Sequence alignment for CL0303

PF05833

RQCH_STRR6/4-428DGFFLHHIVEELRSE------LVNGRIQKINQPFEQ---ELVLQIR-SNRQSHR-LLLSAHPVFGRIQLT--QT-TFENP
Q7V657_PROMM/52-482DLSSLRAVLSELRKE------VLPSRFEKVQQPEPH---TLQLGLR-TLKGLVW-LELSWRADCPRLVKI--TPPPR--L
A5GRV1_SYNR3/5-448DTTTLRGVVHELNAE------LVPSRFEKAQQAESG---GVQLAFR-TLKQRLW-LTLNWQADCPRFHAI--EPPPR--L
Q7VDB7_PROMA/10-439DITSLQAVLADLRKE------IVPSRLEKVQQSDNH---TLQIGFR-TLRDLIW-IEICWHADSARIVQI--DPPAK--I
Q8DHA1_THEEB/5-448DLTTLRAVCADLQH-------WLPARLETVYQRDRH---TIALAVR-TLKKQAW-LTLSWHPQAARIALE--PPPPR--Q
Q31PG3_SYNE7/5-452DYTTLVAVCRELQTA------VVPARLEQVYQRDRF---SLSLGLR-TMSDRPW-LLLSWHPEAARLHLD--TPPPR--D
P73561_SYNY3/5-464DYTTLMAIVAELQGD------WLPARIEQIYQHDRH---GLSLALR-TLERRGW-LTLAWHPQGARICLD--PPPPQ--E
Q8YP27_NOSS1/5-452DFTTLTATCSELHAH------WLPSRLEQVYQRDRY---TIAIALR-TLDKRGW-LQISWHPQATHICIG--DPPPR--T
Q110R4_TRIEI/5-453DYTTLIASCSQLRSQ------WLPARLEHVIQRDRF---TISLALR-TLKKRGW-LDISWHPQAARICIG--DPPPR--I
Q2JJS2_SYNJB/5-470DLTTLRAVLADLAQAKTGRDLVLPARVEWIQQTDLW---TVVIGLR-TLTARPC-LLLCWHPQAARLHLC--QPPPK--E
Q7NK58_GLOVI/5-445DFTALSAARAEIQSA------WIPARVEQIRQDDYQ---TIKLQLK-TFAAQRW-LVASCHPQAARLHMG--EASRG--K
A4S6P0_OSTLU/47-508DYTALVASVREINAL------STPVKIDACAQVDAH---SMTLDAR-AADGRRS-VRVSWHPVTAHVAMS--ARGAKVEK
A6TRX6_ALKMQ/4-463DGFSIAALTQEFQQI------LPINKIEKVYQPEKD---EITLLIR-SQGTNYR-LLLTASSNFPRAQFT--ST-PKENP
A8MH76_ALKOO/4-463DGFVVAALTHELKSE------LCNGRIDKVYQPETD---EIILTVR-SNGKNHK-ILLSADSNYPKIHFT--TS-NKENP
A3DCY8_HUNT2/4-460DGIVTKNIVSELSDI------LTGARIEKIYQPEPD---EIIINLR-TKGQNLK-LLLSANASYPRIHLT--DV-TKENP
B8I3G9_RUMCH/4-460DGIVTKCIVNELNDL------LSGGRIDKVFQPEND---EIVMMIR-SKGQNYR-LVASANASNPRLHLT--TL-QKENP
Q8R9S1_CALS4/4-455DGVTLHAIVKELKKE------IEGGRIEKIYQPEKE---DLIFTIR-SKGKNYK-LLLSANANYPRIHLT--KE-DRENP
A5N7G3_CLOK5/4-459DGIFIHSILQELKSK------LLGGKVEKVNQPEKD---EIILTIR-NEKTPYK-LLISSSSIYPKIHIT--DK-NKKNP
A0Q075_CLONN/4-456DGIFLYSIIDELKNT------IINGKIDKVNQPEKD---EIILNIR-KGRLSFK-LLISSSSNYPRIHLT--DL-TKPNP
Q97HA2_CLOAB/4-451DGIYIHSILHELKDK------LLGGRISKVNQPEKD---EINLTIRTTSNSNIK-LLISANPTYPKIHIT--DL-IKTNP
Q894E2_CLOTE/7-456DGLFLYATLEELKDS------ILNSKIYKINQPEKD---EIVFSLK-KDKNSYK-LLISASTMYPRIHCT--DI-NKKNP
B8CWR5_HALOH/4-456DGIMLAAIKKELTEE------LQGARVDKIYQPEAD---NLTFTLR-QPGQNIN-LFISAGARNPRIHIT--SL-KFKNP
Q0AXH0_SYNWW/4-462DGITIRALCQELNPL------LNGARIDKIFQPEKD---DLVLSVRTVKSGSLR-LMLSANSRWARLHID--SI-KKPNP
A8FD29_BACP2/4-445DGIFTYGMTNELQET------LTGGRISKIHQPYKH---ELIFHIR-ANGKNHK-LLLSAHPSYARVQLT--EQ-QYDNP
Q65JT4_BACLD/4-446DGIFTYGMIEELNEA------IRGGRIAKIHQPFKH---ELVFHIR-ANGKNRK-LLLSAHPSYARVHLT--NE-TYDNP
Q9K9X8_BACHD/4-445DGLMTRAIVHELQET------ISAGRILKIYQPFKT---ELLLTIR-AQGANHQ-LLLSANANFARVHFT--KE-KYANP
Q5WFK0_BACSK/4-443DGMMTRAITHELQQ-------LVGGRINKIHQPFKT---ELVFTVR-AKGKTRA-LLASANAVFARLHLT--TE-KYDNP
Q8ER31_OCEIH/4-445DGIVTRAITEELENK------IVRGKIAKIYQPTDS---EIVMTVR-NNSVNQT-LLFSIHPTYARFHVT--ND-NFTNP
Q5M4J6_STRT2/4-429DGFFLHHMTAELREQ------VLYGRIQKVNQPFER---ELVLTIR-NNRQNYK-LLLSAHPVFGRIQTT--KA-ELPNP
Q8DTA9_STRMU/4-427DGFFLHHLTKELQEQ------ILWGRIQKVNQPFEQ---ELVLTIR-NNRQNYK-LLLSAHPVFGRVQLT--KT-DFQNP
Q835X0_ENTFA/4-442DGVFTHSMVHELTET------LVSGRISKIHQPYEN---EVVLVIR-AKGKNHK-LLLSAHPSYARIQLS--TI-TYSNP
Q38X19_LACSS/4-442DGLMTHAVVNELNTT------LADGKITKIQQPYAN---EVILTIR-ANRKTYP-LLLSAHPSYARVQVT--RV-PYANP
Q1WTS3_LACS1/4-435DGLFTHAMIHELNQT------LQNGRVTKISQPYPN---EVILTIR-ANRTNYP-VLLSANPRYARFQIT--QI-PYTNP
Q03S51_LACBA/4-442DGSFTHAMVHELNQT------IATGRVSKINQPYAN---EVVLTVR-ANGHNYP-ILLSANPTYARIQST--QI-PYINP
Q03FM0_PEDPA/4-444DGLFTHAMVKELVNT------LKTGRVAKIYQPYQG---ELVLTIR-VNRKNKA-LLLSSHPNYARAQIT--EQ-TLTNP
A5VK20_LACRD/4-442DGLFTHAIVHELDQK------LTTGRVAKVSQPYPA---ELIITIR-AHRHNYP-LLISANPTYPRIQIT--EI-PYKNP
Q5FJY7_LACAC/4-438DGLFIHSLLQDLTPT------LVDGRLSKIYQPFEQ---DLILTFR-KNRKNYQ-LLISANAQYPRMYLT--EQ-TIANP
Q74JC6_LACJO/4-439DGLFIHSLLQDLSPT------LVGGKLTKIYQPFEQ---DLVLNFR-KDRKNQR-LLISANAQNPRFYIT--ND-TIANP
A9AW28_HERA2/4-452DALVVAAIVAELQI-------LVGGKIQQVVLPNPD---SVGFEVY-ADGQRHQ-LLLSANPKFARMHTT--PTKLTRDP
A5UZA2_ROSS1/4-464DALTLAAVVDELRAT------LVGGRVQHVLLPGEL---SVALEIY---AGRRYYLVLSAHPQFARVHLS--PVRISRGT
Q24TV3_DESHY/15-479DGITLHHLVQELAPQ------LAGARIDKITQPEKE---EIHLQLR-SQGQSYR-LLLNISATAARLHLS--QT-SKKNP
Q67PS6_SYMTH/4-455DSKVMAAVVEELNQR------LLGGRISKIYQPEPD---ELALLCY-ANGENHR-LLLSAHPRHARVHLT--QI-EKRNP
A4J565_DESRM/4-461DGLVMAAVAQELTSG------LVGGRVEKIQQPTTH---ELILVIHTREKGKQR-LLISADARDARIHFT--QA-SHVNP
Q2RK36_MOOTA/4-459DGLFLAAISAELSG-------LTGSRVDRIFQPEKE---TVILHLR-KGRDTRK-LLLCSLSDQARVHLT--TA-SFTNP
Q9WYJ8_THEMA/4-433DGLLLHKAVRELKE-------LEGEHLRQIYQPTTV---DYYFLFR------SATVRVCLRPDVSHVAIA--EK-EEASE
A7HKC1_FERNB/4-444DGFVMRGTVEQIAKK------IVGFNLRNVY-LSKH---ILYFSFD------NGDLKVSLNPNFSYISF---VN-HFVED
A8F860_PSELT/4-437DGFVLKRIVDELSS-------LEGAKLRQIYQYGKS---DIYLYFQ------NAVVRICLEPSLAHICYT--EK-EDFSD
Q3A4K7_PELCD/16-444DVFYIEAVVDQLQSL------VTGASVKKIHQPDAD---TIILRLW--NGRRELRLRISATVGATGLYLT--ER-TWINP
Q18J82_HALWD/8-471TSVDIAALVTELRR-------YTGAKVDKTYRYGDD---LLRFRMRDFDRGR-LELLIEV-GTQKRIHTADPDH-VPDAP
Q8TZ51_METKA/10-472TSFDVRATARELDSL------LEGALIDKIYQVGER---ELKVKVHVPGVGSHY-LVWEP---GMRVHLT--WR-PKPSP
RQCH_METJA/6-475TNVDVCCVVDELQN-------LINGRLDKAFLIDNEQNRELILKIHVP-EGGSRELVISI---GKYKYITLTNY-EREKP
Q2NGY7_METST/2-454SNVDIHRMVNELNKE------LINTRIDKAYQPDVD---TIRIKLRKAGEGR-KDLVIQA---GVRIHLT--NY-PQPNP
Q8TSZ2_METAC/6-492SSADVAAVVAELSAGP---RSIIDAKIGKIYQPASE---EIRINLYVFHQGR-DNLVIEA---GKRLHMT--KY-VRASP
RQCH_STRSY/4-429DGFFLHHMTAELRAN------LEGGRIQKINQPFEQ---EIVLNIR-SNRQSHK-LLLSAHSVFGRVQLT--QS-DFTNP
A5I337_CLOBH/4-453DGIFLFSMINEMKTK------ILNGRVDKVTQPEKD---EIVLSIK-NNRKTYK-LLISSSAVYPKIHFT--DI-PKKNP
A9WAZ2_CHLAA/4-463DALTLTAVVEELRAT------VLDGRIQRVVLVGPL---AIGLEVY-RQGRRHY-LLASADAQMARIHLI--SQRPTRGV
Q04EZ3_OENOB/4-421DGLFLHSMTKELNKE------LAGGRITKIAFPFPH---EIILTVR-SFRKNRK-LLLSAHPVMARAQIT--KV-DFENP
Q182T2_CLOD6/4-460DGLVIHSIVDELSSK------LTGGKIDKIHQPEDD---EVIFNIR-NNKENFR-LVLSASASNPRVYLT--SNYQKENP
Q1GA87_LACDA/4-437DGLFIHSLLNELQDE------ITAGRLHKIYQPFNN---DLVLVFR-KDRKNKQ-LLISANPEYPRLYLS--KE-SFSNP
Q2G1U1_STAA8/4-441DGLFTKKMVESLQF-------LTTGRVHKINQPDND---TILMVVR-QNRQNHQ-LLLSIHPNFSRLQLT--TK-KYDNP
Q5L0T2_GEOKA/4-444DGVFTYAIVGELEEA------LAGGRITKIHQPSAY---EIVLLVR-ARGHNHK-VMLSAHPTYARVHLT--NE-TYNNP
Q812X1_BACCR/4-444DGLFTRAITHEIENS------LYTGRISKIYQPSKY---EILLHIR-ANGKNQK-LILSSHPTYARMHLT--NQ-NYDSP
Q8DZB9_STRA5/4-427DGFFLHHLTNELQEQ------IEKGRIQKVNQPFDH---ELVLTIR-NNRRNYK-LLLSAHPVFGRIQTT--EA-NFQNP
Q8XJB4_CLOPE/4-452DGIYLYNLINELKDS------LINSRIDKINQPEKD---EIIINVR--GKENKK-LLISSSSKYPRLHFT--TI-SKNNP
Q8Y670_LISMO/4-446DAMFLKAMTEELAEH------GESGRIMKIHQPFSH---ELVLYIR-KNRENKR-LLISSHPSYARIQWT--DD-IPENP
Q9CFY4_LACLA/4-414DGIFLHHMTAELQP-------LVGGRIQKINQPFDQ---ELVLTVR-SAGKSHK-LLLSAHPVFGRVQLT--KT-DFQNP
R5JZW0_9CLOT/4-454DGVVISNVVSDLKKK------LVDGRIYKIYQPEND---ELNIIIK-NNRENYR-LLLSADASLPLIYLL--QV-PKENP
R5QBW9_9FIRM/4-453DGIVVAGLVHELKQK------LTDGRIAKIAQPEAD---ELLLTIK-SPCGQHR-LLISANASLPLIYLT--DT-NKPSP
R6P7M2_9CLOT/4-457DGAFLRHLKKEITDR------ALGARVDKIYQPNKE---ELVFLLR-TRQEAFK-LLLSARANSPRIHFT--QY-APENP
R7FWI9_9FIRM/4-453DGITVAAVVQELEHT------LVGGRISKIAQPEND---ELLLTIK-GNEGQKR-LYISASASLPLIYLT--NE-NKPSP
U5L7J1_9BACI/4-442DGLFTRAMAHELSDT------LQGGRINKIHQPFKN---EIVLVIR-ANGKNHK-LLLSAHPSYARAQLT--HE-AYENP

PF06831

FPG_MYCPN/135-227---------------------LALDPLDQEFNHQAI--------------------------------------------
FPG_ECOLI/129-219---------------------LGPEPL---SDDFNG--------------------------------------------
FPG_STRMU/132-222---------------------IGPEPN---AKDFKL--------------------------------------------
FPG_SYNY3/143-233---------------------LGP-------EPFGA--------------------------------------------
FPG_NEIMB/135-227---------------------LGPEPL---SEAFCA--------------------------------------------
FPG_THET8/122-214---------------------LGPEPL---SEAFAF--------------------------------------------
FPG_BACSU/134-224---------------------LGPEPD---AEEFTS--------------------------------------------
FPG_ARATH/146-238---------------------LGPDAL---LEPMTV--------------------------------------------
D3FWX6_ALKPO/134-224---------------------LGVEPF---SEQFTS--------------------------------------------
FPG_THEEB/137-228---------------------LAPEPL---SEAFTV--------------------------------------------
END8A_MYCTU/126-214---------------------LGPDPL---RSDANP--------------------------------------------
FPG1_MYCTU/144-231---------------------LARDPL---DPRFDC--------------------------------------------
FPG_LACLA/132-223---------------------IGPEPT---YETFDE--------------------------------------------

PF00416

RS18B_YEAST/16-144-------------------------RLLNTNVDGNI---KIVYAL-----------------------------------
RS18_RAT/14-142-------------------------RVLNTNIDGRR---KIAFAI-----------------------------------
RR13_ARATH/49-153-------------------------RVGGVEIPANK---RIEYSL-----------------------------------
RS13_SULAC/11-139-------------------------RLFGQDVDGTM---KLPYAL-----------------------------------
RS18_ARATH/14-142-------------------------RVLNTNVDGKQ---KIMFAL-----------------------------------
RS18_DROME/14-142-------------------------RIMNTNIDGKR---KVGIAM-----------------------------------
RS13_HALMA/25-152-------------------------RIGQTDLDGTK---SVERAL-----------------------------------
RS13_MYCTU/3-109-------------------------RLVGVDLPRDK---RMEVAL-----------------------------------
RS13_SHIDS/3-108-------------------------RIAGINIPDHK---HAVIAL-----------------------------------
RS13_GEOKA/3-108-------------------------RIAGVDIPRDK---RVVISL-----------------------------------
Q6R9D3_MAIZE/4-109--------------------------ISGARLLPDE---QVRIAL-----------------------------------

PF05833

RQCH_STRR6/4-428AQPSTFIMVLRKYLQGALIESIEQ-VENDRIVEMTVSNK----------------NEI-GDHIQAT--------LIIEIM
Q7V657_PROMM/52-482GSGSTLAQQIQHGLRQMALIELKQ-KGFDRVVECGLAHR-------------------PGEPIERT--------LVLELM
A5GRV1_SYNR3/5-448GEGSTLAQQLQHGLKGLALVRLEQ-LPWERVVHLGFAPR-------------------PDAPEQRQ--------LVLELM
Q7VDB7_PROMA/10-439SGESTLCKQIKFGTKGMALIELKQ-NGFERIVEFGLAFR-------------------PNENFEKF--------LVLEIM
Q8DHA1_THEEB/5-448PDTFTFSQQLHAQLNRLALVRVGLINPWERVVVLEFAPR-------------------PQEATQWR--------LYAEIM
Q31PG3_SYNE7/5-452PDTFTLSQQLQAVLKGFALIDLHIPQPWERIVTLSFGDR-------------------PGDPPRFR--------LLLEVM
P73561_SYNY3/5-464PDTFTFSDQLRHQLKGLALISLKPLQPWERVIDLAIAKR-------------------PGDEPLYH--------LFLEVM
Q8YP27_NOSS1/5-452PDTFTFSQQLVHQLGGLALVAIEAIAPWERVIDLQFARR-------------------PGDAALYH--------IYGEIM
Q110R4_TRIEI/5-453PDTFTFSQQLKHQLNGLALIAIAEVSPWERVLDFQFAKR-------------------PGEKPLWH--------LYVEVM
Q2JJS2_SYNJB/5-470PDGFQFSQFLQRHLKGLALTELALLEDWERVIDLRFAPR-------------------PGDPPYRH--------LYLEVM
Q7NK58_GLOVI/5-445GARFSFASTLHQYLGGRVLVHCVQ-PQWERIVRLGFARR-------------------PEQEPEVE--------LHVEVM
A4S6P0_OSTLU/47-508GMNLSFGESANALLKGKVLLDARVGTAWERACRLRFGDR-------------------PGGEAEYE--------LLCEVM
A6TRX6_ALKMQ/4-463SVAPNFCMLLRKHIQGGRIVQIKQ-PDFERVIRFTIETY----------------DEL-KVACSRT--------LIIEMM
A8MH76_ALKOO/4-463SSPPNFCMVLRKHLMGGRIVDIVQ-PQFERIVKIIIESL----------------DEL-NILKSKE--------LMIEIM
A3DCY8_HUNT2/4-460INPPVFCMLLRKHLSGGKITKIDF-HDFERVVTIHIETI----------------DEL-GDLTFKK--------LVVEIM
B8I3G9_RUMCH/4-460AAPPVFCMLMRKHVAGGRLLNISF-HDYERIITLNIESV----------------NEL-GDLTVKR--------LVVEIM
Q8R9S1_CALS4/4-455LEPPMFCMLLRKHLQNGRIAEIRQ-VEFDRIVEIDIETK----------------DEL-QNQAIKT--------LVVEIM
A5N7G3_CLOK5/4-459LQPPMFCMILRKYLNSSKLINISQ-LDTDRVIFLDFQSL----------------NEL-GFDNIYT--------LVIEIM
A0Q075_CLONN/4-456IKAPMFCMVLRKYISNAKIVDIHQ-INQDRIVVIDFEST----------------DEL-GFNSIYS--------LIIEIM
Q97HA2_CLOAB/4-451IKAPMFCMVLRKHLLNSRILKIDQ-IESDRIVIIDFETT----------------DEL-GFNSIYK--------LYIEIM
Q894E2_CLOTE/7-456MTPPMFCMILRKYLSNSKITSIYQ-LQLDRVVFIDLQGK----------------DEL-GFEKTYT--------LIIEIM
B8CWR5_HALOH/4-456LTPPAFCMLLRKYLINGTIGEIKQ-PDFERILEITINKK----------------NNI------YR--------LIIEIM
Q0AXH0_SYNWW/4-462TKPPAFCMLLRKYLEGGKIQEIKQ-VDFERIIHIDIEAL----------------DDF-REWKIKR--------LICEFM
A8FD29_BACP2/4-445SEPPMFCMLLRKHLEGGFIERFEQ-IGFDRVIVLHVRSR----------------NEI-GDEQTRK--------LYIEIM
Q65JT4_BACLD/4-446STPPMFCMLLRKHLEGGFIDQVEQ-IGMDRMMVFHIRSR----------------NEI-GDTLTRK--------LMVEIM
Q9K9X8_BACHD/4-445ATPPMFCMLLRKHLEGAVIEEIKQ-IDLDRIIEITVKTR----------------DEI-GDTSYKT--------LVIEIM
Q5WFK0_BACSK/4-443AEPPMFCMLLRKHLEGGIITSITQ-HGYDRIIVLKVANK----------------DEL-GDTTEKT--------LIVEIM
Q8ER31_OCEIH/4-445KEPPMFCMILRKHLSGAIIEKIEQ-KSLERIVIFSIRTR----------------NEI-GDISYKQ--------LIIELM
Q5M4J6_STRT2/4-429QNPNTYTMIMRKYLQGAVIEDIQQ-LENDRVLEISVSNK----------------NEI-GDSVKVT--------LVMEIM
Q8DTA9_STRMU/4-427QSPNTFTMIMRKYLQGALIENIEQ-IENDRILEMSISNK----------------NEI-GDQIKVT--------MIIEIM
Q835X0_ENTFA/4-442ETPPNFVMMLRKFLDGAILETIQQ-IENDRVIHFTFSKR----------------DEL-GDLQNIV--------LIVELM
Q38X19_LACSS/4-442ATPPNFAMTLRKYLDGAILEQIEQ-VESDRILRLTFKSR----------------NEL-GDMQKLC--------LIVELM
Q1WTS3_LACS1/4-435AVPTNFTMMLRKYLEGAKLLEIKQ-LDNDRVVYFEFLTR----------------NEL-GDKLPLL--------LSAEIM
Q03S51_LACBA/4-442PTPTNFTMILRKYLQGAILKEITQ-VANDRVVHLHFTSR----------------NEL-GDQQELL--------LIIEIM
Q03FM0_PEDPA/4-444STPSNFVMSLRKHLDGAILKDITQ-VENDRIINLHFAHR----------------NDI-GDEEDLI--------LSVEIM
A5VK20_LACRD/4-442AVPTNFTMTMRKYLEGAIVNKIEQ-VDNDRIIKITFDTR----------------DEL-GDSQQLV--------LVSEIM
Q5FJY7_LACAC/4-438DKAPIFVMVLRKYLEGSVLQSIEQ-IGVNRIINLHFSNR----------------NEL-GDQVKLV--------LSVELM
Q74JC6_LACJO/4-439DVAPTFVMVLRKYLEGSVLQKIEQ-IGVERIVNFHFSNR----------------NEL-GDEMQLI--------LSVELM
A9AW28_HERA2/4-452NADSPLLLLLRKYVRGGRITKIES-APLERVISLSIAKMPIPRKEL--EPDDDDDDEVMLTPRYSE--------LVLEII
A5UZA2_ROSS1/4-464DATPPLLLLLRKYVNRGRITAIEQ-PDLERVLLLSIAKRPLLRNSD--DEPELDSDDEDRPDTTSPENETLRCELIVEIM
Q24TV3_DESHY/15-479ASPPMFCMILRKHIEGGKILSLEQ-LGLERIVLLTVQNY----------------NEY-GDLATLH--------LYLEIM
Q67PS6_SYMTH/4-455PTPPMFCMLMRKYVEGGRIVAIEQ-AGRDRICRIAIRNA----------------DEL-GNPVTYL--------LVAEVM
A4J565_DESRM/4-461LSPPIFCMVLRKHLEGGRIRSVEQ-IGLERILQFTVDSR----------------DEL-GRPGEKH--------LICEVM
Q2RK36_MOOTA/4-459PTPPLFCMVLRKHLEGGILTAVEQ-PGLERVLKLHFNTT----------------DEL-GRQAPRL--------LLIEIM
Q9WYJ8_THEMA/4-433KMPSSFTMLLRKELKGAKLLKVEQ-IGMDRTLRFSFEKF----------------DEIEGIVQKD---------LYIEIM
A7HKC1_FERNB/4-444PEKNNFVEFLRSRIRGAKVVDFSN-IQYERTVVLELKKI----------------DEI-GVVHNYV--------LYFDIM
A8F860_PSELT/4-437HRPSNFVLLLRTKLRNARVRKVCQ-VSLDRVMFFEFDKI----------------DEI-GNRHFYR--------LYIEFF
Q3A4K7_PELCD/16-444ANPLRFCQLLRARLS--RLRSVRQ-LFGERIVVFTFDGQ---------------------DDSTYQ--------LIAELY
Q18J82_HALWD/8-471ERPPNFAMMLRNRLSGADLVNVEQ-FEFDRIMILSFERG----------------------EEMTR--------IIVELF
Q8TZ51_METKA/10-472DQPTSVSQALRNTLSGDRIERVTQ-LGFDRILRFDLRSG-------------------------RR--------VHVELL
RQCH_METJA/6-475KLPPSFAMLLRKYLKNAKLIKIEQ-VNFDRVVIFHFETR----------------------DGIYK--------LVAELF
Q2NGY7_METST/2-454TIPPNFPMLLRKHLSGGSITSIEQ-HNFDRIIKIKVQKK-----------------------EEYT--------ILVELF
Q8TSZ2_METAC/6-492TLPQAFPMLLRKYLMGGRIISVEQ-HDFDRIIKIGIERA----------------------GVRST--------LIVELF
RQCH_STRSY/4-429KVPNTFTMILRKYLQGAIIEEIRQ-LDNDRILEFSVSNK----------------DEI-GDHIQAT--------LIVEIM
A5I337_CLOBH/4-453MQPPMFCMVLRKYLNSSKIINIRQ-LDTDRIVLIDFESA----------------DEM-GFNSIYT--------LIIEIM
A9WAZ2_CHLAA/4-463DGETPFLLLLRKYVLGGRIVNIEQ-PPYERVVVLSITKPTESRKQTFDPDELIADDDN-DDDLTADADHLLHCDLIVEPQ
Q04EZ3_OENOB/4-421ITAPNFVMVLRRYLQGGKILAFRQ-IANDRILEILVANA----------------NEI-GDAVSYK--------IVLEIM
Q182T2_CLOD6/4-460LKAPMFCMLLRKYIQGGNIVEISQ-IGFERIIKISVESL----------------DEL-KEKTVKN--------IMIEIM
Q1GA87_LACDA/4-437NVAPLFVMVLRKYLEGSVLQEISQ-VGLSRIVNFSFSNR----------------NEL-GDEIQLI--------LSVELM
Q2G1U1_STAA8/4-441FNPPMFARVFRKHLEGGIIESIKQ-IGNDRRIEIDIKSK----------------DEI-GDTIYRT--------VILEIM
Q5L0T2_GEOKA/4-444SEPPMFCMRLRKQLEGSVIEAVRQ-VDFDRIIVMDTKGR----------------DEL-GDVQTKR--------LIIEVM
Q812X1_BACCR/4-444AIPPMFCMLLRKHLEGGFIEKIEQ-IDLERIIQITVRSR----------------NEI-GDESLKT--------LVIEIM
Q8DZB9_STRA5/4-427QNPNTFTMIMRKYLQGAVIETIQQ-IENDRILEIVVSNK----------------NEI-GDHIKAT--------LVVEIM
Q8XJB4_CLOPE/4-452LQPPVFCMVLRKYLTGGRIIDIYQ-QSTDRIVSIDIANK----------------DEM-GFDSVYT--------LVVEIM
Q8Y670_LISMO/4-446ATPPMFCMLLRKYLEGAIIESITQ-LPNERILQFSIRGK----------------DDI-GENRFCD--------LFVEIM
Q9CFY4_LACLA/4-414QNPNNFVMILRKYLAGAFIEQIEQ-VGNDRQIILHISTK----------------DEI-GDSLKIA--------LITEIM
R5JZW0_9CLOT/4-454MTAPNFCMLLRKHIGNGRIVDVCQ-PGFERIVEFTIEHL----------------DEM-GDLCKKK--------LIIEIM
R5QBW9_9FIRM/4-453ITAPNFCMLLRKHISNSRITDISQ-PKLERIICFTIEHF----------------DEL-GDLCQKK--------LIVEIM
R6P7M2_9CLOT/4-457KVPPMLCMLLRKRLSGAKLVEVRQ-PGLERLLYLDFDAA----------------NEL-GDKVRLS--------LVIEIM
R7FWI9_9FIRM/4-453MTAPGFCMLLRKHIGGGRITAVSQ-PSLERIIHLDIEHL----------------DEM-GDLCRKK--------LIIEIM
U5L7J1_9BACI/4-442SEPPMFCMLLRKHLEGYILEDIRQ-VGLDRILILDVKGR----------------NEI-GDISYKQ--------LIVEIM

PF06831

FPG_MYCPN/135-227-----FNKGHKSN---------------KK-IKTFILDQ-----------------------------------------
FPG_ECOLI/129-219---EYLHQKCAKK---------------KTAIKPWLMDN-----------------------------------------
FPG_STRMU/132-222---KPFEEGLAKS---------------HKVIKTLLLDQ-----------------------------------------
FPG_SYNY3/143-233---DFTAEYLYEKL-----------KSSRRPLKNALLDQ-----------------------------------------
FPG_NEIMB/135-227---DYLYARLKAQ---------------KRAVKLALMDN-----------------------------------------
FPG_THET8/122-214---PGFFRGLKES---------------ARPLKALLLDQ-----------------------------------------
FPG_BACSU/134-224---AYLKDRLAKT---------------NRAVKTALLDQ-----------------------------------------
FPG_ARATH/146-238---DEFAESLAKK---------------KITIKPLLLDQ-----------------------------------------
D3FWX6_ALKPO/134-224---ELLMNAFQKT---------------NRKIKVALLDQ-----------------------------------------
FPG_THEEB/137-228---AFLAARLAHC---------------RRSIKTALLDQ-----------------------------------------
END8A_MYCTU/126-214---SSAWSRITKS---------------RRPIGALLMDQ-----------------------------------------
FPG1_MYCTU/144-231---DAVVKVLRRK---------------HSELKRQLLDQ-----------------------------------------
FPG_LACLA/132-223---QIFREKLQKS---------------TKKIKPFLLEQ-----------------------------------------

PF00416

RS18B_YEAST/16-144--------------------------------------------------------------------------------
RS18_RAT/14-142--------------------------------------------------------------------------------
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139--------------------------------------------------------------------------------
RS18_ARATH/14-142--------------------------------------------------------------------------------
RS18_DROME/14-142--------------------------------------------------------------------------------
RS13_HALMA/25-152--------------------------------------------------------------------------------
RS13_MYCTU/3-109--------------------------------------------------------------------------------
RS13_SHIDS/3-108--------------------------------------------------------------------------------
RS13_GEOKA/3-108--------------------------------------------------------------------------------
Q6R9D3_MAIZE/4-109--------------------------------------------------------------------------------

PF05833

RQCH_STRR6/4-428GKHSNILLVDKSS-HKILEVIKHVGFSQNSYRTLLPGSTYIAPPSTESLNPF--TIKD-E-KLFEI----LQT-------
Q7V657_PROMM/52-482GRHSNLLLLDRQR--QVITLGRQVRNHQSRVRPIGTADIYVAPPPMQGREPS--SKESLK-RWKDI----LCL-------
A5GRV1_SYNR3/5-448GRHSNLFLLDERQ--QVISSGRQVREHQSRLRPISTGDSYSAPPPLQGAEPQ--VQESLE-RWRQR----LLL-------
Q7VDB7_PROMA/10-439GRHSNFLLLNESR--QVITLGKQVRKNQSRLRPIGTGDKYVPPPPLNGQPPK--RSESFE-EWKSN----LSM-------
Q8DHA1_THEEB/5-448GKYSNVILVNAAG--EIVTAAHQVSPQQSRLRPILTGQPYVPPPPLTAALPS--GEIPFE-QWQQQ----VSV-------
Q31PG3_SYNE7/5-452GKYSNLVLVNGDS--EIVTVAHQVSDRQSRLRTVRTGEPYEWPPALTTPIPD--LDEPFD-RWCER----LQL-------
P73561_SYNY3/5-464GKYSNLILTDAQR--QIITVAHQVNSQQSRVRTVQTGQPYQSPPALLATPPS--LTESFS-SWQER----VQL-------
Q8YP27_NOSS1/5-452GKYSNVILTDANN--LIITAAHQVSQQQSSVRPILTGQPYEAPPKLTGTIPS--LQETQA-RWQER----VSL-------
Q110R4_TRIEI/5-453TKYSNVILTTVDN--LVITCARQINIQQSSVRQIQTGQPYELPPSLTNSIPR--VSETQQ-HWQER----ISL-------
Q2JJS2_SYNJB/5-470GKHSNAILVDEAG--MILASGHGVSERQSRIRPVQPGLPYEAPPALTDPIPQ--RSEPFS-CWQER----VAL-------
Q7NK58_GLOVI/5-445GKYSNIVLTDPSG--QILALAHSVSAAQSRVRPLLLGEIYQSPPPLSGPIPN--PDEPFA-SWCAR----LSV-------
A4S6P0_OSTLU/47-508GRYSNAFLLDSKNNDEVLACGYQVGEKQTSVRRLAIGYAYEPPPSAPGIDPTTGVEGGVD-GWTAV----LRDVARGRSG
A6TRX6_ALKMQ/4-463GRHSNIILINNEN-NKVIDSIKRVSLDISRFRQVLPGLPYQLPPSQDKKNPV--TINTFE-EFKEA----LDS-------
A8MH76_ALKOO/4-463GKHSNIILVDSET-NKIIDSIKRVPFDVSRYRQILPGLQYAMPPSQDKFDPQ--GISM-E-DFLSI----LKEK------
A3DCY8_HUNT2/4-460GKHSNIILVN-NE-NKIIDSIKHVDSDISRVREVMPARPYTLPPGQDKINPL--ELDIDL-LFSKA----KEQG------
B8I3G9_RUMCH/4-460GKYSNIILLN-SE-NKIIDSVKHVDSDISSVREIMPARTYLLPPAQNKELPE--NTEVDK-IFNEE----NIKG------
Q8R9S1_CALS4/4-455GRHSNVILIDKAS-QTILDSIKRVYPDMSKVREVLPGKKYTYPPLQQKLSLK--DLTY-E-SFKEA----LLR-------
A5N7G3_CLOK5/4-459GKHSNITLIRKKD-TIIMDSIKHITPEINSIRSLFPGIKYIFPPISNKLNPF--CYKR-E-EFKHV----LQK-------
A0Q075_CLONN/4-456GRHSNMTLIRKRD-NIIMDSIKHITPDINTYRSIYPGIEYVYPPKSPKLNPF--DFSY-D-MIENF----TKE-------
Q97HA2_CLOAB/4-451GRHSNISLVREHD-NTIMDCIKHITPEVNRYRTLLPGCEFVLPPKSDKLNPF--NFEY-N-DLKDY----ISE-------
Q894E2_CLOTE/7-456GRHSNISLVEKSS-SIILDSIKHITPEINSVRTLLPGLKFVLPPKSNKLNPL--DYTY-D-DLEKF----ILE-------
B8CWR5_HALOH/4-456GRHSNIILTD-DN-GYILDAIKRITKEVNTKRELYPGIKYHYPPRQDKLNPL--KVTR-E-EFFKK----IPD-------
Q0AXH0_SYNWW/4-462GRHSNIILVNPEN-NLIIDAIKKYGHDRSSHREVLPGKEYVSPPQQGKLNPL--QASY-E-DFVQL----MWKQ------
A8FD29_BACP2/4-445GRHSNLILVEDDT-QQIIDGLKHLSPSVNSYRTVLPGHEYLLPPAQQKLNPF--AVTK-D-DILKH----LRF-------
Q65JT4_BACLD/4-446GRHSNIVLTDGEK-DVIIDSLKHLSPAMNSYRTVLPGYDYILPPAQNKLSPL--EAET-E-DILRH----LNF-------
Q9K9X8_BACHD/4-445GRHSNMILVDPKT-NVILDSIKHVSLAQSSVRPVLPGQPYTRPPAQGKANPL--TATK-E-DILKK----LDW-------
Q5WFK0_BACSK/4-443GRHSNIILVDEKT-NTIIDSIKHVRFDQSSYRLVGPGQPYKWPPEQNKLDPL--TATE-K-DVLFA----LDF-------
Q8ER31_OCEIH/4-445GKHSNLILIDQEK-GSIIDSLKHISYSQNRHRSILPGQSYQSPPDQQKFHPL--ELSS-E-QFIQK----IDF-------
Q5M4J6_STRT2/4-429GKHSNIILIDKNE-NKIIESIKHVGFSQNSYRTILPGSTYIAPPKTDARNPF--DISD-E-NLFEL----LQ--------
Q8DTA9_STRMU/4-427GKHSNIILLDKNE-GKITESIKHIGFTQNSYRTILPGSRYLAPPKIQAQNPF--TISD-E-TLFEI----LQ--------
Q835X0_ENTFA/4-442GRHSTIVLVNQSS-GKILDAIKHIGMSQNSYRSLLPGATYIEPPKPMGLNPL--TASK-E-EVFAL----LST-------
Q38X19_LACSS/4-442GRHSNVILINLET-QKILDLIRHVGVSQNRFRFLMPGADYVNPPAPTGLNAF--TTDLGTLDWLSY----YNE-------
Q1WTS3_LACS1/4-435GRYSNVILINQST-NKIIDTIKHVGMDQNRYRTLLPGATYRQPPTQDKENPF--EQES-N-TFEEL----IQKY------
Q03S51_LACBA/4-442ARHSNVILVDSAS-MKILDAIKHVGSDQNRYRLLLPGAQYIMPPKQDLDDPF--QGPR-T-DLAAT----IREF------
Q03FM0_PEDPA/4-444GRRSNIVLHSSTT-GKIIDTIKHISSDQNRYRMLVPGAQYLTPPAQDLLNPF--VADA-E-KMMEL----QNKY------
A5VK20_LACRD/4-442ARHSNISLVNLKT-GKIIDTIKHVGSDQNRVRLLLPGATFVMPPKQDKVNPY--L-PN-Q-VYSDL----VRQT------
Q5FJY7_LACAC/4-438GRHSNVILYDQQN-GHIIDLLKRINPDENRARILLPKAKYELPPLKPGINGL--VVTE-N-QFKKL----S---------
Q74JC6_LACJO/4-439GRHSNVILYNADN-NKIIDLLKRINPDENRARLLLPHAPYELPPLLPGINGF--DLCA-D-NFNDL----K---------
A9AW28_HERA2/4-452GHSSNIILVDDNG--LVLESIRHYNPQRSQ-RPIMPRGMYEAPPSQGKSDPLQATAEQIA------------A-------
A5UZA2_ROSS1/4-464ERRSNIVLVGDDN--VILAAARHVTPRMSR-RPVLPREPYELPPPQSRHDPRQTTAVEMRAAVPDG--------------
Q24TV3_DESHY/15-479GKHSNLILVDPQS-GLILDGLKRYSHALSRHREVLPGRLYLAPPSQGKADPL--ELEE---EWRTI----LFRD------
Q67PS6_SYMTH/4-455GKHSNLVLLNPQ--GRIIDAIRRITEEVNRHRELLPGLPYIAPPPTGKLDPA--AATG-P-----V----LAQA------
A4J565_DESRM/4-461GKHSNILLVDPTT-NTILDGIHRYSHAVSRYREVLPNRPYLSPPEQSKFDPR--KLTE-D-QFREI----LMSG------
Q2RK36_MOOTA/4-459GKHSNIILLNPEG--SIIDAARRYTHAVSRHREVLPGRPYVPPPAQDKADPR--KLDD-E-AFTRL----LYEG------
Q9WYJ8_THEMA/4-433GIHSNMILVRDR---RIIDAHRRIVTKK---REILPGREFVIFPS-GKVSIF--ELRELPPE------------------
A7HKC1_FERNB/4-444GKHSNAIIV--EN-SEILEAFKRV---QTKFRNIFPGEKFVLYPS-DKL-----TIDEID-SFDKLKSVFEGFY------
A8F860_PSELT/4-437GSHCNVIFV--EN-DIIIDALRSV---LTVSRRIQKGEIY-RSSN-EKLNPL--EVTYNDFSFDER--------------
Q3A4K7_PELCD/16-444GRRPNIILCDADD--KIVDVLHRREGGSEH-QTYMKGAVWTRPEKVHKWALQ--DVADCS-EMAPV--------------
Q18J82_HALWD/8-471GD-GNVAVVDSAG--EVIQSLETVRLK---SRTVAPGAQYEFPDS--RVNPLQVTYDRFISLMNES--------------
Q8TZ51_METKA/10-472PK-GTLAVTDENN--VIERAFPARRFR---NRAVVPGEVYEPPEG--PPDPYELDRDAFLELLLEA--------------
RQCH_METJA/6-475GD-GNIIFLNNED--TIIAPLRVERWS---TRNIVPKEKYKFPPQ-KPLNPYNLEFSIAYEVFKDY------FL------
Q2NGY7_METST/2-454SK-GNIILLDKDN--NIISPLKHKTWH---DRKITAHEEYKYPPE-KGININNCRFEDLKTVINTS--------------
Q8TSZ2_METAC/6-492AR-GNVLIVDSEN--KIILPMNPVTLK---DRRLRSGEIYELPEA--QLSPLEAKVSDLMEAFSKS--------------
RQCH_STRSY/4-429GKHSNIILVDKSE-QKIIEAIKHVGFSQNSYRTILPGSTYIRPPETHSLNPY--TVSD-E-KLFEI----LST-------
A5I337_CLOBH/4-453GRHSNITLVRERD-NLIMDSIKHVTPEINSVRNLYPSIEYIYPPASLKLNPF--NFSL-K-DFKDY----IKD-------
A9WAZ2_CHLAA/4-463DRRSNIILVDDNN--IILDAIKRVSPRMSS-RVVLPRRVYELPPPPDKRDPL--RASA-A-EIEHL----L---------
Q04EZ3_OENOB/4-421GRHSNIFFLDSEN--KIIELIKHVPAFENRVRILLPGAQYQRPPKQDLINPF--ESSEFT--------------------
Q182T2_CLOD6/4-460GRHSNIIITHGEE-NKIIDSIKRVPFSISRVRQVLPGHDYSLPPEQNKLNPL-DDISK-D-LFIKN----LEE-------
Q1GA87_LACDA/4-437GRHSNVILYDKQS-GKIIDLLKRINPDENRARLLLPKAKYELPPLTPGINGF--TLTE-S-EFSSL------K-------
Q2G1U1_STAA8/4-441GKHSNLILVDENR--KIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPY--DITG-A-EVLKY----IDF-------
Q5L0T2_GEOKA/4-444GRHSNIILVDAST-DTIIDSLKHLPPSVNRYRTVLPGHPYVAPPTHGKLNPL--EATE-E-MVLKK----IDF-------
Q812X1_BACCR/4-444GRHSNIILLDTKT-NVILDSLKHVSLAVNRHRTVYAGAEYVAPPAQHKINPL--QIETAD-DFIRP----LDF-------
Q8DZB9_STRA5/4-427GKHSNIILIDKNE-HKIIESIKHVGFSQNSYRTILPGSTYIAPPKTKAINPF--DISD-Q-TLFEL----LQT-------
Q8XJB4_CLOPE/4-452ARHSNISLVRKRD-NKIMESIKHITANKNSFRVLYPGVSYVFPPASEKLNPF--DFSK-E-DLKIE----LSK-------
Q8Y670_LISMO/4-446GRHSNITLVDRAK-NVIVDCIKHVSPAQNSYRTLLPGATYVLPPATDKLNPF--EVTS-E-QILDR----LDF-------
Q9CFY4_LACLA/4-414GKHSNIILLEKTS-QKIIESIKHIGFSQNQYRTILPGSTYIAPPLNTAIDPF--KATD-E-EIFEA----LQ--------
R5JZW0_9CLOT/4-454GKHSNIIFTDADG--MIIDSIKHISHLVSSVREVLPGKAYVYPPSGDKRSPY--DADQ-D-YFASS----VYT-------
R5QBW9_9FIRM/4-453GKHSNIIFCSEDG--TIIDSIKHVSAQMSSVREVLPGRKYFIPDTMHKKDPL--TTEW-K-EFSLS----VND-------
R6P7M2_9CLOT/4-457GKYSNIILVDGQG--KIVDALKRVDEEMSSQRLVQPGLAYELPPAQNKPCML--ECQPEE-IVEAI----VHQ-------
R7FWI9_9FIRM/4-453GKHSNIIFCDLNG--RIIDSIKHVSAQMSSVREVLPGRDYFIPDTMSKKNPM--TATQ-E-EFISA----ILA-------
U5L7J1_9BACI/4-442GRHSNIVLVDKGR-NMILDSIKHVSYALNSHRAILPGQEYVKPPEQNKINPL--GLEE-E-DILRR----LDF-------

PF06831

FPG_MYCPN/135-227--------------------------------------------------------------------------------
FPG_ECOLI/129-219--------------------------------------------------------------------------------
FPG_STRMU/132-222--------------------------------------------------------------------------------
FPG_SYNY3/143-233--------------------------------------------------------------------------------
FPG_NEIMB/135-227--------------------------------------------------------------------------------
FPG_THET8/122-214--------------------------------------------------------------------------------
FPG_BACSU/134-224--------------------------------------------------------------------------------
FPG_ARATH/146-238--------------------------------------------------------------------------------
D3FWX6_ALKPO/134-224--------------------------------------------------------------------------------
FPG_THEEB/137-228--------------------------------------------------------------------------------
END8A_MYCTU/126-214--------------------------------------------------------------------------------
FPG1_MYCTU/144-231--------------------------------------------------------------------------------
FPG_LACLA/132-223--------------------------------------------------------------------------------

PF00416

RS18B_YEAST/16-144--------------------------------------------------------------------------------
RS18_RAT/14-142--------------------------------------------------------------------------------
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139--------------------------------------------------------------------------------
RS18_ARATH/14-142--------------------------------------------------------------------------------
RS18_DROME/14-142--------------------------------------------------------------------------------
RS13_HALMA/25-152--------------------------------------------------------------------------------
RS13_MYCTU/3-109--------------------------------------------------------------------------------
RS13_SHIDS/3-108--------------------------------------------------------------------------------
RS13_GEOKA/3-108--------------------------------------------------------------------------------
Q6R9D3_MAIZE/4-109--------------------------------------------------------------------------------

PF05833

RQCH_STRR6/4-428--Q-ELTAKNLQ-SLFQGLGRDTANELE----RILV-------------------SEKLSAFRNFFNQET----------
Q7V657_PROMM/52-482-VP-TKLRSALQ-QCYQGISPALALQLV----DDDAKKAHALLEVSVLEITDEQWQHLYHRWSRWLDCLE----------
A5GRV1_SYNR3/5-448-LP-ESIGRALM-GSYRGISPALRDQLL----QTAG----LDRHTPAADLSSAQWQQLFDSWQQWLSQLDS---------
Q7VDB7_PROMA/10-439-LP-KTLKEALK-DCYQGISPSLSLQLASEEKESAE----EFLNLQVQALSQTDWKRLHYRWSKWLKDLE----------
Q8DHA1_THEEB/5-448-IP-GRLRQQLL-KAYRGLSPALVQQLL----ADAA----LPPECCTTDLSAEEWRRLFDHWQHWLECLE----------
Q31PG3_SYNE7/5-452-VP-GRLDRQLI-QCYRGLSSRLVQQLC----RQAD----LDPQQNTAAIAPAAWQQLYGAWQDWLRGLQ----------
P73561_SYNY3/5-464-IP-GLLSKQLL-KSYRGVSPMVVKNLL----GQAD----LDSQVSNQDLTDEQWQNIFIAWQNWLQRLE----------
Q8YP27_NOSS1/5-452-VP-GAIKRQLL-KSYSGLSAVLVESML----LVAN----IAPETTTDTLHPEDWQRLFARWQEWLHTLD----------
Q110R4_TRIEI/5-453-VP-GSLSRNVI-KNYRGLSKALVEPMI----KTAG----LDPQQLTNSLNNSDWEKLFQLWQKWLQALD----------
Q2JJS2_SYNJB/5-470-IP-GPIGQRLL-RCYRGLSRHLVEAMC----HQAG----IPPQTSTDHLSARDWQALFARWQDWLTRLE----------
Q7NK58_GLOVI/5-445-VP-GPFAPTLF-KAYRGVSQTLAQQML----AEAH----LPTKVHIAELAEIDWRRLWELWRQWLACLG----------
A4S6P0_OSTLU/47-508DMGEARLDECMV-RAFRGVSPALAKALI----RGAG----VADGERVETASASDWVAVYDEFMRWIASVS----------
A6TRX6_ALKMQ/4-463-QPEHSIQKSLF-INFTGISPVIAREIC----YVSH----VEEGTPYITLKTEILRRIYVSFDTLVNQVN----------
A8MH76_ALKOO/4-463-DQRTSLYKALY-TSFHGISPLISREIC----FVSS----IDEDILLTNLSEDNLKSIYSSFLYLMNQIK----------
A3DCY8_HUNT2/4-460-DP--RISKFFL-NNIKGFSPLLCEEIC----HRAD----VDPRLPVSSLSEDTIQNLKKVLKEIISKIE----------
B8I3G9_RUMCH/4-460-AK--HPEGLIL-NTVKGFSPYTCRDIC----ASAG----VPSKTPIGELNDSDKEKIKVALAKYIDKIK----------
Q8R9S1_CALS4/4-455-QKTKKIEKALV-EILQGFSTTLSSEVS----FQCS-----ISDSFVETLGEEKIEQIYQKVRDIYEKVY----------
A5N7G3_CLOK5/4-459--MKFLDTKSFS-KIFTGVSTSFSKELY----YMLS----ELKLSELDIFKESTITVLHGFCSKIFSEFK----------
A0Q075_CLONN/4-456-NSLQLNDNIFS-KIFTGVSKTLSSEIC----FRLK--------NNSIDLSLSNLKEIVEVCKDLFKEIQ----------
Q97HA2_CLOAB/4-451-KDITKNPNMFS-KTFTGVSSTLSKELY----FNVE--------------KLNSLEAAFDYLKTIFDKVK----------
Q894E2_CLOTE/7-456-NNIKLNNTFVS-KVFMGVGNQLSKEII----NSLN-----------SELSLENLKDIHKEIELFFNKVT----------
B8CWR5_HALOH/4-456-DFSQSSFKAIM-YNFRGIGPNMAKEIV----YRSG----LDHKKPYGGLSPFERNKLWDGFNNIFRLVI----------
Q0AXH0_SYNWW/4-462-GSNNTLANSFF-QVFSGISPFSSGEFC----WSAG----LDPLLPVDQCGELEFSRLFHHSRTVLQNIE----------
A8FD29_BACP2/4-445--QEGMIAKQIV-DTFSGVSPLFAKEAV----HRAG----LVNQ-----------ETIPNTLLDMFQLIR----------
Q65JT4_BACLD/4-446--QEGKLDRQIV-DTFSGVSPLFAKEAV----FRAG----LANR-----------ATLPNVLTEMFSEIK----------
Q9K9X8_BACHD/4-445--NEGKLDRQLV-RAFSGLSPIVAKEIV----FRAG----MANR-----------DSLPAAFTTFMQDVA----------
Q5WFK0_BACSK/4-443--HGGKLDKQLV-QSFAGLSPLIAAEIV----ARAK----LANR-----------QTLPPAFVSTLAPLK----------
Q8ER31_OCEIH/4-445--NSGKIDQQML-QMLEGFSPLITKDLA----SSVA----LGTN-----------EQYQSMFEEVQHRLA----------
Q5M4J6_STRT2/4-429--TEDLSAKNLQ-KLFQGLGRDTANELS----ALLE-------------------TDKLKNFRDFFNREV----------
Q8DTA9_STRMU/4-427--TEDLAANNLQ-KLFQGLGRDTAAELS----QRLK-------------------TDTFKNFKLFFDSPT----------
Q835X0_ENTFA/4-442--APELNGRYLQ-QHFQGLGKDTADELS----ARLL----------------AQPNEKMAIWTEFWSSVT----------
Q38X19_LACSS/4-442--DADEQIHWLQ-QQFQGMSRESALELQ----TRLM-----------------DHDNYLAVVTDFFKQFD----------
Q1WTS3_LACS1/4-435-PNREVLADSLL-KQYQGISRDNALALA----DKLH-----------------TSNNHVQAFNDFLAMTE----------
Q03S51_LACBA/4-442-PNQEVLAQTLQ-HQYQGLGKDTAAALA----TALH-----------------ASGDAQKHFQAFFERFN----------
Q03FM0_PEDPA/4-444-PNYEVLAQAIR-TTFQGFGKETALELA----YEMV-----------------NAKDSLKTIQDYLAKFD----------
A5VK20_LACRD/4-442-DDTVELSHQLQ-EHYQGFGKDSARELA----AELL-----------------QSDNLPATYQHFLKHFE----------
Q5FJY7_LACAC/4-438--NEKSIP-DLV-KSMDGLDRDDREELT----GYLE-------D-----------DFSYSSFKTFFDQFN----------
Q74JC6_LACJO/4-439--EKYPEPADFV-RQFNGLDGDDKKEFT----GYLE-------D-----------DFSYSSLQTFFNQFN----------
A9AW28_HERA2/4-452--LGGDLAKALV-TEYSGISPQTGREIA----WRAV------GATSVEITPELDFAQIAQLLRQLTSLSR----------
A5UZA2_ROSS1/4-464---QPDLARALV-SAYRGLSPLAAREVV----YRVM------GRTIVPTGADLPWEALAGALRQLCQPPW----------
Q24TV3_DESHY/15-479-GLSEKVVDLLV-RHYAGISPELAREIM----TRSG----LAQTITLDQCGDIDLSRIFQAYTLLANPAH----------
Q67PS6_SYMTH/4-455-DPDLPAWQAVL-ERVDGLGPLLSREAV----CRAG----APADAPLR---AVDPDRLAAAVRELADARD----------
A4J565_DESRM/4-461-DIDLKVTDIFL-QRIAGVGPLTCRELV----FRAG----LAVDYRLEHCGDYELTQLWQQIQYLGELLE----------
Q2RK36_MOOTA/4-459-NWGDPLERLLV-NRLAGVGPETAREII----HRAG----LPAGTTLEGCGAYEVNRLYQALGEVLAATG----------
Q9WYJ8_THEMA/4-433--SEKTIRNVLL-SLLEGFSPVSVEELI----HRTG----YELDTPWKAVDQRKILEVLEEIKKELE-------------
A7HKC1_FERNB/4-444-DKKKSLVEFIY-TKFQGFSKVTAEEVL----YRSE-----LDNKSLSEVSLEDLKRVYEILISVKEELK----------
A8F860_PSELT/4-437----AKISQVLS-QEFFGFSKYIIRELL----NRAN-----LQDKLACDLLTEERESLKHSFFSLINDFE----------
Q3A4K7_PELCD/16-444---DDALAAWLQ-RNIRPMTPVVARDLV----GRM-----LRKETAAEVLGSFARRWQEHDYSFQIAQLE----------
Q18J82_HALWD/8-471---DTDIVRTLA-TQL-NLGGLYAEEVC----ARAG----IDKTTQITNTSDKIYRAIYTALESLGTQLQ----------
Q8TZ51_METKA/10-472---DRDLVRTLA-VDV-GLGGLYAEEVL----LRAGL--YERRESHASEFEEDELEELYETLRDLLEQIS----------
RQCH_METJA/6-475NNKGVECVRLIS-RVF-GIGGLYAEEIC----ERAE----IDKKK--RDLSEEEIKKLFEASKNLFDEIF----------
Q2NGY7_METST/2-454---DRDITRTLA-TN--GLGGLYAEEVI----SYTS----INKEKLAKELTDDEITQLNNAINELFNKIE----------
Q8TSZ2_METAC/6-492---TADIVRTIA-TRF-NLGGVLAEEAC----VRAG----VDKAKPAKEATVEDAEGLRDALQDLFSPLFIGRAAGEGKG
RQCH_STRSY/4-429--Q-ELSPKNLQ-QVFQGLGRDTASELA----NHLQ----IDR---------------LKNFRAFFDQAT----------
A5I337_CLOBH/4-453--NNVKLNKTMFSNIFTGVAMPFSKEIL----YRLE-------KENNLEITLENMDEIYVVTKNIFDSIK----------
A9WAZ2_CHLAA/4-463--GKGEPVKALV-NAYRGVSPQIAREVL----TRAC-------GSIPQAGLALPAYTIAARLREIFAEPP----------
Q04EZ3_OENOB/4-421----SNDPRILA-DHYQGMSMVSAREAA-----D------------------------AEYLTDWFKKFD----------
Q182T2_CLOD6/4-460--LEGPIFKSIY-SKFLGISPIIAKEIC----YRAG----VNQNAIIKDISDEQFDALHKVFCNLFNDIN----------
Q1GA87_LACDA/4-437--RDYPTPADLA-KQMDGLDGDDRQELT----GYLE-------D-----------DYSFSSLKTFYNQFS----------
Q2G1U1_STAA8/4-441--NAGNIAKQLL-NQFEGFSPLITNEIV----SRRQ----FMTS-----------STLPEAFDEVMAETK----------
Q5L0T2_GEOKA/4-444--HAGKLAHQLV-SAFSGISPLFANEAV----FRAG----LANR-----------TTLPKSFLALIDDVR----------
Q812X1_BACCR/4-444--LSGNMDKQLV-GAFMGISPLFAKEVV----KKAG----MVNE-----------KALSEAFFSIQTPLL----------
Q8DZB9_STRA5/4-427--N-DLSPKNLQ-QLLQGLGRDTALELS----HCLK-------------------DNKLNDFRQFFSRE-----------
Q8XJB4_CLOPE/4-452-NNNELDEKIFS-KLLTGVGKNLSLEMY----SLFK------SQFGASYVFDDIFNFICNYFNNIFKDIQ----------
Q8Y670_LISMO/4-446--SAGRIDKQLV-QNFAGFSPLLAREIV----FRAG------------NLTADSLVAAFFEVMGLVNDHL----------
Q9CFY4_LACLA/4-414-------TEQLQ-QKLQGIGRDSKNALT----GLSV-----------------------KEFNEKLLT------------
R5JZW0_9CLOT/4-454--KPVTVTKAIY-TSVTGISPLIANELC----YRVG----IDGGQSTAALTDIQKEKLYQEFEKMVSDIK----------
R5QBW9_9FIRM/4-453--KPMSVAKALY-TSFTGISPVTAEEIC----YLAG----IDSTLPAKEYSQDVLFHLYTQFTIYLSAIK----------
R6P7M2_9CLOT/4-457-PKNQSLNKGIL-NALQGLSPVVCREIE----HQVG----RGQELFTRDLTQEQRERLRFFLERLFTTVR----------
R7FWI9_9FIRM/4-453--KPMPVSKAIY-SSMTGISPVIAEEIC----YLAG----VDSSMTAHDLSEDVLTHLYRQFTYYMEDVR----------
U5L7J1_9BACI/4-442--NAGKMDKQLV-EQFAGISPLFAKEAV----KRAG----MSNR-----------NTIPKAFLDLLGPVK----------

PF06831

FPG_MYCPN/135-227-------------TNISGIGNIYADEIL----FASK----IHPETLAKNLNLSQYQLICQNATDILKKAV----------
FPG_ECOLI/129-219-------------KLVVGVGNIYASESL----FAAG----IHPDRLASSLSLAECELLARVIKAVLLRSI----------
FPG_STRMU/132-222-------------HLVAGLGNIYVDEVL----WAAK----VDPERLASQLKKSEIKRIHDETIRILQLAI----------
FPG_SYNY3/143-233-------------RLVAGLGNIYADEVL----FFCG----FHPTMASNQVSLQDCELIHQQIQATLTAAI----------
FPG_NEIMB/135-227-------------AVVVGVGNIYANESL----FRAG----ISPHRPANRLKKKECALLVETVKAVLQRAI----------
FPG_THET8/122-214-------------RLAAGVGNIYADEAL----FRAR----LSPFRPARSLTEEEARRLYRALREVLAEAV----------
FPG_BACSU/134-224-------------KTVVGLGNIYVDEAL----FRAG----VHPETKANQLSDKTIKTLHAEIKNTLQEAI----------
FPG_ARATH/146-238-------------GYISGIGNWIADEVL----YQAR----IHPLQTASSLSKEQCEALHTSIKEVIEKAV----------
D3FWX6_ALKPO/134-224-------------KTVVGLGNIYVDEAL----FRAR----IHPERLAHSLSKEEMAVLHKAIVSTLEEAV----------
FPG_THEEB/137-228-------------SIVAGMGNIYADESL----FLSG----LHPTQSAHTLTPEQVQRLHGVICQVLREGI----------
END8A_MYCTU/126-214-------------TVIAGVGNVYRNELL----FRHR----IDPQRPGRGIGEPEFDAAWNDLVSLMKVGL----------
FPG1_MYCTU/144-231-------------RVVSGIGNIYADEAL----WRAK----VNGAHVAATLRCRRLGAVLHAAADVMREAL----------
FPG_LACLA/132-223-------------TLVAGLGNIYVDEVL----WLAK----IHPEKVANQLTESSIHLLHDSIIEILQKAI----------

PF00416

RS18B_YEAST/16-144-------------TTIKGVGRRYSNLVC----KKAD----VDLHKRAGELTQEELERIVQIMQNPTHYKI----------
RS18_RAT/14-142-------------TAIKGVGRRYAHVVL----RKAD----IDLTKRAGELTEDEVERVITIMQNPRQYKI----------
RR13_ARATH/49-153-------------QYIHGIGRTRARQIL----VDLQ----MEN-KITKDMAEEELIILRDEVSK----------------
RS13_SULAC/11-139-------------AMIKGIGYNTAMIII----RKLN----LDKDKRLGEISDEDIKKIENLLNNKIIPES----------
RS18_ARATH/14-142-------------TSIKGIGRRLANIVC----KKAD----VDMNKRAGELSAAEIDNLMTIVANPRQFKI----------
RS18_DROME/14-142-------------TAIKGVGRRYSNIVL----KKAD----VDLTKRAGECTEEEVDKVVTIISNPLQYKV----------
RS13_HALMA/25-152-------------TELNGIGHRAARIIA----QKAD----VDRRAVFGKLDDDVIERVVERVENFADDVP----------
RS13_MYCTU/3-109-------------TYIFGIGRTRSNEIL----AATG----IDRDLRTRDLTEEQLIHLRDYIEA----------------
RS13_SHIDS/3-108-------------TSIYGVGKTRSKAIL----AAAG----IAEDVKISELSEGQIDTLRDEVAK----------------
RS13_GEOKA/3-108-------------TYIYGIGKPTAQKIL----KEAG----VSEDTRVRDLTEEELGRIREIVGR----------------
Q6R9D3_MAIZE/4-109-------------TKMDGIGPKKAIQLC----YRLG----ISGNIKIHELTKYQIDQIEQMIAQ----------------

PF05833

RQCH_STRR6/4-428---------------------KP--CL--------T-----ETSFSPV-P---FANQA-G-------EPFANLSDLLDTY
Q7V657_PROMM/52-482--------------K---ERFTM-RFD--------G-----PSSYRV---WDCDTSTSS--------SFTDGLSLTLGSY
A5GRV1_SYNR3/5-448-------------QA---LQFAS------------S-----GSGYRC---WGEPSPCQS--------NTPLALNLSLARY
Q7VDB7_PROMA/10-439--------------R---ENFCI-SFS--------G-----PSAYRV---WKPNLSND---------DNYKKISLSLGNY
Q8DHA1_THEEB/5-448--------------R---GHFGP--QF--------T-----ATGYRVIPPLGAQA------------PSTLSIHEILATY
Q31PG3_SYNE7/5-452-------------AE---TAFQP--QL--------Q-----ESGYRLL-PTGP--------------DSANSVNAVIATY
P73561_SYNY3/5-464--------------K---LDFLG--KS--------L-----PQGYIVL-AETTVVNDV-KPTQEEGDRPLLPINKLVSEY
Q8YP27_NOSS1/5-452--------------S---GKFQP--AW--------M-----ANGYTVM-GWGAV-------------APVQDIQTLINEY
Q110R4_TRIEI/5-453--------------K---LIFNP--GW--------T-----STGYTVT-GWKAI-------------ECVDSVGELLNHY
Q2JJS2_SYNJB/5-470--------------T---GQFDP--AP--------T-----PQGYTVL-GWASGAVPVSGTESL-QQPSRLNLHQLLEGY
Q7NK58_GLOVI/5-445--------------E---GSYRP--GW--------T-----TGGYTVL-GWDLR-------------APERSVHTLLDRY
A4S6P0_OSTLU/47-508--------------S---D------AD--------S-----AGTLANA-TWCEEFGQF---------VAGGPIGALFGAV
A6TRX6_ALKMQ/4-463--------------M---KNFSP--QLYWNQET-EE-----YIDFTAL-P---FSHLN-HYAS----KPFESISHLLEGY
A8MH76_ALKOO/4-463--------------N---HNFSP--SVYLDEAS-GK-----YIDFNAI-E---ISHLR-YYTR----NSFESVNELLEGF
A3DCY8_HUNT2/4-460--------------N---SEFTP--CIIWNGDDRQK-----AVDFHSL-E---IKQ---YNTV----DFYPSISRVLDLF
B8I3G9_RUMCH/4-460--------------S---NNFSP--CIVYEDKSMLR-----PIDFYCF-E---PSK---EVFY----KSYELLSTALDQY
Q8R9S1_CALS4/4-455--------------N---LEVKP--CVVFLED---K-----VADFSCI-E---LTQ---YKKR----LLFDTVNEAADKF
A5N7G3_CLOK5/4-459--------------N---NEFYF--AYYTKDG---K-----MKDFYCS-K---LTYLK-DCME----VHYSTPSKLIDDF
A0Q075_CLONN/4-456--------------S---NKFEF--NCYTKNN---S-----FVGFYCL-N---LMSKE-DYKK----IQYDSSSKLLENF
Q97HA2_CLOAB/4-451--------------N---NDFYF--ASYLTNG---Y-----VKDFYCL-R---LNYLE-GFSE----KTYATPSLLIQEF
Q894E2_CLOTE/7-456--------------Q---DNFSF--FITLEND---I-----FQDFFPI-D---LSSLE-QKDK----LHFSSPSKTLEYY
B8CWR5_HALOH/4-456--------------E---GKFKP--TIGIDNN--NN-----ICYFSAF-P---LEHNKDIKKD----LIFDNTASLFDYY
Q0AXH0_SYNWW/4-462--------------Q---AKLHP--VAIYSNL---Q-----PLEFAPY-P--ILSLNESGYKS----LNFSSINEACDRY
A8FD29_BACP2/4-445--------------M---HSFTP--Q-LTRKD---G-----KEYFYLL-E---LQHI--DGEM----KTFGSLSQLLDRF
Q65JT4_BACLD/4-446--------------S---RRFQP--QLVTTED---G-----KEYFYLL-E---LTHI--KGDN----RPFHTLSELLDRY
Q9K9X8_BACHD/4-445--------------A---HRYEP--T-FIQGE---E-----KEQFSFL-P---LTHM--KGER----KTFASCSALLDRF
Q5WFK0_BACSK/4-443--------------N---HEYTL--E-LVQG----E-----KDYFSVI-H---LSHK--NGER----HVFSSPSALLDRY
Q8ER31_OCEIH/4-445--------------S---HEYIP--T--IYKN---G-----KEDFHVL-P---LTSKS-NAEN----ESFESVNQMLDTF
Q5M4J6_STRT2/4-429---------------------EP--NLT-------------TKAFSAV-R---FSDSQDQ-------PEFETLSELLDYY
Q8DTA9_STRMU/4-427---------------------SP--TLT-------------EKSFTAI-T---FSNSQ---------ETFGSLSDLLDYF
Q835X0_ENTFA/4-442------------------EAVVP--TLTVTEK---------KEYFTPI-P---YQSLVGEQ------TTYATLSELLDAF
Q38X19_LACSS/4-442-------------------QAQP--TLTIGEK---------KSWFTAF-P---YQSLTGTQ------SHFETLSELLDQY
Q1WTS3_LACS1/4-435-------------------DPIP--TMN-------------GNNFSIF-----TDNPNG--------KKFTTLSEMLDVF
Q03S51_LACBA/4-442-------------------APQP--TLTVTVN---N-----KTNFTAF-P---YPTSGTT-------ESHPTLSVLLDHY
Q03FM0_PEDPA/4-444---------------------QP--TGFIYDNKAG------KLTFAAVKP---QLDVNENDV-----HQYASLSETLDQY
A5VK20_LACRD/4-442-------------------NPEP--VLITHSN---G-----KTQFAVF-P---PLNIDGEL------QHFDSLSALLDAF
Q5FJY7_LACAC/4-438--------------N-------P--RAFVLKTPRNK-----RKIFCYL-P---YHLDL-EKEN-----SNPDLNKGLDEF
Q74JC6_LACJO/4-439--------------R-------P--KGYVLQTIKHK-----DRVYTYL-P---YHLEL-NLIY-----SNDDVNKTLDEF
A9AW28_HERA2/4-452--------------------SEPTLARNADGT---------PIGIAAF-----------NLQHQAHTETFPSMNEALATA
A5UZA2_ROSS1/4-464---------------------TP--HIVIDDG---E-----PVAFAPY-----------ELTHLPGARPCPSMSAALDAY
Q24TV3_DESHY/15-479--------------T---PPLEP--TLYYQGAVKLTRPSPLPTAFTIL-P---FQQYQ-GLPA----QSFTTLAEAVESF
Q67PS6_SYMTH/4-455--------------------WSP--RLLYDPQ--GR-----LKEFHVL-P---LRHWP-GRAE----DGFPSVSACLDAY
A4J565_DESRM/4-461--------------K---GYFQP--TLLLDRR--EL-----PVDFSAI-D---LSHLKFFK------KETGSISHVLDGY
Q2RK36_MOOTA/4-459--------------P---AAWKP--EVILRPE--GE-----PLAFASF-E---LHQYQ-GLPR----EHPATPGAACDYF
Q9WYJ8_THEMA/4-433---------------------LPGVFVYYEAS---H-----PVEVSAF-RFTMLSLKE---------RYFEKPSEGINEF
A7HKC1_FERNB/4-444--------------E-----GTL--RLYYEDE---K-----PKDISVI-R---LHQYR-DEKK------CSEFVKCVNEY
A8F860_PSELT/4-437--------------R-----GKT--YV-YEFE---E-----KFLITTI-P---LKTLP-FKNL----SEHSNISNAIDDI
Q3A4K7_PELCD/16-444--------------------GSPRLFVFCPS----------TLSLSSV-------------------RTFSSASEAADCF
Q18J82_HALWD/8-471--------------S---GDFEP--RLYTDD----------DAVIDAT-PFPLEERKQQNLDV----TTYDSFNGALDVY
Q8TZ51_METKA/10-472-----------------EGDLRP--TLYRTTE---------RDYVDVT-PVPLERY-SDELEM----EEQDTFQRALDEY
RQCH_METJA/6-475------------------NNRKP--QIVLKD----------NEYFDVV-PIDLKKY--KGLEK----KYYNSFLEAVDDY
Q2NGY7_METST/2-454------------------TNPQP--QIILDEN---------DKNKDLV-PITLNKY--AQFKS----KSFETFNMAADEF
Q8TSZ2_METAC/6-492EAEAGVGTEPATGVEAEAPKLRP--QHVKKEINGK------IETFDVV-PFDLIRY--SEFEK----EYFDSFNTALDEF
RQCH_STRSY/4-429---------------------QP--SL--------T-----DKSYAAL-P---FANSP--ENQ----PHFESLSSLLDFY
A5I337_CLOBH/4-453--------------N---KEFCF--NCYLEKD---T-----VKDFYCV-N---LHSLY-NFKN----IDYENPSLLIESF
A9WAZ2_CHLAA/4-463---------------------AP--HLVRNEQ---G-----PVAFAPYYP---SHLAGDGATI----TVMPGMSAALEAF
Q04EZ3_OENOB/4-421--------------Q---PQA----TLTKINE---K-----KSEFTAF-P---YKSV--IGEK----TFFPLLSDLLDAY
Q182T2_CLOD6/4-460--------------S---NKYSP--CIIIDKKV-DR-----VVDFSCI-N---LTLFS-DLSY----INKDSMSRILEDF
Q1GA87_LACDA/4-437--------------S---PKAYV----LLTPK---H-----KRRIYPYLP---YHL-E-MTKE----SSSTNLNEALDEF
Q2G1U1_STAA8/4-441--------------------LPP--TPIFHKNHETG-----KEDFYFI-K---LNQFN--DDT----VTYDSLNDLLDRF
Q5L0T2_GEOKA/4-444--------------H---RRFAP--MMYTNG----E-----KEWFYVL-P---LKHLK--IEG----QPFASASELLDRF
Q812X1_BACCR/4-444--------------S---HAYTP--TMITAN----G-----KEFFYLF-P---LTHLQ-G-EE----KTFSSVSELLDRF
Q8DZB9_STRA5/4-427--------------------YYP--SL--------T-----EKSFSAV-Q---FSSS-----H----ETFQSLGQLLDYY
Q8XJB4_CLOPE/4-452----------------------N--IIFYKNE---K-----IIDFYFK-D---LSILN-HCTK----EVYDNSSELLDAF
Q8Y670_LISMO/4-446--------------G---SAAVP--NEW-RIQ---N-----KEDYYFF-S---LRHV--DAEI----TEFANLSTLLDHF
Q9CFY4_LACLA/4-414--------------------VTP--SIYP------------NDTFSSI-K---LAD---EF------VSFDSLSEMLDTY
R5JZW0_9CLOT/4-454--------------T---ENYVP--NIVYDGY---I-----PVEFSSV-R---LSMYQ-DYQV----EDKDEISKVLDEY
R5QBW9_9FIRM/4-453--------------E---GRFEP--AIYYDKQ---E-----PKEFSAL-E---LTYLS-AYEK----RLFPSVCEILRTY
R6P7M2_9CLOT/4-457--------------D---TAGEP--YMVTKIK--GK-----PMEFSFL-N---IVQYGTLASV----SRWEDFSSLLDEF
R7FWI9_9FIRM/4-453--------------Q---GNFHP--SIYYNGN---A-----PKEFSAL-P---VTHFN-EYTK----KEFFSISEVLYTY
U5L7J1_9BACI/4-442--------------N---HEYTP--AIT--AG---Q-----KENFYLF-P---LEHT--GGSS----RTFETLSGMLDRF

PF06831

FPG_MYCPN/135-227--------------------------------------------------------------------------------
FPG_ECOLI/129-219--------------------------------------------------------------------------------
FPG_STRMU/132-222--------------------------------------------------------------------------------
FPG_SYNY3/143-233--------------------------------------------------------------------------------
FPG_NEIMB/135-227--------------------------------------------------------------------------------
FPG_THET8/122-214--------------------------------------------------------------------------------
FPG_BACSU/134-224--------------------------------------------------------------------------------
FPG_ARATH/146-238--------------------------------------------------------------------------------
D3FWX6_ALKPO/134-224--------------------------------------------------------------------------------
FPG_THEEB/137-228--------------------------------------------------------------------------------
END8A_MYCTU/126-214--------------------------------------------------------------------------------
FPG1_MYCTU/144-231--------------------------------------------------------------------------------
FPG_LACLA/132-223--------------------------------------------------------------------------------

PF00416

RS18B_YEAST/16-144------------------------------------------------------------------------PAWFLNRQ
RS18_RAT/14-142------------------------------------------------------------------------PDWFLNRQ
RR13_ARATH/49-153--------------------------------------------------------------------------------
RS13_SULAC/11-139------------------------------------------------------------------------PNWIYNRQ
RS18_ARATH/14-142------------------------------------------------------------------------PDWFLNRQ
RS18_DROME/14-142------------------------------------------------------------------------PNWFLNRQ
RS13_HALMA/25-152------------------------------------------------------------------------EWMT-NHQ
RS13_MYCTU/3-109--------------------------------------------------------------------------------
RS13_SHIDS/3-108--------------------------------------------------------------------------------
RS13_GEOKA/3-108--------------------------------------------------------------------------------
Q6R9D3_MAIZE/4-109--------------------------------------------------------------------------------

PF05833

RQCH_STRR6/4-428YKNKAERDRVK-Q--QASELIRR---VENELQKNRHKLKKQERELLATDNA-----EEFRQKGELLTTFLHQV-PNDQDQ
Q7V657_PROMM/52-482YRRHLETQSLN-Q--LAEDLQKR---LFQWRQREEQALGEQQGRLNETSQS-----NSLQQQADAMLCLP----------
A5GRV1_SYNR3/5-448YGQGLRQAQCQ-Q--QRQRLEQH---LQQLVQREQRELQRQELLLARSGDE-----HLLQRQADLLLCRSDVS-SSGHHQ
Q7VDB7_PROMA/10-439YKNNLEAKKLN-H--TYKRLSED---IIRIKANEEKSLKTQEELFSKISEI-----KSLQIQAENILCLN----------
Q8DHA1_THEEB/5-448YQNQLQQQQTQ-Q--LQQQLHQS---LEAQRQKLIAKIEGFRERLAAAAGG-----DRQRYLADLLMAHAHLW-QPGMTE
Q31PG3_SYNE7/5-452YDRQLLSQQFQ-Q--LRQQLSQR---LQQQQQKLQQKQQDFQGRLLAAEDA-----DRWRQQGDLLMASLDQW-QPGMES
P73561_SYNY3/5-464YRRELGRENFQ-Q--LQHQIQQK---LNNLIAKLQQKADTFKQRLNAAANA-----QQYQRQADLLMAYLHQG-QPGLSS
Q8YP27_NOSS1/5-452YTKQLNQQLFA-Q--LRHQLTQK---LSNILGKLRNKAQTFSDRLQQSDRA-----DEYRQKADLLMAHLQNW-QPGMKE
Q110R4_TRIEI/5-453YTQQLNQQEFT-Q--LHHQISQK---VNSITAKLQLKAQTFTQRLEQSDGA-----ELLRSQADLLMANLQEW-QPGMKN
Q2JJS2_SYNJB/5-470YQAQLNREQFE-R--ERHRLLQR---VSTLLKKLYQRREQFEAMLADSTQA-----EASKQAADLLMAHLHLW-RPGLHH
Q7NK58_GLOVI/5-445YTAQLQADLLR-A--RRSRLQQI---LKATLAKAVKRRAALEQMLAGAAEG-----ERHKQMADLLMAYLHQGAEPGARR
A4S6P0_OSTLU/47-508YGEAGETDVFE-R--ERSRILQA---VRARLKKLASKDVGFRKQLEAASGH-----EEIQLLADALMAYSYNY-KPGSSE
A6TRX6_ALKMQ/4-463YANRDQRERMK-Q--RSQGLRKS---VSIKLDRLYNKIQNLKKDYNKAQKS-----QNDKIIGDLITANLHQL-KKGQKS
A8MH76_ALKOO/4-463YLQRASKERMK-Q--RTVDLRKS---VSLKLDRLYNKLNNLNKDLDNAHES-----EKYKLYGDLITANIYQV-PKGEEE
A3DCY8_HUNT2/4-460YTIKDTSERLA-Q--KKADLAKI---LNNCIDRCNKKISIHMDTLREVAER-----EKFKLYGELITANIYCI-PKNASK
B8I3G9_RUMCH/4-460YMLRDTNERLG-Q--KMGDVLKV---VKNGIERCQKKTTMFNEKLREVSER-----DKLQLYGELITANIYCI-AEGAKS
Q8R9S1_CALS4/4-455FFEKIKSANFQ-M--KSSDLKKI---VQNILEKLYVKLNKLQEELAEADKA-----EIYKLYGELLTVNLHSI-KKGLEK
A5N7G3_CLOK5/4-459YYEKDKADRLN-S--KSSDMQKL---ININLERCNKKVKILMENLKDCKNK-----DTYRIQGELLTSNIYNI-HKGDSK
A0Q075_CLONN/4-456YYAKDKSDRLK-S--KSSDLQKI---VMNNINRCTKKDKILNNTLKKCEDK-----DIFKLYGELLTANIYAL-KKGLSH
Q97HA2_CLOAB/4-451YFEKDKAERLK-N--RSSDLQKI---VNTNLERCRKKNEIYEDELNECANK-----DTYKIYGELLTSNIYTI-KKGDKT
Q894E2_CLOTE/7-456YSEKDKRDRLN-N--KSHSLLKL---VNNNLDRCHKKMEILNDNLKKCEKA-----DKYRIYGELLTANIYSI-KQGDES
B8CWR5_HALOH/4-456YENKIKLAHIG-S--IKNSLIKV---VSNYLKKNRKKRNKLRKQLNESKRA-----DEYKKIGELIKANMYIL-TKGMKQ
Q0AXH0_SYNWW/4-462YNDSLKMIRLE-S--MKVNLSRN---IKIRLDKAYKKHFFQEGDLAKAYEK-----LKYKEWGEMLTAYAFKF-QKGDKT
A8FD29_BACP2/4-445YFGKAERDRVK-Q--QASDLERF---VVNEKKKNENKLKKLNRTLEESQNA-----HKYQLYGELLTANLYAI-KKGDKE
Q65JT4_BACLD/4-446YFGKAERDRVK-Q--QAHDLERF---AANEKKKNENKIKKLKKTLEQSEHA-----QDYQLYGELLTANLYQL-KKGDKE
Q9K9X8_BACHD/4-445YFQKADRDRVK-Q--QAHDLERF---LRNERDKNVNKIKKLEKTLDDAEKA-----KQYQKFGELVTANLHLV-KRGDAS
Q5WFK0_BACSK/4-443YYGKAERDRVK-Q--QAFDLERL---LKNEYQKNKRKLKKLEQTLQQADEA-----DSYQKQGELLTANIHAV-DRGASS
Q8ER31_OCEIH/4-445YSGKAERDRVK-Q--QAKDLYRF---IKNEKQKNERKLKKHQQTVQKSEHA-----DEYQRLGELLTAHMHEV-QLGDKQ
Q5M4J6_STRT2/4-429YLDKAARDRVA-Q--QASDLIHR---VQNELEKNKKKLVKQEKELAATENA-----EEFRQKGELLTTFLSMV-PNDKDS
Q8DTA9_STRMU/4-427YQDKAERDRIA-Q--QASDLIHR---IQNELEKNKKKLKKQEQELQDTDKA-----EEFRQKGELLTTYLNQV-PNNQDS
Q835X0_ENTFA/4-442YSGKAEKDRVK-Q--QGGELIRK---IENELKRNQKKLKKLQQTLADTENA-----ENYRRDGELLTTFMAQV-PKGATE
Q38X19_LACSS/4-442YLHKAQRDRVL-Q--QGGALIHF---IRNEIQKDEKKLKKLQKTLKAADSA-----DDYRIKGEILTTYLRQV-ERGMTE
Q1WTS3_LACS1/4-435YHTKANRDRVQ-Q--QGGQLLHV---IRKNLQRNKKKLKKLSNELKATENA-----DEYRIKGEVLTTYLYQI-KRGMTK
Q03S51_LACBA/4-442YEDKAERDRVQ-Q--QGSVLIRV---VRNELKKNRTKLKKLQRTLAETENA-----DDYRIKGEILTTYLNQV-VRGETA
Q03FM0_PEDPA/4-444YYEKVQRDRVQ-Q--RGHVLIRV---VRNELKKNRKKLKKLQQTMNQTKLA-----DTYRVKGEILTTYLHQI-ERGMTE
A5VK20_LACRD/4-442YANKAEQDRSK-E--LAGQVLKV---LKNELKKDRRKVKKLQQQLQDAATA-----DQYRICGEILTTYLSKL-TPGMKE
Q5FJY7_LACAC/4-438YEYQATRDWVK-Q--RASQVERV---VKNEQNKLSKKIKKLEKQLNLAENS-----EGYRIKGEILNANLGQV-KPGMTE
Q74JC6_LACJO/4-439YRDQANREWVK-Q--KSKRIENI---VNNELKKLKKKIIKLRKQLDQAENS-----EEYRIKGELLNAYLHEV-KAGMTS
A9AW28_HERA2/4-452FAELDQVTAHA-Q--RREALLER---VAEAQRRIKTKADQLRTQLARVEQL-----ERLRWEGEMIFGYIYAI-KPGQSE
A5UZA2_ROSS1/4-464YATRERLTAHH-Q--RRDALRER---LNAMRERLERQRSALRAELERASDL-----ERLRWEGEMIFAFLHEL-APGQDH
Q24TV3_DESHY/15-479YQSKASSNTLE-A--KRGSLRKI---IQEQLQHLNKKKGIYEDTLATAAKG-----LNYQRWGELLTANLYRL-ELGMKE
Q67PS6_SYMTH/4-455FGRRAEEERFL-S--LRGSLARL---VRDEIARVRRKLHAQEESLAAAESA-----ETYRLQAELITANLWQI-TKGMTE
A4J565_DESRM/4-461YRKIIELRQLE-S--FRHSLLQT---VRKEIGRLKKKISLYQKSLASAEKA-----DEYRIFGELLTANLYQI-DQG-KE
Q2RK36_MOOTA/4-459YSLRREHQLLE-G--TRRSLEHV---LEKELKRCRKKEGLQAATVAEAAGA-----EEFRLAGELITANIYRI-KKGQAS
Q9WYJ8_THEMA/4-433VRWKEEKSTFE-N--TKNRFIKV---VVNRIEDLEDLEEKLSRELSEAEKA-----ERYKKLGDLIVQNLWSI-KGKSGE
A7HKC1_FERNB/4-444FEYVEVKDKIT-E--KRNQLISV---VKSKIDHYENLLSELERELEECKDA-----DKYRKYGELIKAYSYQI-NCGEEM
A8F860_PSELT/4-437YKIVLLKKEVD-N--FKARLIKC---VQDKVKKSEKILNTLEEELLACRKA-----EEYHKYGELLK-YAQEK-KDLHKS
Q3A4K7_PELCD/16-444FDDYAMPGRGE-E---RSRLEKV---VRKALARVEKRLQRLRQEAANTDDA-----DRYQQLGQLLMSNLFRV-SKGMAE
Q18J82_HALWD/8-471FREVDRNPAAEESGQTRPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTAR-AEDTSW
Q8TZ51_METKA/10-472YVTKFLAEKER-E--VREEWEREKRRLERTIERQRSSIEQLRTKAEKLRGRANALYLNYNLVDGILSELRKAE-RKGYSL
RQCH_METJA/6-475FAKFLTKVVVK-K--EKSKIEKEIERQENILRRQLETLKKYKEDAEKNQIKGDLIYANYQIVEELLNAIRQAR--EKMDW
Q2NGY7_METST/2-454YSKKIVSDIKN-K--EEKLWAKRIGKFEKRLKMQEETLEGFYKTIEDKQHKGDTIYAHYNEIQQIINVIHQAR--ENYSW
Q8TSZ2_METAC/6-492FGKKALEQVAEVK--AAEKKEKTLGVYERRLLQQEESLAKFGKEIEKNNTLAEIVYANYQLIEELFSVLNGAR-AKGYSW
RQCH_STRSY/4-429YQDKAERDRVA-Q--QANELIKR---VASELEKNRKKLIKQEQELADTETA-----ELVRQKGELLTTYLHQV-PNDQSS
A5I337_CLOBH/4-453YFEKDKSDRLN-S--KSSDLQKL---INVNIERCEKKIKILEGNLKDCNER-----EKFQICGEILTANIYAL-KKGMDK
A9WAZ2_CHLAA/4-463YTARQQPLGRD-Q--RRADLLNR---LRASREHIERQRDQIAAELARTAEL-----DRLRWEGEMIFAFLHQL-PPQATE
Q04EZ3_OENOB/4-421YAQSANQSRVH-E--LSSQIDQI---VKNELHRNRRKLQNLNNDLIKTKGA-----DNYRIKGELLTTFQNKV-IRGNNS
Q182T2_CLOD6/4-460YRTKDIKDRIN-Q--RSSDLKKS---ISVKLDRLYNKLKKQEEELSESENA-----DIYKIKGELITSYIYMV-EKGMES
Q1GA87_LACDA/4-437YAYQANRDWVK-Q--RSQQVTRV---VTNETKKLQKKLKKLEKQLDSAENS-----ENLRVSGELLTAYLSQV-KPGMEK
Q2G1U1_STAA8/4-441YDARGERERVK-Q--RANDLVRF---VQQQLHKYQNKLAKLIEEYEQSKNK-----DTEQLYGELITANIYRI-KQGDKE
Q5L0T2_GEOKA/4-444YFGKAERDRVK-Q--QAHDIERL---MANEKAKNEKKLLKLEQTLEEAKKA-----DVYRLYGELLTAHLYAI-KRGMTE
Q812X1_BACCR/4-444FFGKAERDRVK-Q--QAHDLERF---MQNEKNKNEKKLIKLEKTLQDAGKA-----DKYQLFGELLTANMYAL-KKGDKD
Q8DZB9_STRA5/4-427YQEKAEKDRIA-Q--QASDLIHR---VQSELEKNIKKLAKQQDELLATENA-----EEFRQKGELLTTYLSMV-PNNQDV
Q8XJB4_CLOPE/4-452FANKDKQDRLH-A--KSADIQRL---VNTNIDRCLKKIKVLEKTLEECDKK-----EEFKIKGELLTSYIYSI-KKGDKS
Q8Y670_LISMO/4-446YIGKARRDRVH-Q--FAHDLEKL---LSNELARSRLKIEKLENTLLETEKA-----DVYRIQGELLTANLHLM-ERGMEE
Q9CFY4_LACLA/4-414YADKAERDRVK-Q--VAASVIKK---IQNELKKNRDKLKKQERELLATDNA-----EIFRQKGELLNTFLNQV-PNDKTS
R5JZW0_9CLOT/4-454YYKKSKVTRIR-Q--KSADLRKI---ISTAIERASKKYDLQLKQMKDTEGR-----EKYKVYGELINTYGYGV-EQGTKS
R5QBW9_9FIRM/4-453YSERSLITRIR-Q--KSVDLRHI---VQTALERNRKKYDLQMRQLKDTENR-----DKYKVYGELINAYGYNV-PEGAKQ
R6P7M2_9CLOT/4-457YEERDRQDRMR-V--KAQDLLRL---LANASERLSRKINLQRGELARSEDR-----EHLRVCGDLINANLYRI-ERGSAF
R7FWI9_9FIRM/4-453YSTRNTLTRIH-Q--KSADLRHV---VQTALERNRKKYDLQSKQLKGTEKR-----DKYKVYGELINTYGYNL-EPGSKE
U5L7J1_9BACI/4-442YFGKAERDRVK-Q--QGNDLERF---IINEKEKNEKKIEKLEKTLEEARNA-----DQYQLSGELLTANLYMA-EKGMKE

PF06831

FPG_MYCPN/135-227------------E--MKGTTIGT---------------------------------------------------------
FPG_ECOLI/129-219------------E----QGGTTL---------------------------------------------------------
FPG_STRMU/132-222------------E----KGGSTI---------------------------------------------------------
FPG_SYNY3/143-233------------E----AGGTSF---------------------------------------------------------
FPG_NEIMB/135-227------------E--TGGSTLRD---------------------------------------------------------
FPG_THET8/122-214------------E--LGGSTLSD---------------------------------------------------------
FPG_BACSU/134-224----------------DAGGSTV---------------------------------------------------------
FPG_ARATH/146-238------------E--VDADSSQF---------------------------------------------------------
D3FWX6_ALKPO/134-224------------E--MGGSSIKS---------------------------------------------------------
FPG_THEEB/137-228------------A--AGGTTIRT---------------------------------------------------------
END8A_MYCTU/126-214------------R--RGKIIV-----------------------------------------------------------
FPG1_MYCTU/144-231------------A----KGGTS----------------------------------------------------------
FPG_LACLA/132-223------------K--LGGSSIRT---------------------------------------------------------

PF00416

RS18B_YEAST/16-144NDITDGKDYHT----LANNVESK---LRDDLERLKK-----------------------------IRAHRGIRHFWGL--
RS18_RAT/14-142KDVKDGKYSQV----LANGLDNK---LREDLERLKK-----------------------------IRAHRGLRHFWGL--
RR13_ARATH/49-153---------YM----IEGDLRRF---NALAIKRLKE-----------------------------IQCYRGVRHIQGL--
RS13_SULAC/11-139KDYESGADMHL----VTSDLIFY---VRNDIERERR-----------------------------SRSWRGVRHSLGL--
RS18_ARATH/14-142KDYKDGKYSQV----VSNALDMK---LRDDLERLKK-----------------------------IRNHRGLRHYWGL--
RS18_DROME/14-142KDIIDGKYWQL----TSSNLDSK---LRDDLERLKK-----------------------------IRSHRGLRHYWGL--
RS13_HALMA/25-152KDYFTGETTHE----TGNDLQLT---RRQDINRMKM-----------------------------IDSYRGVRHKRGQ--
RS13_MYCTU/3-109--------NLK----VEGDLRRE---VQADIRRKIE-----------------------------IGCYQGLRHRRGM--
RS13_SHIDS/3-108---------FV----VEGDLRRE---ISMSIKRLMD-----------------------------LGCYRGLRHRRGL--
RS13_GEOKA/3-108---------LK----VEGDLRRE---VSLNIKRLME-----------------------------IGCYRGLRHRRGL--
Q6R9D3_MAIZE/4-109--------DHV----VHWELKRG---ERADIERLIS-----------------------------ISCYRGIRHQDGL--

PF05833

RQCH_STRR6/4-428VILDNYYT---NQ---------------------------PI----MIALDKALTPNQNAQRYFKRYQKLKEAVKYLTDL
Q7V657_PROMM/52-482--------------------------------------------------SPSKDLINQTQKLYRKAQKFRRSVPVLKTR
A5GRV1_SYNR3/5-448LELQDPESN-Q-----------------------------TL----VVRLNPQQTLVSQAQKLYQRARKLRRSVAAIEPR
Q7VDB7_PROMA/10-439--------------------------------------------------NPTKKQVAQAQKLYNKVKKLKRSKAILMER
Q8DHA1_THEEB/5-448LIVTDFTT---QE---------------------------PL----TIALSPEKSAIQTAQELYRQHQKLKRAQQHITPL
Q31PG3_SYNE7/5-452LTLPDFET---GK---------------------------PQ----QLQLDPALNAVQNAQRFYRRHQKAKRSRQAVLPL
P73561_SYNY3/5-464ITLPDFDD---QS---------------------------PV----TISLQPDKTLIQNAQRLYKQQQKLNRAEAAILPL
Q8YP27_NOSS1/5-452ISIPDFET---GE---------------------------PV----AIALLPDKNAVQNAQNLYKQHQKLKRARIAVEPL
Q110R4_TRIEI/5-453ISLPDFET---GE---------------------------II----FIKLDPEKNAVQNAQSIYKKYQKLKRAHTIVKPL
Q2JJS2_SYNJB/5-470IELPDFAS---GQ---------------------------TV----KIPLDPEKNAILNAQAYYRKHRKQKRAQDAIRPL
Q7NK58_GLOVI/5-445VVLEDFES---GE---------------------------PV----TIPLDPTKDLVANAQAYYRLHRKAKRARQAVTPL
A4S6P0_OSTLU/47-508LEGQDFTT---GE---------------------------TV----MFKVDPEKGPVGTAEALYKKTRKLRRTADAVEPL
A6TRX6_ALKMQ/4-463VEVVNFYDE-NQA---------------------------MI----TIPLDLRLSPAQNAQRHYKKYNKGKTALLEVALQ
A8MH76_ALKOO/4-463VELINYYDE-NCS---------------------------SI----TISLDKRLSPAQNAQRYFKLYSKGKTALIQVNHQ
A3DCY8_HUNT2/4-460VSLLNYYSE-NGE---------------------------YV----EVPLDENLLPQENAQRYFKKYAKAKAAYIHATQQ
B8I3G9_RUMCH/4-460ARVLNYYSA-NEE---------------------------YV----DIPLNEYKSAQDNAQKYFKKYSKAKSTHLNVTKQ
Q8R9S1_CALS4/4-455FGTINYYT---GE---------------------------EI----EIPLDKRLSPSQNAQMYYKKYNKLKNAFNTIKKQ
A5N7G3_CLOK5/4-459VKVQNYYSN-ILE---------------------------YI----TIKLDINKTPSENIQSYFKKYNKLKKTEKAAEEQ
A0Q075_CLONN/4-456IELANYYSE-NYD---------------------------TV----KITLDENKTPSQNVQSYYKKYNKLKKSEEAANEQ
Q97HA2_CLOAB/4-451ATVLNYYSE-GNE---------------------------SI----TIKLDENKTPSENIQRYFKKYNKLKKTEENAQIQ
Q894E2_CLOTE/7-456IDVVNYYSE-DSQ---------------------------VI----NIKLDPTKTPSTNIQNYFKRYSKLKKSKEYSLEQ
B8CWR5_HALOH/4-456AEVIDYFSP-GQE---------------------------KT----NIKLDPKLSPSENAQRYFKKYNKAKKGVKYIKRE
Q0AXH0_SYNWW/4-462AIIEDFYQ---GE---------------------------EV----EIPLDPRYTPIQNAQKYFKIYNKSRNAIRHLKQL
A8FD29_BACP2/4-445ATVINYYDE-DGG---------------------------EI----TIPLKTNKTPSENAQAYFTKYQKAKNAVEAVNEQ
Q65JT4_BACLD/4-446AKVINYYDE-NGG---------------------------EI----TIPLNPNKTPSENAQSYFTKYQKAKNSVEVVKEQ
Q9K9X8_BACHD/4-445VDVLDYYEE-DAP---------------------------TI----TIPLDPQKQPSENAQAYFRKYTKAKNSVEVTKEQ
Q5WFK0_BACSK/4-443VDVIDYYDE-NGQ---------------------------TI----TIALDPQKSPAENAQSYFKRYQKAKTARIEVMNQ
Q8ER31_OCEIH/4-445VEVIDYYDP-DQK---------------------------KV----LIKLNPQKSPSENAQSYFKTYAKLKKSRQVMQSE
Q5M4J6_STRT2/4-429VELDNYYT---GE---------------------------KI----TIPLNVALTPNQNAQRYFKKYQKLKEAVKHLTGL
Q8DTA9_STRMU/4-427VELDNYYT---GQ---------------------------KV----SIPLNKALTPSQNAQRYFKKYQKLKEAVKHLGSL
Q835X0_ENTFA/4-442VELPNYYEE--NA---------------------------PL----RISLNPALSPNQNAQKYFQKYQKLKNAVRVVKTQ
Q38X19_LACSS/4-442VTLPNFYDN--NE---------------------------PI----KITLSNQISPSKNAQKYFSKYQKLRNSIAYVNDQ
Q1WTS3_LACS1/4-435ITLPNFYDN--NK---------------------------EI----TISLSNQLSPSQNAQKYFKKYQKLKNAVTFVNEQ
Q03S51_LACBA/4-442VTLPNFYDD--NR---------------------------PL----KITLSNQLSPNQNAQKYFKRYQKAKNAVIYVNEQ
Q03FM0_PEDPA/4-444IELPNFYDE--NK---------------------------LI----KISLSNQLSPSKNAQKYFTKYQKEKNAVKYVSEQ
A5VK20_LACRD/4-442IELPNFYDD--NK---------------------------PL----KIKLAPELSPSRNAQKYFTKYNKLKTSVEYVKEQ
Q5FJY7_LACAC/4-438VSLPNYYE--NNK---------------------------PI----SIKLDPALSPARNAQKYFTRYKKLRDSIKHVNEQ
Q74JC6_LACJO/4-439IDLPNYYE--NNK---------------------------PL----KIKLDPALSPARNAQKYFTRYQKLRNSIKHVNEQ
A9AW28_HERA2/4-452LLLD------------------------------------QG----VITLDPTLSAVENAQAKFREYDKAKGALEDVPQL
A5UZA2_ROSS1/4-464LEVD------------------------------------GR----RIALDPRKSPVECAQDRFRAYEKAKGALAGVPER
Q24TV3_DESHY/15-479IVAEDYNEE-SLP---------------------------QV----TIPLDPQLTGIENSQRYYRLYNKAKATIQKTTPL
Q67PS6_SYMTH/4-455VRVVNYYDP-EGS---------------------------EM----VIPLDPALSPSENAQAYYRRYQRARSGLAAIQEQ
A4J565_DESRM/4-461ARVQNFYDP-AGT---------------------------ET----IIAMDSSLTPSQNAQEYFRKYLKAKNTRNAVTQQ
Q2RK36_MOOTA/4-459LTAANFYDP-DGE---------------------------PV----TIELDPSRTPAENAQWYFNRYNKAKHAARLAAAQ
Q9WYJ8_THEMA/4-433VELTDWET---NE---------------------------KI----VVDVGK--DPAQTAQKFYNTYKKLQRKKEQVEKR
A7HKC1_FERNB/4-444ASLYDWES---DS---------------------------HV----SVPLEKNLSPIENSVKYFNLYSKLKRKAKGIEER
A8F860_PSELT/4-437VNVMDYNT---GQ---------------------------MT----LVPLVDGKGVKESSQYYFALYKKLKEKSEILKAR
Q3A4K7_PELCD/16-444IEVENFFDEGG-----------------------------VV----TIPLDPALSPSENADRLFNRSKKIRRGYIHVHRR
Q18J82_HALWD/8-471DEIRETFAMGAERGIDAAAAVVSV----DGAEAMVTIEIDDM----RVPVNVDVGVEKNADQRYTEAKRIEEKKEGALTA
Q8TZ51_METKA/10-472DEIKRRIQEAKGSGIEEVERIADIDVENRRVILRLPGENGEV----TVPVPIDSDVHSTASKLFDRAKELERKAERAQEV
RQCH_METJA/6-475ARIKKIIRENKEHPILGLIENINEN--IGEIIIRLKSEVDDKVIEERVSLDIRKNAFENAESYYEKAKKLRNKIEGIENA
Q2NGY7_METST/2-454KEIGSIIKKSKKEGKIPELEMIES----IDKMGVINLKLDDT----HVQIDSNIGIPESTEKYYNKGKKAKRKIDGVNKA
Q8TSZ2_METAC/6-492DEIRSILKQAKKTVPAAQKITNID-----QKTGTVTVDLDGR----NVNLDIRKTVPQNAQEYYEKVKKFSKKRDGALKA
RQCH_STRSY/4-429VRLDNYYT---GK---------------------------EL----EIELDVALTPSQNAQRYFKKYQKLKEAVKHLTNL
A5I337_CLOBH/4-453VNLLNYYT---NE---------------------------YM----DIKLDPNKNPSDNIQKYFKKYNKLKKTEVAAKEQ
A9WAZ2_CHLAA/4-463LVVE------------------------------------GE----RIALDPKRSPVEQAQERFRAYEKAKSARAILPER
Q04EZ3_OENOB/4-421ISLNNYYD---GK---------------------------AI----EITLDPKISANANAQKYFTKYQKLKKSVKYLDEQ
Q182T2_CLOD6/4-460IEVANFYDE-NCN---------------------------DV----IIELNKNLTPSENAQKYFKKYNKMKHAKVEISHQ
Q1GA87_LACDA/4-437IDLPNYYEG--NQ---------------------------PM----TIKLDPALSPQRNAQKYFKRYKKMRDSIKHVTEQ
Q2G1U1_STAA8/4-441VTALNYYT---NE---------------------------EV----VIPLNPTKSPSANAQYYYKQYNRMKTRERELQHQ
Q5L0T2_GEOKA/4-444IEVANYYDE-NGG---------------------------TI----TIPLDPQKSPSENAQQYFQKYQKAKNSFAVVQEQ
Q812X1_BACCR/4-444IEVVNYYDE-DGG---------------------------TV----KITLDPLKTPSENAQRYFQKYQKAKNSVAVVEEQ
Q8DZB9_STRA5/4-427VVLDNYYT---NQ---------------------------TI----EISLDRALTPNQNAQRYFKKYQKLKEAVKHLKGI
Q8XJB4_CLOPE/4-452VDLLNYYSE-DEE---------------------------YL----TILLDENKTPSENIQFYFKKYNKLKKAEESALEQ
Q8Y670_LISMO/4-446ITVENFYDD--MK---------------------------KM----TIPLDTRKTPSANAQSYFSRYQKLRNAVEVVKEQ
Q9CFY4_LACLA/4-414VTLENYYT---NE---------------------------PI----EIALNPALSPVQNAQRYFHRYQKLKQAVKFLGEQ
R5JZW0_9CLOT/4-454FRALNYYT---NE---------------------------EI----EIPLDPTISVLENAKRYFAKYNKQKRTYEVLEKL
R5QBW9_9FIRM/4-453MEALNYYT---NE---------------------------TV----TIPLDPTSTPQENAQRFFAKYNKQKRTFEALTQL
R6P7M2_9CLOT/4-457ADLENFYDE--NR---------------------------LM----RVKLDPALNATQNAQKYYKEYRKAKTAQQVLGEQ
R7FWI9_9FIRM/4-453LTALNYYT---NE---------------------------EI----TIPLDPTQTPGENAQRYFAKYNKQKRTFEALTEL
U5L7J1_9BACI/4-442IEVINYYDE-NGA---------------------------TM----VIPLDPQKTPSENAQKYFTKYQKAKTAAGIVKEQ

PF06831

FPG_MYCPN/135-227----------------------------------------FT--------------------------------------
FPG_ECOLI/129-219----------------------------------------KD--------------------------------------
FPG_STRMU/132-222----------------------------------------RS--------------------------------------
FPG_SYNY3/143-233----------------------------------------SD--------------------------------------
FPG_NEIMB/135-227----------------------------------------FV--------------------------------------
FPG_THET8/122-214----------------------------------------QS--------------------------------------
FPG_BACSU/134-224----------------------------------------RS--------------------------------------
FPG_ARATH/146-238----------------------------------------PS--------------------------------------
D3FWX6_ALKPO/134-224--------------------------------------------------------------------------------
FPG_THEEB/137-228----------------------------------------F---------------------------------------
END8A_MYCTU/126-214--------------------------------------------------------------------------------
FPG1_MYCTU/144-231--------------------------------------------------------------------------------
FPG_LACLA/132-223----------------------------------------Y---------------------------------------

PF00416

RS18B_YEAST/16-144----------------------------------------RV--------------------------------------
RS18_RAT/14-142----------------------------------------RV--------------------------------------
RR13_ARATH/49-153----------------------------------------PC--------------------------------------
RS13_SULAC/11-139----------------------------------------KV--------------------------------------
RS18_ARATH/14-142----------------------------------------RV--------------------------------------
RS18_DROME/14-142----------------------------------------RV--------------------------------------
RS13_HALMA/25-152----------------------------------------KV--------------------------------------
RS13_MYCTU/3-109----------------------------------------PV--------------------------------------
RS13_SHIDS/3-108----------------------------------------PV--------------------------------------
RS13_GEOKA/3-108----------------------------------------PV--------------------------------------
Q6R9D3_MAIZE/4-109----------------------------------------PL--------------------------------------

PF05833

RQCH_STRR6/4-428IEETKATILYLESVETVLN---------QA-GLEEIAEIREELIQTGFIRR----RQRE-KIQKRKK
Q7V657_PROMM/52-482IEHHQQRLQLIQGSEMFLEDLLGTSWEGQRERSIRLQELRQEL--DELLIS----QSRN-RQKRGRR
A5GRV1_SYNR3/5-448LRRHQQRLELLEASQVQLQL-------ADPGDADVLEALADDL--EPFLKT----KASQ-SKSSRRQ
Q7VDB7_PROMA/10-439ISYHKERLSFANEIELFLEYIMNNTKENKASKIEDILILKEDI--ENYLLL----KQQK-GTKKIKQ
Q8DHA1_THEEB/5-448LTAAEGELAYLDQVAATLA---------TATSLDVLEEIRAELIQQGYLIA----PDYYRPPTTPSP
Q31PG3_SYNE7/5-452LAEVEAELRYLDSIATALAPLQ---TAQTRADWLALQDIREELAQQGYWPY----KTDR-PRPTRSQ
P73561_SYNY3/5-464LAEVEQELAYLTQVETSVQALT---EFDDLADWQTLTEIRDELAEQNYLAL----SHGR-PRRKEAE
Q8YP27_NOSS1/5-452LQEVQAEIDYLEQVEAAISQID---NYQTAEDLQALEEIRDELIGQKYLEE----LEYR-SRNNNET
Q110R4_TRIEI/5-453LAEVQNEIHYLEQVEAFLSQLN---NYRSPEDLQTLEEIREELIQQGILNA----PEHHQQNNRKDT
Q2JJS2_SYNJB/5-470QEALGQEILYLEQVEASLQQLE---TYRDPQDLTTLKEIETELIEQRYLES----PTRN-SGTESLR
Q7NK58_GLOVI/5-445LEQAREEVAYLEQVGATVEL------LGESTDLEALLEVEEELVQQKYVEA---------KEKPATS
A4S6P0_OSTLU/47-508IEQNASEIEYLEGVEFSILEVS---EFKSRDDLLFIEEIGAEL-KGGGAKP----KTGK-QARKQEM
A6TRX6_ALKMQ/4-463LEKTHGEINYLEQIMVSID---------QSMSLSDVEEIRQELIQTGYIKP----KAKV-KVKVNKQ
A8MH76_ALKOO/4-463IEKTQEEIHYLEQILVSID---------QCTHLSDIEEIRAELEETGFIKK----RAVK-KGASSNQ
A3DCY8_HUNT2/4-460LEEARGELSYLESVLHSLE---------NSNSFEDIDDIRQELAEQGYLPS----KKKR-PEKKNSK
B8I3G9_RUMCH/4-460LAETLSELEYLQSVLTMLG---------NCNSRQEIDEIRQELIDQGYIRQ----SYKN-AKNKQDK
Q8R9S1_CALS4/4-455ISETLEEINYLEGQLINIE---------NSTTLEELEEIKNELIEEGYIHK----HQKK-KVASHSL
A5N7G3_CLOK5/4-459LKIAKEEIEYLNSVFINIK---------NSDSYEHIEEIKRELMETGYIKF----KKST-NKKKIKA
A0Q075_CLONN/4-456LLQNEEELNYLYSVLTNIN---------NADNYDEIEEIKKELIETGYIKF----KKIY-KSKKSKT
Q97HA2_CLOAB/4-451IKNNNEEIEYLQSVLTNIE---------NSDTYSDIEDIRQELIDTEYIRF----SKKN-KQKKKDK
Q894E2_CLOTE/7-456IKITEDEIIYLNSVLTNIK---------NTENYAGIEEIKKELMDARYLKF----KKNI-RKKETKS
B8CWR5_HALOH/4-456LRKLKHEERYLEQVMLNLE---------QAESREEIREIKEELGDEGYIKK----KNRI-NNRRKQQ
Q0AXH0_SYNWW/4-462LASNQEEIDYLESIIVLIA---------QAETPEIVEEIREELEKQGYVKE----HTQR-ARKELLK
A8FD29_BACP2/4-445IERTHEEIAYFDELIQQLS---------SA-SPKDLEEMREELVEGKYLRA----KQKR-NAKKKKT
Q65JT4_BACLD/4-446IKLAEEEIAYFDQLIQQLS---------SA-SPKDITEIREELAEGKYLRA----KQQG-GQKKQKK
Q9K9X8_BACHD/4-445IEKAKIEIDYFERLIQQVE---------TA-SARDVEDIREELIEEGYLRR----KQKV-SKKRKET
Q5WFK0_BACSK/4-443QEKTEQELAYLDSLLAQMA---------SA-SPRDIEEIREELIEGGYIKK----RQQG-KKKKKQL
Q8ER31_OCEIH/4-445MKRTDLEIQYLDQLLQQLD---------VA-STDDIEEIREELREEGYLKK----QRQA-KKKKKPQ
Q5M4J6_STRT2/4-429IEETKQTINYLESVEFSLS---------QA-NMDEIEDIREELVQAGFMRR----RSTD-KRQKRKK
Q8DTA9_STRMU/4-427ISETKATIQYLESVDNALN---------QA-SLSEISEIREELVQTGFVKR----RHRE-KIQKRKK
Q835X0_ENTFA/4-442IQQTQQEISYLESVVAQLE---------IA-TPMDIEVIREELIEQGYLKR----KKNK-KQKQPKK
Q38X19_LACSS/4-442MAKTEAELQYFYTIMAQIE---------IA-EPKDLEDIKAELQAEGYLKI----KKTG-AKKQKRY
Q1WTS3_LACS1/4-435MELTKKEVAYLEEIQTQIE---------LA-TPADLDDIKTELQQEGYIKK----KQQK-SKRSSRV
Q03S51_LACBA/4-442LEKTQADVDYFSNIMAQIE---------LA-APKDLVDIRLELQEGGYLRD----HDHQ-KKNKKQR
Q03FM0_PEDPA/4-444IAKTESEINFLDNIETQID---------LA-KPEDLDDIKLELENEGYLK-----KQVN-PKKRIKP
A5VK20_LACRD/4-442LKLTNDEIKYFENIENQIK---------LA-APADIQEIKLELQEQGYIKK----KKSG-KKQRKVK
Q5FJY7_LACAC/4-438IKIAKENLRYFDSIQTAID---------NA-DPQDIDQITDELINQGYIRK----QQKN-RRKKKIT
Q74JC6_LACJO/4-439IKLANENLDYFDSIQTAID---------NA-DPQDIDAISDELINQGYLKE----QNHN-RHRKKKI
A9AW28_HERA2/4-452LEQTEAQAEYLQQTNDLLS---------LAESFAEIEQFERELIAGGWLRQ-------TIGKAKSKP
A5UZA2_ROSS1/4-464LRAVELRLAGLDETLALLE---------LAEGYDAIEAIAREAEAEGYLGP----ETGR-TRKRPDR
Q24TV3_DESHY/15-479KDAVEEEITYLNSVLLSLE---------QATVPAELDEVHKELIEENYLSG----KHHG-KPLAGEG
Q67PS6_SYMTH/4-455LARSRAELAYLEQVEVTLE---------QAESLPDLEEVRRELAAEGYLREGASRRGSE-PGRRQAA
A4J565_DESRM/4-461LEQAESELNYLDAVDTALS---------QAMYQEDLKEIRSELEEQAYLKP----KIQQ-VKNRSQK
Q2RK36_MOOTA/4-459LEQTKAEIAYLESIAQAVS---------MAATRDDLEEIRRELRQAGYLP-----EERD-KQKPGKK
Q9WYJ8_THEMA/4-433LEEIQREKEYLYQLWQTIE---------DAEDLETLEEIEEEMREFGLLKE----RKTK-KQKSKKT
A7HKC1_FERNB/4-444KEILSKELSYLQQLQLTIE---------NAEGLEELFEIEDEMVENGLIKK----KVDK-KGKKKSE
A8F860_PSELT/4-437IKRETLFLNYAEQLMHTLE---------LAEDLETLQEIEQEMAQQGLIKE----KTVF-RKSKSKP
Q3A4K7_PELCD/16-444IEESHAEKDWLEALMLNLS---------EVTSNEELAMVEEEMREFRLLPR----KADR-QKKRPVS
Q18J82_HALWD/8-471IENTREELNAVKQRRDAWD---------REDAKPDTED----------------------NADNTET
Q8TZ51_METKA/10-472LREQERELEKLLEEGPPEV---------------ELEELTVELTKR--------------RKKDWYE
RQCH_METJA/6-475IELTKKKIEELKKKGEEEL------------KEKESMQMKKKI-----------------RKERKWY
Q2NGY7_METST/2-454IENTKSEIKKLEDKKEVAI--------------ELLRQKQEK------------------REKRELK
Q8TSZ2_METAC/6-492IEETKKAMEKKAASKAAKA------------------------GRKLQAF----------RKKHWYD
RQCH_STRSY/4-429IEETKSTIVYLESVDTMLG---------QA-SLAEIDEIREELIETGYLKR----RHRE-KIHKRQ-
A5I337_CLOBH/4-453IELTCDELKYLNSVLTSIK---------NADSYDDIEEIKRELIETGYIKF----KKKN-NKKFK--
A9WAZ2_CHLAA/4-463LAEIEQRLAGIDQFIALAA---------VADDSNQIDQIAAEAEEAGYLRS----SATR-RPP----
Q04EZ3_OENOB/4-421IRLASKELDYFENIEEQLK---------NA-SPKDLDQIKIELLKEGYLKD----KKSD-KKPAKK-
Q182T2_CLOD6/4-460ISLNKEEIDYLENIILSIE---------NCENLAELQDIKEELAKVGYIKT----QKKN-SKKD---
Q1GA87_LACDA/4-437IEITEENLRYLDSVQTEID---------NA-DPEDVEAIKEELINQGYLRA----EQKK-RQKPK--
Q2G1U1_STAA8/4-441IQLTKDNIDYFSTIEQQLH---------HI-SVHDIDEIRDELAEQGFMKQ----RKNQ-TKKKKA-
Q5L0T2_GEOKA/4-444IERTKEDIAYCDTILSQLE---------TA-SPKDVEEIRDELIEQGYLRP----RAAK-GAKKRK-
Q812X1_BACCR/4-444IEKTNEEILYFDSLLQQME----------AASSKDIEEIREELAEEGYVRN----RKTK-NAKKK--
Q8DZB9_STRA5/4-427ISDTENTITYLESVETSLN---------HA-SMEDINDIREELVETGFIKR----RAHD-KQHKRKK
Q8XJB4_CLOPE/4-452LAINEDELKYLNSVSSSIQ---------VADNYEDIDAIKNELIETGYIRF----RRNN-NGKKKEK
Q8Y670_LISMO/4-446IALTKEEITYLESVESQLE---------TS-GPQDVEEIRQELAEQGYLRY----KQKK-GSRKKA-
Q9CFY4_LACLA/4-414IAKTKETIHYLESVESNLE---------NA-DVAEIADIREELIQTGYIKQ----KYRN-KKQK---
R5JZW0_9CLOT/4-454TVETRHELEYLQSVQTFID---------MTLDENALAQVKEELMISGYIKG----RYGK-KGDKH--
R5QBW9_9FIRM/4-453IRETKDEISYLESIQTSLD---------IAMTEDDLAAIKEELSETGYVRR----KTVR-KKIK---
R6P7M2_9CLOT/4-457IAQAEQELLYVDSVFDCLS---------RAQSESELNEIRQELREEGYLKA----VRDK-RKP----
R7FWI9_9FIRM/4-453IQETADDIQYLESISNALD---------IALSEADLAQIKEELMQSGYIRR----KHTK-KKVK---
U5L7J1_9BACI/4-442IEKAKEEAAYFESLLQQVE----------AASTKDIEEIREELAEGGYIRI----RQKK-QNKKS--

PF06831

FPG_MYCPN/135-227-------------------------------------------------------------------
FPG_ECOLI/129-219-------------------------------------------------------------------
FPG_STRMU/132-222-------------------------------------------------------------------
FPG_SYNY3/143-233-------------------------------------------------------------------
FPG_NEIMB/135-227-------------------------------------------------------------------
FPG_THET8/122-214-------------------------------------------------------------------
FPG_BACSU/134-224-------------------------------------------------------------------
FPG_ARATH/146-238-------------------------------------------------------------------
D3FWX6_ALKPO/134-224-------------------------------------------------------------------
FPG_THEEB/137-228-------------------------------------------------------------------
END8A_MYCTU/126-214-------------------------------------------------------------------
FPG1_MYCTU/144-231-------------------------------------------------------------------
FPG_LACLA/132-223-------------------------------------------------------------------

PF00416

RS18B_YEAST/16-144-------------------------------------------------------RGQH-TKTTGRR
RS18_RAT/14-142-------------------------------------------------------RGQH-TKTTGRR
RR13_ARATH/49-153-------------------------------------------------------RGQR-TKNNCRT
RS13_SULAC/11-139-------------------------------------------------------RGQR-TRTTGRT
RS18_ARATH/14-142-------------------------------------------------------RGQH-TKTTGRR
RS18_DROME/14-142-------------------------------------------------------RGQH-TKTTGRR
RS13_HALMA/25-152-------------------------------------------------------RGQR-TKSTGRT
RS13_MYCTU/3-109-------------------------------------------------------RGQR-TKTNART
RS13_SHIDS/3-108-------------------------------------------------------RGQR-TKTNART
RS13_GEOKA/3-108-------------------------------------------------------RGQN-TKNNART
Q6R9D3_MAIZE/4-109-------------------------------------------------------RGQR-THTNART

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window