Sequence alignment for CL0298

PF02403

SYSM_SCHPO/49-157ILNYKYIYQ----NAEAVQRNCINRNLQAIAETVPKIRSLIDEKESLKNEFFPLLSLKKEITLQIERCSDPN------ER
SYS_SYNE7/1-112MLDLRLLRE----NPEATQARLDRR---HSSYDIQPLLSLDQQVRQWEQERTQLQARSNEIGRSVGQKMREGADPQSEEI
SYSC_MOUSE/2-113VLDLDLFRVDKGGDPALIRETQEKRF--KDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKK------EA
SYSC_SCHPO/1-112MLDINLFQVEKGGNPEIIRESQRKRG--ADVGVVDKVIEMYKEWVSLRFELDNTNKSINRVQKEIGLKMKAK-----EDA
SYS_CORGL/1-106MIDLKFLRD----NPDVVRASQITRG--EDPALVDELISADESRREAIKAADDLRAEQKAFGKKIGQASPED-------R
SYS_BORBU/1-106MLDLKFIRD----NLDLVKRSIKARG---LVLDIDKLIYLDDKRKKLITKIGELNAKRNENSSKMQENLDK------VLK
SYS_XANCP/1-108MLDPALLRQ----HPADLAERLRSTR--GFDLNTAELESLESERKRIQVRTQELQSLRNSKSKAIGQAKAKG-----EDV
SYS_AQUAE/1-109MIDINLIRE----KPDYVKERLATRD-KELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREG-----KDT
SYS_CALS4/1-107MLDIKFIRS----NPDVVRRAIELKG---EKADLDRLLLLDEKRREMLVELEALKNKRNTESDNIARLKREG-----KDA
SYS_FUSNN/1-107MLELKFMRE----NVEMLKEMLKNRN---SNVDMDAFVELDSKRREVLSEVENLKRERNNASAEIANLKKEK-----KNA
SYS_TREPA/1-106MLDYRFIRE----NVDAVKENVKVRN---VHADVDAIVHLYDQRVKLLAELQELQRARNENAQTMKSSLDAL------AR
SYS_CHLTR/1-107MLDIRLIRK----EPKECESRLQ-KK--DPAISLERLLDLDKTVRQLKADSEALLAKRKVLSGQIHKAKVAN-----ENA
SYS_ENCCU/1-115MIDINLIRDP--KTREKVVESEKKRF-R-DGLAVGKAYELDRKRIEMNFRLDQINTRINQLNREIKSGYRQGKNKEDGDL
SYSC_YEAST/1-112MLDINQFIEDKGGNPELIRQSQKARN--ASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQKDIGLKFKNK-----EDA
SYS_AGRFC/1-109MHDIKWIRE----NPEAFDAALARR---SVEPAAAGLIALDEKRRSVIQSLQDMQSRRNAASKEIGAAMAQKN---MELA
SYS_CLOPE/1-110MLDLKKLRS----NTEEVKKALSNRGEDFDVNVIDEVIALDEERRKILVDVEALKKQRNEVSAEIPKRKKAG-----EDV
SYS_BACSU/1-108MLDTKMLRA----NFQEIKAKLVHKG--EDLTDFDKFEALDDRRRELIGKVEELKGKRNEVSQQVAVLKREK-----KDA
SYS_RALSO/1-107MLDIQLLRK----DIDAVAARLN-DR--GYELDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGMLKGKG-----EDA
SYS_COXBU/1-107MLDPKILRQ----NLEHVVEKLR-RR--GFEMDSDTFLQLENKRKEAQLAIQSFQTKRNQLSKTIGMAKSKG-----ENP
SYS_LISMO/1-108MLDVKLLRN----NFDEVKQKLQNRG--EDLGEFEKFGELDKRRRTLIVETEALKSQRNEVSQEIAKLKREK-----QDA
SYS_HAEIN/1-108MIDPNLLRN----NLAEVAEKLKVKR--NFMLDTEKLTALEDQRKNLQVTTENLQAERNARSKAIGAAKARG-----EDI
SYS_NOSS1/1-112MLDIKQIRE----NPQLIQERLNSR---NGTYDIQPILQLDKQQRELEATRSQIQARSNEIGKIVGQKIKSGINPQDPEI
SYS_HALMA/1-110MLSRQFVRE----HPETVRDAIERK--GVTGVDLDEILDIDEEWRELKAEGDGLRQERNEVSSKIGELKQDGK---DEEA
SYS_HELPY/1-109MIDRKLLLQ----DFDKVALSLKKRN-NAMDDELERLREVITHYKKRLIELEGLQAFQNKVSKEFGIKMAQK-----VDT
SYS_BUCAI/1-107MLNPYLLRN----ELHLTAKKL-LKK--GYKLNISKISSMEEKRKTLQIQTENLQFKHNALSNLFKENKNIK-----NKN
SYS_PASMU/1-108MIDPNLLRN----NLEEVAEKLKVKR--NFVLDVALLSELEEQRKSLQVKTESLQAERNARSKNIGQAKARG-----EDI
SYS_RHIME/1-109MLDIKWIRE----NADALDEALAKR---GAEPLSASLIALDERRRAVLQSLQDMQSRRNAASKEIGAAMAQKN---SELA
SYS_BUCBP/1-107MLNPNLLRN----HIEFVFKNL-ARR--GFSLDVKQFTEMEKKRKILQTKVEELQSRHNTLSKHIGRIKLIH-----PNI
SYS_SYNY3/1-114MLDLKQIRE----NPTAIQNRLNQRG-GGASYDLEPILAIAAEQKAKESERTVLQSRSNEIGKLIGQKIGQGADPKGEEI
SYS_MYCPN/1-104MLDRNKLRN----NLDFFKKKLVERG--VSESQFEAYVQADKAMRKLLHQIELANQKQTLLAQQVAKKKGDP------K-
SYS1_CLOAB/1-110MLDLKRIRT----NPEEIKKALTNRGEDFDISVIDELVSLDEERRKNLVEVENLKSKRNKDSGEIAKLKKSG-----QNA
SYS2_CLOAB/1-108MLDLDLIRN----DTEKVKKALLKK---IDNVDFTELLKLDDERRKLIHEVEVLKNKKNEASKQISNIKSQG----GKVD
SYSC_CAEEL/2-114VLDIDMFRTEKGGNPEIIRKSQQDRF--KDPKLVDEVIELDEKWRKERFVADQLNRQKNAISKAIGEKMKKKE---PQGT
SYSC_ARATH/1-112MLDINLFREEKGNNPEIIRESQRRRF--ASVEIVDEIIKLDKEWRQRQFEVDSFRKEFNKLNKQVAQLKIKK-----EDA
SYS_MYCPU/1-107MLDLKKILN----NPDYYRNILLNKK--ANISLFDELVKIGKKRGELMQKSQSLKAKINELSKSFIKLKTN------EEK
SYS_VIBPA/1-109MLDSKLLRT----ELDETAAKL-ARR--GFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQKMAAGD---KEGA
SYS_PSESM/1-107MLDSKLLRT----QLQDVADRL-ASR--GFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQAKQRG-----EDI
SYS_CAUVC/1-109MHDIKAIRE----NPKAYDRHWSGK---GRSGAADEAVRLDAELRAAQTTLQEAQAKRNESSKLIGMAKAKKD---EAEA
SYS2_LACPL/1-108MLDVKMIRQ----NPDFVKEQLGHRG--VAASDIDDLLAADEKRRELIAKSEQLKSTRNQVSGEISQKKRNK-----EDA
SYS_MYCLE/1-106MIDLQLLRE----DPDVVRRSQLSRG--EDPALVDALLTADTARRAAISAADSLRAEQKATSKSLGAASAED-------R
SYS1_LACPL/1-108MLNPKFVRN----NPELVKTKLQTRK--VDPAEVDEYLQLDQQNRDAITKVEGLKKQKNQLTEQIGQSDPQS-----EAG
SYS_LACLA/1-108MLDIKKIRA----DFDGVAAKLATRG--VEKEKLEKLHDLDIKRRELIVKSEALKAERNSVSDEISQVKRAK-----GDA
SYS_CLOTE/1-110MLDLKRIRS----NPEEIKKALAGRGEDFDVSVIDKVLQLDEERRNILVEVESLKNKRKQESAKIPQFKKEG-----KNV
SYS_BRADU/1-109MHDIKSIRD----NPQAFDAGLARR---GLKPLSASLLAIDERRRAAILASEQAQARRNAASKEIGDAKKAKD---EARA
SYSC_CANAL/1-112MLDINAFLVEKGGDPEIIKASQKKRG--DSVELVDEIIAEYKEWVKLRFDLDEHNKKLNSVQKEIGKRFKAK-----EDA
Q89ZR4_BACTN/1-112MLTIKQITE----NTEAVLRGLEKKHFKNAKETIDEVIALNDKRRTTQNLLDKNLAEVNSLSRTIGQLMKEGK---KEEA
SYS_THEAC/1-108MIDVKLLRS----NRELFEKNCEYRG--VDKAPVEDFFRLDEEWRSINRELNGLRSQKNRETRKIAELIK-NN---GDAS
SYS_HALSA/1-109MLSRQFVRE----HPEKVRDALDAK--GVD-ADLDRILEVDEEWRELKARGDELRHDRNEVSSKIGELKQAGD---EDAA
SYS_WIGBR/1-107MIDHKLIIK----NIEEVCKKLILRN---FYLDKKKILLQDQKRKILQIEVEKLQNKRNLQSKIISKIKINN-----KNI
SYS_BACHD/1-108MLDIKRLRK----DFAGIREKLQTRG--EDISGLEKFGSLDEKRRQVIVKVEELKSRRNQVSQEVAQLKREK-----KDA
SYS_THEEB/1-112MIDLKQLRE----NPQAFGDRLRRR---GGDFDLDRILELDAQQRQLEQQRSQLQARSNEIGALVGKKIKSGIAPTDPEI
SYS_STRMU/1-108MLDIKRIRN----DFDQIAEKLARRG--VDEKTLHDLKELDFKRRQLLIKSEEAKAERNTASAAIAQAKRNQ-----EDA
SYS_CAMJE/1-104MLDLKNLQN----NFDEVAKKLKNKK--VDENILKKLAELFASLKKEKIALEEFQAFQNKFSKELATAE---------DK
SYS_STRA5/1-108MLDLKRIRT----DFDVVAKKLATRG--VDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIAQAKRNK-----ENA
SYS_SHEON/1-107MLDPKFLRN----ELAVTAERL-ATR--GFILDVAHLTQLEEKRKSLQVATEELQASRNAISKSIGQAKARG-----EDV
SYS_UREPA/1-109MFDINLIRK----DIATTKEKMLNKK--VPSNLFDQIFDLDVLVRSLMQQEQNLNAKKNQLSKEIGILAKNK----DPKL
SYS_OCEIH/1-108MLDMKYLRQ----NFEEVQQRLQHRG--EDLADLDKFGELDTNRRQLIAETEKLKAQRNEATKKISELKREK-----KDA
SYS_DEIRA/1-105MLDLKFIRE----NPDAVREAIRVK--NVA-LDLDDLLQRDRDLVALKQRVEAMQTERNANAKLVPKAS-------PEDR
SYS_MYCPE/1-109MINKSIIRN----DFKTLETSLKNRN---SKLDISSLKDLDKKQSELLLIIESCNKKRNEISKSIGIYIGKKD---NKKV
SYS_LEPIN/1-109MLDLRYITE----NTEDLKKVLELRG-FKEIGIIDELKSIIQRKREFQKEADILREERNKASKEVGKIKQSG-----GDI
Q9VQL1_DROME/2-115VLDLDLFRSDKGGNPDLVRENQKKRF--KDVALVETVIAKDTEWRQCRHRADNLNKVKNVCSKVIGEKMKKKE---PVGA
SYS_BIFLO/1-106MLDIQFIRE----HTDIVKESQRKRG--ESVELVDEVLSSDTARREALKAFEEARAQQKEIGKKVASAPAD-------EK
SYS_THEMA/1-110MIDIKLIRQ----NPDFVKEALRKRG--EDPAIIDEILKIDADWRATITKTNELRSRRNEISKNVARLKKEGK---NAEA
SYS_STRCO/1-106MIDLRLLRE----DPDRVRASQRARG--EDVALVDSLLSADERRRSSGVRFDELRAEQKGLGKLIGKAAGDE-------K
Q8IBS3_PLAF7/2-115VLDINLFRKEKGGNPDKIKESERKRY--HDENNVDKVIEYDDKWRKCIFELEELKKNINMINKEIGNKKKVDK---NADV
SYS_CHLTE/1-111MLDITYIRQ----NPDDVKEMLRRRQQQGDAPKVDRLLERDAERKAMVQRTDDLKALRNRVSKEIANIKRTG----QGSA
B6TBG7_MAIZE/74-177-IDFKWIRD----NRDAVADNIRTR---NSTANLDLVFELYDQYLTLQKEVERLRAERNAVANKMKGKLDPS------VR
C5ACG9_BURGB/1-106MLDIQLLRK----DLDGVAKRLADR---GYILDVAAFSSLEAERRAIQTRTEELQARRNSLSKQIGAMKGRG-----EDT
C5WTV8_SORBI/1-114MLDINLFRADKGGNPDLIRESQRSRF--ASVELVDEVIALDMAWRGKQFDLDKIRQELNATSKKIGKLKASKQ---EEEA
F4IAJ4_ARATH/79-182-IDFKWIRD----NKEAVEINIRNR---NSNANLEAVLQLYENMVNLQKEVERLREERNNVAKKMKGKLEP------SER
SYS_STAA8/1-107MLDIRLFRN----EPDTVKSKIELRG--DDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNK-----ENA
SYS_MYCTU/1-105MIDLKLLRE----NPDAVRRSQLSRG--EDPALVDALLTADAARRAVISTADSLRAEQKAASKSVGGASP-------EER
SYS_BRUA2/1-109MLDIKWIRE----NPETLDKALAKRG---AAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGKAMAAKD---MGTA
SYS_SHIDS/1-107MLDPNLLRN----EPDAVAEKLARR---GFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQAKARG-----EDI
SYS_NEIG1/1-109MLDIQLLRS----NTAAVAERLARR---GYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGALKGQGK---HEEA
SYS_THET8/1-102MVDLKRLRQ----EPEVFHRAIREKG---VALDLEALLALDQEVQELKKRLQEVQTERNQVAKRVPKAPP-------EEK
SYS_STRR6/1-108MLDIKRIRT----DFEAVAEKLATRG--VDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIAQAKRNK-----ENT
SYS_XYLFA/1-108MLDPTLLRQ----QLAKLAECLSTVR--GFTLDVAALEALESERKRIQVHTQELQSLRNSKSKAIGQARSKG-----EDV

PF10458

SYV_OCEIH/818-883--------------------------------------DFDKEIKRLENELAKWTKEVERVQKKLSNQGFVS-----KAP
A3DC83_HUNT2/816-881--------------------------------------DIEKEIERLEKELSNLQKELDRVNSKLANEGFVS-----KAP
Q2KY84_BORA1/893-958--------------------------------------DVAAERVRLDKEIARLEGEIAKANGKLNNPSFVE-----RAP
Q28LL8_JANSC/961-1026--------------------------------------DVDEEKARLEKTLGKLAKELGGLRGRLNNPKFAE-----SAP
SYV_PROMT/868-933--------------------------------------DIASLRSRLEKDLNKAQKEIESLSGRLANKNFVD-----KAP
Q39X26_GEOMG/819-884--------------------------------------DVEEEEKRLLKEIGKLDKDIEFLAKKLANPSFVE-----RAP
Q587B4_TRYB2/907-972--------------------------------------DVQKEVAKLEKQLAGLQKQIEGVNKKISMPGYET-----KVP
A0A132Z880_ENTFC/813-878--------------------------------------NIEEEIKRLEKELEKWTSEVKRVQGKLSNERFVS-----NAP
SYV_DEIRA/848-913--------------------------------------DIADWVKKQQKRLAELDKQIKQAQGKLNNEGFVA-----RAP
Q2RTE9_RHORT/814-879--------------------------------------DLDRERARLGKELLRLDGEVARIDKKLSNPAFMA-----KAP
A4J7L1_DESRM/814-879--------------------------------------DLDKEIARLNKELKTIQGDLARVQGKLNNQGFLA-----KAP
SYV_NITMU/860-925--------------------------------------DIAAERERLTKELDRVQTEMEKAQTKLANSNFVD-----RAP
Q2RL27_MOOTA/814-879--------------------------------------DLEKEQARLEKELQKARAELEKVEKKLARPDFRA-----KAP
A5D455_PELTS/817-882--------------------------------------DVEKEIARLQKELAVTEKELARVRGKLANPGFLA-----KAP
SYV_CARHZ/810-872--------------------------------------DLEKEKERLNKELKKVLAEIERLNQKLNNPGFLA-----KAP
A5UPL6_ROSS1/836-900--------------------------------------DLEAERARLLKDLEAALAEAARREARLATPGFVE-----KAP
B1WSM7_CROS5/844-909--------------------------------------DIASLRAKLEKNLGKVEAEIKSLSGRLNNPGFVN-----KAP
SYV_THET8/797-862--------------------------------------DVEEWRRRQEKRLKELLALAERSQRKLASPGFRE-----KAP
SYV_PROMM/864-929--------------------------------------DLDALRGRLEKDLAKAEKEIAGLAGRLANPNFAI-----KAP
SYV_BACCR/815-879--------------------------------------NLDEERARLEKELEKFDKEVERVQKKLSNQGFVA-----KAP
SYV_LEPIN/816-881--------------------------------------DVAKEKTRLEKELQKSELEKEKLEIKLSNPGFLS-----KAA

PF02912

D3F0H4_CONWI/20-88-------------------------------ATTDA-----LEHARVRWL-GR-KAELPNMLRGVAQLPP-------EQR
D5QGH9_KOMHA/20-88-------------------------------PDLRA-----WDEVRVATM-GK-SGRLTGLLKELGRMSP-------EER
R6HCE9_9FIRM/20-88-------------------------------TSPAA-----LEELRVKLL-GK-KGELTAVLKQMGKLSP-------EER
D3FWH7_ALKPO/20-88-------------------------------QDVKA-----LQEVRVAYL-GK-KGPITEVLRGMGKLSA-------EER
B3SFN1_TRIAD/20-86-------------------------------EN--E-----LNDIRVKFL-GK-NGIVTSEAKKIALVSK-------DEK
A5EXT2_DICNV/25-93-------------------------------NDLVA-----LEGVKNTYM-AK-KGIFAGYMQTLNALPA-------TER
B2HR20_MYCMM/28-96-------------------------------DDLEA-----LARAKTEHL-GD-RSPLALARQSLGTLPK-------EQR
R5HWY3_9FIRM/20-88-------------------------------DGLER-----LNEVRQAVL-GK-KGELTAVLKGMKDVAP-------EDR
R5B0T6_9BACT/18-86-------------------------------ATLDE-----VEELRIKYI-SK-KGEVQALVDEFRGLSP-------EEK
B7AT72_9FIRM/21-89-------------------------------DSLER-----LNEIKVGLL-GK-KGELTEVLKGMKDVAP-------EER
SYFA_CORGL/21-89-------------------------------QNLDE-----LAALRRDHL-GD-AAPIPQARRSLGTIPK-------DQR
SYFA_AQUAE/19-87-------------------------------SSLKE-----LQEVRSKFL-GS-KGVIKELLKKIKEVPS-------EER
SYFA_WOLSU/12-80-------------------------------QSSAE-----LEELRIKAL-GK-KGILTAQFALLKNLDE-------EEK
R6NQ38_9FIRM/20-88-------------------------------GELGK-----LNDVRVAFL-GK-KGELTAVLKGMKDVAP-------EDR
R6X2S6_9CLOT/20-88-------------------------------QDIKT-----LEEAKVKYL-GK-KGELTAILRGMGALST-------EER
C5ZZ75_9HELI/12-80-------------------------------KNTTE-----LEEIRISVM-GK-KGSLTAKFAALKNCDE-------AQK
SYFA_CORDI/32-100-------------------------------SNLDE-----LNIARRDHL-GD-AAPIPQARRSLGTLPK-------DQR
G2TKP8_BACCO/20-88-------------------------------ADLKT-----LNEIRVAYL-GK-KGPITEVLRGMGKLSA-------EER
D2PM91_KRIFD/36-104-------------------------------PDLAA-----LQEAKVAHL-GE-RSPIALANREIGALPP-------QGR
E6U0I2_BACCJ/20-88-------------------------------TTIKE-----LKDLRVSYL-GK-KGPITEVLKGMGKLSA-------DER
C7N307_SLAHD/22-90-------------------------------ADTAA-----LDQVRIGVL-GK-KGTLTSYLRSMGQVAK-------EER
R6AP89_9FIRM/31-99-------------------------------GDEKA-----LQDAKVFFL-GK-KGKLTAILRSMKDLSA-------AER
D3QAE4_STANL/38-106-------------------------------GDADT-----LASIKHLHL-GD-KAPISLARREIGSLPP-------AAK
SYFA_PELPD/20-88-------------------------------STGEA-----LQNIRIKYL-GR-KGAMTALMKGLGALSA-------EER
R6CNS1_9FIRM/20-88-------------------------------ADLKS-----LDDIRVRFL-GK-KGEITAILKQMGKLSP-------EER
SYFA_PROMM/29-97-------------------------------ADADA-----LEQLRVSLL-GK-KGRLSGVLGAMGKLPS-------EER
SYFA_GEOKA/20-88-------------------------------RDLKA-----LNDVRVAYL-GK-KGPITEVLRGMGALPP-------EER
D2RJL9_ACIFV/20-88-------------------------------KSVED-----LKNIRVQYL-GK-KGALTSILRSLGDVAA-------EER
G2KW84_LACSM/22-90-------------------------------TDVKS-----LNEIRVQLL-GK-KGPITQALRGISKLPV-------EER
SYFA_PSEPK/19-87-------------------------------EDINA-----LEQIRVNYL-GK-KGELTQVMKTLGNLPA-------EER
SYFA_LACBA/22-90-------------------------------TDLKD-----VNQVRVSLL-GK-KGPITEVLRGMRDLDA-------EER
SYFA_RUTMC/19-87-------------------------------QDLQD-----LEDLRTNVL-GK-KGELTTLLKGLGKLSK-------EQR
K4KFC7_SIMAS/19-87-------------------------------QDLQA-----LDYVRVEYL-GK-KGKITELLKGLGKLSA-------EER
H5WKC4_9BURK/19-87-------------------------------PTAAE-----LENAKARFL-GK-AGRVTELLKGLGALPV-------EEK
R6MN70_9FIRM/20-88-------------------------------GDSNE-----LESLRVRFL-GK-KGELTAVLKTMGKLSA-------EER
C6XKF6_HIRBI/23-91-------------------------------TNEAA-----LEELRVAEL-GK-KGRVSLMMRELGKMSP-------EER
A7IGN3_XANP2/31-99-------------------------------EDEAG-----LEEVRIAAL-GK-KGSVSELLKSLGTMSP-------DQR
B1WVT1_CROS5/33-101-------------------------------DSLEA-----LEQLRINYL-GK-KGKLSQILRGMGKLSA-------EER
E1VUN8_GLUAR/40-108-------------------------------GDLNE-----LKEARLSHT-GE-KSALSLANRQIGKLDK-------SEK
M5DSW2_9GAMM/19-87-------------------------------QDVAA-----LDQVRVQYL-GK-KGEITSLMKNLGNVAP-------EDR
F2NPL4_MARHT/13-81-------------------------------EDLEA-----LQALRVRYL-GK-KGRLTQELKALGQLPP-------EER
D3EQU2_ATETH/27-95-------------------------------ISLKD-----LEQLRIFYL-GK-KGKLSQILRGMSKLDS-------SKR
E6SIV5_THEM7/50-118-------------------------------ADLAE-----LERLRVEWL-GK-KGRISLLLRQMGSVPP-------DLR
SYFA_STRR6/25-93-------------------------------GNEKE-----MQDLRVSVL-GK-KGSLTEILKGMKDVSA-------EMR
D7BE71_MEISD/14-82-------------------------------PSLEA-----LHTLKVQYL-GK-NGLVTQEMKTLGKLSP-------EER
SYFA_DEIGD/13-81-------------------------------PDLPA-----LQAVKTRYL-GK-SGLVTRELGALGKLPP-------EER
I5AR65_EUBCE/24-92-------------------------------STPDA-----LNEIRVNVL-GK-KGELKELMKSMKDVAP-------EDR
R5Y6B3_9FIRM/20-88-------------------------------DTKEQ-----IEEARIKYL-GK-KGELTSILKQMGKLSA-------EER
SYFA_GEOSL/20-88-------------------------------ASEDA-----LQELRVRYL-GK-KGELTAVMKGLGSLSP-------EER
SYFA_CHRVO/19-87-------------------------------ADLIE-----LEQVKARFL-GK-SGELTELLKQLGKLAP-------EER
L0DY04_THIND/19-87-------------------------------EGLAD-----LDALRVRYL-GK-KGALTALLKELGRLPA-------EER
SYFA_CHESB/19-87-------------------------------GDEQT-----VEAVRVAAL-GK-KGTVSEKLKTLGSMSP-------EER
F6B409_DESCC/20-88-------------------------------NTPDE-----LNVIRVKYL-GK-KGEVTQVLRGMGALPA-------EER
SYFA_LACLA/22-90-------------------------------ADEKT-----LNNLRTVML-GK-KGELTEILKGMKDLTN-------EER
SYFA_ECOLI/19-87-------------------------------SDVAA-----LDNVRVEYL-GK-KGHLTLQMTTLRELPP-------EER
S5TIM3_9CORY/29-97-------------------------------PSLAE-----LQEARREHL-GD-SAFIPRARQAIGTLPK-------TER
W6AA06_9MOLU/21-89-------------------------------SSRGD-----IEELKKEFI-GK-NSPLNSILQELRNADA-------QTR
SYFA_LARHH/19-87-------------------------------QDLNE-----LEQVKARYL-GK-TGQITELLKQLGKLPP-------EEK
SYFA_HISS2/21-89-------------------------------KSIES-----LEAIRVEYF-GK-KGHFTQLMQGLRDVSA-------EER
B0N0V6_9FIRM/20-88-------------------------------SSLKE-----LNEIRVLYL-GK-KGPIQEAMKSMKDMAP-------EER
E6U2U6_ETHHY/21-89-------------------------------RESSE-----LEALRVRFL-GK-KGELTAILKQMGKLSA-------EER
E4U4K5_OCEP5/13-81-------------------------------ASLEA-----LQEIKVRFL-GK-KGRLTQAFKAMKGLDP-------EER
G2KS35_MICAA/23-91-------------------------------TDLAA-----LDAARVAAL-GK-NGRITALMKNLGTMTP-------DER
SYFA_THISH/19-87-------------------------------TDTQA-----LDALRVQYL-GK-KGVLTEQLKALGKLPP-------EER
E6WZU0_NITSE/12-80-------------------------------STLEA-----LEKVRIEIF-GK-KGILAAEFAKLKDVPG-------PEK
A8F395_PSELT/17-79-------------------------------TDLQQ-----LEKIRVSLL-GK-KGTITEQMKNIASLPV-------HER
E6VRJ1_PSEA9/27-95-------------------------------CSLKE-----LDELRIEFL-GR-KGKLAQSMGQLGRLDA-------TEK
Q2VYY9_MAGSA/19-87-------------------------------TTLDQ-----LEAARVAAL-GK-KGTITGLMKSLGGMGP-------DER
SYFA_ERYLH/19-87-------------------------------TSLDA-----LEEQRVAAL-GK-KGWVSLALKTLGGMDP-------EER
Q6KHX3_MYCMO/11-79-------------------------------ETLED-----LKIAKSNFL-NN-DLELKQLMNDLKLASK-------EQK
K0J3E3_AMPXN/20-88-------------------------------TSLAD-----LEKVRVAYL-GK-KGPITEVLRGMGKLSP-------EER
E6S8E4_INTC7/36-104-------------------------------ATLDD-----LKATRIAHQ-GE-KSALALANREIGALPP-------SAK
U5LEE3_9BACI/20-88-------------------------------ENLKE-----LNDIRVSYL-GK-KGPITEVLKGMGKLSA-------EER
C7LV64_DESBD/24-92-------------------------------SSLEE-----LEELRVRFL-GR-KGLLADLMSGLTALGP-------EER
D5UZC0_ARCNC/12-80-------------------------------DSIEA-----LENLRIEIL-GK-KGFLTKEFARLKDIPN-------EEK
SYFA_THET8/13-81-------------------------------RDLEE-----LKALKARYL-GK-KGLLTQEMKGLSALPL-------EER
R5TBA8_9FIRM/87-155-------------------------------IDEKE-----LQDTKVAFL-GK-RGKLTSILRGMKDLSE-------SER
R6RV93_9CLOT/20-88-------------------------------SSKQE-----LEALRVKYL-GK-KGELTAILKQMGKLSP-------EER
D4H1G6_DENA2/19-87-------------------------------ATSEE-----LYQIKVKYL-GK-KGLISGLNKQLKDVPN-------EDK
I0KCE2_9BACT/18-86-------------------------------TSKDE-----LEQYRLRYL-SK-KGAVTELFDGLKTAPA-------DER
R5NL52_9FIRM/20-89-------------------------------TNSKA-----VYDFKKSFLDSK-VGQIGQLMKEMRNIAP-------EER
E1VIK1_9GAMM/19-87-------------------------------NNEPD-----LDNVRVQYL-GK-KGEITDQLKALGKLPA-------EER
SYFA_FLAPJ/18-86-------------------------------QNKEK-----LEEFRIKFL-GS-KGLVKDIFAEFKNVPN-------DQK
SYFA_CAMJE/12-80-------------------------------ENLND-----LEAIRISVL-GK-KGILTEGFTKLKELED-------EAK
J9YYI7_9PROT/18-86-------------------------------NSQAD-----IQNLKVSYL-GK-KGKITELLKSLKDLSL-------EEK
R5IR39_9FIRM/20-88-------------------------------KDAGE-----LDALRVRFL-GK-KGELTGVLKTMGKLSA-------EER
K4L6C1_9FIRM/20-88-------------------------------TSSEE-----LQELKVRVM-GK-KGSLTSLLKQMGQLSA-------EER
D6Z8H5_SEGRD/20-88-------------------------------EDLPA-----LAAAKAEHL-GE-RSALALARRSLGSLPP-------EER
K9V4Y0_9CYAN/27-95-------------------------------DSLER-----LEELRLSYL-GK-KGQLSVILGMMGKLPP-------EEK
D7BP30_ARCHD/27-95-------------------------------SSLDE-----LKDARLAHS-GD-NAPITHANMQIKSLDK-------SER
SYFA_RICPR/19-88-------------------------------HNLKD-----LQEYKVEFL-GR-NGIVTSELKKLGSLING------QKR
D5A3B3_ARTPN/27-95-------------------------------ETLSG-----LEQLRINYL-GK-KGQLSKVLGGMGKLEP-------EAR
L0FSK7_ECHVK/19-87-------------------------------SNPEE-----LEAFRMRYI-SK-KSVVAALFAEMKNVPN-------DQK
SYFA_STRA5/24-92-------------------------------NHTKE-----LQDLRVQVL-GK-KGSLTELLKGLKDLSN-------DLR
SYFA_NOVAD/19-87-------------------------------ATPEA-----VEAIRVSAL-GK-QGWVSALLKSLGGMTP-------EQR
B1ZQM9_OPITP/20-88-------------------------------KTRPE-----FEAAKARFV-GP-HGELTALMKQMGTVPK-------EQR
K9RTF0_SYNP3/30-98-------------------------------QALGE-----LEQLRIGYL-GK-KGQLSIILGAMGKLPP-------ADR
Q12BQ9_POLSJ/22-90-------------------------------TTPAD-----LENAKAQFL-GK-SGRVTELMKGMAALSV-------EEK
SYFA_RHOCS/19-87-------------------------------PDLPA-----LEEARVAAL-GK-KGRITAMMGDMRSLTP-------EER
SYFA_EXISA/20-88-------------------------------STQKS-----LNDVRIKYL-GK-KGPMTEVLRGMGKLSA-------EER
E3DR66_HALPG/22-90-------------------------------EDLDQ-----LEDLRIKYL-GK-KGAIQSVFSKMGKIEA-------EQR
Q98QL3_MYCPU/9-78-------------------------------KTLEE-----LKQYKFKIY-GK-DGELAKKQEQIKKAPV-------DQK
SYFA_COXBU/20-88-------------------------------QSEIV-----LEEIRVDYL-GK-KGKLTELLKSVGQMPA-------DQR
SYFA_STRT2/24-92-------------------------------EHSKE-----LQELRVAVL-GK-KGSLTELLKGLKDLPS-------EER
SYFA_HAMD5/19-87-------------------------------QNTEA-----LDLIRVSYF-GK-KGHFSTHMASLSQLSV-------EDR
R6U6G1_9CLOT/20-88-------------------------------HNLVE-----LDKVRVSYL-GK-KGSVTGLLKAMKDLSN-------EER
V4IYP3_9GAMM/24-92-------------------------------ANLAE-----LEQVRIRYL-GK-SGLLTAQLKALGTLPK-------EQR
R6VD34_9FIRM/20-89-------------------------------NASSS-----LEELRRNFL-SK-KGYVSGLMKELGKVPP-------EQK
I7GZ45_9HELI/16-84-------------------------------QTLQE-----VENLRVEIM-GK-KGILTQQFAELKNLPD-------EQK
SYFA_XANCP/19-87-------------------------------HTPDQ-----LETLRVALL-GK-NGSITAQLKQLGTLPA-------DQR
SYFA_METPP/19-87-------------------------------RTPAE-----LEDAKAAFL-GK-SGELTARMKQLASLPV-------DEK
E3PXU7_ACESD/20-88-------------------------------EEMDI-----LENLRVQYM-GK-KGELTNILKEMGKLSA-------EER
V6F5W0_MAGGM/19-87-------------------------------DTIEA-----LETARVAAL-GK-KGSISALMGALGKMDP-------DAR
C8WKG2_EGGLE/39-107-------------------------------ADTAA-----LEQVRIGVL-GK-AGTLTGYLRQMGQIAK-------EER
A7I0N3_CAMHC/33-101-------------------------------QNLAE-----LEAIRLSLF-GK-NGEITELFSKLKSLPN-------NEK
F7YY40_9THEM/17-85-------------------------------DKLSE-----LDRVKALYL-GK-KGIITEQMKNIANLSP-------EER
SYFA_NITEU/25-93-------------------------------ESIVD-----LEQIKAQYL-GK-TGEITILLKGLRELTP-------EER
D2S8R2_GEOOG/36-104-------------------------------GDLEQ-----LAAVRPAHL-GD-RAPVLLARRELGALPP-------AAR
R5UWU8_9FIRM/20-88-------------------------------TDAKQ-----LDAIRVQYL-GK-KGALTAILKQMGKLSA-------EER
SYFA_PHYAS/21-89-------------------------------NSLEN-----LIYLEQKFL-GK-KSFLQELNQTLKNIPS-------EKK
E3CXV9_9BACT/23-91-------------------------------RSLGD-----LEALRLEYL-GK-KGALTGLLRLLGQAAP-------EER
F4LW88_TEPAE/20-88-------------------------------DNIDE-----LNELRVKIL-GK-KGELTQILRDMAKLTP-------EER
B8HPR9_CYAP4/30-98-------------------------------ASLDA-----LEQLRITYL-GK-KGQLSQVLGGMGKLSA-------EDR
F7V6I9_CLOSS/20-88-------------------------------EDLNS-----LNEVRVSVL-GK-KGTLKAVLKGMKDVAP-------EDR
A1SJI4_NOCSJ/36-104-------------------------------GDLTE-----LKQARLEHA-GD-RSPLALANREIGALPP-------QAR
X5ECJ7_9CORY/27-95-------------------------------DDLDS-----LAELRRAHL-GD-DAPVPSARRNLGSLPK-------DQR
D5X0W5_THIK1/19-87-------------------------------TDSAT-----LENAKARYL-GK-TGLITIEMKALAALPT-------EEK
D1A1M3_THECD/36-104-------------------------------GDLEE-----LKKVRLEHA-GD-RSPLALANREIGALPP-------HAR
R6LMC9_9FIRM/20-88-------------------------------DVPEK-----LNDVRVKFL-GK-KGELTAVLKGMKDVAP-------EER
A0A3E2XLR3_9FIRM/20-88-------------------------------GGMDA-----LNDIRVSFL-GK-KGELTAIMKSMRDIPP-------EER
F0S361_DESTD/21-89-------------------------------SSLEE-----LEKLRVEFI-GR-KGKVTELLKSIPTLPP-------EER
I4B6L1_TURPD/23-89-------------------------------ADAEA-----LAQVTQNFT-GK-KGALTGVMKQLGSLTP-------EER
SYFA_AGRFC/19-87-------------------------------ADEPA-----IEAVRVSAL-GK-KGSVSELLKTLGSMTP-------EER
SYFA_AGARV/20-88-------------------------------DGLEK-----LNDVRAAIL-GK-KGELTAVLKGMKDVAP-------DER
E8RRV8_ASTEC/45-113-------------------------------QDLAA-----LDAVRVSAL-GK-TGRVSGLLKTLGALPP-------EER
SYFA_PELTS/20-88-------------------------------CSLEE-----LNEIRIRYL-GK-KGELTRVLRSMGSLSA-------EER
SYFA_MYCLE/22-90-------------------------------VNLDA-----LALIKAEHL-GD-RSPLALARQALASLPK-------IDR
SYFA_GLUOX/20-88-------------------------------QDRAQ-----WDAIRVGTL-GK-SGALTGLLKQLGRLEP-------QER
SYFA_DESVH/22-90-------------------------------SSLQE-----LEEQRIAFL-GR-KGRLAQVMAHLPELAP-------AER
F4F3N9_VERMA/36-104-------------------------------GDPDA-----LAAVRPAHL-GD-RAPVSLARREIGALPP-------AAK
F9ZSL9_ACICS/15-83-------------------------------QDLRA-----LEALRVQYL-GK-KGMLTQAMQALAGLDP-------QAR
S6ATC8_PSERE/19-87-------------------------------EDVNA-----LEQIRVHYL-GK-KGELTQVMKTLGDLPA-------EER
SYFA_CLONN/20-88-------------------------------SNKAE-----LENIRVKYL-GK-KGELTQILRGMGKLSS-------QER
G7UR80_PSEUP/19-87-------------------------------QTPDA-----VEALRVALL-GK-SGQVTAQLKTLGTLPA-------DQR
D7GNY8_9FIRM/20-88-------------------------------ESKEQ-----LGEFWQNFL-GK-KGSIADLMKGLGSVPK-------EER
W8FCV6_9BACT/19-87-------------------------------TSAEQ-----LDQFRIAYT-GR-KGQLADLFDQLKTVPQ-------EDR
D9QKI2_BRESC/19-87-------------------------------TTVAE-----VEAVRVAAL-GK-TGAISGLLKGMGAMSP-------DER
D9SF45_GALCS/31-99-------------------------------SDEAE-----LEQVKAKYL-GR-DGALTALLKGLGKLSN-------EER
F7ZZ47_CELGA/39-107-------------------------------RDLDE-----LKSVRLAHA-GD-RSPLALANRAIGGLAP-------ADK
R5ASX9_9CLOT/22-90-------------------------------KSAEE-----LEQLRVQLL-GK-SGQLTGILRQMGKLAP-------EER
F4H7U9_CELFA/29-97-------------------------------ADLDQ-----LKAARLAHL-GE-TSPVALANRAIGGLAP-------ADK
E4RLI2_HALHG/22-90-------------------------------ADLDQ-----LEELRIKYL-GK-KGAIQSIFSQMGKIAS-------DKR
SYFA_ACAM1/24-92-------------------------------DTLDA-----LETLRVSYL-GK-KGQLSQILKGMGKLDA-------SER
SYFA_HELHP/12-80-------------------------------ENLND-----LERLRVEVM-GK-KGILTQQFALLKNLEG-------ETK
R6G2K4_9FIRM/20-88-------------------------------AGIDK-----LNDVKVAFL-GK-KGQLSSLLKGMKDVAP-------EDR
I2F4U8_9BACT/19-87-------------------------------SDLNE-----LQEEKSRLT-GK-QGLITSLMKKLKEIPP-------EER
D6GSI9_FILAD/20-88-------------------------------KDVNL-----LEQVRVQFL-GK-KQELASLLKEMGKLSP-------EER
SYFA_MESFL/20-88-------------------------------KTIEE-----AEKLKKSLL-GK-ESELSEILKSLKDSDT-------NDK
R7LG46_9BACT/19-87-------------------------------SDAQG-----LEELRIKYL-SK-KGVVNDLMNEFRNVPA-------DQK
SYFA_HELMI/20-88-------------------------------DTMEA-----LQDWRVRIL-GK-KGVLTGILRGLGALPA-------EER
R4U488_9MOLU/20-88-------------------------------TSLEQ-----LNNLQVEYL-GK-KSVLNEFLKGMKDLPH-------EER
SYFA_MYCMS/20-88-------------------------------KDLNS-----WEELKKEFI-GK-DSSLTTILKSIKTISS-------DKK
SYFA_ACISJ/19-87-------------------------------ATPAE-----LENAKAQFL-GK-SGRLTELMKGMAQLSP-------EEK
G8PDN9_PEDCP/22-90-------------------------------GDLSK-----LNDIRVNLL-GK-KGPLTEVLRGMRDLSK-------EDR
K9UIS3_CHAP6/23-91-------------------------------QTLEA-----LEQLRVDYL-GK-KGEISKILGGMGKLSA-------EER
R6TA42_9FIRM/20-88-------------------------------RTAVD-----LEAVRVRYL-GK-KGELTAVLKQMGKLSP-------EER
R6NNV6_9FIRM/20-88-------------------------------NSLDK-----LNEVRVAFL-GK-KGELTAVLKGMKDVAP-------EDR
SYFA_HERAR/19-87-------------------------------DDAAA-----LENAKAKYL-GK-TGQITEQMKSLGKLAP-------DER
SYFA_AZOSB/19-87-------------------------------SDSAQ-----LEQAKARYL-GK-SGALTEQLKGLGKLPP-------EEK
S5XVV2_PARAH/19-87-------------------------------SDAPA-----LEEVRLAAL-GK-KGEISGKMKELGKMSP-------EER
A5IXK6_MYCAP/11-79-------------------------------KSFEE-----YKQAKNLVF-GA-GSEIEELKAKIKNSSP-------EER
Q01SP8_SOLUE/21-89-------------------------------QTPEE-----LEAVRVDAI-GR-KGALAEISKGMGKLAP-------EER
B9KHH4_ANAMF/26-95-------------------------------SSVEE-----LDEVRGRYI-GR-GGALTALLRQISTIQDM------NER
E1X2F2_HALMS/20-88-------------------------------TNQAD-----ILNLKSEFI-GK-KGLISEVLKSLKDATP-------EQR
R6MS00_9FIRM/20-88-------------------------------TDIDA-----LEEARIKFL-GK-KGELTAVLKGMGQLSK-------EER
X4ZW87_9BACL/20-88-------------------------------QDPQT-----LNDLRVKYL-GK-KGELTEVLRGMGSLSA-------EER
R6DM83_9FIRM/20-88-------------------------------KDASE-----LETLRVNFL-GK-SGHVTALLKGMGKLSP-------DEK
SYFA_GLUDA/20-88-------------------------------TDRRE-----WDAVRVGTL-GK-SGRLTALLKELGRMTP-------EAR
E8MZH5_ANATU/22-90-------------------------------NDSAS-----LEAWRVAYL-GR-NAPVMQVFSRLGQAPK-------ELR
SYFA_STAEQ/22-90-------------------------------NDAQA-----LQEVKVKYL-GK-KGSVSALMKNMKDLPN-------EEK
D2UDK3_XANAP/19-87-------------------------------QSPEA-----LEQLRVALL-GK-SGSITAQLKQLGGLAP-------EQR
T0VHA3_9ENTE/22-90-------------------------------RSINE-----LNQIRVDVL-GK-KGPITEVLRGMKELSA-------EER
A0A388SC18_9BURK/19-87-------------------------------TQPAA-----LEDAKAKFL-GK-SGTLTTMMKGLRDLAA-------DQR
H1XPD0_9BACT/20-89-------------------------------KSPAD-----LEPIRVKFL-GR-KGLVSTSFERISELPK-------EQR
A8HWM7_AZOC5/27-95-------------------------------SGEAE-----LEQVRVYAL-GK-KGSVSELLKSLGTMSP-------DER
SYFA_AERHH/19-87-------------------------------SDIAA-----LDEIRVKYL-GK-KGFFTEQMKGLGALSA-------EER
SYFA_TOLAT/19-87-------------------------------TDNNA-----LEALRVEYF-GK-KGVFTEQMKALAGLSP-------EER
R6IN57_9CLOT/20-88-------------------------------DSAEQ-----LEKARIQYL-GK-KGELTAILKQMGKLSA-------EER
R7KRG6_9FIRM/20-88-------------------------------GDLKV-----MEELRVKFL-GK-KGELTAILKQMGGLSA-------EER
SYFA_HUNT2/20-88-------------------------------GTIAE-----LENIRVKYL-GK-KGELTAVLRGMGSLSP-------EER
G0VPM6_MEGEL/21-89-------------------------------EHLQD-----VQDIRVKFL-GK-KGELTAIMKEMKNFSK-------EER
A5GUT5_SYNR3/29-97-------------------------------PDAAA-----LEQLRIDLL-GK-KGKLSGVLGAMGKLPG-------DQR
C7M0T2_ACIFD/36-104-------------------------------ADRDE-----LAAIREAAL-GP-QSPLAVLSRSIRNLDP-------EER
K9P790_CYAGP/29-97-------------------------------EDAAA-----LEELRVGLL-GK-KGRLSGVLGAMGRLPG-------DER
R6B6R7_9BACT/19-87-------------------------------QNAEE-----VEQLRLKYL-SK-KGSINALMADFRTVPA-------DQK
SYFA_CELJU/19-87-------------------------------GDLNA-----LEAVRVDYL-GK-KGHITALMKNLGGLSP-------EER
Q189P4_CLOD6/20-88-------------------------------QSIES-----VESLRVKYL-GK-KGEITAILKEMGKLSA-------EER
D9QUN5_ACEAZ/20-88-------------------------------ADLEE-----LEELRIKYL-GK-NGEVTEILQNIGDLPP-------EQR
F2JID4_CELLD/20-88-------------------------------NSLAV-----LEELRVQYL-GK-KGELTAVLRNMKDLSN-------EER
R7IV52_9CLOT/20-88-------------------------------KNSQD-----LQELKVQFL-GK-KSELSNLLKGLGALTA-------EER
R6P7N0_9CLOT/20-88-------------------------------ENIKE-----LNEIKVKYL-GK-KGELTVVLRGMGALSP-------EER
I4CA98_DESTA/20-88-------------------------------KDQRI-----LSEIRTRLL-GR-KGELTSILRSLKDLAP-------DER
R7GMW7_9FIRM/19-87-------------------------------ADAKE-----LNDLRVFYL-GK-KGPIQAAMKSMKTMAP-------EER
G2SPC6_LACRR/22-90-------------------------------DNSQK-----INEIRVNLL-GK-KGPITEVLRGMRDLSA-------EER
SYFA_ACIF2/20-88-------------------------------SDLNT-----LEQIRLRWL-GR-KGVLTEAMQQLGQLSP-------ETR
A9WQ67_RENSM/39-107-------------------------------SDLEQ-----LKEARLAHT-GE-KSPLSLANRGIKDIAK-------ELK
SYFA_GEOLS/20-88-------------------------------TTEEM-----LNEVRVRYL-GR-KGELTGLMKGLGSLPA-------DER
K0CI96_ALCDB/20-88-------------------------------GDARV-----LDEVRVRYL-GK-KGEISALLKSLGGLGP-------EER
SYFA_GEOUR/20-88-------------------------------STEDG-----LQELRVKYL-GK-KGELTAVMKGLGALSP-------EER
A1SUQ5_PSYIN/31-99-------------------------------ADGNE-----LEQIRLQYL-GK-KGLMTEQMKGLGKLPP-------AEK
D5WS18_KYRT2/20-88-------------------------------EDSNQ-----LEAWRLRFL-GK-KGQLTAVLRGMAKLSE-------DER
D9T5W1_MICAI/36-104-------------------------------TDPDA-----LTALRPAHL-GD-RSPVSLARREIGALPP-------AAK
C6WX39_METML/19-87-------------------------------ASMND-----LEIAKAKYL-GK-SGSLTDALKSLGKLSA-------EER
R6TDN0_9FIRM/20-87-------------------------------ESASE-----LETLKIEYL-GK-KGRVAALMSDLKNVAA-------DRK
R7GHP6_9CLOT/22-90-------------------------------KNKIE-----LTNEKANVL-GK-KGPFAQIMANMRNLTV-------EER
R7N4V7_9FIRM/25-94-------------------------------KNSKE-----LYEFKNVYLEGK-KSKISELMKDMGKLAP-------EER
C0Z9E7_BREBN/20-88-------------------------------TEAAQ-----LQDLRVKYL-GK-KGELTELLRGMGSLSP-------EER
D7GEE1_PROFC/31-99-------------------------------KDSAQ-----LKQARAAHA-AD-KSPLALANRRIGSMPK-------DQR
F2I081_PELSM/19-87-------------------------------ESKES-----LEKLKIEIL-GK-KGTLSKLFQDLATIDK-------EKK
F3YW55_DESAF/27-95-------------------------------SSLQD-----LESARVEYL-GR-KGRLAQAMSAMAGLSP-------QER
SYFA_IDILO/18-86-------------------------------DSPTA-----LDEVRVEYM-GK-KGQLTELLKGLGKLDP-------SER
D0LY94_HALO1/25-93-------------------------------SSEQE-----IRAFQAQFM-GK-KGEISQLMKQMGKVPA-------ADR
R5B562_9CLOT/20-88-------------------------------REEKE-----LEELNSSVL-GR-SGSLTGILRTMGQLDK-------EQR
A0A086ZFH0_9BIFI/27-95-------------------------------SSSEE-----LKAIKTQYA-GA-ESAMTQASKAIGSLPA-------DQK
C7Q9J1_CATAD/36-104-------------------------------ASLDA-----LHQVKIAVA-GD-RAPLALANREIGALPP-------AAR
SYFA_FRATT/19-87-------------------------------KDKKT-----LDDIRVKYL-GK-KGELTEMMKLIATLPN-------DEK
SYFA_ZYMMO/19-87-------------------------------GDLAG-----LESVRVHAL-GK-QGVVTALLKSLGKMTP-------EER
M4R8Y3_BIBTR/19-87-------------------------------NDIAA-----IEALRVEYF-GK-KGHFTALMQGLRDVPA-------DER
SYFA_LACJO/22-90-------------------------------ENQKM-----LDKIRVELM-GR-KGELTEILHSMKDIAP-------ENR
SYFA_BACSU/20-88-------------------------------SSLKV-----VNDIRVQYL-GK-KGPITEVLRGMGKLSA-------EER
B0JLL0_MICAN/27-95-------------------------------TTLED-----LEQLRVNYL-GK-KGELSQILREMGKLTP-------EER
D5X800_THEPJ/20-88-------------------------------ATMDE-----VNEIRIKYL-GK-KGLLTGILRGMGSLSP-------DER
SYFA_LACPL/22-90-------------------------------DVLKK-----VNQVKVDLL-GK-KGPITEVLRGMRDLSP-------EER
K0K6A5_SACES/36-104-------------------------------VDLDE-----LAAAKPGHL-GD-RAPVLLARREIGALPP-------AAK
D7CNG9_SYNLT/20-88-------------------------------SSLNE-----VKEVRVRFL-GR-KGEITQVLRGIKDLPE-------AER
R7MJD6_9FIRM/20-88-------------------------------GEIKE-----LEALKIKYL-GK-KGELTAILKQMGKLSA-------EER
B8D293_HALOH/22-90-------------------------------KDLDH-----LEQLRVKYL-GK-KGEITSVLRQMGKIPA-------EER
F3YAD3_MELPT/22-90-------------------------------QSLTK-----LNQIRVEIL-GK-KGPITEILRGMKNLSA-------KER
SYFA_PASMU/19-87-------------------------------EDGKA-----LDAIRVEYF-GK-KGPFTALMQGLRDVSP-------EAR
D5CSM8_SIDLE/19-87-------------------------------EDATE-----LENAKARYL-GK-EGSLTGLLKGLGKLSA-------EER
W0ELN7_9BACT/18-86-------------------------------SKSED-----LEAIRIKYL-SK-KGEISQLFNDFRSVAA-------DQK
H0UKB5_9BACT/28-91-----------------------------------------LQDIKVRFF-GK-KGDMTQLQKLLGKMTP-------QER
L0F475_DESDL/20-88-------------------------------ATLEE-----LQELKVKVL-GK-KGSLTAQLRKMGGLSA-------EER
R6DZH5_9BACT/19-87-------------------------------QNAEE-----LEQLRLKYL-SK-KGEINALMADFRNVPA-------EQK
F7XVN5_MIDMI/19-87-------------------------------SNFTE-----LFNLKAKFL-GK-KSLLVEQMAKLGALTP-------EEK
H5WWU4_9PSEU/36-104-------------------------------TDLDE-----LAAAKPAHL-GD-NSPLLLARRAIGSLPK-------DGK
F7XXQ9_MOREP/19-87-------------------------------QDLDA-----LEHVRVEYF-GK-KGIFTQKMKMLQDLAP-------SER
SYFA_OCHA4/19-87-------------------------------ADEPA-----IEAVRVAAL-GK-KGSVSEKLKTLGSMTP-------EER
R7EK62_9FIRM/20-86-------------------------------D--AD-----LEALRVRYL-GK-KGELTAVLRGMAGLSP-------DER
G4QLB8_GLANF/18-86-------------------------------KTPAE-----LDAVRVAYM-GK-KGKITDLMKGLGKLSN-------EER
SYFA_METS4/19-87-------------------------------ADEAA-----LEGVRVAAL-GK-KGAVSELLKTLGSLSP-------EER
R5RYR4_9FIRM/20-88-------------------------------EKAED-----LEALRVQYL-GK-KGELTAVLKQMGKLSA-------EER
E3GNL2_9FIRM/20-88-------------------------------SDMKS-----LDDIRVKYL-GK-KGVLTAALKEMGKLSK-------DER
T2GAK0_DESGG/37-105-------------------------------ALADA-----LEAVRVEFL-GR-KGRLAGLMAKLGTADP-------ADR
D1AVE8_STRM9/20-88-------------------------------DSMQD-----FNDMKVRYL-GK-KGEFTAIMKEMGNIVA-------EKR
R4KE67_CLOPA/20-88-------------------------------VKKEE-----LEKLRVKYL-GK-KGELTQILRGMGALSK-------EER
Q0AAL9_ALKEH/24-92-------------------------------ENPTA-----LDAVRVAYL-GK-KGRLTEALKGLGKLPA-------EER
D3DJY1_HYDTT/20-88-------------------------------KSLQK-----LLEVKAKYI-GK-EGIITQALKAIREVPQ-------ERR
SYFA_XYLFA/21-89-------------------------------QNLDH-----LEVLRVALL-GK-NGSITLQLKQLGKLPV-------EQR
SYFA_SYMTH/20-89-------------------------------ADVGA-----IQEMRVRYL-GK-KSELSQVLGGLGRLPTV------EER
SYFA_CLOPE/22-90-------------------------------KDSTT-----IDTIRVKYL-GK-KGELTTILRGMGSLSK-------EER
R5R6S6_9FIRM/20-88-------------------------------RTLEQ-----LNEVRVSQL-GK-KGALTEILKGMKDVAP-------EDR
S6B2P5_SULDS/19-87-------------------------------DNPAE-----LEQAKARYL-GK-SGVLTEQLKQLGKMPP-------EER
F8C4E3_THEGP/21-89-------------------------------EDFSQ-----LENFRIKYL-GK-KGKITSFLKLLKELPL-------EEK
F2NFL0_DESAR/21-88-------------------------------GSAPA-----LDQIRVKYL-GR-KGIITQALRSLGGLPV-------EVR
D5EXW8_PRER2/19-87-------------------------------KNAEE-----VEQLRLKYL-SK-KGEITALMNDFREVAA-------DQK
R6E265_9FIRM/31-99-------------------------------DTIQD-----AEDVRIKVL-GK-KGELTEMLKSMGKMDP-------EER
R6QQ94_9CLOT/20-88-------------------------------DAPEK-----LNDVKVRFL-GK-KGELTAVLKGMKDVAA-------EDR
R6R5N3_9FIRM/20-88-------------------------------DNLDK-----LNEIRVAYL-GK-KGELTEVLKGMKDVAA-------DER
R7XSC5_9ACTN/36-104-------------------------------ADLDE-----LKQVRLDHA-GD-RSPIALANREIGALPP-------QAR
F2LY11_HIPMA/16-84-------------------------------ENQEQ-----LKQLKAQFL-GK-KGKITAFFKQLKGLSE-------EEK
A7HPL0_PARL1/20-88-------------------------------VDSDT-----LEAVRVAAL-GK-KGRVSDLMKGLGSMSP-------DER
R6QXL8_9FIRM/20-88-------------------------------DAMDT-----LNDIRIAVL-GK-KGELTQVLKGMKNVAK-------EER
Q4A6A0_MYCS5/9-77-------------------------------NNLED-----LKKLKAKLN-AA-DSEMSLLKEEIKKVSY-------EQK
D1C4D6_SPHTD/20-88-------------------------------CDSQA-----LAAWYAQYL-GR-KGEVTSLTRRLGALPP-------EER
R6BMJ6_9FIRM/20-88-------------------------------NRLDK-----LNEVRVSFL-GK-KGELTAVLKGMKNVDP-------KER
SYFA_ACIAC/19-87-------------------------------ATPTD-----LENAKAQFL-GK-AGRVTELLKGLAQLPV-------EEK
SYFA_ALCBS/19-87-------------------------------GDIRA-----LDDVRVKYL-GK-KGEISALMKGLGKLSA-------EER
M4SHK9_9SPHN/19-87-------------------------------DSLEA-----IEAVRVTAL-GK-ASEIAALMKTLGGMSP-------EER
A1WU57_HALHL/24-92-------------------------------SDLAG-----LDQVRVAYL-GK-KGKLTALLKGLGQLPA-------DQR
R5YQL5_9FIRM/20-88-------------------------------ENLDK-----LNEIRVAYL-GK-KGQLTEVLKGMKDVAP-------EDR
G2J1F0_PSEUL/35-103-------------------------------QDLVE-----LEQVKARYL-GK-SGELTELLKQLGKLPG-------DER
SYFA_SORC5/25-93-------------------------------GDLDE-----LNRLYASLL-GR-RGSLNALMKQLPGAAP-------EER
L0RXE4_MYCC1/8-76-------------------------------NTLED-----LKKAKAKVY-GK-EGEIAKLQNELKLASS-------EQK
SYFA_DESDA/22-90-------------------------------SSLEG-----LEALRVDFL-GR-KGRIAQIMSRLPSLAP-------EQR
D3IE04_9BACT/19-87-------------------------------NNAEE-----IEQLRIKYL-SK-KGEISLLMNDFRDVPA-------ELK
SYFA_MYCPA/28-96-------------------------------GDLDA-----LARLKTEHL-GD-RAPLALARQALGGVPK-------DQR
L0H1M4_9GAMM/23-91-------------------------------VDLTT-----LDQVRVRYL-GK-SGRLTALLKGLGKLPP-------ESR
K7RLS0_ACIA4/36-104-------------------------------SSTAE-----LKQVRIAHT-GD-RSPLALANREIGALPP-------AAR
U5RSK4_9CLOT/23-86-----------------------------------------IEDIRVKYL-GK-KGELTKILRGMKDLSK-------EER
R7GEQ5_9CLOT/20-88-------------------------------KDLKQ-----LQDLKVKYL-GK-KGELTQVLRTMGTLAE-------EER
SYFA_METRJ/19-87-------------------------------SDEAA-----LDAVRVAAL-GK-KGSVSDLLKTLGSMTP-------EER
E1VCP7_HALED/19-87-------------------------------ESMAA-----LDELRVRYL-GK-KGEITALLKGLGQLPA-------EER
B1VH38_CORU7/34-102-------------------------------TNLEE-----LAEARRAHL-GD-DAPIPAARRSLGSLPK-------DQR
A4SX37_POLAQ/19-87-------------------------------ADSAA-----LEDAKAKYL-GK-SGVLTERLKALGGMSP-------EER
SYFA_METSB/19-87-------------------------------ADESA-----LEAVRVASL-GK-KGSISALLSGLGKMSP-------DER
B2UP39_AKKM8/20-88-------------------------------SDRRG-----VEDARVAIL-GK-KGELTLAQTGMKDVPR-------EEK
SYFA_SPHWW/16-84-------------------------------ATLAD-----LEAIRVRTL-GK-SGTITALLKTLGAMTP-------DQR
SYFA_BUCAI/19-87-------------------------------KKISE-----LDKIRIKYL-GK-KGVLTAFMKKLKDFSY-------EDK
SYFA_AZOPC/18-86-------------------------------NNSKE-----LETLRIRFL-GK-KGEIASLMSGFRNVEA-------NQK
L0EXG1_LIBCB/19-87-------------------------------NNEDE-----LDAVRVAAF-GK-NGSFNILLKQLKELDL-------DTM
C8W0F2_DESAS/20-88-------------------------------ENLGQ-----LNDIRVRVL-GK-KGSLTQVLRGMGSLSA-------DER
D3RRM3_ALLVD/24-92-------------------------------ADAAA-----LDQVRVHYL-GK-SGELTALLKQLGTLPP-------AER
SYFA_HELPY/12-80-------------------------------TNSKE-----LEEARLNAL-GK-KGVFADKFNQLKHLNG-------EEK
A8LE36_FRASN/36-105-------------------------------DDLAA-----LSAVRTAHVDGQ-QAPLMLARRELGALPR-------EHR
Q31LH5_SYNE7/27-95-------------------------------SDREA-----LEQLRIAFL-GK-KGELSAILGAMGKLDA-------SDR
E0TF60_PARBH/21-89-------------------------------PDEAA-----LEAVRVAAL-GK-KGAVSDRLKTLGKMTP-------DER
U3GUI6_9CORY/29-97-------------------------------DNLEE-----LSEARRAHL-GD-DAFIPTARKTLGSLPK-------EQR
SYFA_DEHM1/22-88-------------------------------TELKD-----LEAWRVRYL-GK-KSLLTGALRNLASLPI-------EER
R7H7C7_9FIRM/20-88-------------------------------KDARE-----LDAVRVKYL-GK-KGAITGILKQMGKLSA-------EER
C4Z1H7_EUBE2/32-100-------------------------------DSLDK-----LNDIRVAFL-GK-KGELTEVLKGMKEVAP-------EDR
Q1LT08_BAUCH/19-87-------------------------------NDLKT-----LELTRIKFL-GK-KGYFNQQVLYLRHQTP-------DKQ
SYFA_PELUB/19-87-------------------------------LDLNQ-----VNQIKTELF-GK-TGLISSQFKQLGKLAE-------EER
R6F3S1_9FIRM/20-88-------------------------------TSLQE-----AEETRIKVL-GK-KGALTEILRSMGGLAP-------EER
J9W5T8_LACBU/22-90-------------------------------NDLKA-----LNEIRVHLL-GK-KGPITAALRGIKELTP-------EER
W0BIG8_9GAMM/19-87-------------------------------QEISQ-----LEAIRVDFL-GK-KGRLTEILKGLAHLPA-------ADK
R6WVX3_9BACT/19-87-------------------------------KSAEE-----VEQLRLKYL-SK-KGAITALMAEFRDVPA-------DQK
A0A418Q7Q3_9CORY/32-100-------------------------------QDLDD-----LAAARRDHL-GD-DAPIPAARRSLGSLPK-------DQR
F8E9V3_FLESM/19-87-------------------------------DSLER-----LYAVKVKYM-GK-KGQISSLNKQMKSVPA-------EQR
SYFA_LACRD/22-90-------------------------------EDLKR-----INEIRVKML-GK-KGPITSVLRGMRDLSA-------EER
R5E803_9CLOT/20-88-------------------------------KDLDS-----LNDIKVAVL-GK-KGELTAVLKSMKDVPA-------EER
SYFA_LEGPH/24-92-------------------------------TDIVA-----LEQIRVDFL-GK-KGKLTELLKGLANLSA-------EEK
D9RXS8_THEOJ/20-88-------------------------------GNLEE-----LNDLKIKFL-GK-KGKLTVILRGMADLKP-------EER
C8XIG1_NAKMY/48-116-------------------------------ADLDA-----LKTVRLAHA-GD-RSPLALTNRALADLPK-------TER
Q03G90_PEDPA/29-97-------------------------------NELSK-----LNEVRVNFL-GK-KGPITEVLRGMRDLSK-------EER
SYFA_CLOAB/20-88-------------------------------VDKKN-----IEEIRVKYL-GK-KGELTQILRGMGALSS-------EER
A4CII5_ROBBH/18-86-------------------------------DTPEA-----IEAFRIKYL-GK-KGLLTAFFAELKNVPA-------SEK
K9YL41_CYASC/24-92-------------------------------DNLKK-----LEELRVAYL-GK-KGELSLILKGMGKLAP-------EMR
R5SN45_9CLOT/20-88-------------------------------EQLEH-----LNDVKVAFL-GK-KGELTSVLKSMKDVAP-------EDR
SYFA_CHLT3/18-86-------------------------------TDKDS-----AEAFRLKFL-VR-KGSIPQLFEQMKTVSK-------EDK
E6K031_PARDN/27-95-------------------------------TNLDE-----LKAVRGQYA-GG-DSVLAKSSKAIGSLPT-------DQK
SYFA_RUEST/16-84-------------------------------TDENA-----LEAVRLAAV-GK-KGEVALKMRELGKMTP-------EER
X2HAV3_9NEIS/19-87-------------------------------IDLPA-----LELVKASYL-GK-TGELNALLKTLGKMSP-------EER
SYFA_ACIAD/22-90-------------------------------QDLAA-----LDQVRVLFT-GK-KSQLAEQSKALGKMDP-------EQR
SYFA_CLOK5/25-88-----------------------------------------IESIRIKYL-GK-KGELTHILRGMKELSK-------EER
R5Z7J1_9FIRM/19-87-------------------------------QNSKD-----LNDLRVYYL-GK-KGPVQSLMKNMKDLPK-------EEK
SYFA_DESAG/22-90-------------------------------SSLEM-----LEELRIDFL-GR-KGRLAQIMGRLPELAP-------EER
SYFA_ACTSZ/21-89-------------------------------KGIEA-----LENFRVEYF-GK-KGHFTQLMQGLRDVLP-------EER
G8TWH4_SULAD/18-86-------------------------------HDLRQ-----LDAVRHQWV-GR-KGWLTEQMKALSQLPP-------EER
R6XTB5_9CLOT/20-88-------------------------------KTLQE-----LENVRVKYL-GK-KGELTAVLKGMKDLSP-------EER
J7QS32_METSZ/19-87-------------------------------ADEAA-----LEAVRLAAL-GK-KGAISALLATLGKMSP-------EER
F5XS48_MICPN/36-104-------------------------------TSLAE-----LKAARLAHA-GD-KSPIALANREIGSLPP-------QAR
H2FW09_OCESG/19-87-------------------------------ATAAE-----LDEIRVRYM-GK-KGTFTEQSKALGKLSA-------EER
R5YBL9_9BACE/18-86-------------------------------TKAEE-----LENLRIKYL-SK-KGEVSQLFNDFRNVAA-------ENK
I1YF39_METFJ/26-94-------------------------------DDLRA-----LDAIRVDYL-GK-KGQITAYLKALGDVGP-------EQR
F6IJP6_9SPHN/18-86-------------------------------SDLDT-----LEALRVEFL-GK-QGSISGLLKTLGKMSP-------DER
R5YC76_9FIRM/20-88-------------------------------DGLAK-----LNDVRVSIL-GK-KGELTAVLKGMKDVAP-------EDR
W0HTN2_9GAMM/19-87-------------------------------QDMDA-----LELVRVEYL-GK-KGHFTQQMQALRDLAP-------DAR
F0RKC4_DEIPM/13-81-------------------------------QDLDT-----LQQVKTRYV-GK-KGLVTQELGALGKLPP-------EER
SYFA_GLOVI/20-88-------------------------------ADLTI-----LERIRVDFL-GK-KGKLSALLGGMARLPA-------EER
F5Z2P0_MYCSD/31-99-------------------------------ADLDA-----LAHAKTEHL-GD-KAPLALARQALAKLDK-------ADR
SYFA_SULDN/12-80-------------------------------QSVEK-----IEEIRISLF-GK-KGVLAAEFARMKEASD-------EEK
C4LID3_CORK4/26-94-------------------------------TTLDD-----LVQARKEHL-GD-SAPIPLARRSLGSLPK-------SER
R7DDA6_9BACT/18-86-------------------------------SKADE-----IEALRIKYL-SK-KGEISLLFNDFRNVAA-------ENK
F8HZ92_WEIKK/23-91-------------------------------KNAQD-----LQNARVNWL-GK-KGSLTNILRGMKDLTP-------EER
SYFA_LEPIN/22-90-------------------------------ISEED-----LDKNKNDFI-GK-KGKLTAVLKNVASLSI-------EEK
F8GLG0_NITSI/19-87-------------------------------EDPIE-----LENVKARYL-GK-SGILTELLKGLGKLPV-------EER
R6FA66_9FIRM/26-94-------------------------------ENTKG-----VYEYKKTIL-DK-NGIIGGLMKQMGSVPK-------EEK
S6CG63_9GAMM/20-88-------------------------------ADLRA-----LDEVRVRYL-GK-SGVFTGQLKQLGKLPK-------EER
J7L2J3_NOCAA/36-104-------------------------------ADLAE-----LKEVRLAHA-SD-RSPLALANREIGALPP-------AAK
SYFA_BURPS/18-86-------------------------------ADITT-----LENEKARFL-GK-SGALTELLKGLGKLDP-------ETR
SYFA_ALKOO/20-88-------------------------------DSTAV-----LEQARVHYL-GK-KGELTEILRGMGALSA-------EER
R7JLX9_9FIRM/26-95-------------------------------KSSKE-----LYEFKSEYLEGK-KSKISGLMKEMKNIAP-------EER
C5J6V7_MYCCR/13-81-------------------------------NNLED-----LKLAKNSFF-GK-NSYLAELQNKIKSANQ-------EEK
A5FVF5_ACICJ/37-105-------------------------------GDPAA-----LDAVRIALL-GK-TGQVTALLKTLGSLTP-------DER
F8J8M0_HYPSM/41-109-------------------------------ADLAT-----LDAVRVSSL-GK-KGRVSELMSKLGSLPP-------DER
V5SCH8_9RHIZ/22-90-------------------------------RDLAG-----IEAVRVAAL-GK-KGRIAAQMAKLGGLPP-------EER
A9WDN0_CHLAA/23-91-------------------------------ADLSA-----LTEWKSRFI-GK-QGRLSRLSRGLGALPA-------SER
D1CFI1_THET1/22-88-------------------------------SDERS-----LENWRVTFL-AR-RGRLADIISRIPSLPV-------EER
R6CQE1_9CLOT/20-88-------------------------------QDLKD-----LDAVRVKYL-GK-KGELTAILKQMGKLSA-------EER
U5QL78_9CYAN/20-88-------------------------------ADLNV-----LERIRVDFL-GK-KGRLSAILGGMGRLST-------EER
B4U9B8_HYDS0/20-88-------------------------------SSLQD-----LEKLKSKYL-GK-TGVVKELSKAIKDIPP-------EER
Q2JNE8_SYNJB/27-95-------------------------------DGLEA-----LEQIRIDYL-GK-KGKLSKILGGMGKLPP-------EER
G4RBQ6_PELHB/43-111-------------------------------QDEAA-----LEAVRVSAL-GK-KGSISALLATLGKMTP-------EER
SYFA_BLOFL/21-89-------------------------------NTIQD-----VESIRIQFL-GK-HGYINQQLKKINSLNW-------DNK
R6AEK6_9PROT/19-87-------------------------------ATPAA-----LEDAKAVYL-GK-NGSLTALLKGMAKLSI-------EEK
R6HX36_9FIRM/15-88-------------------------------KSSEAGKVSELEELRIEFL-GK-KGHIANLMSELRALPN-------DQK
SYFA_LACSS/22-90-------------------------------VDLDA-----LNQIRVEVL-GK-KGPITEVLRGMRDLSN-------EER
R5AT24_9FIRM/20-88-------------------------------DDITA-----LENLRVKYL-GK-KGELTAILKQMGRLSA-------EER
I4BW85_ACEMN/23-92-------------------------------ENIEA-----LNELRVRYL-GR-RGTVTQMLKSLGTLPE-------DER
R5MLL8_9FIRM/20-88-------------------------------RDATE-----LENFRVQVL-GK-KGELTGILKQMGSLSA-------EER
R6N5W0_9CLOT/20-88-------------------------------KLPQE-----IDELRVRFL-GK-KGELTGILKQMGKLSP-------EER
SYFA_LACAC/22-90-------------------------------TDEKT-----LNEVRVELV-GR-KGELTKILHSMRDVAP-------ENR
SYFA_METFK/19-87-------------------------------ASIAD-----LEQAKARYL-GK-SGSLTEALKGLGKLSA-------EER
K0C0P2_CYCSP/20-88-------------------------------SSLSV-----VEEIRVTYL-GK-KGVFTRQMKTLGKLSA-------EER
SYFA_DICTD/20-88-------------------------------QNLTE-----LEEVKRVYL-GK-QGFLTQILRSIGKMPQ-------EER
R5CK85_9BACT/19-87-------------------------------STPEE-----IEALRLKYL-SK-KGEINTLMADFRNVPA-------EQK
Q2GLQ9_ANAPZ/20-89-------------------------------SSREE-----LDEVRVKYL-GK-SGLLTALLKQISKIEDL------EER
G8QHY1_AZOOP/19-87-------------------------------QDPDA-----LEQIKARYL-GK-SGQITELLKGLGKLAP-------EER
R7IM63_9FIRM/20-88-------------------------------EDLDK-----LNEVKVAVL-GK-KGALTEVLKGMKDVAA-------EER
F9YU16_CAPCC/18-86-------------------------------TTKEE-----IEQFRIQYL-GK-KGILNDFFAAFKQVPN-------EEK
H8L6D3_FRAAD/19-87-------------------------------DSLDA-----LEGLRVSLL-GK-SGVVTQALKALGGLAP-------DER
C7N020_SACVD/36-104-------------------------------ADLDA-----LAAVKPAHF-GD-QAPLSLARRAIGALPK-------EQK
G4L7X2_TETHN/22-90-------------------------------SDLDS-----LNDIRVKTL-GK-KGPITEVLRGMKDLTP-------EDR
K9SR28_9SYNE/27-95-------------------------------ETAEQ-----LEQVKVEFL-GK-KGVLPQLLGGMGKLSP-------EER
R7JWN9_9CLOT/20-88-------------------------------DKLDK-----LNEIKVSFL-GK-KGELTSILKSMKDVAP-------EDR
E2S9J5_9ACTN/36-104-------------------------------GTLAE-----LKQVRIDHA-GD-RSPLALANREIGALPP-------QAR
SYFA_SHEON/19-87-------------------------------SDLKA-----LDDIRVDYL-GK-KGKITDMMKMMGSLSP-------EEK
R5ZWN0_9BACT/19-87-------------------------------ADEKA-----LEELRIKYL-SK-KGVINGLMGEFRDVAP-------ESK
SYFA_MAGMM/22-90-------------------------------ENLKD-----LEDVRIRFM-GK-KGSITQQYGLMKTCPP-------EDK
R5DV22_9FIRM/21-89-------------------------------DSLEK-----LNEVRVSIL-GK-KGELTEVLKGMKDVEP-------KDR
I0AJJ2_IGNAJ/21-88-------------------------------DSFKK-----LEEIRIKYL-AR-NGSVTLLFDKLKEASK-------EEK
B7K1Q7_RIPO1/27-95-------------------------------PNLEE-----LEQLRINYL-GK-KGQLSQILRGMGKLSA-------EER
K9THI8_9CYAN/27-95-------------------------------TTLDE-----LEQLRVNYL-GK-KGQLSQILRGMGKLEA-------ADR
K9VZG7_9CYAN/27-95-------------------------------DTLEQ-----LEQLRVGYL-GK-KGQLSQILRGMGQLAA-------EDR
SYFA_BACCR/20-88-------------------------------KELKG-----LNDVRVAYL-GK-KGPITEVLRGMGKLSA-------EER
SYFA_BIFLO/27-95-------------------------------SNLEE-----LKAIKTTYA-GA-DSAMTKASKAIGSLPA-------DQK
SYFA_BACHD/20-88-------------------------------QEKKV-----VQEIRVKYL-GK-KGPVTEVLRGMGKLSP-------EER
E3EFH5_PAEPS/20-88-------------------------------ATPKE-----LADLRVKYS-GK-KGALTEILRGMGKLSA-------EER
R6Q2L8_9BACT/19-87-------------------------------KNAEE-----VEQLRIKYL-SK-KGEINALMADFRTVAA-------DQK
SYFA_SYNY3/24-92-------------------------------DDLDG-----LDKLRVQYL-GK-KGELSLILKGMGKLSA-------EER
F4B166_DOKS4/18-85-------------------------------ETLEE-----VEAFRIKYS-GK-KGLVNDFMADFRNVPN-------EMK
E3H642_ILYPC/20-88-------------------------------ASLKE-----LDELRVGIL-GK-KGELTEIMKGMRELSK-------EER
SYFA_OENOB/22-90-------------------------------SSVDL-----IENIRVHLL-GK-KGDLTKILKGLKDLDP-------REK
K9SD43_9CYAN/25-93-------------------------------ETLDQ-----LEQLRVKYF-GK-KGQLSSVLGGMGKLDP-------AER
R6AWJ2_9CLOT/20-88-------------------------------KSEEE-----LSELNTSVL-GR-NGALTAILRTMGKLSA-------ERR
I6XQ41_PSEPQ/36-104-------------------------------SSTAE-----LKQVRFDHA-GD-RSPLALANRGIGALPP-------AER
F4A076_MAHA5/21-89-------------------------------SDSEA-----LEALRVKYM-GK-KGLITSLLKGMGKLPS-------EER
D1BIH6_SANKS/80-148-------------------------------DSLDA-----LRAVRTAVT-GD-RSPIALANREIGGLQG-------PDK
F8AZV1_9ACTN/122-191-------------------------------GDLDE-----LAALRTLHLDGR-GAPLALARRALGALPQ-------SER
H8GQ78_METAL/20-88-------------------------------QDLTQ-----LDQVRVHYL-GK-KGLLTQLMKELGALDP-------DQR
C1F7U6_ACIC5/40-108-------------------------------TSAEA-----VEAFRLHWL-GRKQGRLKAVSDAWLKAAPV------EAK
W0DTW8_9GAMM/20-88-------------------------------TQLAE-----VEQLRVDLL-GK-KAEVTALMKTLGQLSS-------EER
F6FT27_ISOV2/27-95-------------------------------RDLDE-----LKAVRTRHT-GD-RSPLALANRAIGALPG-------PDK
R5I3P4_9BACT/18-86-------------------------------SKADE-----IEALRIKYL-SK-KGEISQLFNDFRNVAA-------EQK
SYFA_NOCFA/23-91-------------------------------ADLDA-----LAVAKTEHL-GG-KAPLALAQRALGALPK-------EEK
E4N815_KITSK/36-104-------------------------------ADLDE-----LKQAKVAHT-GD-RSPLSLANREIGALPP-------QAK
D6ZI01_MOBCV/29-97-------------------------------ADVDT-----LKAVRSRYN-GD-KAPLTQAKKLIGKLDS-------QDK
J7IPX0_DESMD/23-91-------------------------------ESTEA-----LQELKVKIL-GK-KGSLTAMLRQMGSLSP-------EER
R5GWV2_9FIRM/20-88-------------------------------ENLDK-----LNEVRVSAL-GK-KGALTELLKSMKEVAP-------QDR
D5V9Q9_MORCB/35-103-------------------------------TDERT-----LQELRVSLS-GK-KSALTALSKQMGALDA-------DTK
SYFA_DESVM/22-90-------------------------------SSLTE-----LEELRVAFL-GR-KGRLAQIMGRLPELSP-------EDR
SYFA_DEIRA/13-81-------------------------------ETLEA-----LQAVKTKYV-GK-SGLVTKELGSLGKLPP-------EER
D3R2H8_MAGIU/23-91-------------------------------ESLSD-----LEAIRVKLL-GK-NGELTAVLRSMGKLSP-------EER
B0RHC8_CLAMS/26-94-------------------------------TDSAS-----LAQARSAHI-GE-ASPLARLNGSLRSLPP-------EQR
SYFA_METCA/20-88-------------------------------GSVAE-----LDQVRVRYL-GK-KGEFTEQMKTLGTLSP-------EER
R7A9X2_9FIRM/19-87-------------------------------VSLSE-----LNELRVLYL-GK-KGPVQELMKGMKDLPK-------EEK
A4APM8_MARSH/18-86-------------------------------ESNEA-----LEAFRIKYL-GK-KGLLNEFFAEFKNVPN-------EQK
SYFA_STRU0/24-92-------------------------------DHSKE-----LQDLKVSVL-GK-KGTLTELLKGLKDLSA-------DMR
SYFA_ALKMQ/20-88-------------------------------TSTDS-----LEKVRVKYL-GK-KGELTEVLRGMGSLSK-------EER
R6WB22_9FIRM/20-88-------------------------------DLPEK-----LNDVRVKYL-GK-KGELTAVLKGMKDVAP-------EDR
C7MEH9_BRAFD/33-101-------------------------------ATTAE-----LKQVRIEHV-GD-ASVLSSANRAIKDLPK-------EQK
SYFA_PARUW/24-92-------------------------------QTTLE-----LEQLKIKFL-GK-KGSLQGLMKELKNVEP-------DQR
SYFA_NITMU/19-87-------------------------------EDLAE-----LEQVKARYL-GR-HGQLTELLKGLGKIPP-------EER
H8MFB8_CORCM/20-88-------------------------------SEPSQ-----VEALRIRYL-GK-KGELSAVLGGMGKLPP-------DER
SYFA_GEOMG/20-88-------------------------------GSEEA-----LQELRIKYL-GK-KGALTAVMKGLGALSA-------EER
B2GKE9_KOCRD/33-101-------------------------------ADLPE-----LKSVRLAHA-GE-KSPLALANRAIGGLDK-------TAK
D9QA48_CORP2/32-100-------------------------------QTLED-----LAEARRAHL-GD-SAPIPQARRALGSIAK-------EKR
SYFA_SALRD/18-87-------------------------------ESAEE-----AEAFRIKYL-GRNQGAIPDLFDQIGDLPP-------EER
Q10YV2_TRIEI/25-93-------------------------------ENREK-----LEDLRIYYL-GK-KGQVSKILGAMGKLSP-------EER
F0JBI7_DESDE/27-95-------------------------------CSLKE-----LEELRIEFL-GR-KGKLAQIMGRLGKLDN-------ADK
SYFA_LEPBP/22-90-------------------------------TTEQE-----LDALKNQFL-GK-KGKLTSVLKGLASLTV-------EEK
K9ZZ43_DEIPD/13-81-------------------------------DTLEA-----LQSVKTQYL-GK-NGLVTAQLKTLGTLTP-------DER
S5LX10_9MOLU/20-88-------------------------------KTKEE-----LDELKKQFA-GK-DSPLTDILKNLKSASP-------EER
C9RN05_FIBSS/22-90-------------------------------TNQEA-----VNNLRVKYL-GK-KGAVTDLMKQMGSLSA-------EER
SYFA_BRADU/19-87-------------------------------GDEAA-----LEAVRVAAL-GK-KGSISALLATLGKMSP-------DDR
R5NNB7_9CLOT/20-88-------------------------------QDINL-----LNDIKVSIL-GK-KGELTQVLKSMKDVAP-------EDR
G8UN57_TANFA/18-86-------------------------------DNAEE-----LEALRIRYL-SK-RGEINALMNDFRNVAA-------DRK
SYFA_MOOTA/20-88-------------------------------TSSEE-----LEALRVRYL-GK-KGELTRVLRGMGKLPP-------EER
R5LX85_9FIRM/20-89-------------------------------TNSKE-----VYEFKKKYMDSK-AGKIGQLMKEMKNIPP-------EER
R7CS04_9FIRM/88-156-------------------------------VDERE-----LQDAKVFYL-GK-KGKLTAILKNMKDVPA-------DQR
V9XCC6_9NOCA/37-105-------------------------------TDLDE-----LAQAKIDHL-GD-KAPISLAKRALGSLPG-------NER
R6CCB5_9CLOT/36-104-------------------------------DALDK-----LNEVRVNVL-GK-KGELTAVLKSMKDVSP-------EER
SYFA_FUSNN/20-88-------------------------------KTLQR-----LEEIRVNYM-GK-KGIFTELSKKMKDLSV-------EER
SYFA_AGRVS/19-87-------------------------------SDEVG-----IEAVRLAAM-GK-KGSVSELLKTLGSMTP-------EER
R7BI32_9FIRM/19-87-------------------------------RSESQ-----LSDVWKTYL-SK-NGSVQGLMNGIKEVAK-------EEK
E1QZ45_OLSUV/22-90-------------------------------DTLDA-----LDRIRVASL-GK-KGSLTAIMRSMGKVPP-------EER
K9SNU2_9CYAN/26-94-------------------------------ITPEQ-----LEQVRLEFL-GK-KGALSKVLGGMGKLPG-------ADR
SYFA_STRCO/21-89-------------------------------DSLDA-----LQEAKVAHT-GG-ASPLALANREIGALPP-------QAK
A4FKE1_SACEN/36-104-------------------------------GDLDE-----LAAAKPAHL-GE-RSPLLTARREIGALPP-------KAR
C3PGJ4_CORA7/29-97-------------------------------SDLDE-----LTSARREHL-GD-GGYIPQARQSLGQLPK-------DQR
K0AXN7_GOTA9/20-88-------------------------------SNLNG-----LEEIRIEYL-GK-KGELTNILKGMKDLTK-------EER
T2KRJ3_FORAG/18-86-------------------------------QSKEE-----VETFRIKYL-GK-KGLLNDYFAEFKNVAN-------DQK
SYFA_DESRM/20-88-------------------------------KTPEA-----LNDIRVKYL-GK-KGEVTQLLRGMGALSA-------EER
SYFA_BACSK/20-88-------------------------------KSEQD-----IQAIRVAYL-GK-KGPITEVLRGMGKLSA-------EER
R5CH99_9FIRM/21-89-------------------------------FSPEE-----INQIKVDFL-GK-KGQLTGILKGMKDVAA-------QDR
D9SN34_CLOC7/20-88-------------------------------ASKEQ-----LEALRVKYL-GK-KSEFTSILRGMGSVSP-------EER
A0A068NSJ4_9BACT/19-87-------------------------------ESTAA-----LREIESRFL-GK-SGSIPALMKLLGGLDK-------DER
R5Q976_9CLOT/20-88-------------------------------TTSQE-----LKELKAKVL-GK-KSELTEILRGMGQIAA-------EQR
M9WA58_9MOLU/20-88-------------------------------HFLND-----LEELKKEFL-GK-ESELNLILKSIKNINQ-------QEK
D3SN50_THEAH/19-87-------------------------------SALHQ-----LQEIKAKYL-GK-KGVLTQALKELPSLPA-------EER
R6WI12_9CLOT/20-88-------------------------------KTLND-----VNNVKVKIF-GK-NGDFTIAMRGLKDVPR-------EQK
SYFA_MYCTU/22-90-------------------------------DTLDV-----LARVKTEHL-GD-RSPLALARQALAVLPK-------EQR
K9WK55_9CYAN/27-95-------------------------------DTLEQ-----LEQLRISYL-GK-KAQLSQVLGGMGKLAP-------EDK
R7FB92_9FIRM/20-88-------------------------------ADSKL-----LENLRVQYL-GK-KGELTAILKQMGKLSA-------EER
SYFA_THEMA/18-86-------------------------------SNVQE-----LESFRIEFL-GK-KGKITGLMKNLKNLPP-------EER
D5EJ34_CORAD/20-88-------------------------------TSRAE-----FEAYKATVS-GP-KGSLTEVMKGMGKVPK-------EDK
F2I8L5_AERUA/22-90-------------------------------SSLDD-----VQAIRVKYL-GK-KGPITEALRHMKDIDP-------SER
A4VVH9_STRSY/42-110-------------------------------QGEKE-----LQDLRVAVL-GK-KGSLTDLLKGLKDLSN-------DMK
D3P8P0_DEFDS/19-87-------------------------------TNLDE-----LYQIKVKYL-GK-KGSITLLNKQLKNIAP-------ENR
R5A683_9CLOT/20-88-------------------------------QNSDT-----VEKLRVAYL-GK-KGSVTELLKGLKSVAG-------DQK
E7FV92_ERYRH/18-86-------------------------------ETLEH-----LNDVRIEYL-SK-KGLLTKVMGQMKDLSN-------EEK
A0A373LLD7_9FIRM/20-88-------------------------------KDISV-----LNDVRVEIL-GK-KGQLTEVLKGMKDVAP-------EDR
W6S064_9CLOT/20-88-------------------------------VTKED-----IEAVRVKYL-GK-KGEVTLILRGMGGLSP-------EER
D5UDW9_CELFN/30-98-------------------------------SDLDG-----LKAARLAHT-GD-ASPLALANRAIGGLPG-------PDK
R6SEA7_9FIRM/23-92-------------------------------ESSKE-----VYEFKKSYLDSK-KGKIGQLMKEMRNIAP-------ENR
L7VMV5_THES1/20-88-------------------------------RDVKT-----LEEIRVLFL-GK-KGKLTGILKGMGTLPA-------DER
R5J6Z6_9FIRM/20-88-------------------------------TSPEE-----VEKLRVDLL-GK-KGELTKILKEMGKLSA-------EER
N0AYS7_9BACI/20-88-------------------------------TNLKE-----LNDIRVAYL-GK-KGPITEVLRGMGKLSA-------EER
U5N4Q5_9BURK/19-87-------------------------------RTAAE-----VENVKAAYL-GK-SGQITLCMQGLGALPL-------EER
V5RIT9_SPIAP/20-88-------------------------------KTKEQ-----LEEVKKEYT-GK-ESPLNLVLNNLKQLSS-------SEK
SYFA_RHORT/19-87-------------------------------GDLDA-----LDAIRVSAL-GK-KGQITGLMKTLGAMDP-------EAR
R6GR40_9CLOT/20-88-------------------------------NSLKN-----LEEIKVKYL-GK-KGELTAILKQMGKLSS-------EER
R4KNF9_9FIRM/20-88-------------------------------NDLEE-----LNNIRVRYL-GK-KGLLTGVLRGMGALSA-------EER
SYFA_HAHCH/19-87-------------------------------ESEQS-----LEQLRVDYL-GK-KGRITQLLKELGRLDA-------AER
F4KPG6_HALH1/22-90-------------------------------ANAEA-----IEQFRLRFL-GS-NNVIKPLMGEIRNVPN-------EQK
SYFA_CHLTR/22-90-------------------------------HSSKD-----LFDVKVKYL-GK-KGIFRGFADQLRKYPI-------EQK
I0HEG5_ACTM4/36-104-------------------------------ADLDA-----LAALKPAHL-GD-RSPISLARREIGSLPP-------AAK
R5XNZ9_9CLOT/20-88-------------------------------TDLKS-----LNELKVKFL-GK-KGELTSVLRGMGALEP-------EER
C8WQJ4_ALIAD/24-92-------------------------------SDSKA-----LNDWRVEVL-GK-KSALGQMSKAMGGLAP-------EDR
SYFA_LACP7/20-88-------------------------------DTLDA-----LNEIRVNFL-GK-KGELTSVLKSMKDVAP-------EDR
K7X996_MYCHR/13-81-------------------------------NNLED-----LKLAKNAFF-GK-DSYLAKLQNQLKSVSN-------EEK
G4Q6B2_ACIIR/20-88-------------------------------KCVDD-----LKNIRVQYL-GK-KGALTEILRGLGSVAA-------EER
E3JA61_FRAIE/38-107-------------------------------ADLAD-----LAAVRTAQVDGR-SAPLMLARQKLGTVAP-------ENR
R5P7G9_9BACT/19-87-------------------------------TNAAE-----LEQLRLKYL-SK-KGAISLLMNDFRSVPA-------EQK
SYFA_HERA2/20-88-------------------------------QSLDD-----LAAWRTQWT-GK-KGALAQASQSIGKLDP-------KDR
R7NGC3_9FIRM/20-88-------------------------------QNLVD-----LDKVRVAYL-GK-KGSVTGLLKGMKELSN-------EER
C5BW27_BEUC1/44-112-------------------------------GDLDA-----LKDVRLAHA-GD-RSPLALANRAIGTIPG-------AER
R5KSX4_9CLOT/20-88-------------------------------QSAQQ-----IEEVRIKYL-GK-KGELTAILKQMGKLSP-------EER
SYFA_LEPCP/19-87-------------------------------TTPAQ-----LEDAKARFL-GK-TGRVTELLKGMAALTP-------DEK
K4LET7_THEPS/36-104-------------------------------GKREE-----LQDLKVKYL-GK-KGLLTKVLRGMGSVPA-------DLR
SYFA_TROWT/22-90-------------------------------DTLRD-----LTKLKNDNL-GS-TSWLAKYSASIKILSQ-------EKK
W8T5S4_PEPAC/20-88-------------------------------VSIEE-----VESIRINAL-GK-KGEITAVLKGMKDLSD-------EER
R6PQP5_9FIRM/20-88-------------------------------SDLQA-----LESLRVEIL-GK-KGELTQILKGMGSLSK-------EER
R5XLV9_9CLOT/20-88-------------------------------SAIDE-----LDSIKVKYS-GK-KGELTKLLKGMGKLSA-------EER
W8SMQ5_9RHOB/19-87-------------------------------GDEAA-----LEEIRVAAI-GK-KGEISLKMRELGKMTP-------EER
C7JGH2_ACEP3/20-88-------------------------------TDLKA-----WDAVRVSTL-GK-SGRLTALLKALGKMQP-------DER
C7R3Q7_JONDD/31-99-------------------------------STLDD-----LKDIRTAHA-GD-KSPLALANREIGGLPP-------ADK
R6QBU0_9FIRM/20-88-------------------------------DNLAD-----IENIRVSYL-GK-KGSVTDLLKGMKELSN-------DER
C5CIP0_KOSOT/21-89-------------------------------TNSAE-----LQVIKARYL-GK-QGLVTSMLKKIRELPP-------EER
G8LZS0_HUNCD/20-88-------------------------------ESIQE-----LENIRVKYL-GK-KGELTSVLRGMGALSA-------EER
B7KBP6_GLOC7/27-95-------------------------------TTLED-----LEQLRVQYL-GK-KGQLSQILREMGKLSA-------EDR
R7I8A9_9FIRM/20-88-------------------------------ANMVD-----LEALRVNYL-GR-KGKVTDALKGMGSLND-------EQK
D8K1Q0_DEHLB/20-86-------------------------------ETTEA-----LETWRVNYL-GK-KSELTAVLRGLGALPV-------EDR
SYFA_CHLPD/18-86-------------------------------ASIKD-----IEAFRLRYT-VR-KGLIAGLFGQLKSVLP-------ADK
K9TZG2_CHRTP/27-95-------------------------------DCLER-----LEELRVAYL-GK-KGQLSAIMRQMGQLSA-------EER
G2IRD2_SPHSK/19-87-------------------------------DTLDA-----VESLRVGAL-GK-NGVVTALLKTLGAMTP-------EER
D7FN85_ECTSI/107-175-------------------------------TTLQE-----LEDLRRKYM-TK-KGPVQKVMGQMRLLSP-------EDK
F9D0B9_PREDD/35-103-------------------------------KNAED-----IEQLRLKYL-SK-KGEINAVMADFRNVAA-------DQK
C6CWJ4_PAESJ/20-88-------------------------------DNPQQ-----LNDLRVKYL-GK-KGALTEILRGMGGLSA-------EER
A5CE07_ORITB/17-85-------------------------------NEKKA-----LNDLKLSYL-GK-SGIITLQLKKIVELNV-------ENR
K9Z449_CYAAP/24-92-------------------------------ESLSQ-----LEELRVSYL-GK-KGQLSLILKEMGKLSA-------EER
K9XQV8_STAC7/27-95-------------------------------TNLEE-----LEQLRVKYL-GK-KGDLSQILRGMGKLSP-------EER
SYFA_AGRRK/19-87-------------------------------TDEQS-----IEAVRVAAL-GK-KGSVSELLKTLGSMSP-------EER
A6Q2R4_NITSB/8-76-------------------------------LSLDE-----LEELRIELF-GK-KGYFAKEFEKLKSLSK-------EEK
Q1GPD5_SPHAL/20-88-------------------------------ADAGA-----IEAVRVAAL-GK-AGRITALLKTLGGMTP-------DER
R6DHE0_9CLOT/20-88-------------------------------GELEK-----LNDIRVAFL-GK-KGELTSVLKGMKDVAP-------EDR
D5AR72_RHOCB/19-87-------------------------------ADEAS-----LEELRLAAL-GK-KGEISLKMRELGQMTP-------EER
D1AGH7_SEBTE/20-88-------------------------------NSLEN-----LDELRIAIL-GK-KGELTSIMKEMGNIAA-------EKR
W6AHF9_9MOLU/20-88-------------------------------NTKQD-----IEELKKVYA-GK-DSPLNEVLKNLKSCSP-------EEK
C6XAN7_METGS/20-88-------------------------------DNLND-----LEQAKARFL-GK-SGALTDALKGLGKLSA-------EER
R7R058_9FIRM/20-88-------------------------------DELGK-----LNDVRVAFL-GK-KGELTAVLKGMKDVSP-------EER
SYFA_THIDA/19-87-------------------------------PDLPS-----LEQIKAGYL-GK-SGQLTELLKSLGAMPA-------DAR
E4TJZ0_CALNY/18-86-------------------------------ENLEQ-----LYQVWVKYL-GK-KGLISLLNKELKNVPE-------EKR
K8E4Z9_CARML/22-90-------------------------------ENLDS-----LNQVRVAYL-GK-KGPLTEVLRGMKDLSA-------EER
D3UFP7_HELM1/12-80-------------------------------KNTAE-----LEAVRIEFF-GR-KGSITQKFAMLKELEG-------EQK
F8KZ83_PARAV/20-88-------------------------------HSSAD-----LEQIKVKYL-GK-KGPLQNLMKSLRDVSP-------EER
C8W7P2_ATOPD/22-90-------------------------------TNLEE-----LEKVRVASM-GK-KGSLTAIMRMMGQVPA-------DQR
F4GU13_PUSST/20-88-------------------------------NDAAA-----LENAKARFL-GK-QGALTALMKGLAQLAP-------DQK
A8EWE7_ARCB4/12-80-------------------------------KSLEE-----LENLRIDTL-GK-KGVLTLEFAKMKSVPN-------EDK
G0FYK5_AMYMS/34-102-------------------------------TGLER-----LAEVKPAHL-GD-HAPLMLARREIGALPK-------QEK
D0L966_GORB4/31-99-------------------------------ADLEA-----LAQAKTAHL-GD-RSPIALARRALGSLPK-------EER
SYFA_PERMH/22-90-------------------------------SDIGK-----LNDIRVNYL-GK-KGKIKSILKTLGKLSP-------EER
R6I3G5_9FIRM/20-88-------------------------------DSPEN-----LEALRVKYL-GK-KGELTAILKQMGKLSA-------EER
D0L0C8_HALNC/50-118-------------------------------MDVVA-----LEEVRVAYT-GK-KGVVTQFMKELGTLDP-------EAR
SYFA_SACD2/19-87-------------------------------EDLAG-----LDAIRVNYL-GK-KGEITAQLKNLGGLSP-------EER
W0E4U7_9FIRM/20-88-------------------------------TSLDT-----LQELKVKVL-GK-KGSLTALLRQMGSLSA-------EER
Q0ATG1_MARMM/22-90-------------------------------TDEAG-----LDAVRVAAL-GK-KGSVSLMMRELGKMSP-------EER
I4D0B3_DESAJ/23-91-------------------------------DKSEA-----LQELKVKVL-GK-KGTLTALLRQMGSLSP-------EER
SYFA_CLOBH/20-88-------------------------------LSKDQ-----LEAIRVKYL-GK-KGELTQILRGMGALSQ-------EER
G7Z7V0_AZOL4/17-85-------------------------------ADLSA-----LDEVRVSAL-GK-KGRITGFMKELGALTP-------DER
M1MX81_9CORY/29-97-------------------------------QDLAE-----LSAARRAHL-GD-DAPIPQARRSLGTLPK-------AER
F8AAU5_THEID/21-87-------------------------------RDEKA-----LEATRVKFL-GR-KGELTQVLKSIAKLPP-------ELK
G4L0S9_OSCVS/20-88-------------------------------KAASE-----LEALRVKYL-GK-KGELTGLLKQMGGLSA-------EMR
R6VYL1_9FIRM/20-88-------------------------------KDGTA-----LEAARVKYL-GK-KGELTAILRGMGSLSA-------DER
A6WCT9_KINRD/39-107-------------------------------GDLGE-----LKAARLAHA-GD-RSPLALANREIAALPG-------PEK
A0LUC7_ACIC1/32-100-------------------------------ADLAE-----LQAVRIAHV-GD-RSPLALANREIGALPP-------QAR
H6L2Q9_SAPGL/22-90-------------------------------QNKEE-----LEQFRLKFL-GT-KNQLKPLFGEMRNVPN-------ERK
K6ZLC3_9ALTE/18-86-------------------------------QDVNF-----LDAVRVDFM-GK-KGRMTELLKGLGKLSN-------EER
W8KPJ2_9GAMM/13-81-------------------------------KDLRN-----LEDLRVHFL-GK-KGVITEQLKTLGSLPV-------EHR
C6W5N1_DYAFD/19-88-------------------------------SNKEQ-----LEAFRLKYI-SK-KGAVTELFDNLKNILQ-------EDR
I7A000_MELRP/20-85-------------------------------HDLKS-----LEELRLKFL-SR-KGIIQNFFEEFKKLST-------DEK
R5ACG5_9FIRM/20-88-------------------------------REIKD-----VDDLKVKFL-GK-KGELTAILKEMGKLSA-------EER
SYFA_ALIF1/19-87-------------------------------GSLVA-----LDEVRVQYL-GK-KGHLTLQLQGLGKLDP-------SER
SYFA_PELCD/20-88-------------------------------DSAVE-----LQEIRVRFL-GK-KGELTAIMKGMGQLTP-------EQR
SYFA_BORPE/28-96-------------------------------SDAAA-----LENAKARFL-GK-EGALTVLLKALGKLDP-------EQK
R5KHV4_9CLOT/20-88-------------------------------DVLTS-----LNDVKVSVL-GK-KGELTQVLKGMKDVAP-------EDR
D6Z312_DESAT/20-86-------------------------------TDPEE-----LEPFRVEYL-GR-KGRFTGLMRSLGQAPA-------EDR
R6CXH4_9FIRM/20-86-------------------------------ATETE-----LQDIKAALL-GK-QGSLTELMKELPKLDV-------SLR
R5RI45_9FIRM/24-92-------------------------------DALDK-----LNDVRVSFL-GK-KGQLTSVLKSMKDVAP-------EDR
D6Y1Z3_THEBD/33-101-------------------------------RDLDE-----LKQVRIAHA-GD-RSPIALANRRIGTLPP-------GER
D5C008_NITHN/19-87-------------------------------PNLET-----LDELRVRYL-GK-KGELTGYLKKLGQLSA-------EER
SYFA_THEEB/30-98-------------------------------STLDA-----LEQLRVAYL-GK-KGELSQILALMGKLPA-------GDR
C8WZ74_DESRD/27-95-------------------------------SVFED-----LETLRVEYL-GR-KGKLAQAMTSMRDLDS-------SER
R7I3S7_9CLOT/20-88-------------------------------EHLES-----LNDVRVAFL-GK-KGELTSVLKSMKEVAP-------EDR
I3TGZ9_TISMK/19-87-------------------------------ADLDA-----LEEVRVQAF-GR-KGRITEMLKGLGALDP-------EAR
D1B028_SULD5/12-80-------------------------------ESLGE-----LDKIRVSLF-GK-KGHFAAQFEALKKLEG-------DAK
R5D8P1_9FIRM/20-86-------------------------------RSEAE-----LQEVKALLL-GK-QGSLTGLLKELPKLDA-------ALR
F4CLG6_PSEUX/40-108-------------------------------PDLAA-----LAAVRPAHL-GD-KAPLLLARRELGSLPG-------PQR
C9LUD7_SELS3/21-89-------------------------------VTLAD-----LDGIRVKVF-GK-KGELTAIQRGMGKLDP-------AER
H1ZB84_MYROD/25-92-------------------------------DNKEQ-----LEAFRIKFL-SK-KGILNELFAYFKTVPN-------DQK
G9WG33_9LACT/22-90-------------------------------KTDDA-----VEDIRVHLL-GK-KGDLTKILKGLKDLAP-------DQR
R6YSU1_9CLOT/20-88-------------------------------KNSQE-----LQELKVKML-GK-KSELSNLLKGLGKLSP-------EER
Q1AWF9_RUBXD/23-91-------------------------------ESTAA-----LEQARVRYL-GR-SAELTEIKKSIGRLPP-------EER
D7CWW6_TRURR/35-103-------------------------------ADQAA-----LQALRVKLL-GK-KGVLTAQLKGLGALSA-------EAR
E9T014_RHOHA/37-105-------------------------------ADLDA-----LAKAKIEHL-GD-KAPIALAKRGLGALPG-------NER
K9YBC7_HALP7/27-95-------------------------------SNLES-----LEQLRVQYL-GK-KGQLSQVLRGMGKLSA-------EER
R6FU47_9BACT/32-100-------------------------------SNAEE-----IEQLRLKYL-SK-KGEITALMADFRNVPA-------DQK
C6BRG7_DESAD/26-93--------------------------------SLSE-----LEDIKIDML-GR-KGRVAKIMSGLPSLPN-------EDK
Q0BRZ9_GRABC/47-115-------------------------------ADLRA-----WDAVRVGVL-GK-SGKLTALLKTLGQATP-------EER
G0A2F3_METMM/20-88-------------------------------KDLAE-----LDLVRVNYL-GK-KGLFTQHMKQLGNLDP-------DQR
K9T1C5_9CYAN/28-96-------------------------------TTLAQ-----LEQLRIDYL-GK-KGKLSQILREMGKLSP-------EDR
SYFA_SYNWW/20-88-------------------------------SSMEE-----LNEFRIKTL-GR-KGEVTLLLRGLKDLSG-------EEK
D5EE62_AMICL/23-91-------------------------------SSADE-----IQDLKVKYL-GK-KGKVTSLLKTLGSLPP-------EKR
SYFA_FERNB/22-90-------------------------------ENSKV-----LNDLRVKYL-GK-SGIVTSLMKQLKDLPN-------EEK
SYFA_BIFA0/27-95-------------------------------STMEE-----LKAIKAKYA-GA-NSAMTRASKAIGSLAK-------NEK
D5UR26_TSUPD/32-100-------------------------------TDLDA-----LNAARLAHL-GE-KSPLALSKRALGSIPK-------EER
M1WYG6_PSEP2/27-95-------------------------------CSLKE-----LDELRIEFL-GR-KGMLAQAMAQLGALDN-------TDK
C7NDS1_LEPBD/20-88-------------------------------ENLEE-----LNDLRVKIL-GK-KGEFTAIMKGMAGIAA-------EKR
A2TYD7_9FLAO/26-94-------------------------------TTKDE-----VESFRIKYL-GS-KGLLKDLFSEFKNVDA-------ELR
F0SWT1_SYNGF/20-88-------------------------------LTRDE-----LQELKVKVM-GK-KGSLTALLKQLGSLSS-------EER
D7A232_STAND/25-93-------------------------------ADEAG-----LEAVRVSAL-GK-KGSVSELLKSLGGMSP-------EER
SYFA_LISMO/20-88-------------------------------SDLKT-----LNDLRVKYL-GK-KGPMTEIMKQMGKLSA-------EER
H8XNL0_FLAIG/18-86-------------------------------DNKER-----LEEFRIKYL-GG-KGILKEFFAEFKNVPN-------ELK
D6XSV7_BACIE/20-88-------------------------------VTLSD-----LRDVRVKYL-GK-KGPMTELMKGMGKLSS-------EER
E6W567_DESIS/57-125-------------------------------PGTRQ-----LDELRIHYL-GK-KGFIAAAMQQLKDVAP-------EER
SYFA_CALS4/20-88-------------------------------KSLQE-----IESLRVKYL-GK-KGELTQILRGMGSLSP-------EER
R7AJJ4_9FIRM/20-88-------------------------------GSIKG-----LDDLRVRFL-GK-KGELTGILKQMGGLSA-------EER
I0HS10_RUBGI/19-87-------------------------------PNPAE-----LENAKARYL-GK-SGRVTELLKGLAALPP-------EQK
SYFA_SYNAS/20-88-------------------------------KTETD-----LAAVRVRYL-GR-KGLLTQFLRNLGQLSI-------EEK
C5CAN9_MICLC/41-109-------------------------------ADLDE-----LKAARLAHT-GD-RAPLTLANKAIGALPK-------ERK
R6B2V2_9CLOT/20-88-------------------------------KDSQA-----LNDFKVKVL-GK-KGELTEILRGMKDIAA-------EER
SYFA_BEII9/19-87-------------------------------ADEGE-----LENVRVGAL-GK-KGTISALLATLGKMSP-------DER
V5WNC2_9SPIO/20-88-------------------------------QSLPD-----MAQFKAEYL-GK-KGRLKGLMAGMRDLSP-------EER
D2R2G0_PIRSD/25-91-------------------------------TSPAA-----LEEARIEFL-GAKSGKLKDAQKGLGQVAK-------EDK
F2J3M3_POLGS/19-87-------------------------------ATEAA-----LEEVRIAAL-GK-KGSISELMKTLGSMSP-------DER
SYFA_LACS1/22-90-------------------------------KDLKK-----INDIRVSLL-GK-KGPITEVLRGMRDLSA-------EER
H6LK10_ACEWD/20-88-------------------------------EELKS-----LDNVRIKYL-GK-KGELTIVLKGMGKLSN-------EER
M4UK68_9GAMM/19-87-------------------------------IDGNQ-----LEEIRLQYL-GK-KGLMTEQMKGLGKLPA-------EEK
F6EI06_HOYSD/42-110-------------------------------GSLDD-----LAHAKTQHL-GD-RSPIALARRALGTLPK-------AER
W5WG41_9PSEU/36-104-------------------------------ADLDA-----LAAVKPAHL-GD-KSPLLLARREIGALPP-------AAR
SYFA_CAUVC/19-87-------------------------------SDLQA-----LDAVRVAAV-GK-TGSISGLLKTLGAMSP-------EER
R6WGM8_9BACT/19-87-------------------------------SNAEE-----IEALRLKYL-SK-KGEINAVMADFRNVPA-------DQK
SYFA_TERTT/19-87-------------------------------NDLAA-----LDTVRVNYL-GK-KGPLTALRKTLGKLSA-------EER
A7HBJ0_ANADF/23-91-------------------------------ADEKA-----LEDLRVRFL-GK-KGELSAVLRGMGALPA-------EER
F8L5F2_SIMNZ/20-88-------------------------------QHTKE-----LEDLRVKYL-GK-KSPVQTLMKSLRDVAP-------EER
SYFA_GEODF/20-88-------------------------------ATEDS-----LQDLRVKYL-GK-KGELTAVMKGLGSLSS-------EER
B8I1X0_RUMCH/20-88-------------------------------GSSAE-----VEELRVKLL-GK-KGELTEMLKDLKNMAI-------EER
SYFA_CLOTE/20-88-------------------------------VDKET-----IESIRVKYL-GK-KGELTKILRGMGGLSA-------EER
F0SQV1_RUBBR/22-89-------------------------------SDSAA-----LEDARILFL-GKKKGRLKDLQSELSKATP-------EER
K9XCP2_9CHRO/27-95-------------------------------DSLDR-----LEELRVVYL-GK-KGQLSGLLRSMGQLSA-------EER
SYFA_NATTJ/20-88-------------------------------SSLDK-----LKDVQVKYL-GK-KGELTKILRGMGNLSP-------EER
SYFA_BDEBA/21-89-------------------------------PSSKD-----LYDLKVQYL-GK-SGSLTEIMKEMASLPK-------EEK
I0JPK4_HALH3/20-88-------------------------------ENVQS-----LKDVRVEYL-GK-KGPITEVLRGMGKLSK-------EER
W0DY81_MARPU/24-92-------------------------------PDLAT-----LDQARVRYL-GK-SGELTALLKRLGTLPP-------AER
B0VGJ1_CLOAI/20-89-------------------------------SSPND-----LLNVKAKYL-GK-KSLLSSLYAQMRNIPV-------EER
L0KD16_HALHC/20-88-------------------------------SNLDE-----LDDLRVKYL-GK-KGEVTQILRSMGELPP-------EKR
R7L3S6_9CLOT/20-88-------------------------------NDEKV-----LNDARVKYL-GK-KGELTLILRGMGEIAP-------EER
K9R6E2_9CYAN/24-92-------------------------------DSLES-----LEGLRVNYL-GK-KGQLSILLRGMGKLSA-------EER
A3HVJ8_9BACT/19-87-------------------------------NTPEE-----LESFRMEFI-SK-KSVVGGLFAEMGKIPN-------EEK
SYFA_PROMA/29-97-------------------------------NDKES-----LENLRIQLL-GK-KGRLSKILGSMATLKG-------SER
W5UZV8_9MOLU/13-81-------------------------------ENLED-----LKLAKNQFF-GK-DSFLASLQLQLKTASP-------EQK
R5KEN7_9CLOT/20-88-------------------------------NDLDA-----LNDIKVNVL-GK-KGELTQVLKGMKDVAP-------EER
C9RBR1_AMMDK/20-88-------------------------------EDLAG-----LEAVRVRFL-GR-KGELTGILRRVSQLPP-------EER
C6WA94_ACTMD/36-104-------------------------------GDLDA-----LAAAKPAHL-GD-RSAVLQARREIGALPP-------AAK
H6NGI2_9BACL/20-88-------------------------------ESPQQ-----LGELRIKYM-GK-KGPLTEILRGMGALSA-------EER
SYFA_ACHLI/20-88-------------------------------LTLND-----LEALRVEYL-GK-NGILTSQMSLIRTLPN-------EEK
H0Q2C1_9RHOO/19-87-------------------------------ADAVL-----LEQTKARYL-GK-TGALTELLKGLGKLAP-------EER
R6SNF3_9CLOT/21-89-------------------------------HSGAE-----LKEFFSTYL-GR-NGSISALMKELGKLSK-------EER
B3R0A3_PHYMT/28-97-------------------------------KTLDD-----VINLEIQFL-GK-KSLIKDFLNHLKNNSL-------IEK
SYFA_DESAP/20-88-------------------------------STAEV-----VEEVRIRYL-GK-KGVLTQVLRSMGSLPA-------AER
D5BT76_PUNMI/19-87-------------------------------ETLEA-----LDNVRIEAL-GK-KGRVSLMMRDLGGMEP-------EAR
SYFA_LEIXX/27-95-------------------------------GDSEA-----LKVVRHDHT-AE-GSPLAQLNAGIRSLPG-------DRK
B2KBL6_ELUMP/25-93-------------------------------ASSDA-----LEAARVNCL-GR-KGVLTELLKNLKDFTI-------EEK
SYFA_GEOBB/20-88-------------------------------STEEG-----VQELRVKYL-GK-KGELTSVMKGLGALTP-------EER
I3Y983_THIV6/24-92-------------------------------ADLMG-----LDQVRVRYL-GK-TGDLTVLLKQLGALPA-------AER
R6S4L0_9FIRM/20-86-------------------------------ANENE-----LQNVKNAYV-GK-QGALSMLMKEMPKLDA-------ALR
SYFA_PROMT/29-97-------------------------------ENSES-----IEKLRLSFL-GK-KGKLSLLLGGMKNLSN-------EER
F9VJE9_ARTSS/20-88-------------------------------DSISK-----FEELRVRYL-GK-KSELSNILKNMKNLSN-------EEK
Q2J858_FRACC/36-105-------------------------------ADLDA-----LAAVRTAHIQGA-SAPLVLARRELGALPR-------AER
G4T3A1_META2/20-88-------------------------------QDLNQ-----LDQVRVHYL-GK-KGLFTLQMKELGRLDP-------QQR
D6YVW7_WADCW/20-88-------------------------------CSTAS-----LEELKIKYL-GR-KGPVQDLMKSLKNASK-------EER
SYFA_CARHZ/20-88-------------------------------SDLNE-----LQTVKVKFL-GK-KGEVTLALKNLKNLPP-------ELR
SYFA_LACDA/22-90-------------------------------ESEKS-----LNDVRVKLV-GK-KGELTQILHQMKDVAP-------EKR
F9VFQ4_LACGL/22-90-------------------------------VEERM-----LNDLRTAIM-GK-KGELTEILKGMKDLTN-------EER
R6N304_9FIRM/20-88-------------------------------SDLVE-----LDKIRVAYL-GK-KGSITALLKGMKDLSP-------DEK
B5YG19_THEYD/17-85-------------------------------SSIQE-----LVNLKAKYI-GK-KGIITEKIKNLGRLTP-------EER
SYFA_HAEDU/19-87-------------------------------TDVAT-----LETLKVEFF-GK-KGHFTQLMQGLRDIPA-------EQR
R5CA95_9FIRM/22-90-------------------------------DALDK-----LQEIRVSYL-GK-KGQLTSLLKGMKDVAK-------EER
SYFA_OCEIH/20-88-------------------------------KDMKS-----LQDLKVKYL-GK-KGSLTSVLRGMGKLSK-------EER
SYFA_ROSS1/22-90-------------------------------ADLTA-----LAEWKSAYL-GK-QGALSRLSRGLGALPA-------EER
SYFA_HAEIN/21-89-------------------------------KSLTA-----LDEIRVEYF-GK-KGHFTQLMQELRNVSA-------EER
B0S1P6_FINM2/26-94-------------------------------IDLKS-----LEDIRVKVL-GK-KGDLTLVLRNMGKLSK-------EER
SYFA_PHEZH/19-87-------------------------------ADVAA-----LEAIRVEAL-GK-SGSISEMLKGLGKMSP-------DER
S5MHW4_9MOLU/20-88-------------------------------NSKND-----LEEIKKEFT-GK-NSKLMEVLKSLKSFSP-------DER
E1SRF2_FERBD/19-87-------------------------------DDLKA-----LDDIRVNYL-GK-KGEITALMKSLGQLSA-------EER
E0URM0_SULAO/16-84-------------------------------KDVES-----LEEIRIAVF-GK-KGVLAAEFAKMKDAPN-------EQK
SYFA_HYDCU/20-88-------------------------------SELVH-----LDEIRVQYL-GK-KGELTAMMKTLGQLSA-------EER
SYFA_EHRCR/21-90-------------------------------SSLEE-----LESIKLYYF-GK-SGTITACLKSIATISNI------EER
B7FQJ6_PHATC/32-100-------------------------------TSVAD-----AEVIRREYL-GK-KGPINKAMGYMRLLPN-------EDK
SYFA_ONYPE/21-89-------------------------------HDLDQ-----LMTLDKEFL-GK-KGILFELTQELKSLPH-------AQK
SYFA_NEIG1/19-87-------------------------------QDFNA-----LEQIKARYL-GK-TGELTGLLKTLGQMSP-------EER
Q091T0_STIAD/20-88-------------------------------SEVSA-----VEALRIRYL-GK-KGELSGVLGGMGKLPP-------EER
E3I177_RHOVT/26-94-------------------------------SDLAA-----LDAIRVSAL-GK-KGEISELMKKLGALPA-------EER
W8WXH2_CASDE/20-88-------------------------------GDAAT-----LENEKAAFL-GK-QGSLTALLKGLAALQG-------EEK
C7RRQ2_ACCPU/19-87-------------------------------DDPDA-----LEQIKASFL-GK-NGQIPGLLKGLAKLPP-------DER
R5NQN3_9CLOT/20-88-------------------------------SNLRE-----LEDVRVKYL-GK-KGKLTAILKTMGSLAP-------EDR
W0ITG1_9BACT/20-88-------------------------------KTRPE-----FEAAKARYV-GP-NGALTACMKQMGSLPK-------EQK
L0EDN6_THECK/20-88-------------------------------ADPAR-----LNDLRVKYL-GK-KGALTEILRGMGSLSA-------EER
I0HYQ7_CALAS/16-84-------------------------------QSLTE-----TEAWYHEYL-GR-KGRLTAILRSLGQLSK-------EER
SYFA_SHEAM/19-87-------------------------------TDLKV-----LDDIRVDYL-GK-KGQITDLMKLMGTLSA-------EEK
SYFA_MACCJ/22-90-------------------------------TDKKA-----LQDIKVSYI-GK-KGVITGLMKEMKSLPN-------EEK
K8GT05_9CYAN/27-95-------------------------------DSLDQ-----LEQLRVKYL-GK-KGPIPQVLGGMGKLDP-------SDR

PF02403

SYSM_SCHPO/49-157GKLVNEAKGLKKKTEEYNK-IISKVTND---LYQYCLAVPNTT
SYS_SYNE7/1-112AALREEGNQLKQQIADLEQ-QERQVRSE---LDTYLLTLPNLP
SYSC_MOUSE/2-113VGDDESVPENVLNFDDLTADALAALKVS---QIKKVRLLIDEA
SYSC_SCHPO/1-112SELLEEKNSLTERKKNLIE-QETAKNKE---MLNVVSSIGNIV
SYS_CORGL/1-106PALLEGSNELKAKVKDAEA-AQEAAEAK---VNELQMKLSNVV
SYS_BORBU/1-106ISLIETGKILKKQLIDLEE-ELERVSVD---FDLENKKVPNIL
SYS_XANCP/1-108AALMAEVAGFGDELKASED-ALDVIRAQ---LEGIALGIPNLP
SYS_AQUAE/1-109TEIQNRVKELKEEIDRLEE-ELRKVEEE---LKNTLLWIPNLP
SYS_CALS4/1-107SELIAKMKELSDKIKDMEQ-ELREIEEE---MEKILWTIPNIP
SYS_FUSNN/1-107DHIIEKMGEVSTKIKDLDA-ELVEIDEK---IKDIQLNIPNVY
SYS_TREPA/1-106SACVETGRALKDRIAHSER-LLVQISDQ---LLSATQALPNMT
SYS_CHLTR/1-107DALIQEVNTIADQLVAFET-TLQEQEAL---LEDLMARLPNYP
SYS_ENCCU/1-115SEKVAEIKGLSDEAKGLRD-DVKAVEDE---LNKVMKGIGNII
SYSC_YEAST/1-112SGLLAEKEKLTQQKKELTE-KEQQEDKD---LKKKVFQVGNIV
SYS_AGRFC/1-109EKLKAEVADIKENMPRAEE-EDRQVSAE---LNDALSRLPNMP
SYS_CLOPE/1-110TEVMAEMREIGDKIKADDA-KVAELNDK---INYIMLRIPNIP
SYS_BACSU/1-108DHIIKEMREVGEEIKKLDE-ELRTVEAE---LDTILLSIPNIP
SYS_RALSO/1-107SAVMAEVAGIGDELKASAA-QLDVVQGR---LQDLLLSIPNVP
SYS_COXBU/1-107ELLMAEVSQLNDELKQEEA-NFETIQKA---FSDFQLAIPNLP
SYS_LISMO/1-108DAKIEEMRVVGDRIKTLDI-ELREIDEK---LDMILMSIPNIP
SYS_HAEIN/1-108APLLAEMDDMGNQLTEAKA-QLDAVLAE---INQIALSIPNLP
SYS_NOSS1/1-112QALRDEGNAIKAQLSELEP-REKELKAE---IEQLILALPNLP
SYS_HALMA/1-110QEAIDRSQELKDELQDIEE-RADELESQ---LEEALLELPNIP
SYS_HELPY/1-109SDLKKELENNKIKLNELSK-SVGELEQQ---IDLKLSIIPNLV
SYS_BUCAI/1-107ELLRHQVIQSSKDLNASKI-ELNSLKEK---IHHFSMCIPNIP
SYS_PASMU/1-108SALLNEVEHMGIELSTTKA-HLDEVLAE---INQIVLAIPNLP
SYS_RHIME/1-109DRLKAEVADLKNALPAAEE-ESRRIEAE---LSDALSRIPNTP
SYS_BUCBP/1-107QCMKERIITLKKKIDVMKK-ELKILLEQ---IHIFLMNIPNLP
SYS_SYNY3/1-114QTLREEGNSLKIQLADLEP-QEKDLKEQ---LQKLLLELPNLP
SYS_MYCPN/1-104--LLKESKELKQKLEQLNI-AFKEAETL---SQELLLNLPNIA
SYS1_CLOAB/1-110DELLAEMKKISDDIKGIDA-KVSEIDEK---MQYIMLRIPNIP
SYS2_CLOAB/1-108ESFFKDIKEISNKISELET-SLEPIKGK---MDTFLEALPNIP
SYSC_CAEEL/2-114D-DSVADDIVARLAELKID-ELSQLTVV---QLKKLRVLVDEK
SYSC_ARATH/1-112SEIIQQTEKNKQDSTAKEA-EVREAYAA---LKAKLEQVGNLV
SYS_MYCPU/1-107NELKAKISKIKKEQEQKEK-KSELIDDR---VFFLLANLPNII
SYS_VIBPA/1-109EEIKKQIGTLGSDLDAKKV-ELEQVMAQ---LDEFTLSVPNIP
SYS_PSESM/1-107APLMADVERMGNELSEGKV-ELDAIQAE---LDALVLNIPNLP
SYS_CAUVC/1-109ARLMAEVESLKGVMATAAE-AENLADGQ---LKDLLASLPNIP
SYS2_LACPL/1-108SAEIAEMQKVSADVKTLDE-ERRTVDAQ---VQDMAAHLPNMP
SYS_MYCLE/1-106PALLERAKDLAEQVKAAET-TQAETAAA---FAAAYMAISNVV
SYS1_LACPL/1-108QALIQQVKQLNGDIKSTEA-AQTEVNDR---LHYLAIRFPNLP
SYS_LACLA/1-108SAQIAAMQKVSAEIKAIDA-ELAEIEEN---LNEIIIMLPNLP
SYS_CLOTE/1-110DDIMAEMKELAGKIKKLDE-RLSEIDGS---IEYIMLRIPNIP
SYS_BRADU/1-109ATLMAEVAELKTTMPQLEA-AAKAADEE---LTKELSAIPNIP
SYSC_CANAL/1-112KDLIAEKEKLSNEKKEIIE-KEAEADKN---LRSKINQVGNIV
Q89ZR4_BACTN/1-112EAARARVAELKESNKALDA-TMTQAATD---MQNVLYTIPNIP
SYS_THEAC/1-108AEKK-AVEDINARISDLEN-KLKKIEEE---RDRILWTIPNLV
SYS_HALSA/1-109QEAIERSQALKDELADVEA-RADDLEAE---LERLLLTLPMVP
SYS_WIGBR/1-107DIYKNKSNKINILLNEKKQ-KLKKIKKE---IDNYLSTIPNIL
SYS_BACHD/1-108DHLIKEMRDVSDEIKGLDE-TLRQLDEE---LDQLLLAIPNVP
SYS_THEEB/1-112QALKAEANALKQKLSDLEP-QERQLKEE---LESLLLTIPNPP
SYS_STRMU/1-108SEQIADMQKLSAEIKALDA-QLVEIDGQ---LKTFTTTLPNIP
SYS_CAMJE/1-104ESLKAKLSENKSKINEQSA-KVNALENE---LEEIAHAIPNIP
SYS_STRA5/1-108DEQIAAMQTLSADIKAIDA-ELADVDAN---LQSMVTVLPNTP
SYS_SHEON/1-107DAIMAQVGDLGAQLDAKKV-ELAAVLEE---VNAIAMSMPNLP
SYS_UREPA/1-109QQTLDLVNNIKNELQDISL-TLSNKQDE---LNKLLLVIPNMP
SYS_OCEIH/1-108EPAIKEMREVGQEIATLDK-QLKDIEEK---LEQIMLSIPNLP
SYS_DEIRA/1-105PGLIQKGKDLSEDLKALEP-QLREQEDA---LKQLLLRVPNIP
SYS_MYCPE/1-109DELKKEMESIKNTLETTNE-ELKTISAK---VDDILLSIPNIP
SYS_LEPIN/1-109TKISASVKLVGEKIKEIES-KLEQEENA---LLNINLGLPNIL
Q9VQL1_DROME/2-115MSEDLPADVTKDLTEIVAE-TLQPLTVN---QIKQLRVLIDDA
SYS_BIFLO/1-106AKLIAETKELSQKVSEYKS-KADSAAEE---YTTAMWKLSNIV
SYS_THEMA/1-110EALIEEGKRLGEEIKALEE-KEKELQKK---LNDLLLMIPNIP
SYS_STRCO/1-106AELLKRAEQLKTDVKAADA-ERDAADAE---TQELLQRLGNLV
Q8IBS3_PLAF7/2-115EDLKKKSLNIKEEIPKYQL-KEKELLKE---RNKYISKIGNLL
SYS_CHLTE/1-111DELIGQMKQVSDEIADLDL-ALSALEAE---IEELLLTLPNKL
B6TBG7_MAIZE/74-177QALVEEGKNLKEGLIALEE-DLVQLTDK---LQLEAQSIPNT-
C5ACG9_BURGB/1-106SAVMAEVGGIGDEMKASAA-KLDEIQSA---MSELMLGMPNL-
C5WTV8_SORBI/1-114KKLMESTDEIKKRLAAKEV-EVQEAKST---LDAKVTTIGNIV
F4IAJ4_ARATH/79-182ERLVEEGKNLKESLVTLEE-DLVKLKDE---LQHVAQSIPNM-
SYS_STAA8/1-107DDVIAEMRTLGDDIKEKDS-QLNEIDNK---MTGILCRIPNL-
SYS_MYCTU/1-105PPLLRRAKELAEQVKAAEA-DEVEAEAA---FTAAHLAISNV-
SYS_BRUA2/1-109EKLKAEVGELKDFLAHAEE-DERRLSKE---LSDALSTIPNIP
SYS_SHIDS/1-107EPLRLEVNKLGEELDAAKA-ELDALQAE---IRDIALTIPNLP
SYS_NEIG1/1-109QAAMDQVAQIKTDLEQAAA-DLDAVQKE---LDAWLLSIPNLP
SYS_THET8/1-102EALIARGRALGEEAKRLEE-ALREKEAQ---LEALLLQVP---
SYS_STRR6/1-108DDKIAAMQNLSAEVKALDA-ELAEIDAK---LTEFTTTLPNIP
SYS_XYLFA/1-108SSLMAEVAAFSDDLKASEI-ALEEIRTE---LEKVALGIPNLP

PF10458

SYV_OCEIH/818-883ESVVEEEKR-----------KEKDYLDK---QAKVKTRLSELK
A3DC83_HUNT2/816-881QKVVEEEKK-----------KKEKYQEM---YDKVVERLNGLK
Q2KY84_BORA1/893-958AAVVEQEKA-----------RVAQFNET---LNKVRDQRSKLG
Q28LL8_JANSC/961-1026AEVVEETKA-----------NLKAREEE---EARLKQALARLA
SYV_PROMT/868-933KDVVEECRA-----------NLTESEAQ---VRLVKERLMGLD
Q39X26_GEOMG/819-884ADVVAKERE-----------KLTEFSQK---KEVLLASLDKIR
Q587B4_TRYB2/907-972ADVREANKV-----------KLESLVEQ---EAQLTEGLTKMK
A0A132Z880_ENTFC/813-878EEVVEAERA-----------KEKDYLEK---QTAVKERIESLR
SYV_DEIRA/848-913AEVIEEEKR-----------RVADFGAQ---KERLEGVLAQLG
Q2RTE9_RHORT/814-879DEVVEEQRE-----------RRAEYESQ---RDKVRDALTRIA
A4J7L1_DESRM/814-879AEVIEKEKA-----------KEQELSVK---ADALKDRLSMLS
SYV_NITMU/860-925AKVVEQEKE-----------RLAGFSTT---LGKLKEQLQKLG
Q2RL27_MOOTA/814-879AAIVAKEEA-----------RAAELKST---ITALTKRLSYLG
A5D455_PELTS/817-882AEVIEKEKA-----------REEELSGK---QAAVRERLGMLA
SYV_CARHZ/810-872AEVVNKERE-----------KLTAFYRE---KEVLEQR---IG
A5UPL6_ROSS1/836-900ATVVQRERD-----------GLAAVRET---IARLQDRLAQQ-
B1WSM7_CROS5/844-909EAVVQGARD-----------SLAEAEKQ---AEILRERLKRLQ
SYV_THET8/797-862KEVVEAEEA-----------RLKENLEQ---AERIREALSQIG
SYV_PROMM/864-929PNVVEECQS-----------NLAEAEAQ---AELARQRLSDLG
SYV_BACCR/815-879AAVIEGERA-----------KEQDYLEK---REAVRQRLADL-
SYV_LEPIN/816-881PEVVEKERD-----------KLKTLIDK---VEVLKKGIQNLA

PF02912

D3F0H4_CONWI/20-88GAVGKAANEARKALEA----LIDARNAD---LAAAELDV-QL-
D5QGH9_KOMHA/20-88KLRGSALNRLRDELSR----EIAARGEA---LEAEALNA-RL-
R6HCE9_9FIRM/20-88PVMGQLANTVRAEIEA----RLERRKSA---IHAAALEA-RL-
D3FWH7_ALKPO/20-88PLIGQMANEVRDEIKS----AIETKEVA---LETAAVEA-KL-
B3SFN1_TRIAD/20-86KEFGAKVNKLKDYIQK----EIQEVKSH---IEEKILNE-KL-
A5EXT2_DICNV/25-93PQFGKIVNQAKAHFQN----AFNAKKTA---VSQAALQQ-KL-
B2HR20_MYCMM/28-96ADAGKAVNLARGDAQC----SYDERLAV---LRAERDAA-VL-
R5HWY3_9FIRM/20-88PKVGQWVNDTRSAIET----ILEEKMKK---LEADALKK-RY-
R5B0T6_9BACT/18-86RAAGQALNALKAVALD----KINSLRDA---VNAAASKE-EA-
B7AT72_9FIRM/21-89PQVGQIVNETRQAIEE----MLENARTD---LAKKKREL-QM-
SYFA_CORGL/21-89KDAGRFVNMALGRAEK----HFAQVKVV---LEEKRNAE-VL-
SYFA_AQUAE/19-87KEYGKRVNLLKEEAEK----LIKEKEEE---LKERELEE-KL-
SYFA_WOLSU/12-80KEKAKELNQLKGEFER----EWTLKKEI---IATEELHK-KL-
R6NQ38_9FIRM/20-88PLVGQLVNETREAIEK----KLDETKQK---LEAAQMEL-KL-
R6X2S6_9CLOT/20-88PVIGSLVNEVREKIET----VFNQKEEE---LKNKEMEE-KL-
C5ZZ75_9HELI/12-80KTLAKELNLLKMEFEK----ALANKKEE---LSFKELQE-KL-
SYFA_CORDI/32-100KDAGRLVNMARGRLEK----HFAQVKEV---LEAKHLEE-ML-
G2TKP8_BACCO/20-88PKMGALANEVRAAIQT----GIEKKQAA---LEAEAVER-QL-
D2PM91_KRIFD/36-104KEAGQRIGSARKAINE----AYASRLAV---LEAEHEQR-ML-
E6U0I2_BACCJ/20-88PKVGQAANEVREAVAT----VIEEKEQK---LEEAALTE-KL-
C7N307_SLAHD/22-90AVVGKTVNEVRQTIEA----ALDEHKAI---LERSELLA-KM-
R6AP89_9FIRM/31-99PVIGALANTVRTDVEA----VIAAKAAE---LKAKRLEE-RI-
D3QAE4_STANL/38-106ADAGKRVNTARQAVTV----AYEARAEV---LAAEAAQR-VL-
SYFA_PELPD/20-88PVVGQMVNSIRDEIES----GIEAGLFA---ARERARDE-KL-
R6CNS1_9FIRM/20-88PVIGQLANKVRADIEQ----AVTSAQNA---IKSKAAAM-KL-
SYFA_PROMM/29-97PLVGQRANVLKTQVQN----LLGERLQV---VKAAALAD-RL-
SYFA_GEOKA/20-88PKIGALANEVREAIQQ----ALEAKQAK---LEQEEVER-KL-
D2RJL9_ACIFV/20-88PKIGKMVNEVRAKMEQ----RINEQMKL---LEAHQMEE-KL-
G2KW84_LACSM/22-90PVVGSFANTIRDELAT----AITTKQTE---LENAKLNA-KL-
SYFA_PSEPK/19-87PKVGALINDAKERVTV----VLNARKAA---FEEAELSA-RL-
SYFA_LACBA/22-90PKVGAFANEIRDDLTA----ALTKRREE---LENAVLNA-RL-
SYFA_RUTMC/19-87PKMGEAINQIKVNIQV----LLADKKNN---LELIALEK-RF-
K4KFC7_SIMAS/19-87PAAGAEINKAKQAVQD----QLNLRKQA---LEEAEINA-KL-
H5WKC4_9BURK/19-87KTRGAEINQAKQAIET----ALTARRQA---LADAELNA-QL-
R6MN70_9FIRM/20-88PVMGQMANNVRAAIEE----KLEEAKTT---LKAKALEQ-KL-
C6XKF6_HIRBI/23-91QEAGPKLNGLKTRLAD----TITARKEV---LETEALNA-QL-
A7IGN3_XANP2/31-99KVMGPAINGLRDRVTG----LITHRRSA---LKTKALEA-RL-
B1WVT1_CROS5/33-101PRVGSLANEVKESLQS----HLDNQRNS---LETAKLKA-QL-
E1VUN8_GLUAR/40-108AVAGKLVGSARGRVNK----ALAARTVV---LEEAEAAR-IL-
M5DSW2_9GAMM/19-87PKIGAVINVAKDQVQD----AINARKLA---LETAALNA-KL-
F2NPL4_MARHT/13-81REKGRLLNEWKRALEA----AFEERAEA---LKRAALEA-KL-
D3EQU2_ATETH/27-95PYVGSFANKVKNVVQK----QLDEKLHD---LSFAELKA-KI-
E6SIV5_THEM7/50-118PAFGQRANAAREAVEA----ALARRRQE---LEAQQEQR-RL-
SYFA_STRR6/25-93PIIGKHVNEARDVLTA----AFEETAKL---LEEKKVAA-QL-
D7BE71_MEISD/14-82KEKGRALNEIKEKLTA----ALAAREAA---IKEQSLQE-QL-
SYFA_DEIGD/13-81KRRGAELNALRQAIDA----ALTEREAV---LKRAALDA-RL-
I5AR65_EUBCE/24-92PKVGQLVNEARDQITE----KLEAAKQK---IEMQQMEL-KM-
R5Y6B3_9FIRM/20-88PVIGQLANEIRADIEK----KIAEKSAQ---IKEAELKH-RL-
SYFA_GEOSL/20-88PRMGQMVNTVKDRLET----TLEETLQR---VRAAAKKE-RL-
SYFA_CHRVO/19-87KAAGATINQAKQAFEA----AHNDKRDQ---LNAAKLEA-QL-
L0DY04_THIND/19-87PRAGQAVNEAKGELSG----RIEARQRE---LAAAEVAR-KL-
SYFA_CHESB/19-87QVMGPAINGLKNRVTE----ALAARRAE---LRDIAIAA-RL-
F6B409_DESCC/20-88PRIGQIANEVRQQIEA----ALEARNQA---VKEAQKAK-QL-
SYFA_LACLA/22-90PVIGALANAFRDEFGA----KFEAKKVE---IEQAVMNA-AL-
SYFA_ECOLI/19-87PAAGAVINEAKEQVQQ----ALNARKAE---LESAALNA-RL-
S5TIM3_9CORY/29-97KDAGKMVNIARGSVEK----HFAEVHDR---IEAKEKAE-QL-
W6AA06_9MOLU/21-89QEAGKLANEIKTQILN----TINELQEK---FDQDDLKL-QL-
SYFA_LARHH/19-87KAAGATINVAKQQFEA----AHNARRDA---LNAARLEA-QL-
SYFA_HISS2/21-89PAVGAKINEAKQKVQA----ILNAKKVE---WEEIALNE-RL-
B0N0V6_9FIRM/20-88KTFGQTSNLVKQELSK----AVEDKKEA---LENQAILD-KI-
E6U2U6_ETHHY/21-89PVIGALANEVRASIED----KIAAAAAA---LRERQMQE-QI-
E4U4K5_OCEP5/13-81KARGQELNRVKQAIEK----ALEEREAE---IKAAELAA-KL-
G2KS35_MICAA/23-91KETGAALNVLKDEIAD----LIARQDAA---LKKQAMDQ-KL-
SYFA_THISH/19-87PAAGQAINRAKETVNE----ALSARLEA---LSAAEQEA-RL-
E6WZU0_NITSE/12-80KAFAEGLNRKKAQLQA----RFDERLSA---LKEARLQE-QL-
A8F395_PSELT/17-79PGAGKILNELKDAVQR----AIEQKKEM---LK-------KI-
E6VRJ1_PSEA9/27-95PAGGKKANEVKQCITT----LLDAWQAE---LSQAESGR-AL-
Q2VYY9_MAGSA/19-87KAAGAALNAARGEVEG----ALAAAKAT---LEAKAWTS-VW-
SYFA_ERYLH/19-87QKAAPAIQAVRAEVAD----AIAARKDA---LEREALEA-QL-
Q6KHX3_MYCMO/11-79ASIGQKINFYKQEIEQ----FFLTKKEE---IEKKEVLK-KI-
K0J3E3_AMPXN/20-88PVIGELANKVRGAIAD----AIEKEKAT---LEEAALNE-RL-
E6S8E4_INTC7/36-104AEAGQRVGQARGRVSA----ALTARQAE---LEAERDAR-IL-
U5LEE3_9BACI/20-88PKMGALANEVRDSISS----AIEEKQEK---LERAAVEQ-KL-
C7LV64_DESBD/24-92PAAGKAANQVKVAMTS----LWEEQVAA---LKSRAREQ-AL-
D5UZC0_ARCNC/12-80KAFAQDLNTKKIEITN----ALESKKEI---LEKIELNK-KL-
SYFA_THET8/13-81RKRGQELNAIKAALEA----ALEAREKA---LEEAALKE-AL-
R5TBA8_9FIRM/87-155PVMGALANTIRETVEK----QFTEKLEE---LKAKKLEE-KI-
R6RV93_9CLOT/20-88PVIGQLANEVRENITQ----LLESAQAD---IKTKERNA-KL-
D4H1G6_DENA2/19-87KEFGMKLGELRNGFEA----LFNSKETE---IAKSELDA-KL-
I0KCE2_9BACT/18-86RALGQQLNGLKNRAQE----RFAAFQEV---VDAQQQAA-AA-
R5NL52_9FIRM/20-89ASYGKGVNELKEWAIN----YFAEIEEK---IKAKELEE-KY-
E1VIK1_9GAMM/19-87PQAGAEINQAKVQVQD----ALNLRKAL---LEQQALER-RL-
SYFA_FLAPJ/18-86KEFGQVINLLKTIAEE----KVKTITEE---LESKEEIK-SL-
SYFA_CAMJE/12-80KEFAAKLNAQKEIFNE----AYLAKFKD---LENLALEE-RM-
J9YYI7_9PROT/18-86KTIGAQINSIRDKVDT----LIKEKLLE---IKTNEINS-KL-
R5IR39_9FIRM/20-88PVMGQAANNVRAAIEE----KIETVRAE---LKEKAMEA-RL-
K4L6C1_9FIRM/20-88PKMGQIVNELRTQLED----AWDKKWRE---FEKNALES-RL-
D6Z8H5_SEGRD/20-88AESGKAVNAAQAEIKA----AHNARQTQ---LEAERERF-VL-
K9V4Y0_9CYAN/27-95PKIGAIANTVKEAIQT----SLERQRTS---LESVKIRA-QL-
D7BP30_ARCHD/27-95PIAGKLMGGARKEIQA----ALAEATER---IEAAAEAR-ML-
SYFA_RICPR/19-88KEFGLKINTLKDKIHD----IIKAKAQN---LEAEELHL-KL-
D5A3B3_ARTPN/27-95PRIGAIANEVKQALQT----QLDQRRTA---LELALIEA-QL-
L0FSK7_ECHVK/19-87KAYGQLVNSVKQAAEE----KFKALIDK---VNEGERTS-KS-
SYFA_STRA5/24-92PVVGKQVNEVRDILTK----AFEEQAKV---VEAAKIQA-QL-
SYFA_NOVAD/19-87QSEGPKIHAAREAVTT----ALAERKSA---LEGAALEA-RL-
B1ZQM9_OPITP/20-88PALGKLINETKGQLQQ----QLDAALRT---IEAGELQA-QL-
K9RTF0_SYNP3/30-98PRLGALANILKDEVQA----SLEQKKAA---LQTAQIEA-QL-
Q12BQ9_POLSJ/22-90KSRGAAINLAKQAIEA----ALNDRRQA---LANAELEK-QL-
SYFA_RHOCS/19-87KERGQQLNALKDRVAE----AIEARRTV---LKKEALAQ-RL-
SYFA_EXISA/20-88PIIGELANTVRTAIQS----TLDARIEE---VKAIELEE-KL-
E3DR66_HALPG/22-90PIVGKNANILKNKIQN----WINEHQQK---LAAEAAEK-RL-
Q98QL3_MYCPU/9-78KILGQELNDLKQKYEK----IFEEINEN---IKSYNIKKRND-
SYFA_COXBU/20-88PLLGKAVNEIKREIQQ----LLNAKSTQ---LREKSLQE-KL-
SYFA_STRT2/24-92PTVGKMVNEVRDVLTE----AFDEAAKV---VEAAKIQA-QL-
SYFA_HAMD5/19-87PAAGRVINQAKKQIQQ----WLDTRKKT---LQSELLAR-RL-
R6U6G1_9CLOT/20-88KDFGKRVNDLKGAVAK----SIEEKTAE---LKEKEIQM-EI-
V4IYP3_9GAMM/24-92PAVGQIINQVKTAVQE----QIDVRKQA---LQRVALEQ-RL-
R6VD34_9FIRM/20-89KTTGQLINTFKQEVIA----KFEEKEKE---LIRLEEERAIN-
I7GZ45_9HELI/16-84KIQAKILNTFKQEFES----KLTEKKES---LFVAQMNE-NL-
SYFA_XANCP/19-87KAAGEAINLARDALTT----ALSERKQV---LETAALDA-RL-
SYFA_METPP/19-87KARGAEINAAKQQVEA----ALTARRQA---MADAELAQ-QL-
E3PXU7_ACESD/20-88PVIGKIANEVRGEIES----IIEEKKSS---LKLAVINQ-KL-
V6F5W0_MAGGM/19-87KAAGAAMNKVKDEVAE----AINVAKTL---LEAKALDQ-RL-
C8WKG2_EGGLE/39-107AAVGKTANEVRAAVEG----ALAARKEE---LAASELAA-AI-
A7I0N3_CAMHC/33-101KEFAKKANEKKELYNN----LISEKRSE---LEAKKQNE-FL-
F7YY40_9THEM/17-85PKVGKLLNELKDKIEA----MIEEKRYQ---LKQEEERK-AI-
SYFA_NITEU/25-93PVMGERINQAKKLLED----ALIERRNL---IQEKNMSA-RL-
D2S8R2_GEOOG/36-104ADAGKRVNAARVAVTE----AYETRRAE---LEAERDAR-VL-
R5UWU8_9FIRM/20-88PVMGQLANAVRSDIES----AITKQQAA---IAEAALEQ-KL-
SYFA_PHYAS/21-89PAIGKLINEFKKTIIL----SLQKEKQY---LKTQKMNL-EL-
E3CXV9_9BACT/23-91PALGQAVNRLRDACEE----SLKVRAAE---LREQEEEA-AE-
F4LW88_TEPAE/20-88PIIGKLANEVKADLEQ----KISEKMQQ---LRKTLKDS-KM-
B8HPR9_CYAP4/30-98PRIGALANDVKEALQT----ALEQKRSD---LQTAQIQA-QL-
F7V6I9_CLOSS/20-88PKVGQMVNEASRKIEG----QLDARKRE---MEQQELLR-RL-
A1SJI4_NOCSJ/36-104KEAGQRIGQARGAVNQ----ALAARQAV---LETEQEER-ML-
X5ECJ7_9CORY/27-95KDAGRLVNQARGRIEK----AYASAKSA---LEEKRNAE-VL-
D5X0W5_THIK1/19-87RARGAEINLAKQAIEQ----ALQRRREA---IEQAALQA-QL-
D1A1M3_THECD/36-104AEAGKRVGAARKAVAE----ALKRRQAE---LEEERDQR-VL-
R6LMC9_9FIRM/20-88PKVGQLVNETRAAIEE----LLDETKKK---MDAAIREE-KL-
A0A3E2XLR3_9FIRM/20-88PAFGQMVNEARQEIEN----SLDTMKKD---LAAKAREL-QL-
F0S361_DESTD/21-89KEFGKACNILKGEIES----LIKEKQSY---FKEIEKKK-KL-
I4B6L1_TURPD/23-89TAVGKAANTFKAKLDE----LLAAKEKQ---LTESKFAS----
SYFA_AGRFC/19-87QTRGAAINQLKTEITD----LIGERKNA---LKDAAIAA-RL-
SYFA_AGARV/20-88PKVGQWVNETREAVEK----LLDEKVKK---FEAEALKR-KY-
E8RRV8_ASTEC/45-113KATGAAINAVRDQIQA----ALDARKDV---LEAEHLSR-RL-
SYFA_PELTS/20-88PRIGQAANEIRDFIEK----ELAARTAA---LKEMVKEQ-KL-
SYFA_MYCLE/22-90AAVGKQVNTARSEVQR----DYDERLAT---LQAERDAA-VL-
SYFA_GLUOX/20-88KERGQALNRLRDELTA----AIEARGRD---IEEEALQA-RL-
SYFA_DESVH/22-90PRVGQAANTVKQALTE----LFEQRKVV---LEQAKEAA-AL-
F4F3N9_VERMA/36-104ADAGKRVNEARRSIEQ----AYAARSEV---LDREQAQR-VL-
F9ZSL9_ACICS/15-83REAGQKLNVLKDDIQE----WLEARRRV---LEEEAMVA-RL-
S6ATC8_PSERE/19-87PKVGALINAAKERVQE----ALNTRKES---LEQAALSA-KL-
SYFA_CLONN/20-88PVIGKLANEVRGSIEE----LIEKAVTE---IKLKEKEA-KL-
G7UR80_PSEUP/19-87KAAGESINRARDVISQ----ALTQRKAV---LEDAALDA-RL-
D7GNY8_9FIRM/20-88PNVGKTINEFKNQVEA----RYQEMKNK---MDELELAA-RN-
W8FCV6_9BACT/19-87RAVGQELNQLKQAAQT----RFEQRQQE---LEAASANA-PA-
D9QKI2_BRESC/19-87REQGPVINGLRDRVTS----AIAEKKAG---LEAAELDA-RL-
D9SF45_GALCS/31-99PAAGARINQVKQVIEA----ALQQRRDT---LAQAKLDA-KL-
F7ZZ47_CELGA/39-107GAAGRLVGQARGRLTA----AIAARQTT---LEAERDAR-VL-
R5ASX9_9CLOT/22-90AAVGAEANRVKQAVEA----ALNERRAA---LEAAAQAA-RF-
F4H7U9_CELFA/29-97GVAGRLLGGARARLQQ----ALAERQTQ---LEAERDAR-VL-
E4RLI2_HALHG/22-90PVVGKEANQLKSKIEN----WLNEQKEV---LESKAAKE-RF-
SYFA_ACAM1/24-92PKIGGLANQVKEALQQ----GLEQKKSD---LNQAAIAA-QL-
SYFA_HELHP/12-80KTFAKELNKNKENFEK----MLESKRES---LLKVQMNE-NL-
R6G2K4_9FIRM/20-88PKVGQMVNEARAGIEA----KMEEKRTA---IQKKLREE-KM-
I2F4U8_9BACT/19-87REYGKTVNEYKNFIEE----ALNRRKSE---LENKAKKE-RE-
D6GSI9_FILAD/20-88PTMGKIVNEVRDEIET----AIREKKEH---LENIALEQ-KL-
SYFA_MESFL/20-88QAIGIASHELRTFIAS----TIDEFVAR---IKKEALDA-KL-
R7LG46_9BACT/19-87REIGMKLNELKTALQN----KFNELRQN---LATQEDDY-TD-
SYFA_HELMI/20-88PLMGALVNEVRAELEF----KLEEKSRE---LKAREKEA-RL-
R4U488_9MOLU/20-88LIVGQLANKIKGELTA----LWQATRKE---LELAELTA-KL-
SYFA_MYCMS/20-88QEIGKLANQIRVEIIN----QLNEKQEQ---LKNKELLV-KL-
SYFA_ACISJ/19-87KTRGAAINVAKQAVEA----ALAARRQE---LADAELQA-QL-
G8PDN9_PEDCP/22-90PKVGEFANRVRDNLTA----TIEKRRTE---LEKERLNR-KL-
K9UIS3_CHAP6/23-91PAIGAAANVVKDAIQA----RLDRSKTD---LQTAQIQA-QL-
R6TA42_9FIRM/20-88PVMGQLANDVRAALEA----AIESRSDA---LAQEAMAA-RL-
R6NNV6_9FIRM/20-88PKVGQWVNEVRAELEG----LLEETKAK---LEAEALEK-KL-
SYFA_HERAR/19-87KTQGAVINSAKEKIEA----ALTARRDA---LSNAQMES-RL-
SYFA_AZOSB/19-87REAGAAINRAKTAIEA----ALEARRNA---LREAALLA-QL-
S5XVV2_PARAH/19-87QTTGASLNRLRDEIDA----ALRARREG---LENAALDA-RL-
A5IXK6_MYCAP/11-79KLIGIKISELKIFYEA----KFKEVEKR---LEKEKINK-II-
Q01SP8_SOLUE/21-89KRIGQVLNAAKQELET----ALDARKRE---FDDAVLRA-RL-
B9KHH4_ANAMF/26-95KAVGSAANAACAALKL----AIQDRESQ---LAREQLHS-RL-
E1X2F2_HALMS/20-88KAIGPKANDIKNNITD----MVAAKLTA---IEAQEINE-KL-
R6MS00_9FIRM/20-88PQIGALANEIRGVIEN----HIDTKKAE---ISEKLEEI-KL-
X4ZW87_9BACL/20-88PVIGQVANTVRSAIEE----IISAKQEA---FQEQETLK-RL-
R6DM83_9FIRM/20-88KTMGQAVNTFKQSVAD----AIGRKAEE---LHKLAVKR-EL-
SYFA_GLUDA/20-88KLRGAAVNRLRDDLTR----EIEARGAE---IESAILNA-RL-
E8MZH5_ANATU/22-90PQIGQSANAVKQALEA----AYQEKLEA---VRRAALEE-EL-
SYFA_STAEQ/22-90PAYGQKVNELRQTIQS----ELDERQKL---IKEEKLNQ-QL-
D2UDK3_XANAP/19-87KQAGEAINRVRDTVSA----ALAARRAL---LDTAALDA-RL-
T0VHA3_9ENTE/22-90PKVGSYANEIRDAVTQ----AIEEAKTS---LEAAALEK-AL-
A0A388SC18_9BURK/19-87KAAGAEINAAKRAVEE----ALNARREA---LAQAALEK-KL-
H1XPD0_9BACT/20-89PLFGKALNELKKELET----QYQALAAS---FKDKEAAKRRI-
A8HWM7_AZOC5/27-95KVMGPAINGLRDRVQG----LLATRKET---LKSAALEA-RL-
SYFA_AERHH/19-87PAAGAVINQAKQQVQD----ALNERREA---LEIAVLNQ-KL-
SYFA_TOLAT/19-87PAAGQLINQAKEKAQN----ALNERREA---LTTAELAK-KL-
R6IN57_9CLOT/20-88PVIGQLANEIRKDIED----TIANKSAE---IKKAAQEK-RL-
R7KRG6_9FIRM/20-88PVIGQLANKVRSEIEA----KITEKAEA---LKSEAAAN-KM-
SYFA_HUNT2/20-88PVIGQLANEIRAYIES----RIEEARNE---LIKKERSQ-KL-
G0VPM6_MEGEL/21-89PKIGQLVNTARNAIEE----QLKAKMEE---VKAQELAA-KI-
A5GUT5_SYNR3/29-97PVVGQRANVLKTQVQS----LLQERQSA---LKEAALEA-RI-
C7M0T2_ACIFD/36-104PVLGRVVAEARASLTS----AIEAAEAR---LDAAELLE-RA-
K9P790_CYAGP/29-97PLVGQRANRLKDQVQQ----LLGARLEA---VRSSAMAE-RL-
R6B6R7_9BACT/19-87KTIGVKINELKQAVTE----RINALKEQ---MEEADASS-DD-
SYFA_CELJU/19-87PAAGAEINKAKDAVQE----ALNTRKQL---LEQAAINA-KL-
Q189P4_CLOD6/20-88PVVGKVANEVRENIEL----SINSKKEE---INAIEKER-KL-
D9QUN5_ACEAZ/20-88PVVGKLGNKLKSKLEN----VIAERKEE---LKQAAKKE-RL-
F2JID4_CELLD/20-88PVVGQIANEVRADIEA----SLANKKVA---LESAEQNK-KL-
R7IV52_9CLOT/20-88PKVGALVNEARKEIEE----KLSIAEEQ---IKSKMLEE-KI-
R6P7N0_9CLOT/20-88PVIGSLVNQVRDELSC----LVEDKEKQ---LKKEELLK-RL-
I4CA98_DESTA/20-88GQVGQLANKIKAELET----LFDRAETA---LQQKAESA-KL-
R7GMW7_9FIRM/19-87KTFGQVSNKTKQEIGQ----AIEEKKAY---LEEKALNE-RL-
G2SPC6_LACRR/22-90PKVGSFANAIKEELAT----AIAEKCEK---IEIERTAK-QL-
SYFA_ACIF2/20-88REAGQLLNERKSEIQS----LLQERKAE---LEAAAIHA-RL-
A9WQ67_RENSM/39-107ATAGKLMGAARGQVNQ----ALAARTEI---LEAEAAER-IL-
SYFA_GEOLS/20-88PKVGQLVNTVKDEVEA----LIEQTMNR---AREEATAK-RL-
K0CI96_ALCDB/20-88PKAGALINEGKQRVQD----AIEERKSL---LQEQVLNA-RL-
SYFA_GEOUR/20-88PVIGQVVNTVKGELEA----KIESAGLK---IREDIKAE-KL-
A1SUQ5_PSYIN/31-99PAAGQMINKAKQAIQA----VLVARKQA---MEAEILNA-RL-
D5WS18_KYRT2/20-88PRIGRLANEIRDALEE----ARASRQDA---LKEEERRR-RL-
D9T5W1_MICAI/36-104ADAGKRVNEARRAIES----AYAARQEI---LDRERAAR-VL-
C6WX39_METML/19-87PAAGAAINVVKQAIEA----ALTARRES---LLNAEQAK-QL-
R6TDN0_9FIRM/20-87KEAGRVINDAKQYIEG----RLREKAEE---IAKREEQ--RL-
R7GHP6_9CLOT/22-90KEIGMISNQYKTELSE----AFDAKLAE---LNDAEINA-RL-
R7N4V7_9FIRM/25-94AGYGKSVNELKTWAFD----KFADMEEK---MKKLELQH-KY-
C0Z9E7_BREBN/20-88PVVGQLVNEVREALEA----AFSGKQKA---FEEAALFA-KL-
D7GEE1_PROFC/31-99KTAGALIGQARGRVNK----ALKERAEQ---IADSELAA-QL-
F2I081_PELSM/19-87KEFASQLNILKTRVLE----QFSILHTK---FEQEEIQK-KL-
F3YW55_DESAF/27-95PLAGKTANTVKERLTT----LLSERQTA---LEQAQAQA-EL-
SYFA_IDILO/18-86REAGQKINEAKQQVQT----SINARKEL---LKAAELAQ-KL-
D0LY94_HALO1/25-93RHVGEVFNRVKGEISD----AVTTKLAA---LEEAAEAA-DL-
R5B562_9CLOT/20-88AKLGQASNAVKKELEQ----AMAERRAK---IAQLMQQK-AF-
A0A086ZFH0_9BIFI/27-95KEAGKLMGKLRADFGR----AFGTKQQQ---IKAEEEQR-AL-
C7Q9J1_CATAD/36-104AEVGKRIGEARGAVKA----ALAARQEA---LETERDAR-VL-
SYFA_FRATT/19-87PKLGQAVNIAKQALQE----AINLKLAN---FEEQELNE-KL-
SYFA_ZYMMO/19-87QEKGPVIHSLRQAVAQ----GIADRKQA---LETALLNE-KL-
M4R8Y3_BIBTR/19-87PVVGAKINEAKQQAQD----AFNAKKEQ---LETAELNA-KL-
SYFA_LACJO/22-90PKVGQEVNQVRDLFQK----QLDEAKNN---FLQTLIAK-KL-
SYFA_BACSU/20-88PKMGALANEVRERIAN----AIADKNEK---LEEEEMKQ-KL-
B0JLL0_MICAN/27-95PRLGAIANEVKELVQS----LLESRRES---LQNAQIKA-KL-
D5X800_THEPJ/20-88PRVGQLANEVRAKLEE----ALAARLIT---LKEAARQE-RL-
SYFA_LACPL/22-90PKVGAYANEVRDRIQA----AIDERREE---LEQAAVNE-QL-
K0K6A5_SACES/36-104ADAGKRVNEAQNAVKL----AFEERRAV---LQVERDER-VL-
D7CNG9_SYNLT/20-88VTVGKIANELKLRLET----LLEDKLEQ---LKQAEEKL-RL-
R7MJD6_9FIRM/20-88PVIGQLANKVRADIEE----AVGQKLAV---LKASQQEA-EI-
B8D293_HALOH/22-90PVIGKKANILKNKLNN----IIIKKKAE---LEELAKQR-KL-
F3YAD3_MELPT/22-90PMVGSFANNVRDLLVQ----AIEERKEV---LEQEALEQ-SL-
SYFA_PASMU/19-87PAVGQKINDAKQLAQN----ALNEKKVQ---LETAELNA-QL-
D5CSM8_SIDLE/19-87PAAGARINQIKQQIEA----ALQAQRDA---IQRRALQA-KL-
W0ELN7_9BACT/18-86REVGKQLNELKERAVE----KLNELKSE---FEDTHSDE-QN-
H0UKB5_9BACT/28-91PTAGKIINDAKNELSA----LLDGAIAR---KTKEAMDE-AE-
L0F475_DESDL/20-88PIFGQVVNETRDILEE----AWSRRSEE---LEQATLQK-QL-
R6DZH5_9BACT/19-87KTIGIKINELKQTALQ----KINSLREQ---LEESEAAA-DD-
F7XVN5_MIDMI/19-87KQLGLEINTVREYILK----NLSEKQKE---LEELELVQ-KL-
H5WWU4_9PSEU/36-104AEAGKRVNEARQAIQT----AFDARRAA---LQAERDER-VL-
F7XXQ9_MOREP/19-87PAAGVVFNQAKYDVQQ----ALIERKTK---LSKSALKD-RL-
SYFA_OCHA4/19-87QAQGPAINGLKNRVTE----ALTERKTE---LRKQAIAA-RL-
R7EK62_9FIRM/20-86PVVGQLANKVRAEIEN----AIAERTAV---QKQKALEA-QL-
G4QLB8_GLANF/18-86PAAGQKINQAKQEVQG----LINAKLKA---QQEAELNE-KL-
SYFA_METS4/19-87RERGPLINGLRDRVQG----AILARRET---LAEAALAA-RL-
R5RYR4_9FIRM/20-88PVIGQLANEVRAKLEE----SVETRAKE---LAAKALEM-KL-
E3GNL2_9FIRM/20-88PVIGKLANEVREEIET----GLAGKKEA---LETAEMMA-AI-
T2GAK0_DESGG/37-105PALGQAANRVKEAISV----RFDDALAA---LEKAKADA-LL-
D1AVE8_STRM9/20-88KEFGAIANEIKTELQE----KFDEKLLK---LREEAKKI-KL-
R4KE67_CLOPA/20-88PVIGKIANEVREKIEG----IINEAMDS---FNQREKEE-KL-
Q0AAL9_ALKEH/24-92PQAGQAINAAKKQLQT----RLEARKAI---LEARAMEQ-AL-
D3DJY1_HYDTT/20-88KDYGLLINTIKEGVEK----LLREKEEE---LRHLEVEE-RL-
SYFA_XYLFA/21-89KAIGEKVNCVRDLISV----ALMDRKAA---LESAALSK-RL-
SYFA_SYMTH/20-89KAMGALGNEIKQAITA----ALDAREAE---LAAAALQA-RL-
SYFA_CLOPE/22-90PIVGKLANEVREVLEA----ELEAITKA---VKEAEKQE-KL-
R5R6S6_9FIRM/20-88PKVGQLVNETRAEIEK----VLEDSRKK---MEELVREA-KM-
S6B2P5_SULDS/19-87REAGARINQAKDLLEQ----ALKDRREA---IQERLLQA-QL-
F8C4E3_THEGP/21-89KYLGKELNELKDLLEE----KLKEKERE---ILFREEDK-DL-
F2NFL0_DESAR/21-88PQFGQEANRLKKLLEQ----QLASAHDC---LKKAALEA--E-
D5EXW8_PRER2/19-87KTVGMKINELKTLATE----RINQLREE---CETQEGGE-EA-
R6E265_9FIRM/31-99KEFGMAANQVRSEIEK----MLDASFEQ---LKNKAKEA-KF-
R6QQ94_9CLOT/20-88PKVGQLVNEAREEIET----ALNNAKTA---MEKAIREA-KL-
R6R5N3_9FIRM/20-88PKIGAMVNDTRAAIEE----KLEEIKNS---LASAAREA-RL-
R7XSC5_9ACTN/36-104KEAGARVGQARGAINK----ALGERSAV---LEEEHEAR-ML-
F2LY11_HIPMA/16-84KEFGKKINELKEFCER----LLEDKSKE---LFERAKQE-SL-
A7HPL0_PARL1/20-88KEMGPKLNGLKDRLTE----ALGQRKQA---LHEQALEA-RL-
R6QXL8_9FIRM/20-88PMVGQMVNDTRAAVEQ----ALEKEMAL---LKKKIMEE-KL-
Q4A6A0_MYCS5/9-77AFLGQKISKLKNKYQD----FFEKCEEK---IQKLKIQE-KI-
D1C4D6_SPHTD/20-88PAFGQAVNALKTTLQG----SFDRRQEE---VRRAELTQ-RL-
R6BMJ6_9FIRM/20-88PFVGQMVNETREAIEE----FLEETKKK---LEEKAREE-KM-
SYFA_ACIAC/19-87KSRGAAVNVAKQAIEQ----ALNERRQA---LADAELQA-QL-
SYFA_ALCBS/19-87PQAGAVINEGKQKVQD----AIADRKSA---MEEAALKQ-QL-
M4SHK9_9SPHN/19-87QVQAPLIQGLRTEVAD----AIAARKAA---LEGAALEA-RL-
A1WU57_HALHL/24-92PQAGAAINAAKERVSQ----RIEARRSE---LERAALEQ-RL-
R5YQL5_9FIRM/20-88PKVGQMVNETRAAIEE----KMEEVKNN---LAAKAREA-KL-
G2J1F0_PSEUL/35-103KAAGAAINAAKQAFEA----RHNERRDL---INADKLAR-QL-
SYFA_SORC5/25-93KALGQRLNAVKGRVER----AREEATAR---IKRAARDR-EL-
L0RXE4_MYCC1/8-76KHLGQKITELKNKYQD----FFIKAEER---IYEIQINN-RV-
SYFA_DESDA/22-90PAVGQTANSVKERCNA----LFESRKGA---LKAGREAE-AL-
D3IE04_9BACT/19-87KTVGMKINELKQLAID----KINELKEN---TCSAQTQN-SL-
SYFA_MYCPA/28-96ADAGRRVNAARAQAQQ----AYDERLDV---LRAERDAA-VL-
L0H1M4_9GAMM/23-91PQAGQAINRAKQAVQA----ALDERRAA---LEEAALAA-RL-
K7RLS0_ACIA4/36-104KDAGRRVGSARGTVNK----ALAARTAE---IAEAELQA-SL-
U5RSK4_9CLOT/23-86PAIGKLANEVRSTLEN----AIEEASKK---IKSSAIQA-KL-
R7GEQ5_9CLOT/20-88PVIGSLVNEVRGKIEN----LISRKEEE---FKKIELNK-KI-
SYFA_METRJ/19-87KERGPLINGLRDRVQG----AVTARKTE---LAEAALEA-RL-
E1VCP7_HALED/19-87PAAGERINQAKQALSA----DLEERKQA---LEKADLEA-RL-
B1VH38_CORU7/34-102KDAGRIVNMARGRVEK----LFAQVKAE---LEEKRNQE-AL-
A4SX37_POLAQ/19-87KSAGAQINQIKTQVEA----ALQERRQA---LADAVLQQ-RL-
SYFA_METSB/19-87KTEGAAINALKDAVNT----ALSARRGV---LKDAALEA-RL-
B2UP39_AKKM8/20-88PAVGQLLNEARKAITE----ALDAKLEE---VQAQADKA-AV-
SYFA_SPHWW/16-84QAEGPKIHALREAVTA----AIADRKAS---LEGAALEA-RL-
SYFA_BUCAI/19-87KKHSIIINKKKQEIIS----KINIKKQK---LSVYILEQ-RI-
SYFA_AZOPC/18-86REIGQKLNSLKVKIQT----KIDQLKET---LGCQDLSE-NL-
L0EXG1_LIBCB/19-87KLQGAAFNKLKDEISE----AISLRKTV---IRNKALEL-RL-
C8W0F2_DESAS/20-88PKIGQVANEVREQIEV----ELGNRLNK---LKAIEKQI-KI-
D3RRM3_ALLVD/24-92PAAGQAINQAKDAVQQ----AIETRKSA---LEQTALAA-RL-
SYFA_HELPY/12-80NAFAKEIHHYKQAFEK----AFEWKKKA---IIELELEE-RL-
A8LE36_FRASN/36-105AEAGRAHNAATAKVRA----AYEARLVE---LTARRDAE-IL-
Q31LH5_SYNE7/27-95PRIGGLANTVKARIST----DLDERREA---LGKAELEA-RL-
E0TF60_PARBH/21-89KLAGPLLNQLKERLSV----AIAARKEI---LEHAALEA-RL-
U3GUI6_9CORY/29-97KDAGRLVNMARGAVEK----AFAETKVR---LEEKRNAE-VL-
SYFA_DEHM1/22-88KAAGAAANEAKAALEA----AFLEKEQL---SKEKQFAS----
R7H7C7_9FIRM/20-88PVMGQLANTVRADIES----AIKEKQTA---LQEAALAE-TL-
C4Z1H7_EUBE2/32-100PKVGQIVNETRQAIEE----VLDKAKTE---LAAKKREL-QL-
Q1LT08_BAUCH/19-87PQIGALFNKAKQEVKQ----AILDRKQA---IKLIKIKT-RL-
SYFA_PELUB/19-87KKFASDLNLVKSELEN----LITIKIDD---IEKKEINK-KL-
R6F3S1_9FIRM/20-88KELGQAANKVRAEVEK----LLAETVNS---LKEKAKEA-GF-
J9W5T8_LACBU/22-90PEVGSYANKIRDAITE----AVSDHREK---LEDAALNA-QL-
W0BIG8_9GAMM/19-87PKVGQLVNEAKREISA----CIEKKLSQ---LKEALLQE-RL-
R6WVX3_9BACT/19-87KTVGMKINELKQTVQG----KINELKEQ---IENTEDSC-CH-
A0A418Q7Q3_9CORY/32-100KDAGRMVNMARGRVEK----SYAQAKEA---LERKRNEE-VL-
F8E9V3_FLESM/19-87AELGKKINEIRQDFEA----RYEAKEKE---VELKEKQA-QL-
SYFA_LACRD/22-90PKVGQFANKVRDELSA----AIEEKRAE---LEQAAMNA-KL-
R5E803_9CLOT/20-88PMVGQMVNEARTAIEE----KLEEEKTK---IARMLRTE-KM-
SYFA_LEGPH/24-92PKVGQLVNQAKQGISA----LIETKMIE---LKEKQLLA-KL-
D9RXS8_THEOJ/20-88PAIGKLANEIKEMLEE----KFSRKSLE---LKEALKQE-RL-
C8XIG1_NAKMY/48-116AAPGKFIGQSRRRVAD----AVAVRESE---LIAERDAR-IL-
Q03G90_PEDPA/29-97PKVGEFANKVRDNLTS----KLEERKEE---LAQAALNK-KL-
SYFA_CLOAB/20-88PIIGKLANEVRSKLES----LIVEASEK---IKDAEKKT-RL-
A4CII5_ROBBH/18-86REFGQTVNQLKNAAAE----KVDALREA---LEAGKQAE-TR-
K9YL41_CYASC/24-92PVIGAVANQIKEKIQD----SLSQQQET---LQKQQIQA-QI-
R5SN45_9CLOT/20-88PKVGQLVNEARAKIET----RLEEKRAA---FEKAIQEE-KI-
SYFA_CHLT3/18-86PAVGKLLNELKLFADG----KFKEAMEH---IAANELAA-DD-
E6K031_PARDN/27-95KESGKLMGKLRADFGR----AYDAKEVE---LKAQEEAR-QL-
SYFA_RUEST/16-84QVAGPALNALKDEINA----ALAAKKAA---LGDAALDE-RL-
X2HAV3_9NEIS/19-87KTTGAHINECKNQFQD----AYNRQRDA---LNEAKLQQ-QL-
SYFA_ACIAD/22-90KVQGAAIHAVREAINA----ALTERQTA---LQQAALQQ-KL-
SYFA_CLOK5/25-88PIIGKLANDIRTALEN----AIEEASQR---IKSSERES-RV-
R5Z7J1_9FIRM/19-87PLFGKKVNELKQKLSV----LIDEKREE---LAEQEMQA-KI-
SYFA_DESAG/22-90PVVGKTANAVKESLNN----LFDRRKTA---LEEEREAE-KL-
SYFA_ACTSZ/21-89PAMGAKINEAKQTVLE----ILNAKKEQ---IEQAALNV-KL-
G8TWH4_SULAD/18-86RQRGQMLNQWRAAIVE----KLETKEAW---LNEQAERE-RL-
R6XTB5_9CLOT/20-88PVIGSIVNEVRDNLES----KIKEVEEI---LKEKAMNL-KL-
J7QS32_METSZ/19-87KTEGAKINALKDKAAE----AIAARREQ---LADAALAM-RL-
F5XS48_MICPN/36-104KDAGRRIGQARGQINA----ALKAREAE---IAEVELAN-RL-
H2FW09_OCESG/19-87PAAGQAINQAKQAVND----ALNAKRDA---LQLAELNA-KL-
R5YBL9_9BACE/18-86REIGQRLNELKEIATE----KINSLREA---LNEKSEAD-NT-
I1YF39_METFJ/26-94PVIGKEVNLAKQAVSG----QLDERLQA---LQQAAMQA-AL-
F6IJP6_9SPHN/18-86KTEGPKIHGLRESVTE----ALTSRKEA---LETAALDV-RL-
R5YC76_9FIRM/20-88PKVGQWVNETREAIEA----KLEETKKK---LEAAELEH-RL-
W0HTN2_9GAMM/19-87PAAGAVINQAKQDVQQ----ALAERKIT---LERSALET-RL-
F0RKC4_DEIPM/13-81KARGAEINVVRTAIQA----ALDEREGV---LKREALDA-RL-
SYFA_GLOVI/20-88PVVGALVNQVKARVEE----ALAAQQTH---LQDQLIEL-RL-
F5Z2P0_MYCSD/31-99ADAGKRVNAARTQAQQ----AYDERLAA---LRAERDAA-VL-
SYFA_SULDN/12-80SKIAQELNIHKTTLMN----ELVQRKIT---LQTQELQE-HM-
C4LID3_CORK4/26-94KDAGRAVNKARGRVEK----RFAERKAV---LEEERNQA-VL-
R7DDA6_9BACT/18-86KEVGKLLNELKEKALN----RINELKEN---LDSNSQEN-NL-
F8HZ92_WEIKK/23-91PTVGSMANEIRDAITE----AIAERQVE---FEAAALER-QL-
SYFA_LEPIN/22-90KTVGQKANELSKKLET----FISETKTS---LKKKLFEK-QA-
F8GLG0_NITSI/19-87PAMGSQINEAKNRLEA----TLKCRRNA---IQAKELED-KL-
R6FA66_9FIRM/26-94ADFGKKVNELKNWASE----HFDELNTK---LKEKEMEL-RY-
S6CG63_9GAMM/20-88PAAGQAINRAKQALQQ----AIEARRQA---LEAVALAE-RL-
J7L2J3_NOCAA/36-104ADAGKRVGGARRDIGQ----ALKARQAV---LEAERDER-VL-
SYFA_BURPS/18-86KTEGARINVAKQQVEA----ALNARRQA---LADALLNQ-RL-
SYFA_ALKOO/20-88PLVGKIANLVRENIEA----ALEEAKAT---VKSKELEK-KL-
R7JLX9_9FIRM/26-95ANYGKSVNELKEWALG----RFQKVEEE---MKERELQK-KY-
C5J6V7_MYCCR/13-81KQLGKQISQLKEEANS----FFSNALKQ---LEQKEQDL-KI-
A5FVF5_ACICJ/37-105KRVGAEVNALKTAISA----ALDARRAV---LEAEALAA-RL-
F8J8M0_HYPSM/41-109KSFGQTVNALKTKVAE----ALDARKSD---LEAAALDE-RL-
V5SCH8_9RHIZ/22-90KAFGAATNAVKEAVTS----SLEARRAE---LEVAALDA-RL-
A9WDN0_CHLAA/23-91PLVGQRVNALREQLEA----AFSAAKER---LEAQAVAA-EL-
D1CFI1_THET1/22-88PAIGKMANALKAELQQ----LYESKLSD---IRRSAISQ----
R6CQE1_9CLOT/20-88PVIGQLANQVRAQIEE----RLEETKTN---LEAHLLDQ-RL-
U5QL78_9CYAN/20-88PLVGALANKVKARIEE----ALEAQRLD---LEEQQIAR-RL-
B4U9B8_HYDS0/20-88KTYGSLLNELKENVEE----LFSQKFLY---FKSLEERK-NL-
Q2JNE8_SYNJB/27-95PAIGALANTFKEALQS----SLEQRKQA---LGEAQLLA-RL-
G4RBQ6_PELHB/43-111KEKGPAINGLKAEIGA----AIETRREA---LAAAALEK-RL-
SYFA_BLOFL/21-89SKIGTVINQVKSDIHQ----LFLERKKL---ITLKAIEK-SL-
R6AEK6_9PROT/19-87RARGAEINKAKREVET----LLNNRREA---LAREELNR-KL-
R6HX36_9FIRM/15-88KEAGQKINTIKQFIET----SMQERLQE---LKALEEQR-LI-
SYFA_LACSS/22-90PKVGAFANEIKSDLAQ----AIEARKAE---LEAKKEAA-QL-
R5AT24_9FIRM/20-88PAMGQLANQVRAELEE----ALDQRREA---LNARMLEM-RL-
I4BW85_ACEMN/23-92PKMGKAINDLKNDIED----MIKKRQQELIDLEESSLER----
R5MLL8_9FIRM/20-88PKMGQLANEVRASIEA----MLKEKTAE---LRSKEQEA-KL-
R6N5W0_9CLOT/20-88PVIGQLANEVRSWIET----DIETRLTE---IKASQMAA-RL-
SYFA_LACAC/22-90REVGQKVNELRDLFNA----QLDEAKEN---IVKAVLAK-RL-
SYFA_METFK/19-87PAAGAAINVVKQQVEA----ALKQRRDA---ILQAEQER-QL-
K0C0P2_CYCSP/20-88PKVGAVINQAKQEFQA----HLEQRKVQ---LENELLAK-RL-
SYFA_DICTD/20-88AKWGRLANEWKEELES----LYENKEKE---LKYLTLQK-KL-
R5CK85_9BACT/19-87KEVGIKINELKQTALE----KINSLREQ---CESKETQS-DD-
Q2GLQ9_ANAPZ/20-89KKVGSETNVLCSEFKA----LLHQREAE---FERELLYA-RL-
G8QHY1_AZOOP/19-87KAAGATINQAKEQVEG----ALNARREA---IRRAALEA-RL-
R7IM63_9FIRM/20-88PKVGQMVNETRGIIED----KIEEVRTK---LAAAARES-KL-
F9YU16_CAPCC/18-86KAFGQVINELKNKVEA----KVQELRDA---LEQQQESK-GV-
H8L6D3_FRAAD/19-87KRQGAEVNLLKNALAE----ALAARRQV---LEQAALDQ-RL-
C7N020_SACVD/36-104ADAGKRVNAARQEVQA----AFEERRAV---LQAERDER-VL-
G4L7X2_TETHN/22-90PKVGSFANQVRDHLTQ----QIEEKRAK---LEEEALNQ-AL-
K9SR28_9SYNE/27-95PQIGAIANEVKQSLQN----QLEEKRVA---IQQAEIIA-RL-
R7JWN9_9CLOT/20-88PKVGQMVNDARSKIEE----HLEEKKKA---FEQALREE-KM-
E2S9J5_9ACTN/36-104KEAGQRVGQARGAVAQ----ALAGRTAE---LEEVEAAR-IL-
SYFA_SHEON/19-87PAFGQAVNDAKQAIQQ----KLTERIDG---LKSAELEA-KL-
R5ZWN0_9BACT/19-87REIGMKLNELKTALQD----KLNELREG---LATKEDDH-SD-
SYFA_MAGMM/22-90KELGQWLNQLKEAYNQ----SFEAQLEK---LKKDELHA-RL-
R5DV22_9FIRM/21-89PMVGQIVNETRQAIEE----VLENARKE---LSEKMREI-QM-
I0AJJ2_IGNAJ/21-88PLLGKKLNELRNSVTE----KFNSKKEL---LEKSETSS-K--
B7K1Q7_RIPO1/27-95PRIGSLANEVKEALQA----SLDQQKAS---LQTAQIQA-KL-
K9THI8_9CYAN/27-95PRIGSLANEVKEALQS----QLEGRNQD---LLQAQIQQ-QL-
K9VZG7_9CYAN/27-95PRIGSLANVVKESLQA----SLDGKRSY---LQEAQIQA-QL-
SYFA_BACCR/20-88PRMGALVNEVREAIQT----RLDDKISN---LEKAVIEA-KL-
SYFA_BIFLO/27-95KEAGKLMGKLRADFGR----AYGPKEVE---LKEAAEKA-AL-
SYFA_BACHD/20-88PVIGQLANDVREAIGK----AIESKMEA---LEQAEIHR-KL-
E3EFH5_PAEPS/20-88PVVGQVANEVREAIEE----VVNRKQDE---FTKAETNE-RL-
R6Q2L8_9BACT/19-87KAIGVKINELKQVAQN----KINGLKEQ---LEEAEASS-DD-
SYFA_SYNY3/24-92PKFGAIANEVKEALQH----DLESRKAN---LQNAAIEA-QL-
F4B166_DOKS4/18-85REYGQVINTLKASALE----KVNELKEK---LEGAEEA--TA-
E3H642_ILYPC/20-88PVMGQLANEVRDSITE----ALEKKMIE---VKEKEKQE-RI-
SYFA_OENOB/22-90PVVGQMANKIRTQLET----MISQKKHI---LEENKLDA-QL-
K9SD43_9CYAN/25-93PRIGALANEVKTALQA----LLDRQHEN---LEAAAIQA-QL-
R6AWJ2_9CLOT/20-88AQLGKAANEVKQSIAE----ALEARKAM---LDAFAEQK-RI-
I6XQ41_PSEPQ/36-104KEAGARVGRARGQVNQ----AVAARQEE---LAAGELAQ-AL-
F4A076_MAHA5/21-89PATGQAINGLKEELTV----LLEDKALQ---IKAMERQR-KL-
D1BIH6_SANKS/80-148ATAGKILGPARGRVNQ----ALSARQVE---LEAERDAR-VL-
F8AZV1_9ACTN/122-191VEAGRRHNTATAAVRA----AYEARLAE---LTAERDAR-VL-
H8GQ78_METAL/20-88REAGQKINQAKDRFQE----QLDGRKQV---LEAKELAT-RL-
C1F7U6_ACIC5/40-108KLLGQRFNALKAQVEA----RLDDASSA---SSASALDA----
W0DTW8_9GAMM/20-88PLVGQQINDVKQAIQQ----LISDKKQA---LETAKMAA-DL-
F6FT27_ISOV2/27-95AAAGKNVGPRRGRVSQ----ALAARQAE---LEAERDAR-VL-
R5I3P4_9BACT/18-86KEIGKLLNELKEQALT----KINDLKNE---LGNEEQDA-NL-
SYFA_NOCFA/23-91KDAGKRVNVARGRVAE----AFEARRAV---LLAERDAA-VL-
E4N815_KITSK/36-104AAAGKLIGQARGAVNQ----ALAARQVE---LEAERDAR-VL-
D6ZI01_MOBCV/29-97ATAGQNLGAAQGRVRA----ALDAKQTE---LQEAAQEA-AL-
J7IPX0_DESMD/23-91PIMGQVVNEVRTRLEQ----AWEERSAE---LDAMALQR-RL-
R5GWV2_9FIRM/20-88PKVGQMVNEVRAEIET----ALETEKAK---LEDRAMEA-RL-
D5V9Q9_MORCB/35-103KQYGVYLHELRTHINQ----ALETKAKQ---LATAAMNA-KL-
SYFA_DESVM/22-90PRLGQAANGVKMALTE----RFEGRKTA---LEAASEAA-AL-
SYFA_DEIRA/13-81KACGAEINVVRAAIQA----ALDEKESA---LKRAALDA-KL-
D3R2H8_MAGIU/23-91PKVGDLTNGIRTAIEI----MLNKQKNV---LRQESQKK-QM-
B0RHC8_CLAMS/26-94KDAGKLVGQSRARVTQ----AFQAREAE---IQEQEAAE-RL-
SYFA_METCA/20-88KEFGQRVNQARDEFQR----LLERRKAA---LEAEALAR-RL-
R7A9X2_9FIRM/19-87PIFGQKVNQLKQLLSS----MIEDKKVE---LEKKEMEA-KI-
A4APM8_MARSH/18-86KEFGQTINKLKISATE----RVNSLKDT---LENKTDEA-SI-
SYFA_STRU0/24-92PIIGKQVNQVRDVLNT----AFEEQSRI---VEEAKIQA-KL-
SYFA_ALKMQ/20-88PLVGKIANLVREQIEE----ALELAKGA---VKDKELES-KL-
R6WB22_9FIRM/20-88PKVGQMVNETREAIEK----VMEERKVK---MERAIREE-QM-
C7MEH9_BRAFD/33-101AAAGKLVGQGKGRV