNFM/11-602------PAPFFRWFE-E---RLD---S----GPQNWKQYAGSLLAFNTLLFAFGFLVLALQ-PWMPL----NPDGKGM--
KDPA_PECAS/12-556LLQ---KFETKTARF-F---ALD--T-----TEMRWQQYAAAILALNLIGIVVLFVLLMAQ-GNLPL----NPENMPG--
KDPA_THEAC/28-571ITG---RIISFFERM-I---GES--PD----HGMTFKEYFINLLLFNFFAGLISFLVIMFQ-KYLPF----SYDTVGM--
R6BHA4_9CLOT/5-583VLN---RVDDVIYKI-S---GID--PH----KKMDWKKYALALLGTNAVMILLGYMILRIQ-SIPIF----NPNGVGS--
KDPA_DEIRA/9-559------ALERLTYRV-I---GIN--PR----ERMDWKRYGLAIVVSNLVMLLLAYLLIRLQ-GALPW----NPAGLAA--
K9Q855_9NOSO/9-574ILN---PIERILYSL-V---GVQ--TK----AEMTGWQYARAILYSNLVMGLLIFLIIMNQ-GWLPF----NPTKIPA--
K9V7P3_9CYAN/9-555IFS---PIEKILFAL-G---GIR--RR----ENMTGGQYARAVLYTNTIMGILVYFLLVTQ-KYLPF----NPMRLVA--
F8L2P0_PARAV/10-555VLG---RLEDGCYQM-G---GVD--PH----LEMTWQEYAKVLGIFNLLGFIFLFFLLLLQ-GILPL----NPQHFPG--
KDPA_LISMO/10-557VLE---PVERFGYRL-M---GVS---E----VGMSAKRYAVSVLAFSAVGFVFVMAVLMLQ-GFLPL----NPEGMKG--
Q6L2R0_PICTO/23-567ISG---RVTNFFEKL-L---GED--KN----KKMKFKDYFLNLLIFNAAAGVIAFIAIYFQ-RFFPF----YDDNKMG--
D1Z017_METPS/13-542AFS---PIEKALSRLLM---GMD---R----HPMDWKEYALSLLALNALLWAVAFAILYSA-G-----------------
E3GWW4_METFV/10-558IVR---PIENFIYKI-C---NID--EK----REMNWKEYAIAFTIFNTVMLTALFLLQEIQ-AFLPL----NPQGFPP--
I3THP9_TISMK/10-558VFA---PVEAGILGL-S---GVR--AG----RESSWLGYALGLITFNYAGFLLLYGVLRLQ-GVLPW----NPAGIPP--
C6VYG5_DYAFD/9-559VLG---PLEKGFYRL-S---GIR--PN----VEMSWKEHLFALLTINMVWFFLGMLVLMNQ-GWLPL----NPDGNPS--
KDPA_PSESM/10-560VLG---PVERACYLI-S---GVD--PK----TEQSWKQYAWALLAFNLAGFVVLFAMLMLQ-GLLPL----NPQQLPG--
U5QJ68_9CYAN/10-567LFD---PIEGLVYRL-G---GVD--SA----ADMDWWTYARAVLVSNLAMFVPVFTILLFQ-GSLPF----NPNAIAG--
D9R2J7_CLOSW/10-558VLA---PVERVIYKL-M---GTA--AG----EEMNAGKYAVSVLLFSGVGFVFLFLLLMLQ-GALPF----NPERMKG--
G7M3P7_9CLOT/7-555VFN---PIDNFIYKI-C---GIN--KE----EKMNWKEYVFSIIAVNAVMVFIGYIILRAQ-GLLFL----NPNKIDG--
F4KRB0_HALH1/9-568FLR---PFERLLYRL-G---GIN--PA----EEMSWQRFLRALLTINMLWLVYGFIMLFYQ-GVLPL----NPDGNPS--
J7QUT1_METSZ/10-561ALA---PIERVFYRL-A---GVD--PA----REQNWLAYTMAMLAFSVIGFVSLYALQRLQ-AYLPL----NPQGFGG--
T0N7P9_9EURY/29-575YTD---PIIGFIEKV-A---GVD--RN----KTYSFKGYFISLIIFNFVAGTISFLFLIFQ-GYFFK----APGQDVM--
I4ETN2_9ACTN/13-566W-----RVERLVYRA-V---GVD--AD----AEQRWPTYLRSVLAFSLVSVLFLYLLQRVQ-QWLPL----G-NGMPA--
KDPA_LEPIN/9-549------GFEKFLYKI-C---GID--PN----RNMDWKEYALSLLVFNFFGFLLLFLILFFQ-NYLPL----NPENFPG--
C7Q1T1_CATAD/12-560L-----RAELALYKT-M---GVD--AE----ADQTWGTYLRSVFAISAVGILLLYLLLRVQ-HHLMT----A-LGMPK--
F5XJD1_MICPN/12-552T-----RLERGLYRL-F---GVN--PD----GEQNARSYATAVLAFSLVSILLLVAILSWQ-PLLPF----S-RGMAG--
A7HRV4_PARL1/16-556------RFTHMFQTI-G---GGV--AR----QSQDWKRYLTAMLVFNAIMFVVSFAILALQ-QYLPL----NPDGKEA--
KDPA_STAA8/4-555IFT---RFENMCFKI-I---GTD---L----EHMSAKTYVKHFLAFNGFMGFITFVLLIVQ-QWLFL----NPNHNLN--
R5UVN1_9BACT/10-563FMA---PIEKWIYKL-C---GIN--PQ----EEMNWKKFLVALLTINVFWFFWGMILLVCQ-GWLPL----NPDGNAG--
C7LZF2_ACIFD/8-557LLV---RLERPVLAL-V---GVS--AS----EEQSWQRYARSLLVFSGVSIVVTYLIIVSQ-AHLPL----DPQHLVG--
I3TDE3_THEC1/12-531------RVLEVVYRC-LDRIGL---DT----TNKSFTDYAKDLLFFNFILIAIDTVLLAKQ-G-LFF----GGAD-----
J7U1A2_MORMO/10-556VLR---RVEGVLWRF-A---GIG--R-----DEMRWQGYLTALLLFNALGLIFLTAILMLQ-ADLPL----NPRHFPG--
KDPA_METNO/10-559VLA---PIERGLYRA-A---GID--AR----QEQTWLGYAGALLLFHVFGFLVLYAILRLQ-AALPL----NPADQAA--
K7WVS0_9NOST/9-560VLN---PIERIIFVL-I---GVR--PQ----DEMTGWQYAKAVLYSNIVMGILVFTILITQ-AWLPF----NPTGLGT--
KDPA_CAUVC/10-560VMR---PVEGLFYKA-C---GVD--PS----KSQSWHAYALALLAFNLIGFVFVYAVLRLQ-GVLPL----NPQGFPG--
S5Z0Q6_PARAH/9-553LFN---PVERRLLQL-A---GVS---G----RGQRWTSFAMSLLAFNAAGFALLYLVLRLQ-GWLPF----NPQGVGA--
KDPA_SOLUE/10-559ILR---PVEVAIYKL-C---GVD--EA----AEQRWTGYAGSLLAFSLVSLLFTYLIQRVQ-QWLPL----NPQGLAN--
E0UCQ4_GLOV7/9-555ILN---PIERIIYAG-I---GTN--PN----KNMTAAQYIKAVLWSNLVMAILVYLIFMIQ-GSLPF----NPTGLQA--
D7BJD8_MEISD/5-565FLA---PLERGIYRL-L---GVN--PE----RGMDWRGYAKALLGSNLLLALAAYGVLVLQ-GKLPL----NPDGVPS--
T0LT74_9EURY/28-573FSE---KAIYFIEKI-S---GVD--EN----ESHTFKGYFFSLLFFNLMAGVFTLFFLLIQTNYFPL-----PGQRGF--
B1WPS5_CROS5/10-555LLS---PIEKLIYAL-S---GVR--SQ----REMTGWQYAKNVIFSNLVMGIFVFLIFSFQ-AILPL----NPTELAA--
D7A9S5_STAND/10-561VLG---PVERGFYRL-A---GVD--ET----REQGALAYTLGMLAFNAAGVVLLYAILRLQ-GFLPF----NPLGFAG--
KDPA_RHOCS/10-561VLG---PLERGLYRI-A---GID--PA----REQHWTGYTLALLSFNLLGLLLLYALLRFQ-ALLPL----NPAELGP--
V6F0K6_MAGGM/10-558VLG---PIERSLYKI-C---GVN--AA----REQHWAAYALSLLMFNLAGVLVLYGLQRLQ-AHLPF----NPAAMAA--
KDPA_GLOVI/10-566VLG---PIENLVYRL-G---GVR--PE----LTMDWWSYARAVLASNAAMFVPVFAVLLLQ-GSLPL----NPNGISG--
A0JW40_ARTS2/13-553T-----RTERLFYRL-A---GLD--AS----TEQTWPVYLRSVLAFSAVSILAVFGLQRLQ-RVLPG----A-GALPG--
KDPA_AGRVS/10-560ILG---PLERLLLRI-S---GVD--AR----REQGWLAYTLAMLAFNAAGFLALYGILRLQ-AYLPY----NPQGFAG--
K9PBZ4_CYAGP/8-552WLL---PLETALLRW-I---GDR--GQ----PAATAWAYLQPFLVANACFGGLAFLLLAFQ-PAW-L----NPLGWPG--
D2UFZ8_XANAP/7-575LFG---WIERPLYRL-L---GTD--PA----RGMHWRGYTAAFLLSNLVLGVLVFVLFVTQ-AWLPF----NPDAVPN--
E8U851_DEIML/5-570ALA---PLERALVRL-I---GAN--PD----RGMTWQAYGRALLLSNIPLALLAFLVYAFQ-APLPL----NPDRIGN--
J9Z8M5_LEPFM/10-559------SIEKGLYRL-L---GLD--AD----REMGWKEYASTLLVSNGFFFVAGYLVLWAQ-GGLPL----NPRNLPP--
KDPA_STRCO/12-552L-----RIEKWIYKS-I---GAD--PD----TEMRWPAYLRGVLAFSLAGVLFLYLLQRLQ-GVLPG----S-LGFAS--
I0K505_9BACT/9-568FMA---PLERLLYRV-G---GVD--PN----RDMTWKENLVALLTINLVWLVYAFVLLLTQ-GSLPL----NPDGNPS--
C8XB13_NAKMY/15-551A-----RVERGIYRL-V---GVD--AG----SEQSWGVYARSVLAFSAVSVLALYALQRVQ-QHLWL----S-LGFDA--
E4T7V0_PALPW/11-556PLG---WLERLTYKL-V---GVD--AT----EETNWKTYTFGLLLFNFIGFLFVFLLQLTQ-AYLPL----NPANLPN--
KDPA_CLOAB/7-555VLD---KIDGFIYKL-S---GIQ--KE----EEMNWKQYIFALLMCNAVPAIIGYIILRIQ-AVGIF----NPNHVKG--
KDPA_LARHH/11-562WMG---RIERGILWL-M---GAA--PD----EEMGWKRYAAAILLFNLAGVVLLFLLQRWQ-GMLPL----NPAGLEG--
KDPA_ACIC5/10-582VLV---PVEKLLYRL-T---AVK--AE----EEMHWTAYCASMLIFSAATMLLTYLIERVQ-QFLPL----NPQHLGG--
E3I291_RHOVT/10-561ILS---PVERIFYAL-A---GVD--PK----AEQRWSAYALSMLAFNFAGFLLLYAILRLQ-DLLPL----NPQGMGG--
E4NDZ7_KITSK/13-552L-----RAEKALYKV-V---GVD--AD----ADQRWPVYLRSVLAFSALSVLFLYGLIRLQ-THLLL----S-LGVPE--
F8AWS9_9ACTN/16-552L-----RAEKMTYRL-V---GVD--PD----ADQRWSVHLRAVLAFSCVSALFLYVFLRLQ-GRLPF----N-LGFDG--
V5XHA6_MYCNE/12-554S-----RLERGIYRL-I---GAD--PK----AEQTWGAYARSVLAFSAVSIVFLFVFQLVQ-GKLPL----H-LNDPATE
W0PFX0_9BURK/11-559------ILESGTYAL-L---GVD--PH----QKMNWTTYGLALLLSNAAMMLLGYFLLRIQ-QTIPG----DTLQRAA--
G8TYY4_SULAD/10-560LFG---RLETAIYRA-A---AIN--PR----VEMDWKTYMKSVLAANLMMALVGYLLLRLQ-GRLPL----NPAKVSA--
KDPA_YERPE/10-556ALQ---KVEAGLWRC-S---GVK--N-----AEMNGWQYALAILCFNLLGIVLLFVLLMTQ-GSLPL----NPEHLPG--
E6STC1_BACT6/10-566FMK---PMEKLIFKA-G---GID--PE----EEMDWKLFLKTFLMLNAFWFVWGMLLLVTQ-HWLPL----NPDGNSS--
A9HGI8_GLUDA/24-574FFG---PFEAGLYRL-A---GID--AA----REQSWWGYAVAMLVFKLLCFLTVYALLRFQ-VHLPL----NPVGMGT--
KDPA_KINRD/13-552L-----RLERGIYRV-L---RVD--AD----ADTRWPTYALSVLGFSTVSILFLYAFLRLQ-GFLPL----S-LGRPG--
KDPA_KORVE/10-583VLR---PIERLIYRC-T---AVD--ES----QEMKWTEYAIAMLLFSAVSMLMLYIMQRVQ-LHLPF----NPQKFGA--
G7ZDN7_AZOL4/10-561IVG---PVERGLYRL-A---GVD--ER----TEQHWVSYAVSMLLFSAAGMLLLYALQRLQ-AVLPL----NPQGMAA--
KDPA_SORC5/10-576VLG---PLERLAYRA-A---GVR--PD----QEMRWKDYAFAVLAFNLAGLLVLYALQRLQ-GVLPL----NPEGMAA--
B7J712_ACIF2/10-575LMS---PVERGLYRV-I---GVS--AS----EEMDWKRYAIALLIFNLIGGVFLYALLLAQ-GALPL----NPLHFGG--
H1YB12_9SPHI/10-568FMA---PVERLIFRL-S---GID--AQ----REMNWKQHLYAMLTVNAVWLFYAFFCLLYQ-SHLPL----NPDANPS--
C7PUT0_CHIPD/9-567FLN---PVERFIYRI-C---GID--PH----KEMNWKQHMAALLSINLVWLIYAFFILLFQ-SHLPL----NPDGNPD--
KDPA_DESDA/9-579ALA---PCERALYRL-M---GVD--PA----EQMGWKCYMACVIAFSAVSLVALTALLMAQ-HLLPL----NPRNVSG--
K9RWG4_SYNP3/9-555IFQ---PVERLLFQA-S---GIN--PH----ISMTAWQYIRALLMSNLVMGLFVFVLQLAQ-GFLPL----NPTGLGE--
KDPA_STAEQ/4-554VFN---PIEKLIYQL-I---GTK---L----EHMSGKTYIKHFLLFNGLMGGLSFVLLLIQ-QWLFL----NPNHNLN--
KDPA_CLAMS/12-556T-----RVERGIYRL-I---GVD--PR----SEQTWPAYLRAVLAFSLVGVLVVYGMQRLQ-AFLPY----A-LGLPA--
KDPA_SYNY3/9-555IAR---PLESLIFAG-S---GIT--KH----PSMGATQYVSAALISNLVMGVFVFLILMFQ-GSLPL----NPTGLAA--
KDPA_KLEP7/11-556GLA---GVERVLWRV-A---GIR--A-----EEMGWLQYLLAILLFNALGGLALFALLMLQ-GVLPF----NPQHLPG--
K9Z7H8_CYAAP/9-557FLK---PIESRLYSL-F---GLRILEA----TNSNGYQYVKDVIASNLVMGILVYLILMTQ-GFLPL----NPTDLSA--
D1CGX3_THET1/8-561ALA---PLERAIYRV-A---RVD--PD----REQDWRGYALALLLFNLSGMLALYALQRLQ-AWLPL----NPEHLPG--
E2Q1F7_STRCL/12-553L-----RAERVVHRA-A---GVP--PD----ADQTWPAYLRSVLAFSLVSLALLYVLLRAQ-HLLPL----S-LGRPG--
W8EUK3_9BACT/12-563FMR---PVENGIYRL-S---GID--AR----REMTWQQHMVALLTINLVWFLLAMLVLCTQ-GSLPL----NPDGNPS--
K9TR50_9CYAN/9-555GCR---PIERWIYQI-G---GIS--SW----ESMTGWQYARAVLISNLMMGILVFLIFMFQ-GILPL----NSTGLEA--
W0EX99_9BACT/9-563IFK---PVDTIFYRL-G---GID--PS----KEMNWKQHLIALLTINLFWFLGCMFVLMNM-SWLPL----NPDKNPS--
C6D691_PAESJ/7-556LFG---GIERFIYKV-I---GLK--SR----EGMTWKKYALSFLLTNIVLVALSYLILRLQ-GSLSG----NPNGIGA--
B3EAQ3_GEOLS/13-570LLA---PVERLIYRS-C---GVQ--PD----EEMGWKRYAAAMLFFNLVLFAGLFVLLMTQ-HLLPL----NPRQMPS--
K9VVM6_9CYAN/9-559VIN---PVDSMIYKL-G---GLR---T----ESMTGWQYARAVLYSNLVMGIFVYLILMLQ-GILPL----NPTGLSS--
K9X7N8_9CHRO/9-556VIN---PIERTIFAI-N---GTR--YK----DNMTGRQYIQAVIISNLVMSIFVFSILMLQ-GVLPL----NPTGLNP--
I3Y5A2_THIV6/11-568LGG---GLESLLYRL-C---GVR--QN----KEMGWLHYALAILLFNLLGALAVYALQRLQ-VWLPL----NPQQLAN--
W5WRB9_9PSEU/12-552W-----KLERALYKV-V---RVN--PD----SEQRWSTYAYGVLGFSFVSVLFLYLLQRLQ-TVLPL----G-LGRPE--
F4C4K6_SPHS2/10-559LFG---NIENTIYRL-G---KID--SK----HEMSWKQHLVALLTINSIWFLVGMFILMNQ-DWLPL----NPDTNPA--
D9QG06_BRESC/10-560VLR---PVEKVFYGL-A---GVN--PD----RSQGWVGYAGALVVFNAMGFGLLYAILRLQ-GGLPL----NPQGFEG--
A8HY16_AZOC5/10-561VLG---PVERGLYRV-A---GVD--PK----LDQSWIGYTLAMLAFNGAGAVLLYAILRFQ-DFLPW----NPQGFAG--
Q186E7_CLOD6/11-560LFD---KVDNFIYKV-C---SID--KK----KEMNWKQYALALLFTNAVMVFIGYIILRTQ-SMHIF----NPSGIKS--
KDPA_TOLAT/12-560WLI---RVESHIKFL----------EN----SQMKWQTYAAAILVFNLLGAALLFLLMLFQ-GSLPL----NPLHLPD--
U5LJM5_9BACI/9-555VFG---PIENILFKI-S---GIK---K----INQTWKQYAMTLVLANGFMILLVYMVFRLQ-GILPL----NPSGNPG--
KDPA_BEII9/10-560VLK---PVERLVYRA-C---GID--PR----QSQTWSSYALALLAFSAASFILLYAILRLQ-GWLPL----NPQGFAG--
KDPA_ANADE/10-573PVA---RLERGLYRL-A---GVD--PA----EQMGWRRYAAAALTFNAAGLLAVFALERLQ-AALPG----NPAGLPA--
E8X5C7_GRATM/10-587LFR---PVERALYKL-S---GID--ES----YEMRWTEYAISMLLFSLVTLLLTYMIERLQ-QWLPL----NPQHLAN--
C5C4A0_BEUC1/16-557L-----RVERAGYRL-A---RVD--PD----ADQTWSTYLLSLLGFSLVSVLFLFGLGRLQ-EYLPW----N-LGFVG--
K8GCZ3_9CYAN/9-558VLN---PLEQVIFSL-S---GIR--SN----EEMTGWQYARAVVYSNTVMLVFIFSIFMFQ-GVLPF----NPTGLTA--
D0IYN9_COMT2/9-559------WLERLSYRV-M---GVN--PQ----ERMGWQRYGTALVLSNALMMLLGYLLLRLQ-GALPL----NPLEIAA--
E0SEX9_DICD3/10-555ALR---RYELGVARL-C---GFS--T-----REMGWQHYAGAILVFNLLGIVLLFLMLAYQ-DRLPL----NPQQMPG--
R6RMK4_9FIRM/8-574LLR---PVEHGIYKI-M---HVK--EE----EEMGWKRYAGSVFMFSITALIVLMLIHMFQ-GVLPW----NPQGQKG--
F4F4Y7_VERMA/14-551S-----RVERGIYRL-I---GVN--PA----AEQSWGVYARAVLAFSAVSVLFLYAFLRLQ-NHLWL----S-LGFDP--
A8KYG3_FRASN/13-567L-----PVERAIYRL-T---GVN--PN----AGQRWTVYARSVLAFSAVSVLFLYLLQRVQ-DHLPW----D-LGFSG--
E1VQU5_9GAMM/5-576LFQ---WIERPLYAL-L---GAR--PE----AGMSWRGYAGAFLLSNLVLAVVVWIIFMTQ-AWLPL----NPDGIPN--
C6XZL6_PEDHD/9-568FLK---PLENGIFKL-S---GIN--PK----EEMNWKQHMKALLTINLVWLVYGFFVLIYQ-DKLPL----NPDGNPG--
B7J714_ACIF2/9-575FLG---PLEKRIYRL-T---GVP--VD----DEMGWKRYSLSLLLFNILGVLFMYFIFQAQ-GALPL----NPQHLPG--
E8RRM4_ASTEC/14-564VFT---PVEGLIYSM-G---DVR--PD----QDMRWTDYATAVILFSFGGFALLFGLLLTQ-GVLPF----NPQHLPN--
K0CGH7_ALCDB/5-555GIA---TVENGLLRL-A---GIN--PN----ADMSWSDYARVLLKLHLLLAIVIFLVLTLQ-QWLPL----NPDHIPN--
K8E2F1_CARML/9-558VIE---PIENQVYKF-I---GKP--AK----LEMTAKKYALAIVSFSLFSFLAVFLLMLGQ-GFLPA----NPNGFSG--
D3EAK4_GEOS4/7-556WFS---WAEKRIFAL-I---GLK--ER----KGMTWKGYAVSFVLTNIVLVAAGYLILRLQ-KVLPL----NPSGIGH--
D5WU10_KYRT2/12-563VLR---PLERGLYRL-F---GLN--AS----REMSWKTYAWAVIAFNAVGMAVLFVLQLVQ-GWLPF----NPQHFSA--
G8TDF8_NIAKG/9-568FMN---PVERFIFRV-S---GIN--PN----ASMDWKQFLKAMLSINLLWFVYAFFALLFQ-DKLPL----NPDGNPA--
KDPA_HYDS0/11-568PIR---YVEKTIYKI-L---GID--ES----KEMNWKEYLYALLSFNFLGFLVLFLTLLFQ-KYLPL----NQYHIPN--
D7DKK2_METV0/11-584LGG---PIERIIYRA-L---GIK--PE----TEMGWKHYAVALLLFNVIGIVFVYVLQRLQ-VWLPL----NPQSFPA--
R6PVD9_9CLOT/5-571VFN---PIDHFIYKI-C---GIK---D----EEMGWKKYALTLVMVNAVMVFVGYLILRIQ-NVLFL----NPNGIEG--
F2IFU1_FLUTR/9-571IFN---PIERFFFRI-S---GLD--GT----REMNWEQHIYALLGINLVWFFICFLLLLNQ-GWLPL----NPDHNPS--
F7QKE7_9BRAD/10-559ILR---PVEAVLYRL-G---GVD--EK----HEQHWLTYTVAMLLFHVGGFVLLYTLIRLQ-GVLPF----NPAGQSA--
KDPA_MICAN/9-574LCD---RVESLLYTF-V---GVK--GK----ENMTGWQYTRAVLYSNAVIAILVFSLIAGQ-GVLPL----NPTGIPA--
S0EVD3_CHTCT/10-589ILR---PLEVGLYRL-F---GIE--EE----VEMPWTTYALAFVLFSVVGLLLTYILLRLQ-GHLPW----NPQKFGADQ
KDPA_RHIME/11-561ILG---PVERGLYGA-A---GID--PT----REQGWLAYTLSMLAFSIAGFLLLFAILRLQ-AWMPL----NPQGFGN--
D5AKZ2_RHOCB/10-560LLH---PVERGFYRL-A---GVT--PE----REQGWLGYALAMLAFSAAGFAALYLILRAQ-GLMPF----NPGQLPG--
C9R8E6_AMMDK/12-560LLR---PIEGVVYRL-A---GVN--PY----AEMSWTRYLGSLLLFNFWGLLAGYLLLRWQ-NHLSF----NPLHLPG--
C6W8P0_ACTMD/12-539T-----RVERLLYRA-A---RVD--PD----SQQRWGTYAQGVLGFSLVGVALLYLMQRVQ-PWLPF----D-HDRGA--
Q09AH8_STIAD/10-563VLG---PVERGLFRL-C---GVD--PS----REQTWGQYTRALLAFSLFGVLLLDALQRLQ-HVLPL----NPQGLPA--
C4KYL4_EXISA/11-542------ALETRITRR-L---RIN--ER----EKQSWFGYAKDFLTLNLLFLLIGYVLLRFQ-GVLPF----NPNGAVN--
KDPA_PSEAE/10-560PLA---PLERVCYRL-F---GVD--PA----SEQDWKTYTLALLAFNLAGLVLLFSILMLQ-GSLPL----NPQHLPG--
A0KED5_AERHH/10-553WLA---PLERATLAC-C---GTD---G----REQDWKSYALSLLAFNGAGFGLLFLILLAQ-GLLPL----NPQQLPG--
E9T4H3_RHOHA/12-565FRSGDLRIETVVYRL-C---RIN--PR----TEQTWYGYAGSLLGFSAASVLLLYFLQRIQ-GVLPL----G-GGLEG--
Q31MM1_SYNE7/10-552LCT---PWEQRLFRW-I---TVD--SS----QSMPTGQYLRSLLWVNAVTAVLSWGLLSLQ-AWLPL----NPSQRSP--
KDPA_NOSS1/9-555VMN---PIERSVYVI-S---GVR--PK----DEMTGWQYIRAILYTNLFMGILVYSLIYFQ-RLLPW----NPNGLGV--
K9UDW3_CHAP6/9-563VLH---PVERLIFGL-S---GVK--PE----VQMTGWQYARAILYSNLAMAILLFAILMLQ-GVLPL----NPTGLGA--
KDPA_HALSA/11-578IFT---PIENGLYRL-S---GIN--PR----REMTWKGYLKAVLVFNVCIWVLLFVVLMFQ-DALPM----NFVGVGG--
W0A4I8_9SPHN/10-559VLG---PVEAGFYRL-A---GID--PA----AEQSWRRYAVHMLIFNVALLLLTYAVLRLQ-GLLPG----NPLGYAG--
KDPA_RHORT/10-561VFG---PLERGLYRL-S---GVR--PK----EEQHWAAYALSMLVFNLAGLLGLYLILRVQ-GWLPL----NPAGLGA--
R6NNJ3_9FIRM/5-564IFN---PLDNTIYKI-C---HIG---R----EGMNWKQYALHLLTTNAVMVFIGYLVLRLQ-GILFA----NPNGIEA--
D3RSD8_ALLVD/5-565VFG---PVEWVIYRA-I---GVD--PL----APMSWKAYGKALLKLHLIIALIALVILVQQ-GWLPA----NPDGVEG--
I0H1S8_ACTM4/10-547T-----VVERAVYRT-V---GVD--AA----AGQTWGVYARSVLAFSAVSLLFLYLFLRVQ-DALWL----S-LGLPA--
KDPA_GEOKA/9-557FFS---PIEAVIYRL-S---GIR--SL----EEMTWKSYCTALLIVNAALLGISYGLLRIQ-HYLPL----NGAKVEN--
KDPA_CALS4/9-558IFL---PVENFIYKI-T---GIN--PE----EEMDWKKYALTFLLVNMVMMIITYFILRVQ-QFLPL----NPTGAKN--
D2Q289_KRIFD/12-553T-----RVERGAYKM-L---GVD--AK----ADQTWAVYARSVLAFSVVGLVLLYLLQRLQ-AYLPL----S-LGLPG--
K9RK69_9CYAN/10-555VMN---PLELLIYKL-A---DVN--PQ----ENMRGKEYAYCVLQSNLFIGLLVYLFISFQ-KFLPW----NPSNLGA--
KDPA_ALIAD/10-559VMV---PVERAIYRL-I---GVN--PE----VEMDWKAYLRAMMVSNLVMALFAYAVFRLQ-GVLPL----NPAHIPA--
B6JA58_OLICO/10-557VLG---PVERGLYGM-A---GTS--EK----EEQHWTTYLGAMLLFNLAGFALLYLLQRVQ-GGLPF----NPAGMGA--
D3PV93_STANL/12-552R-----KVERGVYRL-V---GVK--SD----VEQTWGGYARSVLAFSAVGVFFLYGFQRLQ-PLLPW----S-NDMAA--
H1ZCI8_MYROD/9-559IMS---PLEQFCYKS-S---RIK--PE----EGMNWKQHLVALLTLNAVWFVVAFILLLTQ-GSLPL----NPDHNPS--
H9ZZC9_FERFK/11-532------KLLKKVFDV-LDIIGLG--SS----SEKSFLKYIADAFLLNFILIAIDTIMLMKQ-S-LFF----GGPD-----
KDPA_FLAPJ/10-570IFN---PIEKFIFKI-S---GIN--AT----EVMNWKQHLKALLSINMVWFFLCFFILLFQ-GSLFL----NPDNNPS--
A5FU08_ACICJ/10-556FLA---AIEAPIYRL-C---GID--PQ----RQMAWGAYAVGLLLLSLIHFLLLYAILRLQ-YFLPF----NPEHIRG--
K9Y0M2_STAC7/9-555IAQ---PLEKLIYTV-G---GIN--YQ----KNMTGWRYARSVLISNLVMLVFVFLILIFQ-GLLPL----NPTGLTA--
C0ZIZ1_BREBN/7-554VFG---GLEKAIYKL-S---GIR---V----ADMTWKQYAMAVLVSNISMVAIAYLLLRLQ-GMLPG----NPSGIAA--
D6ZE64_SEGRD/12-555L-----AVERVLYKA-A---RVN--AA----AEQTWQWYTLSLLGFSFVSVFFLYALQRLQ-GVLHL----G-GGLAA--
H7C701_ENTFA/10-555FLQ---PVERLFYKA-I---GPI--SK----KEMSAKRYALNVLLLSFFSIVLLIAILMTQ-HFLPG----G-SSVKN--
F4CT92_PSEUX/12-552W-----RIESMLYRL-V---RVD--AS----SGQRWPTYAAGVLGFSFVSCALLYLLQRLQ-PVLPA----S-FGRGP--
E8V6X7_TERSS/10-579LLA---PCERLLYRL-T---GVK--PE----EEMRWTEYAVAMLAFSTATLVLTYAIERLQ-HLLPL----NPQHLTG--
KDPA_PHOLL/10-561WLT---KIESGLWRC-C---GLQ--KPGGTVKEMNWWQYALAITIFNLTGLLLLFTLLVTQ-HALPL----NPEHFPG--
KDPA_MYCTU/10-568VFG---PIERVIYQV-C---RVD--PG----SEQRWSTYALSVLAFSVMSFLLLYGIARFQ-GVLPF----NPTDKPA--
J7J1Q1_DESMD/10-560IMG---PLEAFIYRI-C---GID--AQ----KEMNWWEYALSLLVFSFVGLFTLFILQLGQ-GYLPL----NPQGFGG--
D5UVP7_TSUPD/12-549W-----RVERAVYKI-V---GAD--PE----AEQGYRTYAVAALAFSAVSIIALTILLLAQ-GLLP--------GFHPRQ
U5RTG7_9CLOT/7-555VLD---KVDNFIYKI-S---GIT---K----EEMTWKQYIGALLLCNLVPAILAYIILRIQ-FMPVF----NPNHIGG--
D1BAQ9_SANKS/14-555L-----RVERLGYRV-M---RVD--AD----AEQRWTSYLFSLLGFSLVSLLALYAMGRLQ-EHLPM----N-LGVSA--
L0ABX1_CALLD/9-533KLN---KIENFIFKT-L---GIN--KE----NSMNYKEYLLSLLSLNIIFIVFDTVFLMFQ-NHLSF----IGPNYKG--
KDPA_GRABC/10-560ILG---PVERALYRF-S---GVR--PE----EEQSWSHYALALLSFKIVCFVAVYAILRLQ-AYLPL----NPAGQGS--
C9A6Y5_ENTCA/10-555FIQ---PIERLTYRV-I---GSV--SK----KEMTAKTYLFSVLAVSVFSIIGLTGLLMVQ-HWLPQ----G-AAVEN--
W0I187_9GAMM/10-555LTA---GFERTLWRL-C---GIG--------GAMHWRHYLCAILLFNLLGGALLLAILLLQ-GLLPL----NAQHLPG--
B8ESF4_METSB/10-566-LK---FIEDSLFRL-T---GVD--PE----SEQNWLNYAAALIIFNLAGILLLFAFLLLQ-DALPL----NPRGFGP--
KDPA_METB6/11-574LFV---PVEAWILKA-C---GAG--SD----EEMDWKSFAVAMMIFSVIGIVFVFILQEVQ-QFLPL----NPLGATA--
D5SYH3_PLAL2/10-576FIG---PLERLLYRL-C---GID--KS----AEMTWRQYSVAAMSFSLVSFLAVYAFQRTQ-GWLPL----NPESLPA--
D7B3X9_NOCDD/11-556L-----RIERGFYRL-V---GVD--PR----SEQSWPAYLRAVLAFSAVGLVLLYLLQRLQ-HVLPH----A-LGLPP--
E3EDK0_PAEPS/7-556IFG---ETEKPIYKV-V---GLK--KQ----DSMRWTTYAMSFIATNVVLVGISYLLLRLQ-AILPG----NPVGNSN--
B8GSR6_THISH/5-564LFL---WLERPLYAL-I---GTN--PE----RGMSWRGYAGAFLLSNLVLAVIVWLILMTQ-AWLPL----NPNGAPN--
A5N882_CLOK5/5-568VFD---PIDGMIYRI-C---GID---K----KEMNWKQYITALLVTNAFMVLIGYFILRLQ-ALHIF----NPNGISG--
H6NGX7_9BACL/8-552WFG---WIEKPIYTI-S---GIC---R----DNQTWKQYALAVVFSNLVMIILVYLIFRFQ-KFLPL----NPSGIAN--
KDPA_ECOLI/10-556GTT---GVERVLFRA-L---GVS--D-----REMNWKQYLCAILGLNMLGLAVLFFMLLGQ-HYLPL----NPQQLPG--
R5W702_9BACT/12-563FMA---PVERFIYKV-C---GID--PE----REMNWKQFLKALLTVNLFWFIWGMVLLVCQ-GWMPL----NPDGNPG--
KDPA_HERA2/10-575FFG---PIERLIYRL-L---GID--AK----SEMHWKHYALALLGFNAMGMLLLYGLQRMQ-AWLPL----NPQQLPA--

PF08016

PKD1_MOUSE/3701-4103VYD-SGGYIQ-ELG-LSLEESRA--------RLGFLQLHNW----LDSRSRAVFVELTRYS-------------------
PKD2_MOUSE/265-685SYS-GAGYYL-DLS-RTREETAA--------QLAGLRRNFW----LDRGTRAAFIDFSVYN-------------------
Q8T8Z2_DROME/169-596NYPEVAGYVV-LMM-STKINCLK--------QIEYLRDYSW----LDKNTSALFIDLTMYN-------------------
PKDRE_MOUSE/1621-2051TYG-SGGYVFYFFPGQQMFNSTV--------RLKELEGKNW----LDELTWAVIVELTTLN-------------------
Q95V80_STRPU/2211-2645SLP-SSGYIW-VLG-SMYEEAKD--------SLAEMVDARW----LDARTRALFVEWTSYN-------------------
PKD2_CAEEL/119-538SYG-GGGFVQ-RLPVAGSTEAQS--------AIATLKANRW----IDRGSRAIIVDFALYN-------------------
Q9VVZ8_DROME/165-591NYPESKGYKV-LLS-DTRHKSLK--------IIDYLMKKNW----LDANTTALFMDFSLYN-------------------
PKDRE_HUMAN/1748-2178TYG-SGGYALYFFPEQQRFNSTL--------RLKELQESNW----LDEKTWAVVLELTTFN-------------------
Q9VK95_DROME/402-803FYR-TGGYTV-NLD-YDKDRNVK--------IINDLKDIHW----LDRGSRLCLVEFNLFN-------------------
PK2L1_MOUSE/147-567SYS-GGGYYL-DLP-GSRQASAE--------ALQGLQEGLW----LDRGTRVVFIDFSVYN-------------------
Q9W4X5_DROME/170-595SYPELAGYVS-LLA-RSAANSMK--------VIDYLSENHW----LTLNTSAVFIDFTLYN-------------------

PF00520

TRPV2_MOUSE/387-652--------------------------------------RFF----FNFAC-YLVY-------------------------
TRPC5_RABIT/372-636--------------------------------------ASY----LTFLFMLLLA-------------------------
O46129_LOLFO/351-636--------------------------------------ASY----LSFLV-LLIL-------------------------
TRPG_DROME/361-664--------------------------------------ASY----FTFLF-LLMLASQ----------------------
TRPL_DROME/382-680--------------------------------------SSY---LFFLFI-LILVSQRADD-------------------
Q94447_CALVI/372-670--------------------------------------CSY----MFFLMLLGAA-------------------------
TRPC2_MOUSE/670-932--------------------------------------AS-----YLWFL-IFLL-------------------------
TRPC3_HUMAN/379-670---------------------------------------------ASFII------------------------------
TRPC6_MOUSE/447-738---------------------------------------AS----FTIFLGLLVMNA-----------------------
TRPM2_HUMAN/801-1060--------------------------------------LNI----LSYFA-FLCL-------------------------
TRPM1_HUMAN/833-1087--------------------------------------FYT----ISYLG-YLLL-------------------------
Q20766_CAEEL/902-1141--------------------------------------S------WCIAF-LIFL-------------------------
TRPG_CAEEL/1312-1567----------------------------------------S----WTISF-ILFI-------------------------
TRPV5_RABIT/332-590---------------------------------------------LASLY-ILYM-------------------------
Q9VUD5_DROME/475-730--------------------------------------TFW----LNFTE------------------------------
O61220_CAEEL/519-775--------------------------------------RLV----FELFV-VIGI-------------------------
Q9W3W0_DROME/459-665--------------------------------------RYC----AEFAT-LVGV-------------------------
PAIN_DROME/494-746--------------------------------------IFY----LNFLI-YSLF-------------------------
TRPA1_DROME/793-1039--------------------------------------NMG----WEQLT-MNLS-------------------------
TRPA1_HUMAN/720-972--------------------------------------MMN----LGSYC-LGLI-------------------------
TRPA1_CAEEL/813-1080--------------------------------------MYY----FALFMYLVFIVS-----------------------
Q9VHY7_DROME/551-812--------------------------------------RLIFCFSFVLFL-TLYV-------------------------
PYX_DROME/496-735--------------------------------------SLA----YHTLFVILFT-------------------------
O13054_MAKNI/4778-4992--------------------------------------ERI----------AELL-------------------------
O61567_HOMAM/1212-1418--------------------------------------DAI----SNLLG------------------------------
O96310_HELVI/229-436--------------------------------------DSI----SNMLG------------------------------
ITPR_DROME/2408-2692--------------------------------------ITI----FSLVI-VLALPRES---------------------
O77089_PANAR/2326-2624--------------------------------------GLAIVVSFQQQI-FIYL-------------------------
ITPR1_MOUSE/2315-2600--------------------------------------AML----ISLAI-VIALPKPH---------------------
ITPR2_HUMAN/2270-2552--------------------------------------AVAICTSMLFFF-SKPV-------------------------
Q9VW35_DROME/351-581--------------------------------------RSV----LNIFV-LLTCALSFAL-------------------
CCH1_YEAST/769-1010--------------------------------------YSH----VEFIF-VILI-------------------------
NALCN_RAT/35-333--------------------------------------KPW----VHSLL-RICA-------------------------
CCH1_SCHPO/514-755--------------------------------------YLF----YSNFIWISFI-------------------------
TPC1_ARATH/429-683--------------------------------------SPN----FGYAI-SFIL-------------------------
TPC1_HUMAN/440-698--------------------------------------SKA----FQYFM-YLVV-------------------------
TPC1_ARATH/103-316--------------------------------------DRD----YYYLG-ELPY-------------------------
CCH1_SCHPO/1272-1517--------------------------------------RTF----TGLYI-VHLL-------------------------
CCH1_YEAST/1529-1779--------------------------------------NFY----YASFL-QVVL-------------------------
CCH1_YEAST/1209-1484--------------------------------------VFI----FALAT-ILLI-------------------------
CCH1_SCHPO/941-1224--------------------------------------YRV----IQVFI-YACI-------------------------
CCH1_SCHPO/184-493--------------------------------------HPL----YNIFI-FVVI-------------------------
TPC1_HUMAN/105-331--------------------------------------NHL----FYLME-LATA-------------------------
NALCN_RAT/1209-1458--------------------------------------HPF----FKRTI-ALLV-------------------------
NALCN_RAT/383-610--------------------------------------SSV----FHMFI-LSMV-------------------------
NALCN_RAT/885-1167--------------------------------------VTY----LDWVM-ITVT-------------------------
CAC1E_DIPOM/1104-1385--------------------------------------LRY----FEMCI-LLVI-------------------------
Q17354_CAEEL/340-623--------------------------------------TKY----FEMMV-MTVI-------------------------
M9NDV1_DROME/768-1051--------------------------------------LPY----FDFFI-MVVI-------------------------
P91744_HETBL/894-1174--------------------------------------LRY----FDLFI-MIVI-------------------------
O02038_CYACP/868-1147--------------------------------------NKI----FINSI-LVLI-------------------------
O97017_STYPI/849-1127--------------------------------------NTY----FVNFI-LCLI-------------------------
O96057_HALRO/803-1082--------------------------------------YNW----FNNAI-LACI-------------------------
CAC1D_DROME/1343-1621--------------------------------------HSN----FGNII-LCCI-------------------------
CAC1S_CYPCA/814-1092--------------------------------------HTT----FTNII-LLFI-------------------------
CAC1S_HUMAN/798-1076--------------------------------------ATW----FTNFI-LLFI-------------------------
CAC1C_HUMAN/899-1197--------------------------------------DTI----FTNLI-LFFI-------------------------
CAC1D_HUMAN/885-1163--------------------------------------HHI----FTNLI-LVFI-------------------------
CAC1G_RAT/1254-1527--------------------------------------HKM----FDHVV-LVII-------------------------
Q9W433_DROME/2144-2418--------------------------------------QKW----FDNVV-LLFI-------------------------
O44930_EXADI/1046-1318--------------------------------------HKY----FEWTI-LAII-------------------------
O62604_POLPE/908-1178--------------------------------------HKY----FEGVI-LFLI-------------------------
Q17314_CYACP/963-1231--------------------------------------NKY----FEFMI-LFLI-------------------------
P97706_RAT/954-1225--------------------------------------NSW----FECFI-GLVT-------------------------
SCN7A_HUMAN/933-1204--------------------------------------NNW----FKCFI-GLVT-------------------------
SCN1_HETBL/781-1052--------------------------------------NKY----FETGV-LVII-------------------------
O02037_BDECA/985-1259--------------------------------------HKY----FETFI-LFMI-------------------------
SCNBA_RAT/1033-1299--------------------------------------HSW----FESFI-IFVI-------------------------
SCNBA_HUMAN/1055-1319--------------------------------------HSW----FESFI-IFVI-------------------------
Q25150_HALRO/1260-1547--------------------------------------HAW----FESFI-ILMI-------------------------
SCNAA_CANLF/1158-1436--------------------------------------HSW----FESFI-IFMI-------------------------
SCNA_ELEEL/999-1275--------------------------------------HDY----FETFI-IFMI-------------------------
SCN4A_HORSE/1027-1303--------------------------------------HHW----FKTFN-SSLI-------------------------
SCN8A_RAT/1195-1473--------------------------------------HNW----FETFI-IFMI-------------------------
P90670_APLCA/1177-1452--------------------------------------NKY----FDSFI-IAMI-------------------------
Q25377_DOROP/1022-1296--------------------------------------HEY----FETFI-ITMI-------------------------
SCNA_DROME/1300-1571--------------------------------------NKY----FETAV-ITMI-------------------------
Q9XZC1_RHIMP/461-733--------------------------------------HKY----FETIV-VVLI-------------------------
Q9W433_DROME/300-623--------------------------------------NPW----FERVS-ILVI-------------------------
CAC1I_RAT/76-407--------------------------------------NPW----FECVS-MLVI-------------------------
CAC1G_RAT/80-406--------------------------------------NPW----FERVS-MLVI-------------------------
CAC1H_HUMAN/99-430--------------------------------------NPW----FEHVS-MLVI-------------------------
CAC1E_DIPOM/101-374--------------------------------------WPP----FEYMI-LATI-------------------------
M9NDV1_DROME/37-324--------------------------------------WPP----FEYAV-LLTI-------------------------
P91744_HETBL/64-348--------------------------------------WGP----FEYMV-LLTI-------------------------
O02038_CYACP/112-392--------------------------------------WKP----FDFFI-LASI-------------------------
O97017_STYPI/80-362--------------------------------------WKP----FDVMI-LITI-------------------------
O96057_HALRO/46-328--------------------------------------WRP----FDVLI-LLTI-------------------------
CAC1D_DROME/614-889--------------------------------------WKP----FEFLI-LLTI-------------------------
CAC1S_CYPCA/69-362--------------------------------------WKP----FEIII-LLTI-------------------------
CAC1F_HUMAN/91-383--------------------------------------WKP----FDILI-LLTI-------------------------
CAC1D_CHICK/120-412--------------------------------------WKP----FDIFI-LLSI-------------------------
CAC1S_HUMAN/50-345--------------------------------------WKP----FETII-LLTI-------------------------
CAC1S_LITCT/50-343--------------------------------------WKP----FEMII-LLTI-------------------------
P97706_RAT/117-405--------------------------------------HPL----LRLLI-LISV-------------------------
SCN7A_HUMAN/117-405--------------------------------------HPF----FQLFI-LISV-------------------------
O02037_BDECA/134-418--------------------------------------HPL----FSIVV-LLTI-------------------------
SCNBA_RAT/128-406--------------------------------------HSV----FSMFI-ICTV-------------------------
SCNBA_HUMAN/128-411--------------------------------------HSL----FSMFI-IGTV-------------------------
SCNA_DROME/152-440--------------------------------------HPL----FSLFI-ITTI-------------------------
P90670_APLCA/137-431--------------------------------------HPI----FSLLV-MMTI-------------------------
Q25377_DOROP/131-412--------------------------------------HPI----FSLVV-ILTI-------------------------
Q25150_HALRO/130-477--------------------------------------HSV----FNSVI-MLTI-------------------------
SCNAA_CANLF/129-417--------------------------------------HSW----FSLFI-TVTI-------------------------
SCNA_ELEEL/121-413--------------------------------------NSA----FNFFI-MFTI-------------------------
SCN4A_HUMAN/130-458--------------------------------------HAL----FSMFI-MITI-------------------------
SCN5A_HUMAN/130-424--------------------------------------HSL----FNMLI-MCTI-------------------------
Q90518_TAKRU/128-427--------------------------------------HSM----FSMLI-MFTI-------------------------
SCN1_HETBL/54-345--------------------------------------NVC----FDYFL-MFTI-------------------------
O44930_EXADI/112-392--------------------------------------NQF----FEFFI-LLTI-------------------------
Q17314_CYACP/142-419--------------------------------------NQI----FEIFI-LLTI-------------------------
CAC1G_RAT/1578-1830--------------------------------------SHY----LDLFI-TGVI-------------------------
Q17354_CAEEL/666-920--------------------------------------SPP----FEYFI-MTMI-------------------------
P91744_HETBL/1217-1468--------------------------------------SPK----FECVV-MVLI-------------------------
M9NDV1_DROME/1094-1348--------------------------------------STP----FEYFI-MMLI-------------------------
CAC1B_DIPOM/1467-1716--------------------------------------SPP----FEYLI-MALI-------------------------
CAC1E_DIPOM/1428-1674--------------------------------------SPS----FEYTI-LTMI-------------------------
CAC1E_HUMAN/1477-1734--------------------------------------SPS----FEYTI-MAMI-------------------------
O02038_CYACP/1188-1437--------------------------------------SRL----FEYMI-FGFI-------------------------
O97017_STYPI/1168-1422--------------------------------------SQA----FEYLI-FAFI-------------------------
CAC1M_MUSDO/1108-1378--------------------------------------SSS----FEYSI-FVLI-------------------------
O96057_HALRO/1123-1384--------------------------------------STY----FEYFM-LVLI-------------------------
CAC1S_CYPCA/1133-1413--------------------------------------SCY----FEYLM-FFLI-------------------------
CAC1S_RABIT/1117-1392--------------------------------------SSY----FEYLM-FALI-------------------------
CAC1C_HUMAN/1238-1535--------------------------------------STY----FEYLM-FVLI-------------------------
O02037_BDECA/1306-1555--------------------------------------NKN----FDIVI-MGFI-------------------------
SCN7A_HUMAN/1250-1507--------------------------------------SQA----FNVIV-MVLI-------------------------
P90670_APLCA/1499-1743--------------------------------------DQK----FDIAI-MVII-------------------------
Q25377_DOROP/1343-1600--------------------------------------NQK----FDVAI-MMVI-------------------------
SCNA_DROME/1618-1871--------------------------------------DKK----FDIII-MLFI-------------------------
Q9XZC1_RHIMP/780-1031--------------------------------------NKM----FDMAI-MIFI-------------------------
SCNBA_RAT/1345-1595--------------------------------------SQV----FDVII-LGLI-------------------------
SCNBA_HUMAN/1365-1615--------------------------------------SQI----FDIII-ISLI-------------------------
Q25150_HALRO/1593-1850--------------------------------------HQT----FEIAI-MILI-------------------------
SCNA_ELEEL/1321-1578--------------------------------------QPF----TDIFI-MALI-------------------------
SCN1A_HUMAN/1540-1797--------------------------------------RQV----FDISI-MILI-------------------------
SCN5A_HUMAN/1527-1783--------------------------------------KQA----FDVTI-MFLI-------------------------
SCN1_HETBL/1100-1362--------------------------------------SNQ----FEIFI-TTII-------------------------
O44930_EXADI/1367-1619--------------------------------------SSR----FETLI-MFFI-------------------------
O62604_POLPE/1225-1481--------------------------------------TKY----FEFFI-MSVI-------------------------
Q17314_CYACP/1278-1536--------------------------------------KKQ----FELFI-MSVI-------------------------
O62604_POLPE/486-725--------------------------------------SSA----FEGFI-TFCI-------------------------
Q17314_CYACP/509-745--------------------------------------STW----FEGFI-TGCI-------------------------
P97706_RAT/526-760--------------------------------------HPL----FDLFL-VICI-------------------------
SCN7A_HUMAN/504-739--------------------------------------APF----TDLFL-IICI-------------------------
SCNBA_RAT/571-809--------------------------------------DPF----TELAI-TICI-------------------------
SCNBA_HUMAN/576-822--------------------------------------DPF----TELAI-TICI-------------------------
Q25150_HALRO/798-1033--------------------------------------DPF----LDLFI-TICI-------------------------
SCNAA_CANLF/673-910--------------------------------------DPF----AELTT-TLCI-------------------------
SCNA_ELEEL/565-801--------------------------------------DPF----TDLFI-TLCI-------------------------
SCN5A_RAT/717-953--------------------------------------DPF----ADLTI-TMCI-------------------------
SCN4A_HORSE/571-807--------------------------------------DPF----VDLGI-TICI-------------------------
SCN1A_RAT/767-1003--------------------------------------DPF----VDLAI-TICI-------------------------
P90670_APLCA/753-995--------------------------------------DAF----VDLFI-TICI-------------------------
Q25377_DOROP/591-824--------------------------------------DAF----VDLFI-TLCI-------------------------
SCN1_HETBL/410-640--------------------------------------DSF----TEVFI-IFII-------------------------
O44930_EXADI/622-858--------------------------------------HGY----MDTFI-TFCT-------------------------
CAC1G_RAT/743-976--------------------------------------SKY----FGRGI-MIAI-------------------------
Q9W433_DROME/1230-1471--------------------------------------HKY----FQQGI-LLAI-------------------------
Q17354_CAEEL/9-248--------------------------------------TQI----FYWSV-ITLV-------------------------
P91744_HETBL/480-720--------------------------------------TQG----FYWFV-IILV-------------------------
CAC1A_RAT/488-727--------------------------------------TQA----FYWTV-LSLV-------------------------
M9NDV1_DROME/440-678--------------------------------------TQW----FYWFV-IVLV-------------------------
O02038_CYACP/496-738--------------------------------------SQT----FYWMV-IIAV-------------------------
O97017_STYPI/468-710--------------------------------------TQA----FYWIV-IVVV-------------------------
CAC1D_DROME/984-1226--------------------------------------SQA----FYWLI-IVLV-------------------------
O96057_HALRO/428-670--------------------------------------SKS----FYWLV-IVLV-------------------------
CAC1S_CYPCA/446-687--------------------------------------SKF----FNWWV-LLVV-------------------------
O73697_TAKRU/439-680--------------------------------------TKS----FYWLV-MFLV-------------------------
CAC1C_HUMAN/523-764--------------------------------------SNV----FYWLV-IFLV-------------------------
CAC1S_LITCT/430-671--------------------------------------SRF----FYWLV-IIII-------------------------
CAC1S_HUMAN/431-672--------------------------------------SKV----FYWLV-ILIV-------------------------
CNGC3_ARATH/80-406--------------------------------------LQS----WNKIF-LLLS-------------------------
CNGC6_ARATH/111-443--------------------------------------LLL----CNKLF-VASC-------------------------
CNGC7_ARATH/98-431--------------------------------------LLV----WNRLF-VISC-------------------------
CNG16_ARATH/52-386--------------------------------------ITR----WNHIF-LITC-------------------------
CNG14_ARATH/84-410--------------------------------------NRV----FLFWC-LVAL-------------------------
HCN4_MOUSE/262-525--------------------------------------RFY----WDLTM-LLLM-------------------------
O96385_PARTE/140-383--------------------------------------LFL----WDLLM-MLVT-------------------------
Q27170_PARTE/142-388--------------------------------------SIW----WNIYI-LTIL-------------------------
SKOR_ARATH/82-334--------------------------------------YKA----WTMFI-LIWA-------------------------
KAT3_ARATH/86-336--------------------------------------YRL----WELFL-VILV-------------------------
Q9XH40_SAMSA/77-327--------------------------------------YRC----WESLM-VVLV-------------------------
Q9SM12_MAIZE/69-319--------------------------------------YRW----WDTFM-VVLV-------------------------
AKT2_ARATH/75-324--------------------------------------YRC----WEFYM-VLLV-------------------------
O04703_SOLTU/88-338--------------------------------------YRC----WETLM-VLLV-------------------------
O24538_VICFA/55-305--------------------------------------YRC----WESFM-VVLI-------------------------
AKT5_ARATH/78-324--------------------------------------YRA----WDWFL-VILV-------------------------
O04242_MAIZE/64-310--------------------------------------YRC----WETFL-IILV-------------------------
O24382_SOLTU/63-309--------------------------------------YRL----WETFL-IVLV-------------------------
AKT1_ARATH/57-300--------------------------------------YRI----WEAFL-VVLV-------------------------
KAT2_ARATH/59-307--------------------------------------FRG----WEMWL-VILV-------------------------
Q41461_SOLTU/60-311--------------------------------------YRC----WEMFL-VVMV-------------------------
KCNH5_RAT/214-479--------------------------------------KTT----WDWVI-LILT-------------------------
O44164_CAEEL/216-496--------------------------------------KTI----WDWSI-LALT-------------------------
KCNAE_DROME/236-500--------------------------------------KAI----WDWVI-LCLT-------------------------
KCNH6_RAT/256-523--------------------------------------KAV----WDWLI-LLLV-------------------------
Q23974_DROME/267-516--------------------------------------KGI----WDWVI-LVAT-------------------------
KCNH3_RAT/224-515--------------------------------------RAT----WDGFI-LLAT-------------------------
KCNH8_RAT/221-481--------------------------------------KAG----WDWLI-LLAT-------------------------
Q9U5E2_DROME/125-365--------------------------------------YFY----WLMML-TVCV-------------------------
CNG_CAEEL/165-422--------------------------------------NST----TQVEC-TYNM-------------------------
CNGA4_RAT/34-277--------------------------------------YYW----WLNTM-VFPI-------------------------
CNGA_DROME/107-358--------------------------------------HYR----WLAIV-SLAV-------------------------
CNG_ICTPU/138-376--------------------------------------YYY----WLFFI-ALAS-------------------------
CNGA1_BOVIN/163-406--------------------------------------YYN----WLFCI-TLPV-------------------------
CNG1_CHICK/210-453--------------------------------------YYN----WLTII-AAPV-------------------------
CNGA2_BOVIN/140-383--------------------------------------YYR----WLFLI-ALPV-------------------------
CNGB1_BOVIN/770-1005--------------------------------------YIL----WLFFV-VLAW-------------------------
Q9W2D5_DROME/468-704--------------------------------------YIS----WLCVV-SLSF-------------------------
KCMA1_RAT/178-400--------------------------------------GRV----LVVLV-FALS-------------------------
SLO_DROME/126-348--------------------------------------GRI----LVVLV-FILS-------------------------
SLO1_CAEEL/138-363--------------------------------------GRF----LVLLV-FILS-------------------------
KCNQ1_HUMAN/122-359--------------------------------------CFV----YHFAV-FLIV-------------------------
Q9XWG9_CAEEL/76-313--------------------------------------CFL----YHFSV-FLIV-------------------------
KCNQ3_HUMAN/122-363--------------------------------------ALL----YHALV--FLI-------------------------
KCNQ2_HUMAN/92-324--------------------------------------AFI----YHAYV-FLLV-------------------------
KCNQ4_HUMAN/98-330--------------------------------------AFV----YHVFI-FLLV-------------------------
Q9RW39_DEIRA/33-252--------------------------------------ARA----YDKIV-IVLI-------------------------
Q16976_APLCA/213-469--------------------------------------AMI----YGVTS-FLFV-------------------------
KVS4_CAEEL/229-477--------------------------------------AQA----FAVCS-VVFV-------------------------
KCNG2_CHICK/216-464--------------------------------------GKI----FACIS-ISFV-------------------------
G1R5R7_NOMLE/226-471--------------------------------------GKV----FACLS-VLFV-------------------------
KCNAL_DROME/184-417--------------------------------------ALV----FYYVT-GFFI-------------------------
P91784_POLPE/201-427--------------------------------------ARI----LYYIT-GFFI-------------------------
KCNV1_RAT/212-442--------------------------------------ARI----FGVIS-IIFV-------------------------
KCNS3_HUMAN/184-417--------------------------------------AKL----IAISS-LSVV-------------------------
KCNS1_MOUSE/188-439--------------------------------------SKL----FSCVS-IGVV-------------------------
KCNS2_MOUSE/186-421--------------------------------------SRV----FSVLS-ILVV-------------------------
A0A0D9S9T6_CHLSB/181-417--------------------------------------ARV----VAVLS-FLLI-------------------------
KCNAB_DROME/434-670--------------------------------------ARV----IAVIS-ILFI-------------------------
Q26344_APLSP/314-551--------------------------------------ARV----VAIIS-ILFI-------------------------
KCNAG_CAEEL/203-453--------------------------------------AKL----IAGIS-VLFI-------------------------
O76457_APLCA/173-421--------------------------------------AKI----IAVIS-VFFI-------------------------
KCNAW_DROME/173-424--------------------------------------AKT----IGVVS-VFFI-------------------------
KCNSK_CAEEL/274-519--------------------------------------ARI----IAFIS-IAVI-------------------------
O76266_HIRME/209-446--------------------------------------AYA----VAFIS-VIMT-------------------------
Q26094_POLPE/173-409--------------------------------------AKI----FAILS-VVII-------------------------
Q26095_POLPE/181-410--------------------------------------AKI----VAIIS-VLVI-------------------------
KCNA6_RAT/230-470--------------------------------------EDS----YAFPG------------------------------
Q25376_DOROP/169-415--------------------------------------ARV----IAIVS-VSVI-------------------------
KCNA1_HUMAN/166-419--------------------------------------ARV----IAIVS-VMVI-------------------------
KCNAS_DROME/226-489--------------------------------------ARV----VAIIS-VFVI-------------------------

PF07885

W5K2Z9_ASTMX/448-526-----------------------------------------------------IS-------------------------
O45894_CAEEL/291-370---------------------------------------------------LMKL-------------------------
Q8IG65_CAEEL/164-235---------------------------------------------------EIFD-------------------------
YUGO_BACSU/22-99---------------------------------------------------IILC-------------------------
Q8IKI3_PLAF7/284-373---------------------------------------------------GVLL-------------------------
Q21094_CAEEL/108-184---------------------------------------------------EMVR-------------------------
Q21094_CAEEL/246-329---------------------------------------------------SMCL-------------------------
Q22042_CAEEL/196-277---------------------------------------------------EKRC-------------------------
Q22042_CAEEL/336-411---------------------------------------------------LVIV-------------------------
Q92XJ4_RHIME/49-134---------------------------------------------------AHLF-------------------------
TWK9_CAEEL/141-217---------------------------------------------------KKIK-------------------------
TWK9_CAEEL/321-397---------------------------------------------------ITFT-------------------------
UNC58_CAEEL/260-344---------------------------------------------------RVSE-------------------------
KCNK2_HUMAN/233-313---------------------------------------------------GCVL-------------------------
O28600_ARCFU/13-88---------------------------------------------------IFLS-------------------------
O29543_ARCFU/11-91---------------------------------------------------IFIF-------------------------
YDJJ_BACSU/70-156---------------------------------------------------VIWI-------------------------
O45891_CAEEL/89-166---------------------------------------------------RVLS-------------------------
O45891_CAEEL/231-305---------------------------------------------------IVLF-------------------------
O53346_MYCTU/46-130---------------------------------------------------VAVV-------------------------
O54192_STRCO/97-179---------------------------------------------------LIVL-------------------------
E9AC73_LEIMA/284-359---------------------------------------------------VVGI-------------------------
O66650_AQUAE/33-110---------------------------------------------------LMLH-------------------------
O76788_CAEEL/150-235---------------------------------------------------SLSR-------------------------
O86498_STRCO/99-182---------------------------------------------------TLVL-------------------------
P73132_SYNY3/31-106---------------------------------------------------ITLA-------------------------
TWK18_CAEEL/92-170---------------------------------------------------KVLT-------------------------
TWK18_CAEEL/232-307---------------------------------------------------LITV-------------------------
Q19525_CAEEL/88-163---------------------------------------------------ITAE-------------------------
TWK12_CAEEL/92-168---------------------------------------------------WLLD-------------------------
TWK12_CAEEL/248-324---------------------------------------------------IMLI-------------------------
Q21529_CAEEL/110-189---------------------------------------------------MLED-------------------------
Q23297_CAEEL/158-233---------------------------------------------------EAID-------------------------
Q23297_CAEEL/322-397---------------------------------------------------GITV-------------------------
Q55509_SYNY3/13-88---------------------------------------------------LFFV-------------------------
Q814N2_BACCR/16-91---------------------------------------------------ICMT-------------------------
Q81I81_BACCR/43-132---------------------------------------------------IYTT-------------------------
A0A6H3AGI5_BACAN/22-99---------------------------------------------------FIVV-------------------------
A0A6L7HBD1_BACAN/29-104---------------------------------------------------VLTF-------------------------
Q82GY7_STRAW/111-194---------------------------------------------------TVPL-------------------------
Q87FU6_VIBPA/136-225---------------------------------------------------LFLL-------------------------
Q87QT5_VIBPA/25-105---------------------------------------------------VISI-------------------------
Q886B6_PSESM/51-136---------------------------------------------------AHAI-------------------------
Q89PL5_BRADU/59-133---------------------------------------------------AHTM-------------------------
Q8A4M7_BACTN/145-224---------------------------------------------------MLLA-------------------------
Q8BUW1_MOUSE/240-321---------------------------------------------------GCIV-------------------------
Q8CV55_OCEIH/53-143---------------------------------------------------VYIT-------------------------
Q8DJ50_THEEB/18-93---------------------------------------------------TLFV-------------------------
Q8E842_SHEON/30-105---------------------------------------------------FLLV-------------------------
Q8ELF1_OCEIH/22-99---------------------------------------------------STIV-------------------------
Q8ENY9_OCEIH/22-99---------------------------------------------------IVLV-------------------------
Q8FRG9_COREF/43-123---------------------------------------------------YALL-------------------------
Q8HZT2_BOVIN/94-171---------------------------------------------------GIIE-------------------------
Q8I4G4_CAEEL/424-508---------------------------------------------------FTAF-------------------------
Q8KG47_CHLTE/19-94---------------------------------------------------ISVA-------------------------
KCO2_ORYSJ/70-152---------------------------------------------------LLLV-------------------------
Q8NSA2_CORGL/24-104---------------------------------------------------YAMV-------------------------
Q8TN45_METAC/34-111---------------------------------------------------LLII-------------------------
Q8TNR4_METAC/28-103---------------------------------------------------YITA-------------------------
Q8TQJ3_METAC/29-108---------------------------------------------------TILS-------------------------
Q8TQL3_METAC/32-111---------------------------------------------------SVLS-------------------------
Q8TXQ4_METKA/19-94---------------------------------------------------VVLS-------------------------
Q8U058_PYRFU/403-481---------------------------------------------------LWLG-------------------------
Q8WMG4_PIG/210-290---------------------------------------------------LTLG-------------------------
Q8YXX7_NOSS1/5-80---------------------------------------------------IALG-------------------------
KCNK2_RAT/120-198---------------------------------------------------QIVT-------------------------
Q92ZS8_RHIME/63-137---------------------------------------------------PIAL-------------------------
Q93732_CAEEL/112-187---------------------------------------------------AAAI-------------------------
Q93732_CAEEL/216-292---------------------------------------------------FIVL-------------------------
Q9A7V3_CAUVC/24-99---------------------------------------------------AFVL-------------------------
Q9BJ49_LEIMA/261-340---------------------------------------------------LFIC-------------------------
Q9CH27_LACLA/24-98---------------------------------------------------IAVA-------------------------
Q9HP16_HALSA/160-242---------------------------------------------------TGLI-------------------------
Q9HPA3_HALSA/494-584---------------------------------------------------TVAL-------------------------
Q9I5I7_PSEAE/12-98---------------------------------------------------LYLQ-------------------------
Q9JK62_MOUSE/63-139---------------------------------------------------VVSD-------------------------
Q9K7M1_BACHD/23-100---------------------------------------------------IIFV-------------------------
Q9KBF6_BACHD/24-100---------------------------------------------------FGIL-------------------------
Q9KEA6_BACHD/47-136---------------------------------------------------VYTT-------------------------
Q9PPR6_UREPA/224-315---------------------------------------------------ILVL-------------------------
Q9RRZ3_DEIRA/10-85---------------------------------------------------GLLL-------------------------
Q9VE68_DROME/115-197---------------------------------------------------DVLR-------------------------
Q9X0E7_THEMA/41-116---------------------------------------------------LMIV-------------------------
Q9XA52_STRCO/42-126---------------------------------------------------IALL-------------------------
Q9XX01_CAEEL/207-283---------------------------------------------------EVFI-------------------------
Q9XX01_CAEEL/347-423---------------------------------------------------LICV-------------------------
Q9XXF6_CAEEL/162-241---------------------------------------------------VLFT-------------------------
Q9XXF6_CAEEL/312-388---------------------------------------------------ILFL-------------------------
G3GXR2_CRIGR/72-153----------------------------------------------------SCI-------------------------
G3V8R8_RAT/180-259---------------------------------------------------IVAI-------------------------
M1B592_SOLTU/194-267----------------------------------------------------TLV-------------------------
M1B592_SOLTU/73-153----------------------------------------------------YLV-------------------------
M1C0Y6_SOLTU/84-157----------------------------------------------------FLI-------------------------
KCNK4_MOUSE/181-259----------------------------------------------------CLL-------------------------
KCH_ECOLI/149-221----------------------------------------------------TLL-------------------------
Q7RZF3_NEUCR/370-446----------------------------------------------------WLV-------------------------

PF01007

H2TFE7_TAKRU/11-151---------------------------------------------VSKDGHNNV--------------------------
F6SPD2_XENTR/38-178---------------------------------------------ISKSGHSNV--------------------------
F7FJC1_MONDO/46-187---------------------------------------------VKKNGQCNI--------------------------
U3II41_ANAPP/30-170---------------------------------------------VDKNGRCNV--------------------------
H2MFJ0_ORYLA/31-168---------------------------------------------IRKEGSCNI--------------------------
H2T950_TAKRU/46-187---------------------------------------------VSKSGQCNI--------------------------
H2Q537_PANTR/43-185---------------------------------------------VSKDGRCNI--------------------------
B4KG98_DROMO/102-248---------------------------------------------MQKNGHENV--------------------------
H2ZYX1_LATCH/30-171---------------------------------------------VSKSGQSNI--------------------------
W5M8R3_LEPOC/3-142---------------------------------------------VTKDGKCRV--------------------------
T1EE13_HELRO/114-252---------------------------------------------F-KNGECNV--------------------------
H3B1J1_LATCH/31-172---------------------------------------------MSKDGHSNV--------------------------
H3BAR9_LATCH/36-174---------------------------------------------VAKNGACNV--------------------------
U3JLS4_FICAL/37-181---------------------------------------------IAKNGACNL--------------------------
H3A9C1_LATCH/46-186---------------------------------------------VKKNGQCNV--------------------------
Q1L8I6_DANRE/24-166---------------------------------------------VTKDGRCNI--------------------------
W4YAR4_STRPU/79-219---------------------------------------------VGKDGVCNV--------------------------
M3XYC0_MUSPF/50-188---------------------------------------------VKKDGHCNV--------------------------
Q5TQ25_ANOGA/25-171---------------------------------------------INKKGEGNV--------------------------
U3KL94_FICAL/39-177---------------------------------------------LHKDGSCNV--------------------------
A0A0R4IAU4_DANRE/50-186---------------------------------------------VNKDGRCNV--------------------------
K1QHC7_CRAGI/79-221---------------------------------------------VYKNGEVNI--------------------------
B0W1P8_CULQU/118-264---------------------------------------------INKKGNLNV--------------------------
I3K6N4_ORENI/30-172---------------------------------------------VTKDGHCNI--------------------------
H9JWA7_BOMMO/187-325---------------------------------------------VYKNGDENVP-------------------------
W4YRL0_STRPU/65-213---------------------------------------------VSKNGECNV--------------------------
B0W1P7_CULQU/12-158---------------------------------------------IDKLGERNV--------------------------
B0XCY9_CULQU/27-172---------------------------------------------L-KNGECNI--------------------------
IRK1_CAEEL/76-216---------------------------------------------VGKNGICNV--------------------------
K1QR55_CRAGI/39-179---------------------------------------------VQKSGHYRV--------------------------
Q7PX90_ANOGA/25-165---------------------------------------------IFKQGDCNV--------------------------

PF00060

IR93A_DROME/574-841--------------------------------------------TVETWFCL-MG-------------------------
GLR31_ARATH/591-843--------------------------------------------TLPMWAVT-AS-------------------------
Q9VVU7_DROME/386-644--------------------------------------------ENDVWVSI-LM-------------------------
Q19693_CAEEL/134-404--------------------------------------------SWEVWVIT-AA-------------------------
GLR11_ARATH/540-781--------------------------------------------EKSLWLAS-GA-------------------------
GLR14_ARATH/568-810--------------------------------------------TLSLWLTI-AS-------------------------
GLR37_ARATH/578-833--------------------------------------------TSRLWCVV-LV-------------------------
GLR34_ARATH/613-869--------------------------------------------TIEMWAVT-GG-------------------------
GLR27_ARATH/582-833--------------------------------------------SLDLWVTT-AC-------------------------
GLR29_ARATH/566-820--------------------------------------------SLELWVTT-GC-------------------------
GLR28_ARATH/577-828--------------------------------------------GLDLWVTT-AC-------------------------
GLR21_ARATH/574-835--------------------------------------------TLALWLIS-LL-------------------------
GLR22_ARATH/580-842--------------------------------------------SIELWLTT-LV-------------------------
NMD3B_HUMAN/574-842--------------------------------------------HWSTWLGV-FA-------------------------
NMD3A_RAT/674-942--------------------------------------------HWTMWLGI-FV-------------------------
O76903_DROME/477-751--------------------------------------------DTASWMLVGIV-------------------------
NMDE1_RAT/554-828--------------------------------------------SASVWVMMFVM-------------------------
NMDE3_RAT/552-826--------------------------------------------SPAVWVMMFVM-------------------------
Q9W365_DROME/518-818--------------------------------------------RLEVWLSI-VA-------------------------
NMDZ1_HUMAN/559-824--------------------------------------------QSTLWLLV-GL-------------------------
NMDA1_DROME/573-843--------------------------------------------SNTLWILV-MV-------------------------
GRID1_HUMAN/562-842--------------------------------------------DFAVWACI-AA-------------------------
GRID2_RAT/566-842--------------------------------------------DLSLWACI-AG-------------------------
A0A4W1TXG3_ANAPP/168-431--------------------------------------------SKETWTGL-LF-------------------------
GLRK_LITBE/161-425--------------------------------------------SKELWIGI-II-------------------------
B7ZPS4_XENLA/162-426--------------------------------------------SKETWIGI-LV-------------------------
Q90278_CARAU/149-409--------------------------------------------SGETWFGI-LI-------------------------
Q90279_CARAU/144-405--------------------------------------------STEMWMGV-LV-------------------------
O01623_CAEEL/566-855--------------------------------------------SWQIWTAI-AT-------------------------
Q9VMP4_DROME/554-829--------------------------------------------AVEVWIYM-IF-------------------------
O45028_DROME/553-829--------------------------------------------NAEVWLFV-MI-------------------------
Q9TVI0_DROME/547-823--------------------------------------------SSEVWLYL-GI-------------------------
B4II60_DROSE/545-823--------------------------------------------SLDVWIYM-AT-------------------------
GRIK2_HUMAN/560-831--------------------------------------------SPDIWMYI-LL-------------------------
Q9V4A0_DROME/553-829--------------------------------------------AIEIWLYV-LA-------------------------
Q25412_LYMST/545-818--------------------------------------------AVEIWLYV-IG-------------------------
GLR1_CAEEL/591-867--------------------------------------------STEIWMYI-IF-------------------------
GLR2_CAEEL/619-910--------------------------------------------GMTIWIFT-LS-------------------------
GLR1_DROME/610-907--------------------------------------------SQEIWISV-IL-------------------------
Q9VSV5_DROME/630-967--------------------------------------------SQEIWVSV-IF-------------------------
G1R3B7_NOMLE/543-824--------------------------------------------AYEIWMCI-VF-------------------------
GLRK_LYMST/556-830--------------------------------------------SSEIWMCI-VF-------------------------
Q9U0T0_DOROP/568-841--------------------------------------------SYEIWMCI-LF-------------------------

PF02386

TRKG_ECOLI/38-485-----------------VSG-ITTTGATVIDDVSSL--PRAYLYYRSQLN---------FIGG--LGVIVLAVAVL-PLL
TRKH_HAEIN/35-487-----------------FSG-LTTTGATVMTGLDNL--PKSILFYRQFLQ---------WLGG--MGIIVLAVAII-PLL
Q9HPA9_HALSA/77-556-----------------MSG-WTGSGLTMAIHEPSL--PRSIQWWRSLTQ---------WVGG--VGVVVLTVSIL-ARP
O83176_TREPA/103-567-----------------TSA-VCVTGLSVIDVATQL--STWGKAILAALI---------QIGG--LGFMVFSFFGM-ITI
Y460_MYCPN/24-557-----------------VSA-FSDTGLSTTVVSETY--SVFGQTVLAILL---------QLGG--IGFVVIAFLVW-RLF
TRK1_SCHPO/316-816-----------------GLH-RPIRWTKSFTS------NRRNLTLERVLSSAFAKKREPSISS-RHTTMSLPYLSYNPTV
TRK2_YEAST/301-846-----------------HRN-LAKSAPSSFVDEEMSFSPQESLNLQFQAHPPKPKRREGDIGHPFTRTMSTNYLSWQPTF
TRK2_SCHPO/354-857-----------------ERS-MSVLPFQLAKSFTSA-LPRRLTFNRTHTK---------------ASTMSLPYLSYNATV
TRK1_YEAST/624-1180-----------------NGG-SDHNGLNNYPTYNDDEEGYYGLHFDTDYDLDPRHDLSKGSGK--------TYLSWQPTI

PF03814

E3GJV8_9FIRM/5-557M----------------EAS-LSFNTIISFMTNTNL-QHYSGESGLSYLS---------QMLVIIYMMFVSAASGYGVCV
R4KGK3_CLOPA/7-555M----------------EQG-LTFNTVIAFMTNTDI-QDYSGEWGLSYFS---------QMIVITFFMFFAAATGLAITL
X4ZCZ5_9BACL/10-554M----------------EPT-LAFNTAISFMTNTNL-QHYSGESGLSYLS---------QMIGIIFMMFTAPASALAGAI
I2BB55_SHIBC/11-556L----------------SWD-LALNTAISFVTNTNW-QAYAGESTLSYFS---------QMAGLTVQNFLSAATGIAVAY
D2B153_STRRD/14-551V----------------TDH-VAWNTAISFVTNTNW-QAYSGESTMGHLV---------QMAGLAVQNFVSASVGMAVAV
A7I6Q1_METB6/235-800V----------------PWD-LSLNTAVSFATNTNW-QAYVPEVTLSYFT---------QMVGLVVQNFVSAAVGLAVLI
Q6F8C8_ACIAD/9-565I----------------KWD-LALHTTISFLTNTNQ-QHYSGQAQLSYLS---------QMTVIVGMQFLSPIIGLALLT
KDPA_BACCR/7-552M----------------EPT-LAFNTAISFMADTNL-QHYSGENGLSYLS---------QLIGITFLMFAAPATTLALVM
KDPA_PARD8/9-566Q----------------SPD-LAFNTCISFMVNCNL-QHYSGESGLTYFT---------QLFVIMLFQFITAATGMAAMA
T0LA52_9EURY/11-544M----------------SWS-LALNTVLSFSSNTNL-QHYNGELTLSYLS---------QMSAIQFLQFTSAATGLAVGV
Q4JUS0_CORJK/12-549V----------------HWD-QAWNTAVSFTTNTNW-QSYSGETAMTILT---------QMAGLAVQNFVSAAVGITVAI
I4D2C5_DESAJ/10-560V----------------SPD-LAFNTAASFVTNTNW-QAYSGESTMSYMV---------QMAGFTVQNFVSAATGIVVVI
D3F9I8_CONWI/10-571-----------------APADVNFNTASSFVANTNW-QYYAGETTLSNFS---------QMGGLAVQNFLSAAVGIAVVI
B8GER2_METPE/14-556F----------------SPD-LALNTAISFVTNTNW-QAYSGEVAASYLS---------QMVGFAVQNFLSAATGLAVTV
E3JBQ1_FRAIE/12-552V----------------KPA-LAWNTSVSFVTNTNW-QAYSGESTMGHTV---------QMAGLAVQNFASAAVGIAVAI
R4TDT9_9PSEU/13-552V----------------SPA-VAFNTAVSFVTNTNW-QSYSPEATMGHFV---------QMAGLTVQNFLSAAVGLAVAI
A0A6N4SSD6_CYTH3/25-575M----------------SGD-LAFNTAVSFVTNTNL-QHYSGESGLSYLG---------QL-ILMLWQFISAGTGIAICA
G8X3F4_STREN/12-552V----------------TPQ-QAFNTAASFVANTNW-QSYSGESTMGHVV---------QTGGLAVQNFVSAAVGIAVAI
KDPA_DESVH/10-561L----------------SWH-LAFNTAVSFLTNTNW-QSYAGESTVSHFS---------QMVGLAYHNFVSAAAGLAVAV
F9ZTB8_ACICS/11-575P----------------GVQ-ISFNTAASFVSNTNW-QDYGGETTMSYLS---------QMLGMAVQNFLSAASGIVLAI
A4FMI7_SACEN/14-552V----------------EPA-TAFNTAVSFVTNTNW-QSYVPETTLGHTV---------QMAGLTVQNFLSAAVGMAVAV
KDPA_MAGSA/10-548V----------------PPD-LAFNTAISFATNTNW-QNYGGESTMSHLT---------QMAGLTVHNFLSAAAGIAVAV
L0DLW9_SINAD/14-575LGALGYKDTAGVDHPGADTA-VVFNTVCSFVTNTNL-QHYAGEQNLSYFS---------QLACIVWLMFVTPAAGLAVML
KDPA_METPP/10-570V----------------GAD-SSLNTAVSFVSNTNW-QGYAGETTMSYLT---------QMLALGVQNFLSAATGIAVAF
H8KMI0_SOLCM/10-568Q----------------TPD-LAFNTIISFMVNCDL-QHYSGESGVTYLT---------QLFVMNFLMFVSAATGIAALV
F0S640_PSESL/9-559Q----------------SAD-LAFNTTISFLVNCNL-QHYSGETGISYLG---------QI-WLMFLQFVTAGVGMAAAV
A0LLJ6_SYNFM/11-602L----------------APS-TIFHSVASFMTNTDL-QHYAGERHLSNFS---------QIFFGMINLFLSAAIGLCALT
KDPA_PECAS/12-556L----------------SWH-LALNTAVSFVTNTNW-QAYSGENTLSYLS---------QMVGLTVQNFLSAASGIAVAF
KDPA_THEAC/28-571-----------------SPS-LDFNTVVSFLTNTNL-QHYSNPMRLSYFS---------QTFVITGLMFLSAGTGFAASM
R6BHA4_9CLOT/5-583M----------------EES-LSFNTIISFMTNTNL-QHYSGESGLSYLS---------QMLVITFMMFVSAASGYAACV
KDPA_DEIRA/9-559Q----------------SPD-LAWNTVVSFMTNTNW-QAYSGEQSLSYFS---------QMAVITTFMFTSAATGFAAAL
K9Q855_9NOSO/9-574P----------------TWD-TALHTTISFITNTNQ-QHYSGETYLSYAS---------QMWGLGYHMFTSAATGLAVGI
K9V7P3_9CYAN/9-555P----------------RWD-LALHTTISFLTNTDQ-QHYAGETTLSYFS---------QTSAIAFLMFTSAATGLAVGI
F8L2P0_PARAV/10-555V----------------SWH-LAYNTAISFVTNTNW-QSYAGETTLSYLT---------QMVGLTVQNFLSAATGMATLL
KDPA_LISMO/10-557L----------------SFS-LAFNTAASFVSNTNW-QAYSGETALSYFS---------QSIGLTVQNFVSAATGIAVLF
Q6L2R0_PICTO/23-567L----------------S---LTFNTVVSFLTNTDL-EHFSNPLKLSIFS---------WTFSIMGLMFLSAATGFAASM
D1Z017_METPS/13-542M----------------SPD-LAFHTATSFVTNTDQ-QHYSGD-TLSPAA---------QMLALTMLMFASAATGISSAF
E3GWW4_METFV/10-558V----------------RWD-TALNTAISFMTNTNW-QAYAGENTMSYLT---------QMIGLTVHNFLSAAAGMAPLL
I3THP9_TISMK/10-558L----------------DPA-VAFNIAISFVTNTNW-QAYSGEAQLSSFS---------QAFGLGVQNFLSAATGIAVMV
C6VYG5_DYAFD/9-559Q----------------SAD-LAFNTAISFVVNCNL-QHYSGETGMSYLG---------QL-FLMFLQFVTAGTGMAAAA
KDPA_PSESM/10-560M----------------EWS-LAFNTAMSFVTNTNW-QAYSGEASLSYLS---------QMVGLTVQNFVSAATGLAVLV
U5QJ68_9CYAN/10-567M----------------SPD-TALHTAISFLTNTDQ-QHYSGETGTSHFA---------QMAGLQFLMFTSAATGLAVGV
D9R2J7_CLOSW/10-558T----------------SWH-LAFNTAASFTTNTNW-QAYSGESDLSYFT---------QFTGLAVQNFVSAATGIAVLF
G7M3P7_9CLOT/7-555M----------------EQS-LSFNTIISFMTNTNL-QDYSGESGLSNLS---------QMIVIIFMMFTSAATGFAAAL
F4KRB0_HALH1/9-568M----------------TPD-LTFNTVISFVVNCNL-QHYSGESGLSYLS---------QVGVIMYFQFVSAATGMAALA
J7QUT1_METSZ/10-561V----------------PAD-LAFNTSISFVTNTNW-QNYGGESTMSHLT---------QMLGLTVHNFVSAATGLAMAF
T0N7P9_9EURY/29-575-----------------SPS-LTFNTIISFLTNTNL-QHYSSPTTLTYLD---------LTVVIIGLMFLSAGTGFAASM
I4ETN2_9ACTN/13-566V----------------EQG-SSWNTAVSFVTNTNW-QGYAGESTMGHLV---------QMAGLAVQNFLSAAVGLAVAV
KDPA_LEPIN/9-549L----------------VWD-LAFNTAVSFATNTNW-QAYSGESTLSFFS---------QMAGLTTQNFLSATTGLCVLL
C7Q1T1_CATAD/12-560M----------------NAD-LAYNTAASFVTNTNW-QNYGGENTLGYVA---------QVTGLAVQNFVSASVGIAVVA
F5XJD1_MICPN/12-552M----------------SLP-MAINTAVSFVTNTNW-QSYAGESTLGYTA---------QAAGLTVQNFVSAAVGIAVAA
A7HRV4_PARL1/16-556I----------------EGS-LIFNTAASFTSNTNL-QHYSGEVSLSYLS---------QLGALMWLQFVSAATGIAALA
KDPA_STAA8/4-555Q----------------SID-LAFNTAISFLTNSNL-QHYNGESDVTYLT---------QMIVMTYLMFTSSASGYAVCI
R5UVN1_9BACT/10-563Q----------------TPD-LAFNTCISFMVNCNL-QHYSGESGLTYFT---------QLFVIMLFQFITAATGMAALA
C7LZF2_ACIFD/8-557V----------------PPA-LAFNTAVSFVTNTNW-QNYAGETTMSYFS---------QMAALAVQNFVSAAVGIAVAI
I3TDE3_THEC1/12-531L----------------SWD-LAFNTAVSFATNTNL-QHYIGETTLTNMA---------QSVVIGSTMFLAPATGIAVSL
J7U1A2_MORMO/10-556M----------------SWD-LALNTAVSFVTNTNW-QSYSGESAVSYFS---------QMAGLTVQNFLSAATGIAVAF
KDPA_METNO/10-559V----------------APD-LAFNTSASFITNTNW-QNYGGESTLSYLS---------QMLGLTHQNFLSAATGIAVAV
K7WVS0_9NOST/9-560P----------------TWD-TALHTTFSFLTNTDQ-QHYSGETTLSYAS---------QTFALSFLMFVSSATGLSVGI
KDPA_CAUVC/10-560L----------------SGH-LAFNTAISFITNTNW-QSYAGETTMSTLS---------QMLVLTVQNFVSAATGATVAA
S5Z0Q6_PARAH/9-553M----------------EAS-QAFNTAVSFMTNTNW-QSYSGETALSNFS---------QMFGLTVQNFVSAASGIAVAV
KDPA_SOLUE/10-559V----------------AAD-LGWNTAASFTTNTNW-QAYTPETTMSYIT---------QMIALATHNFFSAAAGIAVAI
E0UCQ4_GLOV7/9-555P----------------SWD-LALHTTISFITNTDQ-QHYSGETTLSYAS---------QMWAIGYLMFTSAATGLAVGI
D7BJD8_MEISD/5-565M----------------SWH-LALHTVASFITNTNQ-QHYSGQAQLSYLA---------QMLAITALQLITPAAGLATLV
T0LT74_9EURY/28-573-----------------SFS-LAINTISSFLTNTNL-QNYSSPQRLSYYE---------LTIVIIGLMFLSAGTGFAASM
B1WPS5_CROS5/10-555P----------------TWD-LALHTAISFITNTNQ-QHYSGETTYSYAS---------QMLALGFLMFTSAGTGLAVAI
D7A9S5_STAND/10-561V----------------SPD-LAFNTATSFVSNTNW-QSYGGETTMSLFS---------QMAGLTVQNFLSAATGLALAV
KDPA_RHOCS/10-561V----------------GPD-LAFNTAVSFTTNTNW-QSYGGETTLSYLS---------QMLGLTVQNFVSAATGIAVAV
V6F0K6_MAGGM/10-558I----------------APD-LAFNTAISFVTNTNW-QAYGGETAMSYLV---------QMAGFTVQNFVSAATGIAVAV
KDPA_GLOVI/10-566M----------------SWD-LALHTAISFLTNTNQ-QHYSGETGASHLA---------QMVCFQFLMFTSAATGLAVGI
A0JW40_ARTS2/13-553V----------------DPW-VAMNTAISFVTNTNW-QTYVPETTVGMFV---------QMCLLAVQNFLSAAVGIVVAV
KDPA_AGRVS/10-560M----------------TPD-LAFNTAISFVTNTNW-QAYSGEQSASHFS---------QMAGLAVQNFLSAATGIAIAL
K9PBZ4_CYAGP/8-552L----------------RWD-LALHTSLSFLTNTDQ-QHVVPEQTLGTFA---------QLGVIQFLMFVSAASGLAVGF
D2UFZ8_XANAP/7-575M----------------RWD-VALHTMVSFLTNTDQ-QHYSGQAQLSYLS---------QAMGVVGLQFVTPMMGLALVA
E8U851_DEIML/5-570M----------------PWF-VALNTAASFITNTNW-QNYSGQAQLGYLA---------QMLGVTALQFITPAAGIAVLF
J9Z8M5_LEPFM/10-559L----------------TPE-VVFNTAASFVTNTNW-QAYAGEAQLSNFS---------QMVAITFLMFVGANTGLASLV
KDPA_STRCO/12-552I----------------DPD-QAFNTAASFVANTNW-QSYYGEQAMGHVV---------QTAGLAVQNFVSAAVGIAVAV
I0K505_9BACT/9-568M----------------TPD-LAFNTAISFLVNCNL-QHYSGESGLTYLT---------QLGVITFLQFVSAATGIAALV
C8XB13_NAKMY/15-551V----------------APD-QAWNTAVNFVTNTNW-QSYSGETTMGYLV---------QAAGLAVQNFVSAAVGIAVAA
E4T7V0_PALPW/11-556V----------------SWH-SAFNTAVSFMTNTNW-QGYGGETTLSYLV---------QMLALTVQNFVSAATGIAVLL
KDPA_CLOAB/7-555M----------------EQG-LTFNTIISFLTNTNL-QDYAGETGASYLS---------QMIVITFFMFFAAATGIAVAL
KDPA_LARHH/11-562M----------------SAD-SALNTAVSFVTNTNW-QGYSGETTMSLLT---------QMLGLAVQNFLSAATGIAVVV
KDPA_ACIC5/10-582V----------------PAQ-LAWNTAISFTTNTNW-QAYTPESTMSYLT---------QMVGLATHNFWSAAVGIALAI
E3I291_RHOVT/10-561M----------------PPD-LALNTAASFVTNTNW-QNYGGESTLGYFA---------QMAGLTVQNFVSAATGIALAV
E4NDZ7_KITSK/13-552M----------------AAH-QAWNTAISFTTNTNW-QSYSGESAMGHLV---------QMAGLAVQNFVSAAVGIAVVA
F8AWS9_9ACTN/16-552M----------------APG-QAFNTAASFVTNTNW-QSYAGESTLGYLA---------QMAGLAVQNFASAAVGISVAI
V5XHA6_MYCNE/12-554M----------------TPA-LAWNTAVSFVTNTNW-QAYSGETTQGHLV---------QMAGLTVQNFVSAAVGMAVAI
W0PFX0_9BURK/11-559Q----------------TPD-LAFNTAASFITNTNW-QAYSGESSLSNFS---------QMAVITFLMAVSAATGVAAAG
G8TYY4_SULAD/10-560P----------------SWD-LAWNTVVSFVTNTNW-QNYAGESALSYWS---------QMTVITYLQFASAATGIAVAL
KDPA_YERPE/10-556M----------------SWH-LALNTAVSFVTNTNW-QAYSGENTLSYLS---------QMAGLTVQNFLSAATGIAVAF
E6STC1_BACT6/10-566Q----------------TPG-QAFNTCISFLVNCNL-QHYSGENGVTYFT---------QLFVVMLFQFLSASAGMAAMA
A9HGI8_GLUDA/24-574I----------------TPD-LAYNTAISFMTNTNW-QSYAGETTMSYLS---------QMLALTVQNFTSAAAGIAIAF
KDPA_KINRD/13-552M----------------EPT-QAWNTAVSFVGNTNW-QSYAGESTLGHLV---------QMAGLTVQNFLSAAVGLAVAV
KDPA_KORVE/10-583V----------------DPAHLAFNTAASFTTNTNW-QAYSGEAVMSYFT---------QMAGLAYHNFMSAAVGIAIAI
G7ZDN7_AZOL4/10-561V----------------PAD-LAFNTAASFTTNTNW-QNYGGETTMGHLV---------QMAGLTFHNYVSAAVGIALAV
KDPA_SORC5/10-576V----------------PPD-LAFNTAASFASNTNW-QAYGGESTLSYLT---------QMAGLGVQNFVSAATGMAVLV
B7J712_ACIF2/10-575V----------------PSA-SAFNTAVSFITNTNW-QDYSGGSTMSYLS---------QMLGLTVQNFLSAATGITIVL
H1YB12_9SPHI/10-568Q----------------TPD-LAFNTAISFLVNCNL-QDYSGESGATYFT---------QHFVFMFLHFASAATGIAALV
C7PUT0_CHIPD/9-567M----------------TPD-LAFNTAISFLVNCNL-QHYSGETGVTYLS---------QLIVITFLQFVSAATGVAAVA
KDPA_DESDA/9-579A----------------SWH-LALNTAISFVTNTNW-QSYAGESTMSYLS---------QMAGLTVQNFVSAAVGIAVLF
K9RWG4_SYNP3/9-555P----------------TWD-LALHTAVSFITNTNQ-QHYSGETTYSYLT---------QAGGLGYLMFTSAATGIAVAI
KDPA_STAEQ/4-554Q----------------SVS-LAFNTMASFLTNTNL-QHYAGETDLSYLT---------QMCVITFLMFTSAASGYAVCI
KDPA_CLAMS/12-556V----------------PEG-ISFNTAVSFVTNTNW-QSYSPEATMGYTV---------QLAGLAVQNFVSAAVGIAVAI
KDPA_SYNY3/9-555P----------------SWD-LALHTAISFVTNTNQ-QHYSGETTYTYFS---------QAGALGFLMFTSAATGIAVAI
KDPA_KLEP7/11-556L----------------SWD-LALNTAISFISNTNW-QAYAGESTMSYLS---------QMVGLTVQNFLSAATGIAVVF
K9Z7H8_CYAAP/9-557P----------------TWH-LGLHTAISFLTNTNQ-QHYSGETTFSYAS---------QVLALGFLMFTSAGTGLAVAI
D1CGX3_THET1/8-561V----------------APD-LAFNTAASFVTNTNW-QAYAGETTMSYLT---------QMAGLTVQNFLSAAVGLAAAV
E2Q1F7_STRCL/12-553V----------------PPD-LSFNTAVSFVTNTDW-QAYAGERTLGHLV---------QMAGLTVQNFLSAAVGIAVAA
W8EUK3_9BACT/12-563M----------------SPD-LAFNTAISFLVNCNL-QHYSGESGLSYLS---------QIVVITFLQFVSAATGIAAAV
K9TR50_9CYAN/9-555P----------------SWD-LALHTAISFTTNTNQ-QHYSGETTFTYAS---------QMFALGFLMFTSAGTGLAVAI
W0EX99_9BACT/9-563M----------------SAD-LAFNTAISFICNTNL-QHYSGETGISYFG---------QL-TLMLFQFVSAGCGMAIAA
C6D691_PAESJ/7-556M----------------EET-LSFNTVISFITNTNL-QHYSGETGLSYFS---------QMAVIMMMMFTSAATGFSVAI
B3EAQ3_GEOLS/13-570F----------------SWQ-LALNTAVSFITNTNW-QNYAGEQAVSYLT---------QMVGLTVHNFVSAATGMAIVI
K9VVM6_9CYAN/9-559P----------------TWD-TALHTTLSFLTNTDQ-QHYSSETTLSYAS---------QILALGFLMFTSAATGLAVGI
K9X7N8_9CHRO/9-556P----------------SWD-LALHTTISFITNTNQ-QHYSGETTYSYAS---------QMLALAFLMFTSAATGLAVGI
I3Y5A2_THIV6/11-568V----------------SPD-SAFNTAISFATNTNW-QGYAGESTMGHLT---------QMLGLAVQNFLSAATGIAVAV
W5WRB9_9PSEU/12-552I----------------SPS-VAFNTAVSFVTNTNW-QSYVPEQAFGHLV---------QMAGLTVQNFVSGAVGIAVAV
F4C4K6_SPHS2/10-559M----------------SAH-LAFNTVISFVVNCNL-QHYSGESGLSYLG---------QL-WLMFLQFVSAGTGMAAAA
D9QG06_BRESC/10-560V----------------SPH-LAFNTAISFVTNTNW-QSYGGETTLSTFT---------QMVGLTVQNFLSAATGAAIAA
A8HY16_AZOC5/10-561L----------------SPD-LAFNTAVSFVTNTNW-QAYAGETTMSNFS---------QMVGLTVQNFLSAATGLALAI
Q186E7_CLOD6/11-560M----------------EQG-LSFNTIISFMTNTNL-QHYSGESGLSYFS---------QMTVIIYMMFTSAATGYAAAM
KDPA_TOLAT/12-560V----------------SPL-LAMNTAISFITNTNW-QAYAGETTLSPLS---------QMLGLTVHNFLSAANGIAVAF
U5LJM5_9BACI/9-555M----------------DPT-LAFNTAISFMTNTNL-QHYSGESGLSYLG---------QMIGILFMMFAAPGTALAAAI
KDPA_BEII9/10-560L----------------PPH-LAFNTAISFVSNTNW-QSYVPEATVSAFS---------QMAGLTSHNFLSAAAGIAVAA
KDPA_ANADE/10-573V----------------SPL-VAWNTAVSFATNTNW-QAYGGESTMSHLT---------QMGALTVQNFLSAATGISVLA
E8X5C7_GRATM/10-587V----------------SPD-LALNTAVSFTTNTNW-QSYVPEATMSYLT---------QMLTLAYHNFFSAAAGMALAI
C5C4A0_BEUC1/16-557L----------------DPA-GAWNTAVSFVTNTNW-QWYSGEAAAGHLY---------QMAGLAVQNFVSAAVGMAVAI
K8GCZ3_9CYAN/9-558P----------------SWD-LALHTAISFVTNTNQ-QHYSGETTYSYFS---------QFAALGFMMFTSAATGIAVAI
D0IYN9_COMT2/9-559Q----------------APD-LAFNTAASFITNTNW-QAYSGENSLSNAT---------QMVVITFLMFAGATTGVAAGA
E0SEX9_DICD3/10-555L----------------SWH-LALNTAISFVTNTNW-QAYSGENTLSYFS---------QMVGLTVQNFLSAATGIAVAF
R6RMK4_9FIRM/8-574I----------------SWD-LAFNNAVSFVTNTNW-QAYSGESALSYFT---------QAMGLTVQNFLSAAVGIAVLF
F4F4Y7_VERMA/14-551V----------------VAH-GAWNTAVSFVTNTNW-QWYSGESTMGHLV---------QMAGLAVQNFVSAAVGIAVAV
A8KYG3_FRASN/13-567V----------------SPA-LAWNTAVSFTTNTDW-QAYSGESTMSHFT---------QMAGLAVQNFASAAVGIAVAI
E1VQU5_9GAMM/5-576M----------------SWD-LALHTMVSFLTNTNQ-QHYSGQAQLSYLS---------QMTGIVGLQVVTPIVALAVAC
C6XZL6_PEDHD/9-568M----------------TAD-LSFNTIISFVVNCNL-QHYSGESGVSYLT---------QHYVLMFLQFVSCATGIAAAV
B7J714_ACIF2/9-575T----------------SIG-TAFNSAIAAITTTNW-QDYGGETTLSYLS---------QMLPYTDLNFIGGASGIAIVL
E8RRM4_ASTEC/14-564L----------------TPD-LAFNTAVSFVTNTNW-QSYAGETTLSYFS---------QMVGLTVQNFVSAAVGIAVLA
K0CGH7_ALCDB/5-555M----------------SWD-LALHTVISFLTNTNQ-QHYSGQAQLSYFA---------HTLGIVTLQVVTPAAGLATLV
K8E2F1_CARML/9-558T----------------SIG-LAFNTAMSFVTNTNW-QAYSGEVTLSPFT---------QMVALTVQNFVSAGVGIAVLF
D3EAK4_GEOS4/7-556M----------------EPT-LSFNTIISFMTNTNL-QHYSGESGLSYLA---------QMAVITMMMFTSAATGLCVAI
D5WU10_KYRT2/12-563V----------------RWD-TALNTAASFITNTNW-QSYSGESTMSYFT---------QMAGLTVQNFLSGATGVAVLI
G8TDF8_NIAKG/9-568Q----------------TPD-LAFNTAISFLVNCNL-QHYSGETGLTYFT---------QLAVITFLQFVSAATGIAALL
KDPA_HYDS0/11-568M----------------SWD-LAFNTAVSFVTNTNW-QAYAGETQATYFS---------QITGLALQNFLSAASGIVVAL
D7DKK2_METV0/11-584V----------------SVD-SSLNTAISFVTNTNW-QGYSGESTMSYLT---------QMLALTVQNFLSAATGIAVVI
R6PVD9_9CLOT/5-571M----------------DAS-LSFNTIISFMTNTNL-QHYAGESGLSYAS---------QMCVIIFMMFTSAASGYAACM
F2IFU1_FLUTR/9-571M----------------SPD-LAFNTTISFLVNCNL-QHYSGETGLSYLS---------QIGGIMFLQFVTAGTGMAACA
F7QKE7_9BRAD/10-559A----------------APD-LTFNTAISFLTNTNW-QNYGGESTMSYLV---------QMLGLTPQNFLSAATGIVLAL
KDPA_MICAN/9-574P----------------SWD-TTLHTTISFITNSDQ-QHYSGETTLSYGS---------QIWGLGYQMFTSAGTGLAVGI
S0EVD3_CHTCT/10-589M----------------TPD-LAFNTAVSFTTNTNW-QSYTPESTVSYFS---------NMVALAMHNWMSAAAGIAVAV
KDPA_RHIME/11-561V----------------PPD-LAFNTAVSFVTNTNW-QNYGGETTLSHFS---------QMMGLTVQNFVSAATGISIAL
D5AKZ2_RHOCB/10-560L----------------PAD-LAFNTAVSFLTNTNW-QAYAGETTMSPFS---------QMAGLAVQNFLSAATGIALAM
C9R8E6_AMMDK/12-560-----------------VPGVLAFNTIVSFVTNTNW-QAYSGETTMSYFS---------QMFVLAVQNFLSAATGLAGAV
C6W8P0_ACTMD/12-539V----------------SPG-MAFNTAASFVANTNW-QSYVPETVLGHTV---------QMAGLTVQNFVSGAVGMAVAV
Q09AH8_STIAD/10-563V----------------GPA-LAFNTAASFTANTNW-QSYAGESTMSHFS---------QMVGLTWQNFVSAAAGLGVAL
C4KYL4_EXISA/11-542L----------------DWH-LAFHTVISFMTNTDQ-QHYSGE-ALSHLS---------QMFVLSTLMFVAPTMAFTMAL
KDPA_PSEAE/10-560L----------------EWT-LAFNTAVSFVTNTNW-QAYSGEASLSYFS---------QMVGLTVQNFVSAAVGLCVLV
A0KED5_AERHH/10-553L----------------NWQ-LAFNTAVSFMTNTNW-QAYSGEASLSYFS---------QMVGLTTQNFVSAATGAAVAI
E9T4H3_RHOHA/12-565V----------------SPA-VAFNTAASFVANTNW-QSYVPETTMSHLT---------QAAGLAVQNFVSAAVGMAVAA
Q31MM1_SYNE7/10-552L----------------RWD-LALHTIISFVTNTDQ-QHYSGELSLSNAS---------QIGVIGFLMFTSAATGLAVGI
KDPA_NOSS1/9-555P----------------SWD-IVLHTVISFVTNTDQ-QHYAGETTLSYFS---------QVAALGFLMFTSAATGLAVGI
K9UDW3_CHAP6/9-563P----------------TWD-TALHTTISFITNTNQ-QHYSGETTISYLT---------QTVGLGFMFFTSAATGIAVAI
KDPA_HALSA/11-578E----------------SWD-LAFHTASSFTSNTNQ-QHYSGE-TLSVFT---------HTFGIGIAMFLTPATGLALMP
W0A4I8_9SPHN/10-559L----------------SEH-LAFNTAVSFTTNTNW-QSYGGESTMSNLS---------QMLGLTIHNFLSAATGIALAF
KDPA_RHORT/10-561V----------------APD-LAFNTAVSFVTNTNW-QAYGGESTLSYFS---------QMVGLTVQNFVSAATGIAVLV
R6NNJ3_9FIRM/5-564M----------------EPT-LSFNTIISFMTNTNL-QHYSGESGLSYLS---------QMLVIIFMMFVSAASGYAACM
D3RSD8_ALLVD/5-565M----------------SWD-LALHTTASFITNTNQ-QHYSGQAQLSYFA---------HLVAIVSMQVITPAAGIAALV
I0H1S8_ACTM4/10-547V----------------TDH-IAWNTAVSFVTNTNW-QAYSGESTMGHLA---------QMAGLAVQNFVSAAVGIAVAV
KDPA_GEOKA/9-557M----------------EPT-LTFNTVVSFMTNTNL-QHYSGESGLSILS---------QMLFVTMMMFTSAATGLTVAT
KDPA_CALS4/9-558M----------------ESS-LAFNTVISFMTNTNL-QHYAGEDGITFLS---------QMIVIVFLMFTSAASGLVTAA
D2Q289_KRIFD/12-553V----------------GSG-SAFNTAASFVSNTNW-QSYSPEATMGHLI---------QFAGLAVQNFLSAAVGIAVAI
K9RK69_9CYAN/10-555P----------------RWD-LTLHTTISFLTNTGQ-QHYLGEKTLSHFS---------TMAGLTFLMFVSAGTGLAIGI
KDPA_ALIAD/10-559M----------------PPY-LAFNTAASFITNTNW-QNYAGEQSLSYLS---------QMIGITFLQFTSAATGLAAAM
B6JA58_OLICO/10-557V----------------SAD-SSFNTAVSFMTNTNW-QGYGGETTMSYLT---------QMAGITVQNFVSAAVGVAGAM
D3PV93_STANL/12-552V----------------EPA-TAFNTAVSFVTNTNW-QSYSGESTMGHLV---------QMAGLAVQNFVSAAVGIAVAI
H1ZCI8_MYROD/9-559M----------------SPD-LAFNTAISFLVNCNL-QHYAGETGATYLA---------QL-ALMFLQFVSAATGMAAAV
H9ZZC9_FERFK/11-532L----------------PWD-LALNTAVSFVTNTNL-QHYAGEISLTNMA---------QCVVIGTTMFIAPATGIAVSL
KDPA_FLAPJ/10-570M----------------PPD-LAFNTAISFLVNCNL-QHYSGESGVSYLS---------QL-FLMFLQFVSAGVGMAAAA
A5FU08_ACICJ/10-556M----------------SPK-LAFNTAVSFTTNTNW-QAYAPESQISYGA---------QMFGLVVHMFISAAAGLAAAG
K9Y0M2_STAC7/9-555P----------------SWD-LALHTAISFVTNTNQ-QHYSGETTYSYAS---------QMFALGFMMFTSAATGIAVAI
C0ZIZ1_BREBN/7-554M----------------EPL-LSFNTAVSFLTNTNL-QHYSGESGLSYLS---------QMLVIIYLMFTTPATGIAVVM
D6ZE64_SEGRD/12-555V----------------SPA-VAFNTAVSFVTNTNW-QSYTPETTMGVWT---------QPLGLAVQNFLSAAVGMAVAI
H7C701_ENTFA/10-555L----------------TLP-LAINTAVSYVTNTNW-QAYVGETTLSNTS---------QMFGLTAQNFVSAGVGLSVLV
F4CT92_PSEUX/12-552V----------------PPA-TAFNTAVSFVTNTNW-QSYVPEQTLGDTV---------QMAGLTVQNVLSAAVGLAVAV
E8V6X7_TERSS/10-579V----------------EPA-LALNTAISFTTNTNW-QSYVPESTMSYLT---------QMVGLATHNFWSAAVGLALAV
KDPA_PHOLL/10-561L----------------KWD-LALNTAISFITNTDW-QAYSGENTLSYFS---------QMTGLTVQNFLSAATGIAVAF
KDPA_MYCTU/10-568V----------------TDH-VAFNAAVSFMTNTNW-QSYSGEATMSHFT---------QMTGLAVQNFVSASAGMCVLA
J7J1Q1_DESMD/10-560L----------------KWD-LAWNTAVSFTTNTNW-QAYGGESTMSYLS---------QMAGLTVHNFVSAAAGIAVVV
D5UVP7_TSUPD/12-549W----------------RFD-EALNTAISFVTNTNW-QWYGGESMANLVA---------QAVGLAVQNFVSAAVGIAVAV
U5RTG7_9CLOT/7-555M----------------EQG-LTFNTVISFLTNTNL-QGYSGESGLSYFS---------QMIVITFFMFLAASTGLSIAL
D1BAQ9_SANKS/14-555F----------------DPA-GAWNTAVSFVANTNW-QWYSGEAAAGHVF---------QMVGLAVQNFVSAAVGISVAI
L0ABX1_CALLD/9-533I----------------NFD-LAFNTAVSFVTNTNL-QHYIGETSLSLTS---------QMLVIITTMFIGPSTGLATSF
KDPA_GRABC/10-560V----------------APD-LAYNTAVSFVTNTNW-QSYGGETTMSYLS---------QMLGLTVQNFVSAAAGIAVAA
C9A6Y5_ENTCA/10-555M----------------SFD-LALNTAVSFVTNTNW-QAYAGEEALTNLS---------QALGLTVQNFLSAAVGLAVLC
W0I187_9GAMM/10-555L----------------SWH-LALNTAISFVTNTNW-QSYAGETTISYFS---------TLAGLAVQNFLSAATGIAVLF
B8ESF4_METSB/10-566M----------------APD-LAFNTAVSFVTNTSW-QAYGGETTLSYFN---------QMGGVAVQSFLSAATGMAVAI
KDPA_METB6/11-574V----------------PWD-LSLNTAVSFATNTNW-QFYVPETTVSYLT---------QMIGLTVQNFMSAAVGMVVLV
D5SYH3_PLAL2/10-576V----------------SPD-SSFNTAVSFTTNTNW-QGYGGETTMSYLT---------QMLALTVQNFVSAAAGMAVLV
D7B3X9_NOCDD/11-556V----------------PEG-LAFNTAASFVTNTNW-QSYSPELTLGYTV---------QFAGLAVQNFVSASTGIAVAV
E3EDK0_PAEPS/7-556M----------------EAS-LAFNTVISFMTNTNL-QHYSGESGLTYLT---------QMAFVTMMMFTSAASGFSVAA
B8GSR6_THISH/5-564M----------------SWD-LALHTMVSFLTNTNQ-QHYSGQAQLSYLA---------HMTGIVTLQVITPMMGLALVV
A5N882_CLOK5/5-568M----------------EPT-LSFNTIISFMTNTNL-QHYSGESGLSYLS---------QMMVITFMMFTSAATGFSAAM
H6NGX7_9BACL/8-552M----------------EPT-LAFNTAISFMTNTNL-QHYSGESGLSYLS---------QMIAIVFMMFTAPATGLAAAI
KDPA_ECOLI/10-556L----------------SWD-LALNTAVSFVTNTNW-QSYSGETTLSYFS---------QMAGLTVQNFLSAASGIAVIF
R5W702_9BACT/12-563Q----------------TPD-QAFNTCISFMVNCNL-QHYSGETGLSYFT---------QLFVIMLFQFITAACGMAALA
KDPA_HERA2/10-575V----------------SAD-SAFNTAASFVSNTNW-QGYAGETTMSYLT---------QMLGLTVQNFVSAATGMAVLI

PF08016

PKD1_MOUSE/3701-4103-----------------PAV-GLHAAVTLRL-----EFPVAG--------------------------------------
PKD2_MOUSE/265-685-----------------ANI-NLFCVVRLLA-----EFPATG--------------------------------------
Q8T8Z2_DROME/169-596-----------------ADA-NLFTLITLRV-----ENSPFG--------------------------------------
PKDRE_MOUSE/1621-2051-----------------PDT-SLMCSISVVF-----EVSPLG--------------------------------------
Q95V80_STRPU/2211-2645-----------------ANT-NLFCVVTFLM-----ETPASG--------------------------------------
PKD2_CAEEL/119-538-----------------ANI-NLFCVVKLLF-----ELPASG--------------------------------------
Q9VVZ8_DROME/165-591-----------------ADA-NTFTVCTLWV-----EKFPYQ--------------------------------------
PKDRE_HUMAN/1748-2178-----------------PDI-NLFCSISVIF-----EVSQLG--------------------------------------
Q9VK95_DROME/402-803-----------------ENT-DIFQSIKLIA-----EIPPTG--------------------------------------
PK2L1_MOUSE/147-567-----------------ANI-NLFCILRLVV-----EFPATG--------------------------------------
Q9W4X5_DROME/170-595-----------------VDV-NLFSICTLRV-----EKTPFG--------------------------------------

PF00520

TRPV2_MOUSE/387-652----------------------MIIFTIVAY-----HQPSLEQ-------------------------------------
TRPC5_RABIT/372-636----------------------SQHIVRTDL-----HVQGPP--------------------------------------
O46129_LOLFO/351-636----------------------VSQRIENPF-----FFLFPMK-------------------------------------
TRPG_DROME/361-664-----------------RIE-TFIGGWFFAD-----SSGMLNT-------------------------------------
TRPL_DROME/382-680-----------------DFV-RIFGTTRMKK-----ELAEQE--------------------------------------
Q94447_CALVI/372-670----------------------SLRVVQITF-----ELLAFPW-------------------------------------
TRPC2_MOUSE/670-932----------------------GESLVMETQ-----LSTFKG--------------------------------------
TRPC3_HUMAN/379-670----------------------FLGLLVFNA-----SDRFEG--------------------------------------
TRPC6_MOUSE/447-738------------------AD-RFEGTKLLPN-----ETSTDNA-------------------------------------
TRPM2_HUMAN/801-1060----------------------FAYVLMV-------DFQPVP--------------------------------------
TRPM1_HUMAN/833-1087----------------------FNYVILVRM-----DGW-----------------------------------------
Q20766_CAEEL/902-1141----------------------TTQTCILLL-----ETSLKP--------------------------------------
TRPG_CAEEL/1312-1567----------------------TFFTYTLLV-----KTPPRP--------------------------------------
TRPV5_RABIT/332-590----------------------ICFTTCCIY-----RPLKLRD-------------------------------------
Q9VUD5_DROME/475-730----------------------YYDPSEVEVLPAWWESYAQC--------------------------------------
O61220_CAEEL/519-775-------------------------CVQVFL-----DFRDIK--------------------------------------
Q9W3W0_DROME/459-665----------------------LSYVIFQQG-----DEIKNQ--------------------------------------
PAIN_DROME/494-746----------------------TASIITYTL-----LKFHES--------------------------------------
TRPA1_DROME/793-1039----------------------QNPSVASQI-----RLDSCE--------------------------------------
TRPA1_HUMAN/720-972----------------------PMTILVVNIK---PGMAFNS--------------------------------------
TRPA1_CAEEL/813-1080------------------LT-QYVRHTKAPYNVWNEESYYDS--------------------------------------
Q9VHY7_DROME/551-812----------------------LTALAHNCYNGSKNDNTTIP--------------------------------------
PYX_DROME/496-735----------------------FYVIWVYVRCCKKEELCVAP--------------------------------------
O13054_MAKNI/4778-4992----------------------GVDLASLDV-----SQQHEK--------------------------------------
O61567_HOMAM/1212-1418----------------------METTMSFKQ-----EEASTG--------------------------------------
O96310_HELVI/229-436----------------------MEKTSFSAQ-----EEEGSK--------------------------------------
ITPR_DROME/2408-2692-----------------GIR-TFIGSVILRF-----IFLLGP--------------------------------------
O77089_PANAR/2326-2624----------------------LGSISVVRL-----IFSVGP--------------------------------------
ITPR1_MOUSE/2315-2600-----------------GIR-ALIASTILRL-----IFSVGL--------------------------------------
ITPR2_HUMAN/2270-2552----------------------GIRPFLVSI-----MLRSIY--------------------------------------
Q9VW35_DROME/351-581-----------------CTR-ALWRAYLLRCT---TVNFFRS--------------------------------------
CCH1_YEAST/769-1010----------------------ICDIGMRAS-----VKVSTS--------------------------------------
NALCN_RAT/35-333----------------------IISVIPVCM-----NTPMTF--------------------------------------
CCH1_SCHPO/514-755----------------------VAQFVTLCT-----QTYDQT--------------------------------------
TPC1_ARATH/429-683----------------------IINFIAVVV-----ETTLDI--------------------------------------
TPC1_HUMAN/440-698----------------------AVNGVWILV-----ETFMLK--------------------------------------
TPC1_ARATH/103-316----------------------LTNAESIIY-------------------------------------------------
CCH1_SCHPO/1272-1517----------------------FLLTIFYPC-----PIAYTY--------------------------------------
CCH1_YEAST/1529-1779----------------------YLHIIMLLS-----RSYNPG--------------------------------------
CCH1_YEAST/1209-1484----------------------VCSCYVTPL-----YRMHHK--------------------------------------
CCH1_SCHPO/941-1224----------------------LTAVIIECI-----ATPIYER-------------------------------------
CCH1_SCHPO/184-493----------------------VLHAVLLMI-----RSDDPH--------------------------------------
TPC1_HUMAN/105-331----------------------LLLLLLSLC-----EAPAVP--------------------------------------
NALCN_RAT/1209-1458----------------------LAQSVLLSV-----K-WDVE--------------------------------------
NALCN_RAT/383-610----------------------TVDVIVAAS-----NYYKGE--------------------------------------
NALCN_RAT/885-1167----------------------ICSCISMMF-----ESPFRR--------------------------------------
CAC1E_DIPOM/1104-1385----------------------AASSVALAA-----EDPIHK--------------------------------------
Q17354_CAEEL/340-623----------------------CLSSVSLAA-----EDPVDE--------------------------------------
M9NDV1_DROME/768-1051----------------------SMSSIALAA-----EDPVRE--------------------------------------
P91744_HETBL/894-1174----------------------CASSIALAA-----EDPVND--------------------------------------
O02038_CYACP/868-1147----------------------IMSSVALAA-----EDPIGR--------------------------------------
O97017_STYPI/849-1127----------------------IVSSILLAA-----EDPLNA--------------------------------------
O96057_HALRO/803-1082----------------------ILSSIALAC-----EDPVSA--------------------------------------
CAC1D_DROME/1343-1621----------------------MFSSAMLAA-----ENPLRA--------------------------------------
CAC1S_CYPCA/814-1092----------------------LLSSISLAA-----EDPIDP--------------------------------------
CAC1S_HUMAN/798-1076----------------------LLSSAALAA-----EDPIRA--------------------------------------
CAC1C_HUMAN/899-1197----------------------LLSSISLAA-----EDPVQHT-------------------------------------
CAC1D_HUMAN/885-1163----------------------MLSSAALAA-----EDPIRS--------------------------------------
CAC1G_RAT/1254-1527----------------------FLNCITIAM-----ERPKID--------------------------------------
Q9W433_DROME/2144-2418----------------------ALNCITLAM-----ERPNIP--------------------------------------
O44930_EXADI/1046-1318----------------------MASSIALTF-----EDINLP--------------------------------------
O62604_POLPE/908-1178----------------------AFSSLTLVF-----EDIDLP--------------------------------------
Q17314_CYACP/963-1231----------------------AFSSLTLVF-----EDIHLS--------------------------------------
P97706_RAT/954-1225----------------------LLCTGTLAL-----EDIYIH--------------------------------------
SCN7A_HUMAN/933-1204----------------------LLSTGTLAF-----EDIYMD--------------------------------------
SCN1_HETBL/781-1052----------------------FASSILLAF-----EDIYLN--------------------------------------
O02037_BDECA/985-1259----------------------AFSSLTMTL-----EDKYLP--------------------------------------
SCNBA_RAT/1033-1299----------------------LLSSGALIF-----EDVNLP--------------------------------------
SCNBA_HUMAN/1055-1319----------------------LLSSGALIF-----EDVHLE--------------------------------------
Q25150_HALRO/1260-1547----------------------MLSSGALAF-----EDVYLK--------------------------------------
SCNAA_CANLF/1158-1436----------------------LLSSGSLAF-----EDYHLD--------------------------------------
SCNA_ELEEL/999-1275----------------------LLSSGVLAF-----EDIYIW--------------------------------------
SCN4A_HORSE/1027-1303----------------------LLNSGTLAF-----EDIYIE--------------------------------------
SCN8A_RAT/1195-1473----------------------LLSSGALAF-----EDIYIE--------------------------------------
P90670_APLCA/1177-1452----------------------LASSCALAL-----EDAYLH--------------------------------------
Q25377_DOROP/1022-1296----------------------LASSLALAL-----EDIHLR--------------------------------------
SCNA_DROME/1300-1571----------------------LMSSLALAL-----EDVHLP--------------------------------------
Q9XZC1_RHIMP/461-733----------------------LTSSLALAL-----EDVNLK--------------------------------------
Q9W433_DROME/300-623----------------------LLNCITLGM------YQPCV--------------------------------------
CAC1I_RAT/76-407----------------------LLNCVTLGM------YQPCD--------------------------------------
CAC1G_RAT/80-406----------------------LLNCVTLGM------FRPCE--------------------------------------
CAC1H_HUMAN/99-430----------------------MLNCVTLGM------FRPCE--------------------------------------
CAC1E_DIPOM/101-374----------------------IANCVVLAL-----EQHLPN--------------------------------------
M9NDV1_DROME/37-324----------------------IANCVVLAL-----EEHLPG--------------------------------------
P91744_HETBL/64-348----------------------IANCIVLAL-----EEHLPN--------------------------------------
O02038_CYACP/112-392----------------------FANCAALAA-----YEPLPA--------------------------------------
O97017_STYPI/80-362----------------------FANCAALAA-----FEPLPE--------------------------------------
O96057_HALRO/46-328----------------------LANCVALAV-----YVPFPG--------------------------------------
CAC1D_DROME/614-889----------------------FANCIALAV-----YTPYPG--------------------------------------
CAC1S_CYPCA/69-362----------------------FANCVALAV-----FLPMPE--------------------------------------
CAC1F_HUMAN/91-383----------------------FANCVALGV-----YIPFPE--------------------------------------
CAC1D_CHICK/120-412----------------------FANCVALAV-----YIPFPE--------------------------------------
CAC1S_HUMAN/50-345----------------------FANCVALAV-----YLPMPE--------------------------------------
CAC1S_LITCT/50-343----------------------FANCVALAI-----FLPMPE--------------------------------------
P97706_RAT/117-405----------------------LTDSILMCM-------SNLP--------------------------------------
SCN7A_HUMAN/117-405----------------------LIDCVFMSL-------TNLP--------------------------------------
O02037_BDECA/134-418----------------------ITNCIIMAL----------N--------------------------------------
SCNBA_RAT/128-406----------------------IINCMFMANSMERSFDNDIP--------------------------------------
SCNBA_HUMAN/128-411----------------------IINCVFMAT-------------------------------------------------
SCNA_DROME/152-440----------------------LVNCILMIM--------PTT--------------------------------------
P90670_APLCA/137-431----------------------LVNCVFMAI-----TSYTPP--------------------------------------
Q25377_DOROP/131-412----------------------VCNCVFMTM-----KENPLP--------------------------------------
Q25150_HALRO/130-477----------------------LVNCGFMAY---------GE--------------------------------------
SCNAA_CANLF/129-417----------------------LVNCVGMTQ-----TELPDR--------------------------------------
SCNA_ELEEL/121-413----------------------FSNCIFMTI-------SNPP--------------------------------------
SCN4A_HUMAN/130-458----------------------LTNCVFMTM-------SDPP--------------------------------------
SCN5A_HUMAN/130-424----------------------LTNCVFMAQ-------HDPP--------------------------------------
Q90518_TAKRU/128-427----------------------LTNCAFMTL-------SNPP--------------------------------------
SCN1_HETBL/54-345----------------------MINCVFLAM----------P--------------------------------------
O44930_EXADI/112-392----------------------IVNCIFLAL----RDAPEQP--------------------------------------
Q17314_CYACP/142-419----------------------ITNCVFMAL-----SDPPKE--------------------------------------
CAC1G_RAT/1578-1830----------------------GLNVVTMAM-----EHYQQP--------------------------------------
Q17354_CAEEL/666-920----------------------CCNTLILMM-----KYYNNP--------------------------------------
P91744_HETBL/1217-1468----------------------ALNTLVLMM-----KYYGSP--------------------------------------
M9NDV1_DROME/1094-1348----------------------VFNTLLLMM-----KYHNQG--------------------------------------
CAC1B_DIPOM/1467-1716----------------------ALNTIVLMM-----KFYNAP--------------------------------------
CAC1E_DIPOM/1428-1674----------------------ALNTVVLMM-----KHHSPP--------------------------------------
CAC1E_HUMAN/1477-1734----------------------ALNTVVLMM-----KYYSAP--------------------------------------
O02038_CYACP/1188-1437----------------------LGNTIVLAA-----QYHNAS--------------------------------------
O97017_STYPI/1168-1422----------------------VCNTVVLMM-----QYYQEP--------------------------------------
CAC1M_MUSDO/1108-1378----------------------MINTVTLAM-----KFYKQP--------------------------------------
O96057_HALRO/1123-1384----------------------LLNTVCLAV-----QHHQQS--------------------------------------
CAC1S_CYPCA/1133-1413----------------------MLNTLCLGI-----QHCNQS--------------------------------------
CAC1S_RABIT/1117-1392----------------------MLNTICLGM-----QHYHQS--------------------------------------
CAC1C_HUMAN/1238-1535----------------------LLNTICLAM-----QHYGQS--------------------------------------
O02037_BDECA/1306-1555----------------------VLNTLTMCI-----EFQDQP--------------------------------------
SCN7A_HUMAN/1250-1507----------------------CFQAIAMMI-----DTDVQS--------------------------------------
P90670_APLCA/1499-1743----------------------ILNMLTMMF-----EHHGMS--------------------------------------
Q25377_DOROP/1343-1600----------------------LLNMITMAM-----EHYNMS--------------------------------------
SCNA_DROME/1618-1871----------------------GLNMFTMTL-----DRYDAS--------------------------------------
Q9XZC1_RHIMP/780-1031----------------------VLNMTVMAL-----DHYKQS--------------------------------------
SCNBA_RAT/1345-1595----------------------VLNMIIMMA-----ESADQP--------------------------------------
SCNBA_HUMAN/1365-1615----------------------ILNMISMMA-----ESYNQP--------------------------------------
Q25150_HALRO/1593-1850----------------------VTNMFTMMI-----EYHDMP--------------------------------------
SCNA_ELEEL/1321-1578----------------------CINMVAMMV-----ESEDQS--------------------------------------
SCN1A_HUMAN/1540-1797----------------------CLNMVTMMV-----ETDDQS--------------------------------------
SCN5A_HUMAN/1527-1783----------------------CLNMVTMMV-----ETDDQS--------------------------------------
SCN1_HETBL/1100-1362----------------------ITNMIFMAF-----EHYNQS--------------------------------------
O44930_EXADI/1367-1619----------------------CLNILVMMI-----QHYGQK--------------------------------------
O62604_POLPE/1225-1481----------------------LLNMLTMMI-----QHHGQS--------------------------------------
Q17314_CYACP/1278-1536----------------------IANMLTMMI-----QHYDQT--------------------------------------
O62604_POLPE/486-725----------------------MLNTCLMAS-----EHYKMP--------------------------------------
Q17314_CYACP/509-745----------------------MVNTIAMAA-----EHFEQP--------------------------------------
P97706_RAT/526-760----------------------ILNICFLAL-----EHFPMS--------------------------------------
SCN7A_HUMAN/504-739----------------------ILNVCFLTL-----EHYPMS--------------------------------------
SCNBA_RAT/571-809----------------------IINTVFLAV-----EHHNMD--------------------------------------
SCNBA_HUMAN/576-822----------------------IINTVFLAM-----EHHKME--------------------------------------
Q25150_HALRO/798-1033----------------------IVNTAFMTA-----EYQPME--------------------------------------
SCNAA_CANLF/673-910----------------------VVNTVFMAM-----EHHGMS--------------------------------------
SCNA_ELEEL/565-801----------------------ILNTLFMSI-----EHHPMN--------------------------------------
SCN5A_RAT/717-953----------------------VLNTLFMAL-----EHYNMT--------------------------------------
SCN4A_HORSE/571-807----------------------VLNTLFMAM-----EHYPMT--------------------------------------
SCN1A_RAT/767-1003----------------------VLNTLFMAM-----EHYPMT--------------------------------------
P90670_APLCA/753-995----------------------LVNTAFMAM-----EHYDME--------------------------------------
Q25377_DOROP/591-824----------------------VLNTVFMAI-----DHYDMQ--------------------------------------
SCN1_HETBL/410-640----------------------VLNTVFLAM-----EHHGMS--------------------------------------
O44930_EXADI/622-858----------------------MVNTLFLSL-----EYHNMD--------------------------------------
CAC1G_RAT/743-976----------------------LVNTLSMGI-----EYHEQP--------------------------------------
Q9W433_DROME/1230-1471----------------------LINTLSMGI-----EYHNQP--------------------------------------
Q17354_CAEEL/9-248----------------------FLNTCCVAS-----EHYGQP--------------------------------------
P91744_HETBL/480-720----------------------FLNTLCVAS-----EHYGQA--------------------------------------
CAC1A_RAT/488-727----------------------ALNTLWLAI-----VHYNQP--------------------------------------
M9NDV1_DROME/440-678----------------------FLNTVCVAV-----EHYGQP--------------------------------------
O02038_CYACP/496-738----------------------FLNSLVLAV-----EHYDQP--------------------------------------
O97017_STYPI/468-710----------------------FLNSLTLAL-----EHYDQP--------------------------------------
CAC1D_DROME/984-1226----------------------FLNTGVLAT-----EHYGQL--------------------------------------
O96057_HALRO/428-670----------------------FCNTLSLAT-----EHYRQP--------------------------------------
CAC1S_CYPCA/446-687----------------------LLNTLVIAM-----EHHNQT--------------------------------------
O73697_TAKRU/439-680----------------------FLNTLTIAT-----EHHHQP--------------------------------------
CAC1C_HUMAN/523-764----------------------FLNTLTIAS-----EHYNQP--------------------------------------
CAC1S_LITCT/430-671----------------------LLNTVIIAT-----EHHHQP--------------------------------------
CAC1S_HUMAN/431-672----------------------ALNTLSIAS-----EHHNQP--------------------------------------
CNGC3_ARATH/80-406----------------------VVALAFDPL-----FFYIPYV-------------------------------------
CNGC6_ARATH/111-443----------------------ILAVSVDPL-----FLYLPFI-------------------------------------
CNGC7_ARATH/98-431----------------------ILAVSVDPL-----FFYLPIV-------------------------------------
CNG16_ARATH/52-386----------------------LLALFLDPL-----YFYLPIV-------------------------------------
CNG14_ARATH/84-410----------------------YVDPLFFFL-----SSVKRIG-------------------------------------
HCN4_MOUSE/262-525----------------------VGNLIIIPV-----GITFFK--------------------------------------
O96385_PARTE/140-383----------------------IVNIFYVPL-----QLSFNL--------------------------------------
Q27170_PARTE/142-388----------------------NINVLYVSI-----KIAFKF--------------------------------------
SKOR_ARATH/82-334----------------------LYSSFFTPL-----EFGFFRG-------------------------------------
KAT3_ARATH/86-336----------------------GYSAWASLF-----ELAFEK--------------------------------------
Q9XH40_SAMSA/77-327----------------------GYSAWVYPF-----EIGFLM--------------------------------------
Q9SM12_MAIZE/69-319----------------------AYSAWVYPF-----EVAFMN--------------------------------------
AKT2_ARATH/75-324----------------------AYSAWVYPF-----EVAFLN--------------------------------------
O04703_SOLTU/88-338----------------------AYCAWVCPF-----EIAFMN--------------------------------------
O24538_VICFA/55-305----------------------AYSAWAYPF-----EVAFMH--------------------------------------
AKT5_ARATH/78-324----------------------LYTAWASPF-----EFGFLQ--------------------------------------
O04242_MAIZE/64-310----------------------VYSAWVSPF-----EFGFIQ--------------------------------------
O24382_SOLTU/63-309----------------------VYTAWVSPF-----EFGFLG--------------------------------------
AKT1_ARATH/57-300----------------------VYTAWVSPF-----EFGFLR--------------------------------------
KAT2_ARATH/59-307----------------------IYSAWICPF-----EFAFIT--------------------------------------
Q41461_SOLTU/60-311----------------------IYTAWISLF-----EVAFLS--------------------------------------
KCNH5_RAT/214-479----------------------FYTAIMVPY-----NVSFKT--------------------------------------
O44164_CAEEL/216-496----------------------FYTAFMVPF-----NIAFKNS-------------------------------------
KCNAE_DROME/236-500----------------------FYTAIMVPY-----NVAFKN--------------------------------------
KCNH6_RAT/256-523----------------------IYTAVFTPY-----SAAFLLS-------------------------------------
Q23974_DROME/267-516----------------------FYVALMVPY-----NAAFAK--------------------------------------
KCNH3_RAT/224-515----------------------LYVAVTVPY-----SVCVST--------------------------------------
KCNH8_RAT/221-481----------------------FYVAVTVPY-----NVCFIG--------------------------------------
Q9U5E2_DROME/125-365----------------------LYNLWTLIV-----RQSFPE--------------------------------------
CNG_CAEEL/165-422----------------------LTNMKEMPT-----YSQYPD--------------------------------------
CNGA4_RAT/34-277----------------------MYNLIIVVC-----RACFPDL-------------------------------------
CNGA_DROME/107-358----------------------LYNIIFVVG-----RAVFWE--------------------------------------
CNG_ICTPU/138-376----------------------LYNWIMLVA-----RACFDQ--------------------------------------
CNGA1_BOVIN/163-406----------------------MYNWTMIIA-----RACFDEL-------------------------------------
CNG1_CHICK/210-453----------------------FYNWCMLIC-----RACFDE--------------------------------------
CNGA2_BOVIN/140-383----------------------LYNWCLLVA-----RACFSD--------------------------------------
CNGB1_BOVIN/770-1005----------------------NWNCWLIPV-----RWAFPY--------------------------------------
Q9W2D5_DROME/468-704----------------------LYNAWVIPL-----RASFPF--------------------------------------
KCMA1_RAT/178-400----------------------IGALVIYFI-----DSSNPI--------------------------------------
SLO_DROME/126-348----------------------IASLIIYFV-----DASSEE--------------------------------------
SLO1_CAEEL/138-363----------------------IGSLIIYFY-----DASFQNF-------------------------------------
KCNQ1_HUMAN/122-359----------------------LVCLIFSVL-----STIEQY--------------------------------------
Q9XWG9_CAEEL/76-313----------------------LICLILSVLSTVEEHSHFAA--------------------------------------
KCNQ3_HUMAN/122-363----------------------VLGCLILAV-----LTTFKE--------------------------------------
KCNQ2_HUMAN/92-324-----------------------FSCLVLSV-----FSTIKE--------------------------------------
KCNQ4_HUMAN/98-330-----------------------FSCLVLSV-----LSTIQE--------------------------------------
Q9RW39_DEIRA/33-252----------------------VASVLAVTL-----ESVPEL--------------------------------------
Q16976_APLCA/213-469----------------------VTSIAGFCL-----ETLPELR-------------------------------------
KVS4_CAEEL/229-477----------------------LISISGLVL-----GSLPELQ-------------------------------------
KCNG2_CHICK/216-464----------------------AITAVSLCI-----STMPDVR-------------------------------------
G1R5R7_NOMLE/226-471----------------------TVTAVNLSV-----STLPSLR-------------------------------------
KCNAL_DROME/184-417----------------------AVSVMANVV-----ETVPCGH-------------------------------------
P91784_POLPE/201-427----------------------AVSVGSTII-----ETIDCS--------------------------------------
KCNV1_RAT/212-442----------------------AVSIVNMAL-----MSAELS--------------------------------------
KCNS3_HUMAN/184-417----------------------LASIVAMCV-----HSMSEF--------------------------------------
KCNS1_MOUSE/188-439----------------------LASIAAMCI-----HSLPEYQ-------------------------------------
KCNS2_MOUSE/186-421----------------------LGSIITMCLN--SLPDFQIP--------------------------------------
A0A0D9S9T6_CHLSB/181-417----------------------LVSSVVMCM-----GTIPELQ-------------------------------------
KCNAB_DROME/434-670----------------------VLSTIALTL-----NTLPQLQ-------------------------------------
Q26344_APLSP/314-551----------------------VLSTIALTL-----NTIPALQ-------------------------------------
KCNAG_CAEEL/203-453----------------------FISIFSFCL-----KTHQSFR-------------------------------------
O76457_APLCA/173-421----------------------VISILSFCL-----KTHPEMR-------------------------------------
KCNAW_DROME/173-424----------------------CISILSFCL-----KTHPDMR-------------------------------------
KCNSK_CAEEL/274-519----------------------ALSIISFCW-----ETVPSDI-------------------------------------
O76266_HIRME/209-446----------------------TISIILFCV-----ETLERFA-------------------------------------
Q26094_POLPE/173-409----------------------VVSLIMFVI-----ETLPVFA-------------------------------------
Q26095_POLPE/181-410----------------------LISIVVFCL-----ETIPSLN-------------------------------------
KCNA6_RAT/230-470----------------------SIPSGGLGT-----GGTSSF--------------------------------------
Q25376_DOROP/169-415----------------------VISIVTFCL-----ETLPEFK-------------------------------------
KCNA1_HUMAN/166-419----------------------LISIVIFCL-----ETLPELK-------------------------------------
KCNAS_DROME/226-489----------------------LLSIVIFCL-----ETLPEFK-------------------------------------

PF07885

W5K2Z9_ASTMX/448-526--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
A0A6H3AGI5_BACAN/22-99--------------------------------------------------------------------------------
A0A6L7HBD1_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q9A7V3_CAUVC/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------

PF01007

H2TFE7_TAKRU/11-151--------------------------------------------------------------------------------
F6SPD2_XENTR/38-178--------------------------------------------------------------------------------
F7FJC1_MONDO/46-187--------------------------------------------------------------------------------
U3II41_ANAPP/30-170--------------------------------------------------------------------------------
H2MFJ0_ORYLA/31-168--------------------------------------------------------------------------------
H2T950_TAKRU/46-187--------------------------------------------------------------------------------
H2Q537_PANTR/43-185--------------------------------------------------------------------------------
B4KG98_DROMO/102-248--------------------------------------------------------------------------------
H2ZYX1_LATCH/30-171--------------------------------------------------------------------------------
W5M8R3_LEPOC/3-142--------------------------------------------------------------------------------
T1EE13_HELRO/114-252--------------------------------------------------------------------------------
H3B1J1_LATCH/31-172--------------------------------------------------------------------------------
H3BAR9_LATCH/36-174--------------------------------------------------------------------------------
U3JLS4_FICAL/37-181--------------------------------------------------------------------------------
H3A9C1_LATCH/46-186--------------------------------------------------------------------------------
Q1L8I6_DANRE/24-166--------------------------------------------------------------------------------
W4YAR4_STRPU/79-219--------------------------------------------------------------------------------
M3XYC0_MUSPF/50-188--------------------------------------------------------------------------------
Q5TQ25_ANOGA/25-171--------------------------------------------------------------------------------
U3KL94_FICAL/39-177--------------------------------------------------------------------------------
A0A0R4IAU4_DANRE/50-186--------------------------------------------------------------------------------
K1QHC7_CRAGI/79-221--------------------------------------------------------------------------------
B0W1P8_CULQU/118-264--------------------------------------------------------------------------------
I3K6N4_ORENI/30-172--------------------------------------------------------------------------------
H9JWA7_BOMMO/187-325--------------------------------------------------------------------------------
W4YRL0_STRPU/65-213--------------------------------------------------------------------------------
B0W1P7_CULQU/12-158--------------------------------------------------------------------------------
B0XCY9_CULQU/27-172--------------------------------------------------------------------------------
IRK1_CAEEL/76-216--------------------------------------------------------------------------------
K1QR55_CRAGI/39-179--------------------------------------------------------------------------------
Q7PX90_ANOGA/25-165--------------------------------------------------------------------------------

PF00060

IR93A_DROME/574-841----------------------IILLTAPTLYAINRLAPLKEM-------------------------------------
GLR31_ARATH/591-843----------------------FFVIVGAAIWILEHRINDEFR-------------------------------------
Q9VVU7_DROME/386-644----------------------LLIITTVVLVLELFFSPHN---------------------------------------
Q19693_CAEEL/134-404----------------------VILISGVIFLVMTNIIRKVYE-------------------------------------
GLR11_ARATH/540-781----------------------FFVLTGIVVWLVERSVNPEFQ-------------------------------------
GLR14_ARATH/568-810----------------------FFILTGAIVWLIERHDNADFQ-------------------------------------
GLR37_ARATH/578-833----------------------SFLVIAVVIWILEHRINEDFR-------------------------------------
GLR34_ARATH/613-869----------------------FFLFVGAMVWILEHRFNQEFR-------------------------------------
GLR27_ARATH/582-833----------------------FFVFIGFIVWILEHRVNTDFR-------------------------------------
GLR29_ARATH/566-820----------------------FFVFIGFVVWLFEHRVNTDFR-------------------------------------
GLR28_ARATH/577-828----------------------FFVLIGFVVWLFEHRVNTDFR-------------------------------------
GLR21_ARATH/574-835----------------------SFFIIGLVVWVLEHRVNPDFD-------------------------------------
GLR22_ARATH/580-842----------------------FFFLVGISVWTLEHRVNSDFR-------------------------------------
NMD3B_HUMAN/574-842----------------------ALHLTALFLTVYEWRSPYGLT-------------------------------------
NMD3A_RAT/674-942----------------------ALHITAIFLTLYEWKSPFGMT-------------------------------------
O76903_DROME/477-751----------------------AIQAATFMIFLFEWLSPSGYD-------------------------------------
NMDE1_RAT/554-828----------------------LLIVSAIAVFVFEYFSPVGYN-------------------------------------
NMDE3_RAT/552-826----------------------CLTVVAITVFMFEYFSPVSYN-------------------------------------
Q9W365_DROME/518-818----------------------ALVGTAIMIWFMDKYSPYSSR-------------------------------------
NMDZ1_HUMAN/559-824----------------------SVHVVAVMLYLLDRFSPFGRF-------------------------------------
NMDA1_DROME/573-843----------------------SVHVVALVLYLLDRFSPFGRF-------------------------------------
GRID1_HUMAN/562-842----------------------AIPVVGVLIFVLNRIQAVRAQ-------------------------------------
GRID2_RAT/566-842----------------------TVLLVGLLVYLLNWLNPPRLQ-------------------------------------
A0A4W1TXG3_ANAPP/168-431----------------------AYILTCFCLFLVARLSPCEWN-------------------------------------
GLRK_LITBE/161-425----------------------SYVITSLCLFLVGRLSPCEWT-------------------------------------
B7ZPS4_XENLA/162-426----------------------AYMVTSLCLFLVGRLSPCEWT-------------------------------------
Q90278_CARAU/149-409----------------------AYFVTAVCICIVGRLSPCEWS-------------------------------------
Q90279_CARAU/144-405----------------------AYLLTSVCIFLVSRISPCEWK-------------------------------------
O01623_CAEEL/566-855----------------------SIITVTLGMYFVANVTPYEWNLNFS------------------------------CCT
Q9VMP4_DROME/554-829----------------------AQLIMTLAFVFIARLSYREWL-------------------------------------
O45028_DROME/553-829----------------------AMMITAFALIFTGRIDQYEWD-------------------------------------
Q9TVI0_DROME/547-823----------------------AYLGVSLCFFIIGRLSPIEWD-------------------------------------
B4II60_DROSE/545-823----------------------AYLGVSVLLFILAKFTPYEWP-------------------------------------
GRIK2_HUMAN/560-831----------------------AYLGVSCVLFVIARFSPYEWY-------------------------------------
Q9V4A0_DROME/553-829----------------------AYILVSFALFVMARFSPYEWK-------------------------------------
Q25412_LYMST/545-818----------------------AYLIVSFTIFTLARFSPYEWY-------------------------------------
GLR1_CAEEL/591-867----------------------AYIGVSVVIFLVSRFSPYEWR-------------------------------------
GLR2_CAEEL/619-910----------------------SYFGVSLTIFLVSWFSPYEKR-------------------------------------
GLR1_DROME/610-907----------------------SYVGVSFVLYFVTRFPPYEWR-------------------------------------
Q9VSV5_DROME/630-967----------------------SYIGVSIVLFFVSRFSPHEWRLVQQQPQQSQSPDPHAHHEQLANQQPPGIIGGAPLPA
G1R3B7_NOMLE/543-824----------------------AYIGVSVVLFLVSRFSPYEWH-------------------------------------
GLRK_LYMST/556-830----------------------AYIGVSVVLFLVSRFSPNEWH-------------------------------------
Q9U0T0_DOROP/568-841----------------------AFIGVSVVLFLVSRFSPSGWH-------------------------------------

PF02386

TRKG_ECOLI/38-485G---IGGAK--------------------------LYQ----S-------------------EMPGPFKDDKLTPRLADT
TRKH_HAEIN/35-487G---IGGTQ--------------------------LYR----A-------------------ESSGPLKDQKSLPKISEV
Q9HPA9_HALSA/77-556G---SGSYA--------------------------LYR----S-------------------EA----REKKIHPSVVST
O83176_TREPA/103-567----KKKMS--------------------------LES----R-------------------LVASHLVSDSDMGSLSHN
Y460_MYCPN/24-557KLHKKGKYS--------------------------FYE----K-------------------LMLQSERGGSKLGTTSEM
TRK1_SCHPO/316-816D---RNSAF--------------------------VAL----S-------------------KEQRDELGGIEYRALKCV
TRK2_YEAST/301-846G---RNSVF--------------------------IGL----T-------------------KQQKEELGGVEYRALRLL
TRK2_SCHPO/354-857G---RNSAF--------------------------YAL----T-------------------PVEREELAGIEYESLRIL
TRK1_YEAST/624-1180G---RNSNF--------------------------LGL----T-------------------RAQKDELGGVEYRAIKLL

PF03814

E3GJV8_9FIRM/5-557A---FIRGL--------------------------AGG----KDGR----------------KAMGNFYADLIRITTRVL
R4KGK3_CLOPA/7-555A---FIRAI--------------------------SGR----K-------------------KEIGNFYVDLVRIITRIL
X4ZCZ5_9BACL/10-554A---FIRAL--------------------------S------G-------------------KPLGNFFVDMIRCITRIL
I2BB55_SHIBC/11-556A---LIRAF--------------------------TRQ----S--V----------------TTLGNAWSDLLRITLWIL
D2B153_STRRD/14-551A---LVRGF--------------------------ARS----R--T----------------ENLGNFWVDLVRGTVRIL
A7I6Q1_METB6/235-800A---LIYAF--------------------------SRK----S--A----------------TTLGNFWVLLVRSVM-IL
Q6F8C8_ACIAD/9-565A---MLRTLFLQSGKTQSKDKQ-------------HWQ----E-------------------INLGNYWLDLIRPLLRFF
KDPA_BACCR/7-552A---FIRGL--------------------------A------G-------------------KELGNFFVDFTRALTRVF
KDPA_PARD8/9-566G---IMKSM--------------------------AAK----T--T----------------KTIGNFWHYLVISCTRIL
T0LA52_9EURY/11-544A---VIRGF--------------------------AGK----A-------------------RTIGNFYYDYVRSLTRVL
Q4JUS0_CORJK/12-549A---LIRGL--------------------------ANR----M--G---------------NGQIGNFWVDLTRAVFRVL
I4D2C5_DESAJ/10-560A---LTRGL--------------------------ARK----T--A----------------STIGNFWVDLTRSILWIL
D3F9I8_CONWI/10-571A---VIRGF--------------------------SAR----S--L----------------RTLGNFWSDLTRTLLYIL
B8GER2_METPE/14-556V---LIRGL--------------------------TRR----E--T----------------DRVGCFWVDLTRGVLGVL
E3JBQ1_FRAIE/12-552A---LVRGL--------------------------ARK----K--S----------------DTLGNFWVDLVRTVVRIL
R4TDT9_9PSEU/13-552A---VVRGF--------------------------VRS----K--T----------------DRLGNFWVDLTRGTIRIL
A0A6N4SSD6_CYTH3/25-575V---VFVAM--------------------------KER----T--T----------------NTLGNFYSFFVRSCTRIL
G8X3F4_STREN/12-552A---LVRGF--------------------------ARS----R--T----------------GELGNFWSDLVRTTVRIL
KDPA_DESVH/10-561A---VMRGL--------------------------ASQ----E--S----------------KTIGNFWADLVRSVLYVL
F9ZTB8_ACICS/11-575A---MIRGF--------------------------TRA----E--K----------------PGIGNLWVDLVRTTLYVL
A4FMI7_SACEN/14-552A---LVRGF--------------------------TGT----A--T----------------NRVGNVWVDITRGVTRIL
KDPA_MAGSA/10-548A---LMRGF--------------------------ARH----S--T----------------RTVGNFYVDITRVTLGLL
L0DLW9_SINAD/14-575A---TLRGL--------------------------RGD------------------------SHLGDFYADLMRSLVYVF
KDPA_METPP/10-570A---LIRGF--------------------------AAR----S--S----------------SAIGNFWVDVTRITVYVL
H8KMI0_SOLCM/10-568A---LLNAL--------------------------KAK----T--T----------------NNLGNFWEIFVKTNTRIL
F0S640_PSESL/9-559V---LFKAF--------------------------REK----S--T----------------TQLGNFYNYFLKSCTRIL
A0LLJ6_SYNFM/11-602A---IIRAL---------------------------RG----D-------------------PSLGNFFVDMWRVVVYLF
KDPA_PECAS/12-556A---LIRAF--------------------------SRR----C--V----------------DTLGNAWLDLLRITLYVL
KDPA_THEAC/28-571A---FVRGI--------------------------RTD----T-------------------GNIGNFYHDFLVSIFDLI
R6BHA4_9CLOT/5-583A---FIRGL--------------------------AGK----S--K----------------NNVGNFYSDLVRIITRVL
KDPA_DEIRA/9-559A---FMRGL--------------------------AGR----D--G----------------TNLGNFWVDVTRLIYRVL
K9Q855_9NOSO/9-574A---FIRGL--------------------------TGR----P---------------------LGNFYVDLIRSITRVL
K9V7P3_9CYAN/9-555A---FIRGL--------------------------TGR----Q---------------------LGNFYVDLTRGIIRVL
F8L2P0_PARAV/10-555V---LVRGM--------------------------TRK----M--V----------------NTVGNFWCDLVRTIVYLL
KDPA_LISMO/10-557A---VIRGF--------------------------IWK----K--Q----------------KTVGNFWQDLFRVTLYIL
Q6L2R0_PICTO/23-567A---FVRGI--------------------------RND----D-------------------GFIGNFYHDFLVSLFYLI
D1Z017_METPS/13-542A---LIRGL--------------------------LAT----D-------------------GKLGNFFSDFIKCIVRVL
E3GWW4_METFV/10-558A---FIRGF--------------------------IRS----N--T----------------DKIGNFWVDVTRMTLYVL
I3THP9_TISMK/10-558A---LARGF--------------------------ARA----E--T----------------PTIGCLTTDVTRITLRLL
C6VYG5_DYAFD/9-559V---VIMAI--------------------------KER----T--T----------------DKLGNFYDLFVKSCTRIL
KDPA_PSESM/10-560A---LCRGI--------------------------SRR----S--S----------------HSLGNFWADMTRATLYAL
U5QJ68_9CYAN/10-567A---FIRGL--------------------------LGR----P---------------------MGNFYVDLTRSISRIL
D9R2J7_CLOSW/10-558A---LIRGL--------------------------VLR----Q--K----------------KTIGNFWADLVRTTLYLL
G7M3P7_9CLOT/7-555A---FMRGI--------------------------IGK------------------------KSTGNFFVDITRITTRVL
F4KRB0_HALH1/9-568G---VYRAM--------------------------QEK----Q--S----------------STLGNFYVYFIQSITRVL
J7QUT1_METSZ/10-561A---LVRGF--------------------------SRA----E--S----------------PTIGNFWVDLTRSTLYVL
T0N7P9_9EURY/29-575A---FVRGI--------------------------MND----D-------------------KKLGNFFHDFLVAIFDLI
I4ETN2_9ACTN/13-566A---LVRGF--------------------------ART----R--T----------------DRLGNAWVDITRAVTRIL
KDPA_LEPIN/9-549A---LSRGI--------------------------SVN---YN--V----------------FALGNFWKDMIRGTLYVL
C7Q1T1_CATAD/12-560T---LIRGF--------------------------TRN----R--T----------------DRLGNFWVDLTRVLIRLM
F5XJD1_MICPN/12-552A---LLRGL--------------------------AAR----Q--T----------------TALGNFWVDLTRIVLRLL
A7HRV4_PARL1/16-556A---LARGL--------------------------AG-------------------------REMGNFFVDLQRASFLVL
KDPA_STAA8/4-555A---MLRRL--------------------------TGL----T-------------------NIIGNFYQDIVRFIVRVL
R5UVN1_9BACT/10-563G---IFKAM--------------------------ATR----S--G----------------KQIGNFWNLLVKSCTRIL
C7LZF2_ACIFD/8-557A---LVRGI--------------------------ARR----G--R----------------ATIGNFWVDTVRGVLWIL
I3TDE3_THEC1/12-531A---FLRSL--------------------------I------G-------------------ESAGNFYRDLVMAVGLLL
J7U1A2_MORMO/10-556A---LIRAL--------------------------CRR----S--V----------------QTLGNAWADLTRITLWLL
KDPA_METNO/10-559A---LIRGF--------------------------ARA----S--T----------------RTLGSFWVDLTRAILYVL
K7WVS0_9NOST/9-560A---FIRGL--------------------------TGR----T---------------------LGNFYIDITKSITRIL
KDPA_CAUVC/10-560A---LARAF--------------------------VAN----R--G----------------EGVGNFWADLVRTTLYLL
S5Z0Q6_PARAH/9-553A---VVRGL--------------------------VGR----S--V----------------QDLGNFWVDLTRATLYLL
KDPA_SOLUE/10-559A---FVRGF--------------------------SRH----S--A----------------NTLGNFWVDFTRATLYIL
E0UCQ4_GLOV7/9-555A---FIRGL--------------------------TGQ----P---------------------LGNFYVDLTLSITRVL
D7BJD8_MEISD/5-565A---ILRALRPPAGRK-------------------A--------------------------GDLGNYFVDVTRALTRVL
T0LT74_9EURY/28-573A---FIRGI--------------------------IKD----D-------------------GKLGNFFHDFLVAIFELI
B1WPS5_CROS5/10-555A---FIRGL--------------------------TGR----S---------------------LGNFYVDLTRSITRIL
D7A9S5_STAND/10-561A---LVRAF--------------------------ARS----N--A----------------STVGNFFVDMTRSTLYVL
KDPA_RHOCS/10-561A---LIRGF--------------------------ARR----A--G----------------KTVGNFWADLVRATLYVL
V6F0K6_MAGGM/10-558A---LIRGF--------------------------ARN----G--A----------------KSIGNFYVDLTRAVLYLL
KDPA_GLOVI/10-566A---FIRGL--------------------------LGK----P---------------------LGNFYVDLTRSVSRIL
A0JW40_ARTS2/13-553A---LIRGI--------------------------ART----R--T----------------DRLGNFWVDLARTSFRVL
KDPA_AGRVS/10-560A---VTRAF--------------------------ARS----A--A----------------NTLGNFWVDMTRSTLYLL
K9PBZ4_CYAGP/8-552A---VVRGL--------------------------CGL----P---------------------LGNFHRQLVRSLTRVL
D2UFZ8_XANAP/7-575A---TLRGLF--GGRAHAAAASVGSSAPASSMAEPPHA----E-------------------VDVGNYWADVIRPTLRLL
E8U851_DEIML/5-570A---ILRGLNGGVN---------------------ADAPAGAP-------------------RDFGNYYVDVVRALTRVL
J9Z8M5_LEPFM/10-559A---IIRGF--------------------------VRE----G--S----------------ATIGNFWSDFFRFFLRAF
KDPA_STRCO/12-552A---LVRGF--------------------------ARS----R--T----------------GELGNFWADLVRGVVRVL
I0K505_9BACT/9-568L---IFRSF--------------------------LPA----T--T----------------DRSGNFYTFFIKSITRIL
C8XB13_NAKMY/15-551A---LIRGF--------------------------ARA----A--T----------------DRLGNFWVDLVRIVIRVL
E4T7V0_PALPW/11-556A---LTKGL--------------------------SRR----T--T----------------DKLGNFWVDLTRSTLYVL
KDPA_CLOAB/7-555A---FIRAL--------------------------SGK------------------------KKLGNFYVDLVRITTRIL
KDPA_LARHH/11-562A---LVRGF--------------------------VRS----G--G----------------GAIGNAWLDLLRATLWLL
KDPA_ACIC5/10-582A---FIRGI--------------------------ARK----E--M----------------KTLGNFWVDMTRAILWVL
E3I291_RHOVT/10-561A---LIRGF--------------------------TRR----S--A----------------AGIGNFWADLTRCTLYIL
E4NDZ7_KITSK/13-552A---LIRGF--------------------------TRN----R--T----------------DRVGNFWVDLTRISLRLL
F8AWS9_9ACTN/16-552A---LVRGF--------------------------SRS----H--T----------------DRLGNFWVDLVRTVVRVL
V5XHA6_MYCNE/12-554A---FVRGL--------------------------VRR----S--T----------------GDLGNFWVDLVRGSLRIL
W0PFX0_9BURK/11-559G---FIRGL--------------------------SRR----S--A----------------ADIGNYWVDFTRVLYRVL
G8TYY4_SULAD/10-560A---VVRGL--------------------------VRQ----K--A----------------RTLGNFWVDWVSVQTRVL
KDPA_YERPE/10-556A---LIRAF--------------------------ARH----S--A----------------TTLGNAWVDLVRITLYVL
E6STC1_BACT6/10-566G---VMQSM--------------------------AAK----T--T----------------KTIGNFWKFMVLSCTRIL
A9HGI8_GLUDA/24-574A---VFRGF--------------------------SRE----S--A----------------KTIGNFWVDLTRITLYVL
KDPA_KINRD/13-552A---LVRGL--------------------------VAR----G--T----------------GTIGNFWVDLTRGTLRVL
KDPA_KORVE/10-583A---FIRGI--------------------------ARR----Q--S----------------ETIGNFWVDMTRAVLWVL
G7ZDN7_AZOL4/10-561A---LVRGF--------------------------ARA----S--S----------------RTVGNFWVDLTRATLYVL
KDPA_SORC5/10-576A---LIRGI--------------------------TRK----T--A----------------DTVGSFWVDLVRSTLYIL
B7J712_ACIF2/10-575P---IIRAL--------------------------ARH----K--T----------------KNLGNFWVDMTRTVLYVL
H1YB12_9SPHI/10-568A---LFRGL--------------------------KDK----V--T----------------DKLGNFWDNFVKTITRIL
C7PUT0_CHIPD/9-567V---LFRAF--------------------------ADK----T--T----------------EKLGNFFVFFTKTITRIL
KDPA_DESDA/9-579A---LIRGV--------------------------RAS----G--G----------------IGLGNFWADATRAVLYIL
K9RWG4_SYNP3/9-555A---FIRGL--------------------------TGQ----P---------------------IGNFYQDLVLAITRIL
KDPA_STAEQ/4-554A---MLRRL--------------------------TGM----T-------------------DVIGNFYQDITRFIVRVL
KDPA_CLAMS/12-556A---LVRGF--------------------------ART----R--S----------------GTIGNMWVDLIRGSLRLL
KDPA_SYNY3/9-555A---FIRGL--------------------------TGQ----A---------------------IGNFYQDLVLSITRIL
KDPA_KLEP7/11-556A---LTRAF--------------------------ARQ----K--M----------------STLGNAWVDLTRITLWLL
K9Z7H8_CYAAP/9-557A---FIRGL--------------------------TGQ----R---------------------LGSFYVDLTLSITRIL
D1CGX3_THET1/8-561A---LARGL--------------------------TRR----S--T----------------RQLGNFWVDVTRSVLYVL
E2Q1F7_STRCL/12-553A---LVRGF--------------------------TRE----R--S----------------ERVGHFWTDLTRLVVRVL
W8EUK3_9BACT/12-563V---VFNAL--------------------------QTR----T--T----------------EKLGNFYDYFVKSLTRLL
K9TR50_9CYAN/9-555A---FIRGL--------------------------TGR----P---------------------LGNFYVDLTRSITRIL
W0EX99_9BACT/9-563T---VFFAL--------------------------RER----T--S----------------VKLGNFYFLFVRSCTRIL
C6D691_PAESJ/7-556A---FIRGL--------------------------TSR----G-------------------STIGNFFSDFVKSHTRIF
B3EAQ3_GEOLS/13-570A---LIRGF--------------------------ARR----R--S----------------DTIGNFWVDLTRGILYIL
K9VVM6_9CYAN/9-559A---FIRGL--------------------------SGR----S---------------------LGNFYVDLTKSITRIL
K9X7N8_9CHRO/9-556A---FIRGL--------------------------TGR----P---------------------IGNFYVDLTLAITRIL
I3Y5A2_THIV6/11-568A---LMRGF--------------------------ARH----S--A----------------STIGNAWVDLTRVTLYLL
W5WRB9_9PSEU/12-552A---LIRGF--------------------------TRA----N--T----------------DRLGNVWVDITRAVVRVL
F4C4K6_SPHS2/10-559V---LFNAL--------------------------KER----T--T----------------DKLGNFYVYFLKSCTRIL
D9QG06_BRESC/10-560A---LARAF--------------------------VAS----R--G----------------EGVGNFWADMTRTTLYLL
A8HY16_AZOC5/10-561A---LVRGF--------------------------ARS----G--A----------------KGVGNFFVDTTRSTLYIL
Q186E7_CLOD6/11-560A---FVRGL--------------------------VGK----K-------------------KTLGNFYVDLIRITTRVL
KDPA_TOLAT/12-560V---LMRAL--------------------------TRT----G--S----------------QQLGNAWVDIWRITVYLL
U5LJM5_9BACI/9-555A---FVRAL--------------------------S------G-------------------KEIGNFLVDLFRAITRVL
KDPA_BEII9/10-560A---VTRAF--------------------------AAN----R--E----------------EGLGNFWVDLTRVSLYLL
KDPA_ANADE/10-573A---LVRAL--------------------------AGP----A--G----------------SGLGSFWVDLTRVTLRLL
E8X5C7_GRATM/10-587A---LIRGI--------------------------ARK----E--T----------------KTLGNFWVDTTRASLWIL
C5C4A0_BEUC1/16-557A---LVRGF--------------------------ARS----R--A---------------DGRIGNFWSDLTRSVTRIL
K8GCZ3_9CYAN/9-558A---FIRGL--------------------------TGS----P---------------------LGNFYSDLIRGITRIL
D0IYN9_COMT2/9-559G---FVRGL--------------------------ARS----S--S----------------KDVGNFWVDFVRVFWRVL
E0SEX9_DICD3/10-555V---LMRAF--------------------------ARR----T--T----------------HELGNAWLDLLRINLYLL
R6RMK4_9FIRM/8-574A---LIRGF--------------------------IKV----K--S----------------KGLGNFWVDLTRITLYLL
F4F4Y7_VERMA/14-551A---LVRGF--------------------------ARS----R--A----------------GQLGNFWVDLTRITLRVL
A8KYG3_FRASN/13-567A---VVRGF--------------------------ARR----R--APVAAGPGSMDGVVGTGDEIGNFWVDLTRTIVRIL
E1VQU5_9GAMM/5-576A---TLRGLF--GGR---ARLEGAP----------LSA----S-------------------IDVGNYWVDVIRAAVRFV
C6XZL6_PEDHD/9-568V---FFKAF--------------------------RDK----T--S----------------VKLGNFWDFFVKSITRLL
B7J714_ACIF2/9-575A---IIRGV--------------------------VRK----N--T----------------HLLGNFWVDITRIILYVL
E8RRM4_ASTEC/14-564A---VIRGL--------------------------TGQ----T--T----------------DKLGNFWVDLVRIQLYIL
K0CGH7_ALCDB/5-555A---ILRTLF-------------------------SKAPSGET-------------------VSVGNFHRDLLRSVLWVM
K8E2F1_CARML/9-558A---LLRGF--------------------------IAR----N--K----------------ETLGNFWQDLTKAVLYIL
D3EAK4_GEOS4/7-556A---FIRAV--------------------------TSK----G-------------------TTVGNFFEDFVKAHTRVF
D5WU10_KYRT2/12-563A---LIRGL--------------------------VRR----R--A----------------SAIGNFWVDMTRCTLWVL
G8TDF8_NIAKG/9-568G---LLNGL--------------------------KEK----T--T----------------NNLGNFWNLLVKSITRIL
KDPA_HYDS0/11-568V---LIRAF--------------------------ARK----N--T----------------IYLGNFYVDFTRTILYVL
D7DKK2_METV0/11-584A---LIRGF--------------------------ARH----T--V----------------QTIGNFWVDITRSTLYIL
R6PVD9_9CLOT/5-571A---FCRGL--------------------------SGR----K---------------------MGNFYKDMVRIITRIL
F2IFU1_FLUTR/9-571M---VFNAM--------------------------RNR----Q--S----------------DQLGNFYNYFIKSCTRVL
F7QKE7_9BRAD/10-559A---LIRGF--------------------------ART----S--M----------------QTVGNFWVDMTRCTLYVL
KDPA_MICAN/9-574A---FIRGL--------------------------TGR----P---------------------LGNFYVDLIRAITRIL
S0EVD3_CHTCT/10-589A---FIRGF--------------------------ARR----T--V----------------HEIGNFWVDTTRATLYIL
KDPA_RHIME/11-561A---VTRSF--------------------------ARS----A--A----------------PTIGNFWVDLTRSTLYVL
D5AKZ2_RHOCB/10-560A---VTRAF--------------------------ARA----G--T----------------DRLGNFWADMTRATLYVL
C9R8E6_AMMDK/12-560A---LTRAF--------------------------ARK----E--K----------------KTLGNVWVDLTRSVLYIL
C6W8P0_ACTMD/12-539A---LVRGF--------------------------TRE----G--S----------------DRLGNFWVDLTRGTLRVL
Q09AH8_STIAD/10-563A---LARGF--------------------------TRRLGPEG--P----------------KTLGNFWGDLVRGVLYVL
C4KYL4_EXISA/11-542A---FIRGI--------------------------LGK----P---------------------IGQFYFDFVRVIVYVL
KDPA_PSEAE/10-560A---LARGI--------------------------SRR----S--T----------------RQLGNFWVDLTRGTLYVL
A0KED5_AERHH/10-553A---LFRGI--------------------------ARQ----Q--T----------------THLGNFWQDLVRFCLYVL
E9T4H3_RHOHA/12-565A---LIRGF--------------------------VRV----S--R---------------GGEIGNFWVDLTRGALRIL
Q31MM1_SYNE7/10-552A---FVRGL--------------------------AGQ----G---------------------LGNFYRDWTLSLTRVL
KDPA_NOSS1/9-555A---FIRGL--------------------------TGR----K---------------------LGNFYVDLTRGITRIL
K9UDW3_CHAP6/9-563A---FIRGL--------------------------TGR----S---------------------LGNFYVDLTLAITRIL
KDPA_HALSA/11-578A---FARAF--------------------------TNK----E--D----------------PRLGNFYENVVRGLVRFL
W0A4I8_9SPHN/10-559A---FFRGF--------------------------ARR----R--A----------------ATIGNFWADCTRVTLYLL
KDPA_RHORT/10-561A---LIRGF--------------------------ARR----S--A----------------RTLGNFWVDLTRTVLYLL
R6NNJ3_9FIRM/5-564A---FCRGL--------------------------AGK----Q-------------------KDVGNFYEDMVRITTRIL
D3RSD8_ALLVD/5-565A---ILRTAFTQRDTTASTPEG-------------A--------------------------VSVGNFHADLVRAIVRVM
I0H1S8_ACTM4/10-547A---LIRGI--------------------------AAR----K--K----------------TTLGNFWVDLTRITLRIL
KDPA_GEOKA/9-557A---LIRAL--------------------------SKK----G-------------------KTIGNFYQDFVRANVRVL
KDPA_CALS4/9-558A---IMRGL--------------------------SKK----T-------------------TNLGNFYADFVRITVRLL
D2Q289_KRIFD/12-553A---LIRGF--------------------------SRS----R--T----------------ERLGNFWVDLTRTVLRVL
K9RK69_9CYAN/10-555A---FIRGL--------------------------TGK----P---------------------LGNYYADLIKAITRIL
KDPA_ALIAD/10-559A---FLRGL--------------------------SRQ----K--T----------------DALGNFWVDLVKAHTRLL
B6JA58_OLICO/10-557A---IIRGF--------------------------SRA----S--A----------------KTVGNFWVDLTRATLYIL
D3PV93_STANL/12-552V---LVRGF--------------------------ARK----L--T----------------DKLGNFWVDLTRITIWVL
H1ZCI8_MYROD/9-559A---LFEAF--------------------------RNK----T--T----------------TLLGNFYVYFVKSITRIL
H9ZZC9_FERFK/11-532A---FMRSL--------------------------K------G-------------------LQAGNFYRDLVMVTFFLL
KDPA_FLAPJ/10-570M---VFTAM--------------------------KER----T--T----------------DKLGNFYNFFIKSCTRIL
A5FU08_ACICJ/10-556A---LMRAF--------------------------ASG----G--I----------------RTLGNFYVDLVRITLYLL
K9Y0M2_STAC7/9-555A---FIRGL--------------------------TGN----P---------------------LGNFYVDLTKSITRIL
C0ZIZ1_BREBN/7-554A---FMRGL--------------------------TGQ------------------------RSIGNYYVDLVRAHTRVL
D6ZE64_SEGRD/12-555A---LVRGF--------------------------VHV----R--E---------------GGEVGNFWVDLVRGAVRVL
H7C701_ENTFA/10-555A---LLRGL--------------------------SQV----K--K----------------KALGNFWQDLTRSLVYIL
F4CT92_PSEUX/12-552A---LIRGF--------------------------VRS----G--T----------------DRLGNVWVDLTRGTVRIL
E8V6X7_TERSS/10-579A---FVRGI--------------------------ARR----E--A----------------KTLGNFWVDLTRGTLWVL
KDPA_PHOLL/10-561A---LIRTF--------------------------SRH----G--V----------------NTAGNAWVDITRITLYLL
KDPA_MYCTU/10-568A---LIRGL--------------------------ARK----R--A----------------STLGNFWVDLARTVLRIM
J7J1Q1_DESMD/10-560A---LIRGL--------------------------SRH----Q--A----------------KTIGNFWVDLTRTILWIL
D5UVP7_TSUPD/12-549A---LIRGF--------------------------VRS----R--T----------------DRLGNFWVDLTRITVRVL
U5RTG7_9CLOT/7-555A---FMRGL--------------------------AGK----K-------------------KTLGNFYVDYVRIITRIL
D1BAQ9_SANKS/14-555A---LVRGF--------------------------ARS----G--T---------------DGRVGNFWSDLTRTCVRVL
L0ABX1_CALLD/9-533A---FIRGF--------------------------IRR----G-------------------KHLGNFYVDFMRSLIFLI
KDPA_GRABC/10-560A---IIRGF--------------------------ARR----E--S----------------KAIGNFWVDMVRATLYVL
C9A6Y5_ENTCA/10-555A---LIRGL--------------------------QQK----Q--K----------------RTVGNFWQDITRSLLYIL
W0I187_9GAMM/10-555A---LIRGF--------------------------ARH----S--T----------------QDLGNAWRDLVRVTLFVL
B8ESF4_METSB/10-566A---MARGF--------------------------ARH----G--A----------------ETVGNAWVDITRATLYVL
KDPA_METB6/11-574A---FIYGF--------------------------SRR----S--S----------------HTIGNFWVLLLRS-IWIL
D5SYH3_PLAL2/10-576A---LIRGF--------------------------TRH----T--T----------------ETIGNFWVDLVRGTLYIL
D7B3X9_NOCDD/11-556A---LVRGF--------------------------ARR----R--S----------------GTIGNFWVDLTRGTLRLL
E3EDK0_PAEPS/7-556A---FMRGL--------------------------TRR----G-------------------EGLGNFFQDFIKANIRIF
B8GSR6_THISH/5-564A---TLRGFF--GGRNAQERKADGQ----------EQA----P-------------------VDVGNYWADVIRPTLRFM
A5N882_CLOK5/5-568A---FIRGL--------------------------AGK----T-------------------KTMGNFYMDLIRIITRVL
H6NGX7_9BACL/8-552A---IIRAL--------------------------A------G-------------------KPIGNFFVDLIRSITRIL
KDPA_ECOLI/10-556A---LIRAF--------------------------TRQ----S--M----------------STLGNAWVDLLRITLWVL
R5W702_9BACT/12-563G---IFKGM--------------------------AAK----T--T----------------KSIGNFWVYLTRSVTRIL
KDPA_HERA2/10-575G---LIRGI--------------------------ARR----S--T----------------STIGNFWVDLTRSTIYIL

PF08016

PKD1_MOUSE/3701-4103--------------------------------------------------------HALAAFSVRPFALRRLSTGLSLPL
PKD2_MOUSE/265-685--------------------------------------------------------GVVPSWQFQPVKLIRYVTAFDFFL
Q8T8Z2_DROME/169-596--------------------------------------------------------IQLPRVHVDSVSMLGNVETRSNSE
PKDRE_MOUSE/1621-2051--------------------------------------------------------VVNSSLSVYSFSLADFNRKTSSEI
Q95V80_STRPU/2211-2645--------------------------------------------------------GLLKLPEVQAVRLHRYAANYKLFV
PKD2_CAEEL/119-538--------------------------------------------------------GVITTPKLMTYDLLTYQTSGGTRM
Q9VVZ8_DROME/165-591--------------------------------------------------------YPDGHTRIESHTFVEQLREFTKFG
PKDRE_HUMAN/1748-2178--------------------------------------------------------VVNTSISLHSFSLADFDRKASAEI
Q9VK95_DROME/402-803--------------------------------------------------------GVIPQAHLQTVKMYSFFTDRSMLM
PK2L1_MOUSE/147-567--------------------------------------------------------GTIPSWQIRTVKLIRYVNNWDFFI
Q9W4X5_DROME/170-595--------------------------------------------------------GIVPDVQVDSAKLLENVDQMPYTG

PF00520

TRPV2_MOUSE/387-652------------------------------------PAIPS----------------------SKATFGDSML------L
TRPC5_RABIT/372-636-----------------------------------------------------------------------------PTV
O46129_LOLFO/351-636--------------------------------------------------------------------EEKKISELRGSP
TRPG_DROME/361-664------------------------------------M------------------------------EELPTKRGAKPTF
TRPL_DROME/382-680---------------------------------------------------------------------LRQRGQT-PSK
Q94447_CALVI/372-670------------------------------------MIE-------------------------MLDDWRKHERGSLPGP
TRPC2_MOUSE/670-932---------------------------------------------------------------------RSQS-----VW
TRPC3_HUMAN/379-670-----------------------------------------------------------------------ITTLPNITV
TRPC6_MOUSE/447-738------------------------------------R------------------------------QLFRMKTSC-FSW
TRPM2_HUMAN/801-1060------------------------------------------------------------------------------SW
TRPM1_HUMAN/833-1087------------------------------------------------------------------------P-----SL
Q20766_CAEEL/902-1141------------------------------------------------------------------------------SK
TRPG_CAEEL/1312-1567------------------------------------------------------------------------------TV
TRPV5_RABIT/332-590------------------------------------DNRTDPRDITILQQKLLQEAYVTHQDNIRLVGELVTV-----TG
Q9VUD5_DROME/475-730---------------------------------------------------------------------PLMNLESDLAK
O61220_CAEEL/519-775----------------------------------------------------------------------RIGRKKWWNV
Q9W3W0_DROME/459-665------------------------------------------------------------------------------GL
PAIN_DROME/494-746---------------------------------------------------------------------DQRALT---AF
TRPA1_DROME/793-1039---------------------------------------------------------------------ERINRTTAILF
TRPA1_HUMAN/720-972---------------------------------------------------------------------TGIINET-SDH
TRPA1_CAEEL/813-1080---------------------------------------------------------------------EYFDENETCPQ
Q9VHY7_DROME/551-812----------------------------------------------------------------------AQELCQKQSI
PYX_DROME/496-735----------------------------------------------------------------------GYVSTI-GYL
O13054_MAKNI/4778-4992------------------------------------------------------------------------------KQ
O61567_HOMAM/1212-1418--------------------------------------------------------------------------------
O96310_HELVI/229-436------------------------------------------------------------------------------GL
ITPR_DROME/2408-2692---------------------------------------------------------------------ESTL-----CL
O77089_PANAR/2326-2624---------------------------------------------------------------------EPTL-----WL
ITPR1_MOUSE/2315-2600---------------------------------------------------------------------QPTL-----FL
ITPR2_HUMAN/2270-2552----------------------------------------------------------------------TIGLGPTLIL
Q9VW35_DROME/351-581---------------------------------------------------------------------QFGKELSFDGR
CCH1_YEAST/769-1010---------------------------------------------------------------------ANCN-----NI
NALCN_RAT/35-333---------------------------------------------------------------------EHYPPL--QYV
CCH1_SCHPO/514-755---------------------------------------------------------------------SSTA-----NR
TPC1_ARATH/429-683---------------------------------------------------------------------EESSAQ---KP
TPC1_HUMAN/440-698---------------------------------------------------------------------GGNFFSK-HVP
TPC1_ARATH/103-316--------------------------------------------------------------------------------
CCH1_SCHPO/1272-1517-------------------------------------------------------------------------------V
CCH1_YEAST/1529-1779------------------------------------------------------------------------------NL
CCH1_YEAST/1209-1484---------------------------------------------------------------------MGTW-----NW
CCH1_SCHPO/941-1224--------------------------------------------------------------------DHLLNDKQ-HAW
CCH1_SCHPO/184-493---------------------------------------------------------------------DKS------QT
TPC1_HUMAN/105-331---------------------------------------------------------------------ALRLGI---YV
NALCN_RAT/1209-1458---------------------------------------------------------------------DPVT-----VP
NALCN_RAT/383-610------------------------------------------------------------------------NFRRQYDE
NALCN_RAT/885-1167---------------------------------------------------------------------VMHA-----PT
CAC1E_DIPOM/1104-1385---------------------------------------------------------------------DSARN----QV
Q17354_CAEEL/340-623---------------------------------------------------------------------ENPRN----KV
M9NDV1_DROME/768-1051---------------------------------------------------------------------NSRRN----KI
P91744_HETBL/894-1174---------------------------------------------------------------------ESVNN----QI
O02038_CYACP/868-1147---------------------------------------------------------------------DVLRN----KI
O97017_STYPI/849-1127---------------------------------------------------------------------SAKRN----QV
O96057_HALRO/803-1082---------------------------------------------------------------------HSARN----KV
CAC1D_DROME/1343-1621--------------------------------------------------------------------NDDLN-----KV
CAC1S_CYPCA/814-1092---------------------------------------------------------------------RSFRN----KV
CAC1S_HUMAN/798-1076---------------------------------------------------------------------DSMRN----QI
CAC1C_HUMAN/899-1197------------------------------------SFRNHIL------------------FYFDIVFTTIFTIEIALKI
CAC1D_HUMAN/885-1163---------------------------------------------------------------------HSFRN----TI
CAC1G_RAT/1254-1527---------------------------------------------------------------------PHSAER---IF
Q9W433_DROME/2144-2418---------------------------------------------------------------------PSST-----ER
O44930_EXADI/1046-1318---------------------------------------------------------------------SRPKLK---EY
O62604_POLPE/908-1178---------------------------------------------------------------------KRPTLE---KF
Q17314_CYACP/963-1231---------------------------------------------------------------------KKVVLK---AF
P97706_RAT/954-1225---------------------------------------------------------------------QRKTIK---IF
SCN7A_HUMAN/933-1204---------------------------------------------------------------------QRKTIK---IL
SCN1_HETBL/781-1052---------------------------------------------------------------------EKPRLK---LA
O02037_BDECA/985-1259---------------------------------------------------------------------NYPMLE---NT
SCNBA_RAT/1033-1299---------------------------------------------------------------------SRPQVE---KL
SCNBA_HUMAN/1055-1319---------------------------------------------------------------------NQPKIQ---EL
Q25150_HALRO/1260-1547---------------------------------------------------------------------DKIGLQ---RV
SCNAA_CANLF/1158-1436---------------------------------------------------------------------QKPTVK---AL
SCNA_ELEEL/999-1275---------------------------------------------------------------------RRRVIK---VI
SCN4A_HORSE/1027-1303---------------------------------------------------------------------QRRVIR---TI
SCN8A_RAT/1195-1473---------------------------------------------------------------------QRKTIR---TI
P90670_APLCA/1177-1452---------------------------------------------------------------------EKPILK---EI
Q25377_DOROP/1022-1296---------------------------------------------------------------------KKPILQ---LV
SCNA_DROME/1300-1571---------------------------------------------------------------------QRPILQ---DI
Q9XZC1_RHIMP/461-733---------------------------------------------------------------------DRPTLK---AV
Q9W433_DROME/300-623---------------------------------------------------------------------DDACVTNRCKI
CAC1I_RAT/76-407---------------------------------------------------------------------DMECLSDRCKI
CAC1G_RAT/80-406---------------------------------------------------------------------DIACDSQRCRI
CAC1H_HUMAN/99-430---------------------------------------------------------------------DVECGSERCNI
CAC1E_DIPOM/101-374---------------------------------------------------------------------GDKTPM--AKS
M9NDV1_DROME/37-324---------------------------------------------------------------------GDKTVL--AQK
P91744_HETBL/64-348---------------------------------------------------------------------EDKTPL--AVQ
O02038_CYACP/112-392---------------------------------------------------------------------GDMTST--NQD
O97017_STYPI/80-362---------------------------------------------------------------------KDSSEI--NDN
O96057_HALRO/46-328---------------------------------------------------------------------DDSNRT--NEI
CAC1D_DROME/614-889---------------------------------------------------------------------SDSNVT--NQT
CAC1S_CYPCA/69-362---------------------------------------------------------------------EDTNNT--NLT
CAC1F_HUMAN/91-383---------------------------------------------------------------------DDSNTA--NHN
CAC1D_CHICK/120-412---------------------------------------------------------------------DDSNST--NHN
CAC1S_HUMAN/50-345---------------------------------------------------------------------DDNNSL--NLG
CAC1S_LITCT/50-343---------------------------------------------------------------------DDTNST--NSV
P97706_RAT/117-405------------------------------------------------------------------------------EW
SCN7A_HUMAN/117-405------------------------------------------------------------------------------KW
O02037_BDECA/134-418------------------------------------------------------------------------------LD
SCNBA_RAT/128-406--------------------------------------------------------------------------------
SCNBA_HUMAN/128-411----------------------------------------------------------------------GPAKNSNSNN
SCNA_DROME/152-440------------------------------------------------------------------------------PT
P90670_APLCA/137-431--------------------------------------------------------------------------------
Q25377_DOROP/131-412--------------------------------------------------------------------------------
Q25150_HALRO/130-477---------------------------------------------------------------------------D-VD-
SCNAA_CANLF/129-417--------------------------------------------------------------------------------
SCNA_ELEEL/121-413------------------------------------------------------------------------------AW
SCN4A_HUMAN/130-458------------------------------------------------------------------------------PW
SCN5A_HUMAN/130-424------------------------------------------------------------------------------PW
Q90518_TAKRU/128-427------------------------------------------------------------------------------EW
SCN1_HETBL/54-345------------------------------------------------------------------------------DI
O44930_EXADI/112-392--------------------------------------------------------------------------------
Q17314_CYACP/142-419--------------------------------------------------------------------------------
CAC1G_RAT/1578-1830---------------------------------------------------------------------QILD-----EA
Q17354_CAEEL/666-920---------------------------------------------------------------------LFYE-----EI
P91744_HETBL/1217-1468---------------------------------------------------------------------TEYK-----LL
M9NDV1_DROME/1094-1348---------------------------------------------------------------------DMYE-----KS
CAC1B_DIPOM/1467-1716---------------------------------------------------------------------DPYD-----RM
CAC1E_DIPOM/1428-1674---------------------------------------------------------------------PGFA-----SV
CAC1E_HUMAN/1477-1734---------------------------------------------------------------------CTYE-----LA
O02038_CYACP/1188-1437---------------------------------------------------------------------KLYE-----RV
O97017_STYPI/1168-1422---------------------------------------------------------------------KLYT-----RV
CAC1M_MUSDO/1108-1378---------------------------------------------------------------------EYYS-----EI
O96057_HALRO/1123-1384---------------------------------------------------------------------KELT-----VI
CAC1S_CYPCA/1133-1413---------------------------------------------------------------------DHIT-----KL
CAC1S_RABIT/1117-1392---------------------------------------------------------------------EEMN-----HI
CAC1C_HUMAN/1238-1535---------------------------------------------------------------------CLFK-----IA
O02037_BDECA/1306-1555---------------------------------------------------------------------KLLT-----RV
SCN7A_HUMAN/1250-1507---------------------------------------------------------------------LQMS-----IA
P90670_APLCA/1499-1743---------------------------------------------------------------------AQMK-----NI
Q25377_DOROP/1343-1600---------------------------------------------------------------------RTFE-----DF
SCNA_DROME/1618-1871---------------------------------------------------------------------DTYN-----AV
Q9XZC1_RHIMP/780-1031---------------------------------------------------------------------RLFE-----SI
SCNBA_RAT/1345-1595---------------------------------------------------------------------KDVK-----KT
SCNBA_HUMAN/1365-1615---------------------------------------------------------------------KAMK-----SI
Q25150_HALRO/1593-1850---------------------------------------------------------------------KNLM-----DV
SCNA_ELEEL/1321-1578---------------------------------------------------------------------QVKK-----DI
SCN1A_HUMAN/1540-1797---------------------------------------------------------------------EYVT-----TI
SCN5A_HUMAN/1527-1783---------------------------------------------------------------------PEKI-----NI
SCN1_HETBL/1100-1362---------------------------------------------------------------------EVVT-----EV
O44930_EXADI/1367-1619---------------------------------------------------------------------PAVE-----QA
O62604_POLPE/1225-1481---------------------------------------------------------------------QQVS-----LA
Q17314_CYACP/1278-1536---------------------------------------------------------------------KEVE-----VA
O62604_POLPE/486-725---------------------------------------------------------------------KKLE-----DA
Q17314_CYACP/509-745---------------------------------------------------------------------EVMT-----KM
P97706_RAT/526-760---------------------------------------------------------------------EELM-----SL
SCN7A_HUMAN/504-739---------------------------------------------------------------------KQTN-----TL
SCNBA_RAT/571-809---------------------------------------------------------------------DNLK-----TI
SCNBA_HUMAN/576-822---------------------------------------------------------------------ASFE-----KM
Q25150_HALRO/798-1033---------------------------------------------------------------------ESYA-----RI
SCNAA_CANLF/673-910---------------------------------------------------------------------SAFE-----AM
SCNA_ELEEL/565-801---------------------------------------------------------------------ESFQ-----SL
SCN5A_RAT/717-953---------------------------------------------------------------------AEFE-----EM
SCN4A_HORSE/571-807---------------------------------------------------------------------EHFD-----KV
SCN1A_RAT/767-1003---------------------------------------------------------------------EHFN-----HV
P90670_APLCA/753-995---------------------------------------------------------------------DDLK-----AV
Q25377_DOROP/591-824---------------------------------------------------------------------EGLR-----VA
SCN1_HETBL/410-640---------------------------------------------------------------------MELK-----NV
O44930_EXADI/622-858---------------------------------------------------------------------SNYL-----MV
CAC1G_RAT/743-976---------------------------------------------------------------------EELT-----NA
Q9W433_DROME/1230-1471---------------------------------------------------------------------PELT-----AI
Q17354_CAEEL/9-248---------------------------------------------------------------------QWFT-----DF
P91744_HETBL/480-720---------------------------------------------------------------------EWHT-----EF
CAC1A_RAT/488-727---------------------------------------------------------------------EWLS-----DF
M9NDV1_DROME/440-678---------------------------------------------------------------------SFLT-----EF
O02038_CYACP/496-738---------------------------------------------------------------------DYIT-----MF
O97017_STYPI/468-710---------------------------------------------------------------------DWLT-----KF
CAC1D_DROME/984-1226---------------------------------------------------------------------DWLD-----NF
O96057_HALRO/428-670---------------------------------------------------------------------PWLT-----LA
CAC1S_CYPCA/446-687---------------------------------------------------------------------EGLT-----SF
O73697_TAKRU/439-680---------------------------------------------------------------------EWLT-----SL
CAC1C_HUMAN/523-764---------------------------------------------------------------------NWLT-----EV
CAC1S_LITCT/430-671---------------------------------------------------------------------DSLT-----KA
CAC1S_HUMAN/431-672---------------------------------------------------------------------LWLT-----RL
CNGC3_ARATH/80-406------------------------------------KPE--------------------------RFCL-NLDKKL-QTI
CNGC6_ARATH/111-443------------------------------------NDK--------------------------AKCV-GIDRKL-AII
CNGC7_ARATH/98-431-------------------------------------------------------------------DNSGSSCIGIDTK
CNG16_ARATH/52-386------------------------------------QAG--------------------------TACM-SIDVRF-GIF
CNG14_ARATH/84-410------------------------------------R-----------------------------SSCMTTDLKL-GIV
HCN4_MOUSE/262-525---------------------------------------------------------------------DENT-----TP
O96385_PARTE/140-383---------------------------------------------------------------------NEDNMG---SV
Q27170_PARTE/142-388---------------------------------------------------------------------DEQSQD---DF
SKOR_ARATH/82-334-------------------------------------------------------------------LP--EN-------
KAT3_ARATH/86-336----------------------------------------------------------------------AAE-----GA
Q9XH40_SAMSA/77-327---------------------------------------------------------------------SSPT-----HK
Q9SM12_MAIZE/69-319---------------------------------------------------------------------ASPK-----GG
AKT2_ARATH/75-324---------------------------------------------------------------------SSPK-----RN
O04703_SOLTU/88-338---------------------------------------------------------------------LNPN-----KK
O24538_VICFA/55-305---------------------------------------------------------------------SSPN-----RK
AKT5_ARATH/78-324----------------------------------------------------------------------TPR-----AP
O04242_MAIZE/64-310----------------------------------------------------------------------KPT-----GA
O24382_SOLTU/63-309----------------------------------------------------------------------KPE-----GP
AKT1_ARATH/57-300----------------------------------------------------------------------KPR-----PP
KAT2_ARATH/59-307----------------------------------------------------------------------YKK-----DA
Q41461_SOLTU/60-311---------------------------------------------------------------------YKKD-----DT
KCNH5_RAT/214-479---------------------------------------------------------------------KQNN-----IA
O44164_CAEEL/216-496------------------------------------LRP-------------------------FYLISSRENPGGGIDS
KCNAE_DROME/236-500---------------------------------------------------------------------KTSED----VS
KCNH6_RAT/256-523------------------------------------DQ----------------------------DESQRGTCGYTCSP
Q23974_DROME/267-516---------------------------------------------------------------------AD-------RQ
KCNH3_RAT/224-515----------------------------------------------------------------------AREPSAARGP
KCNH8_RAT/221-481-----------------------------------------------------------------------NEDLSTTRS
Q9U5E2_DROME/125-365---------------------------------------------------------------------LQQSVP---TF
CNG_CAEEL/165-422--------------------------------------------------------------------LGWSKYWHFRML
CNGA4_RAT/34-277--------------------------------------------------------------------QHSYL-----VA
CNGA_DROME/107-358---------------------------------------------------------------------INKSAP---AF
CNG_ICTPU/138-376---------------------------------------------------------------------LQDENF---FL
CNGA1_BOVIN/163-406--------------------------------------------------------------------QSDYL-----EY
CNG1_CHICK/210-453---------------------------------------------------------------------LQIDHI---KL
CNGA2_BOVIN/140-383------------------------------------------------------------------------LQKGYYIV
CNGB1_BOVIN/770-1005---------------------------------------------------------------------QTPDNI---HL
Q9W2D5_DROME/468-704---------------------------------------------------------------------QTKENT---NI
KCMA1_RAT/178-400----------------------------------------------------------------------ESCQNFYKDF
SLO_DROME/126-348---------------------------------------------------------------------VERCQKWSNNI
SLO1_CAEEL/138-363--------------------------------------------------------------------QVETCIPWQDSP
KCNQ1_HUMAN/122-359---------------------------------------------------------------------AALAT----GT
Q9XWG9_CAEEL/76-313------------------------------------------------------------------------------EL
KCNQ3_HUMAN/122-363---------------------------------------------------------------------YETVSG---DW
KCNQ2_HUMAN/92-324---------------------------------------------------------------------YEKSSE---GA
KCNQ4_HUMAN/98-330--------------------------------------------------------------------H--QELA--NEC
Q9RW39_DEIRA/33-252---------------------------------------------------------------------SHAVR----AR
Q16976_APLCA/213-469------------------------------------PKFLNVTT----------------ECEGGHSRELGRVMTS-HEA
KVS4_CAEEL/229-477------------------------------------VATKQ---------------------RNNLTGEEFTEMEP-MPI
KCNG2_CHICK/216-464--------------------------------------------------------------------EEEDRGECSQKC
G1R5R7_NOMLE/226-471------------------------------------E------------------------------EEEQGHCSQMCHN
KCNAL_DROME/184-417------------------------------------RP---------------------------GRAGTLPCGERYKIV
P91784_POLPE/201-427--------------------------------------------------------------------ANRPCGEVYNKI
KCNV1_RAT/212-442----------------------------------------------------------------------WLNL----QL
KCNS3_HUMAN/184-417---------------------------------------------------------------------QNEDGEVDDPV
KCNS1_MOUSE/188-439------------------------------------AREAAA-------------------AVAAVAAGRSAEEVRDDPV
KCNS2_MOUSE/186-421---------------------------------------------------------------------DSQGNPGEDPR
A0A0D9S9T6_CHLSB/181-417------------------------------------V------------------------------LDAEGNRVE-HPT
KCNAB_DROME/434-670-------------------------------------------------------------------HIDNGTPQD-NPQ
Q26344_APLSP/314-551-------------------------------------------------------------------DRADPSLNQDNED
KCNAG_CAEEL/203-453------------------------------------LPVLIGQNI-------------TMPGGVVQPSIERVSTEP-LPI
O76457_APLCA/173-421------------------------------------VPVLKNATS-------------RTVNGTYTWRLEKKETEP-HEA
KCNAW_DROME/173-424------------------------------------VPIVRNITV--------------KTANGSNGWFLDKTQTNAHIA
KCNSK_CAEEL/274-519------------------------------------EEKPIN-------------------NSATAELLDEMDEKH-YSP
O76266_HIRME/209-446------------------------------------K-----------------------------SHCVADEAPNFLDP
Q26094_POLPE/173-409------------------------------------PKELL----------------------TNNGTIYKTVYSEHATW
Q26095_POLPE/181-410--------------------------------------------------------------------PDKPEGSHMRVT
KCNA6_RAT/230-470---------------------------------------------------------------------STLGGSFFTDP
Q25376_DOROP/169-415------------------------------------RYEL-----------------------LNDTIIVDDAMPKFGTP
KCNA1_HUMAN/166-419------------------------------------DDKDFTG-----------------TVHRIDNTTVIYNSNIFTDP
KCNAS_DROME/226-489------------------------------------HYKVFN-------------------TTTNGTKIEEDEVPDITDP

PF07885

W5K2Z9_ASTMX/448-526--------------------------------------------------------------------------------
O45894_CAEEL/291-370--------------------------------------------------------------------------------
Q8IG65_CAEEL/164-235--------------------------------------------------------------------------------
YUGO_BACSU/22-99--------------------------------------------------------------------------------
Q8IKI3_PLAF7/284-373--------------------------------------------------------------------------------
Q21094_CAEEL/108-184--------------------------------------------------------------------------------
Q21094_CAEEL/246-329--------------------------------------------------------------------------------
Q22042_CAEEL/196-277--------------------------------------------------------------------------------
Q22042_CAEEL/336-411--------------------------------------------------------------------------------
Q92XJ4_RHIME/49-134--------------------------------------------------------------------------------
TWK9_CAEEL/141-217--------------------------------------------------------------------------------
TWK9_CAEEL/321-397--------------------------------------------------------------------------------
UNC58_CAEEL/260-344--------------------------------------------------------------------------------
KCNK2_HUMAN/233-313--------------------------------------------------------------------------------
O28600_ARCFU/13-88--------------------------------------------------------------------------------
O29543_ARCFU/11-91--------------------------------------------------------------------------------
YDJJ_BACSU/70-156--------------------------------------------------------------------------------
O45891_CAEEL/89-166--------------------------------------------------------------------------------
O45891_CAEEL/231-305--------------------------------------------------------------------------------
O53346_MYCTU/46-130--------------------------------------------------------------------------------
O54192_STRCO/97-179--------------------------------------------------------------------------------
E9AC73_LEIMA/284-359--------------------------------------------------------------------------------
O66650_AQUAE/33-110--------------------------------------------------------------------------------
O76788_CAEEL/150-235--------------------------------------------------------------------------------
O86498_STRCO/99-182--------------------------------------------------------------------------------
P73132_SYNY3/31-106--------------------------------------------------------------------------------
TWK18_CAEEL/92-170--------------------------------------------------------------------------------
TWK18_CAEEL/232-307--------------------------------------------------------------------------------
Q19525_CAEEL/88-163--------------------------------------------------------------------------------
TWK12_CAEEL/92-168--------------------------------------------------------------------------------
TWK12_CAEEL/248-324--------------------------------------------------------------------------------
Q21529_CAEEL/110-189--------------------------------------------------------------------------------
Q23297_CAEEL/158-233--------------------------------------------------------------------------------
Q23297_CAEEL/322-397--------------------------------------------------------------------------------
Q55509_SYNY3/13-88--------------------------------------------------------------------------------
Q814N2_BACCR/16-91--------------------------------------------------------------------------------
Q81I81_BACCR/43-132--------------------------------------------------------------------------------
A0A6H3AGI5_BACAN/22-99--------------------------------------------------------------------------------
A0A6L7HBD1_BACAN/29-104--------------------------------------------------------------------------------
Q82GY7_STRAW/111-194--------------------------------------------------------------------------------
Q87FU6_VIBPA/136-225--------------------------------------------------------------------------------
Q87QT5_VIBPA/25-105--------------------------------------------------------------------------------
Q886B6_PSESM/51-136--------------------------------------------------------------------------------
Q89PL5_BRADU/59-133--------------------------------------------------------------------------------
Q8A4M7_BACTN/145-224--------------------------------------------------------------------------------
Q8BUW1_MOUSE/240-321--------------------------------------------------------------------------------
Q8CV55_OCEIH/53-143--------------------------------------------------------------------------------
Q8DJ50_THEEB/18-93--------------------------------------------------------------------------------
Q8E842_SHEON/30-105--------------------------------------------------------------------------------
Q8ELF1_OCEIH/22-99--------------------------------------------------------------------------------
Q8ENY9_OCEIH/22-99--------------------------------------------------------------------------------
Q8FRG9_COREF/43-123--------------------------------------------------------------------------------
Q8HZT2_BOVIN/94-171--------------------------------------------------------------------------------
Q8I4G4_CAEEL/424-508--------------------------------------------------------------------------------
Q8KG47_CHLTE/19-94--------------------------------------------------------------------------------
KCO2_ORYSJ/70-152--------------------------------------------------------------------------------
Q8NSA2_CORGL/24-104--------------------------------------------------------------------------------
Q8TN45_METAC/34-111--------------------------------------------------------------------------------
Q8TNR4_METAC/28-103--------------------------------------------------------------------------------
Q8TQJ3_METAC/29-108--------------------------------------------------------------------------------
Q8TQL3_METAC/32-111--------------------------------------------------------------------------------
Q8TXQ4_METKA/19-94--------------------------------------------------------------------------------
Q8U058_PYRFU/403-481--------------------------------------------------------------------------------
Q8WMG4_PIG/210-290--------------------------------------------------------------------------------
Q8YXX7_NOSS1/5-80--------------------------------------------------------------------------------
KCNK2_RAT/120-198--------------------------------------------------------------------------------
Q92ZS8_RHIME/63-137--------------------------------------------------------------------------------
Q93732_CAEEL/112-187--------------------------------------------------------------------------------
Q93732_CAEEL/216-292--------------------------------------------------------------------------------
Q9A7V3_CAUVC/24-99--------------------------------------------------------------------------------
Q9BJ49_LEIMA/261-340--------------------------------------------------------------------------------
Q9CH27_LACLA/24-98--------------------------------------------------------------------------------
Q9HP16_HALSA/160-242--------------------------------------------------------------------------------
Q9HPA3_HALSA/494-584--------------------------------------------------------------------------------
Q9I5I7_PSEAE/12-98--------------------------------------------------------------------------------
Q9JK62_MOUSE/63-139--------------------------------------------------------------------------------
Q9K7M1_BACHD/23-100--------------------------------------------------------------------------------
Q9KBF6_BACHD/24-100--------------------------------------------------------------------------------
Q9KEA6_BACHD/47-136--------------------------------------------------------------------------------
Q9PPR6_UREPA/224-315--------------------------------------------------------------------------------
Q9RRZ3_DEIRA/10-85--------------------------------------------------------------------------------
Q9VE68_DROME/115-197--------------------------------------------------------------------------------
Q9X0E7_THEMA/41-116--------------------------------------------------------------------------------
Q9XA52_STRCO/42-126--------------------------------------------------------------------------------
Q9XX01_CAEEL/207-283--------------------------------------------------------------------------------
Q9XX01_CAEEL/347-423--------------------------------------------------------------------------------
Q9XXF6_CAEEL/162-241--------------------------------------------------------------------------------
Q9XXF6_CAEEL/312-388--------------------------------------------------------------------------------
G3GXR2_CRIGR/72-153--------------------------------------------------------------------------------
G3V8R8_RAT/180-259--------------------------------------------------------------------------------
M1B592_SOLTU/194-267--------------------------------------------------------------------------------
M1B592_SOLTU/73-153--------------------------------------------------------------------------------
M1C0Y6_SOLTU/84-157--------------------------------------------------------------------------------
KCNK4_MOUSE/181-259--------------------------------------------------------------------------------
KCH_ECOLI/149-221--------------------------------------------------------------------------------
Q7RZF3_NEUCR/370-446--------------------------------------------------------------------------------

PF01007

H2TFE7_TAKRU/11-151---------------------------------------------------------------------RIDNVE-GMVK
F6SPD2_XENTR/38-178---------------------------------------------------------------------KIDKVE-GVFL
F7FJC1_MONDO/46-187---------------------------------------------------------------------EFANMD-DKSQ
U3II41_ANAPP/30-170---------------------------------------------------------------------QHGNLG-GESS
H2MFJ0_ORYLA/31-168---------------------------------------------------------------------TFRHIP-EEWL
H2T950_TAKRU/46-187---------------------------------------------------------------------HFSNMD-EKSW
H2Q537_PANTR/43-185---------------------------------------------------------------------EFGNVEAQSRF
B4KG98_DROMO/102-248---------------------------------------------------------------------VFRRIP-EKSW
H2ZYX1_LATCH/30-171---------------------------------------------------------------------KLDHVD-GLVL
W5M8R3_LEPOC/3-142---------------------------------------------------------------------NLRHIA-EPG-
T1EE13_HELRO/114-252---------------------------------------------------------------------NRANIK-KRRQ
H3B1J1_LATCH/31-172---------------------------------------------------------------------RMDHIA-DKSF
H3BAR9_LATCH/36-174---------------------------------------------------------------------AHKNIR-EQG-
U3JLS4_FICAL/37-181---------------------------------------------------------------------AHKNIR-EQG-
H3A9C1_LATCH/46-186---------------------------------------------------------------------YFANLS-NKSQ
Q1L8I6_DANRE/24-166---------------------------------------------------------------------EFDNVMHRNRF
W4YAR4_STRPU/79-219---------------------------------------------------------------------VHTRVA---RL
M3XYC0_MUSPF