Sequence alignment for CL0389

PF02176

TRAF6_MOUSE/204-261------HDQS-CPLANI-----------------ICE-----------Y--CGTILIREQM-------PNHYDLDCPTAP
DG17_DICDI/197-255------HYKT-CPMVPI-----------------DCS-----------QGCSVK-IERKSI-------IDHIENDCCNTQ
TRAF5_HUMAN/183-241------HEENLCPEYPV-----------------FCP-----------NNCA-KIILKTEV-------DEHLA-VCPEAE
TRAF2_MOUSE/178-235------HYEV-CPKFPL-----------------TC------------DGCGKKKIPRETF-------QDHVR-ACSKCR
TRAF5_MOUSE/128-183------HLQH-CSFQAV-----------------PCP-----------NESCREAMLRKDV-------KEHLSAYCRFRE
TRAF2_HUMAN/178-235------HHEV-CPKFPL-----------------TC------------DGCGKKKIPREKF-------QDHVK-TCGKCR
TRAF3_HUMAN/136-192------HLKNDCHFEEL-----------------PCV-----------RPDCKEKVLRKDL-------RDHVEKACKYRE
TRAF4_HUMAN/102-156------HLNT-CSFNVI-----------------PCP-----------NRCPMK-LSRRDL-------PAHLQHDCPKRR
TRAF4_HUMAN/210-269------HQYQ-CPRLPV-----------------ACP-----------NQCGVGTVAREDL-------PGHLKDSCNTAL

PF17848

A0A073CCX9_PLAAG/30-55------WVK--CEK-------------------------------------CNALTYAKDL-------QANNK-VCLEC-
A0A140E654_9GAMM/28-53------WNK--CPR-------------------------------------CDAILFNAEL-------EKNFS-VCPKC-
J0L5Y7_9HELI/27-52------WIK--CDS-------------------------------------CSALMYYKEV-------ENQMY-VCPKC-
LYAR_HUMAN/3-28------FFT--CNA-------------------------------------CGESVKKIQV-------EKHVS-VCRNC-
E3PX51_ACESD/8-33------WIK--CGS-------------------------------------CKSNIYANDL-------EETKQ-VCPSC-
A0A098YBX8_9ACTN/20-45------WTS--CPA-------------------------------------CGWLLYRRRL-------ERDLH-VCPEC-
A0A0S2W5T2_9FIRM/36-61------FSK--CPH-------------------------------------CGAGVSKREL-------ARTLY-VCPQC-
T2RED7_PAES9/32-57------WIY--CDS-------------------------------------CKNETFRKDI-------EENLN-VCPKC-
ACCD_RUBXD/6-31------FTK--CER-------------------------------------CKQPVYEKDL-------RARFN-VCPNC-
A0A165S9F9_9SPHN/24-49------WVK--CPS-------------------------------------CQQMVFAQEY-------EDNSY-VCPRC-
F2I422_PELSM/30-55------WTN--CAS-------------------------------------CSNIIYREDI-------ENNLY-CCTNC-
D3PBT8_DEFDS/28-53------WLK--CPE-------------------------------------CGEINYKKEI-------ERNFH-TCPNC-
E6U768_ETHHY/33-58------WFQ--CPR-------------------------------------CRAATLEEEF-------ARNLQ-VCPKC-
A0A059KFR1_9BURK/28-53------WVK--CDA-------------------------------------CETVLYKTDL-------DGNVN-VCPKC-
A0A1V0DC26_9BACT/26-51------WIK--CPE-------------------------------------CNEILNRRVL-------VDHAM-VCPLC-
Q5NHS3_FRATT/28-53------WSQ--CPN-------------------------------------CGVTLYSEEL-------HNNKS-VCPSC-
Q1IWB3_DEIGD/24-49------WTQ--CPQ-------------------------------------CKQGLYNRDL-------AAHSF-VCPKC-
A0A0F0CVK6_9BACT/23-48------WIK--CIG-------------------------------------CGELLYNKNL-------KENSK-VCKKC-
A8PMD5_9COXI/26-51------WIK--CES-------------------------------------CGSVLYRAEF-------ERNLM-VCLTC-
R9IHW3_9FIRM/23-48------WIK--CTK-------------------------------------CGKLIYRKEL-------EKNKF-ICMEC-
A0A089X303_STRGA/15-40------WRR--CAS-------------------------------------CGAFVYGKRL-------DRNRK-VCPEC-
ACCD_ACHLI/36-61------FSQ--CEQ-------------------------------------CNSAIYNKDL-------EHNYE-VCPYC-
M1Z2Q1_NITG3/21-46------WVE--CKS-------------------------------------CKEQIYQIDL-------IDNLH-VCPKC-
ACCD_CLOBH/35-60------WVK--CNK-------------------------------------CGEILYQNDL-------EKNYM-VCNLC-
A7HDB6_ANADF/31-56------WHK--CAG-------------------------------------CENVVARAEL-------EREWN-VCPSC-
R6NF91_9CLOT/57-82------WIK--CPA-------------------------------------CKTMLLSSDL-------REDLF-VCRKC-
F8L6H8_SIMNZ/27-52------WVK--CTK-------------------------------------CEEMIHANQL-------QDNHN-CCPKC-
F0T0C5_SYNGF/39-64------WIK--CQD-------------------------------------CGATIYNKDL-------LKSNG-VCTVC-
A0A0R1PCR2_9LACO/30-54------WTK--CPK-------------------------------------CGETILTKDL--------DQYS-TCPHC-
R7GF07_9CLOT/28-53------WIK--CEA-------------------------------------CKEILYKESV-------RENYS-ICPNC-
A0A0M2UYG4_9BACT/15-40------WTR--CNG-------------------------------------CGSMVFKKTV-------EDGMF-VCPEC-

PF15965

H2LB95_ORYLA/6-98------HEH--CDKCFS-AHCQVLVQTSRSCMVTKC------------PKNCGTVLHACKR-------EEHVL-LCPNET
U3ICA7_ANAPP/14-106------HRH--CEKCFS-RHCRAPIEPSVSCMVISC------------RFHCGATFHMCKE-------EEHQL-LCPLEQ
M3ZZZ2_XIPMA/36-128------HLH--CDSCYS-RRCRARVEPSASCALVPC------------RLLCGAVFHLCKE-------EDHLL-LCPNVR
W5KE54_ASTMX/10-102------HKH--CEKCFN-QHCKVSVEISTSCVVISC------------RLQCGAAFHLCKE-------DEHNL-LCPKVT
I3NGQ0_ICTTR/12-104------HRH--CEGCIN-RHCHVPVEPNVSCLVISC------------HLLCGATFHMCKE-------AEHKL-LCPLEQ
B7QIX1_IXOSC/11-103------HPH--CLNCISIVKCNARSEQRKSCQIVAC------------KLDCGASFHSCKC-------QEHQL-LCPNVK
A7S9N8_NEMVE/9-97------HEH--CQNCFK-LYCTSN----EKCKVIAC------------DSGCCLRMHECKL-------SEHKL-VCLKAK
H3DNZ1_TETNG/7-99------HLH--CNQCYD-AHCQVSAKLSDSCVVIKC------------PKNCGAILHACKQ-------EEHQL-LCPNET
C3ZBV3_BRAFL/1-93------HSH--CTQCYR-RSCFVKPELDVSCEMQAC------------PADCGARFHACKL-------SEHGL-ICPNEK
A0A1I7VQE8_LOALO/27-111------HIH--CAYCFC-VDCQYN-----RCALRSC------------PE-CHAILHGCKL-------EDHLL-ICAKAY
T1KF06_TETUR/33-126------HSH--CDNCIKITKCRYKNARDAACPIISC------------KEGCGFRFHRCKS-------DEHQL-LCANEK
F1Q6V8_DANRE/12-104------HRH--CESCHS-RRCKTPIEISVSCAIISC------------RLLCGAVFHLCKE-------EEHMF-LCPNER
H2ZZ11_LATCH/16-108------HRH--CEKCLN-RHCRMPIEPTVSCVMINC------------HSHCGAIFHLCKE-------EEHRL-LCPLER
W5MDX5_LEPOC/13-105------HKH--CEKCFS-RRCKAPIQISVSCMVINC------------RLLCGAVFHMCKE-------QEHQL-LCPNEK
E5S5E0_TRISP/811-899------DEH--CKCCFS-KKCKFS-----QCPMLSC------------PNRCCFTMHSCKL-------VDHLF-ICQEQE
M3X5C4_FELCA/7-99------HSH--CVTCVN-RRCMIRPEPGISCDLIGC------------PLVCGAVFHSCKA-------DEHRL-LCPFER
H3D3Y5_TETNG/8-100------HAH--CVCCFN-QRCMVRPQPGISCELIYC------------PTLCGAVFHSCKA-------DEHRL-ICPLVR
G3PEZ9_GASAC/7-99------HEH--CITCYS-VHCHVPVQISVSCIVVKC------------RHNCGATFHMCKQ-------EEHHL-LCPNET
F1QPK7_DANRE/5-97------HSH--CMSCIN-RRCMLKPEPGTSCDLISC------------SFVCGAIFHSCKA-------TEHKL-LCPLER
W4YYV2_STRPU/500-592------HGH--CGSCYS-RDCQVSPQPGNACSLVNC------------EVDCGARFHRCKE-------DEHRL-LCPNAK
I3ISU9_DANRE/12-104------HRH--CETCYN-RRCKASIEVSVSCMVINC------------RLLCGASFHLCKE-------DEHSL-LCPNEK
I3K6V1_ORENI/5-97------HVH--CMSCFN-QRCTVKAETGLSCELITC------------PLVCGAVFHSCKV-------DEHQL-MCPLMR
B3RLD3_TRIAD/13-101------HPQ--CLTCIL-IDCQHK----NHCQMIQCN-----------NSGCNACFHACKL-------TEHKL-LCLYEN
E9HAM6_DAPPU/10-103------HAH--CESCIKISKCTKKTIEGESCAIICC------------QRKCGASFHSCKE-------SEHIL-LCPNVQ

PF18048

A0A5E4B0U9_MARMO/157-183------FALMNCPQ-------------------------------------CQRAFQKCQF-------NIHILKDCP---
A0A2I3G7Q8_NOMLE/157-183------FALMDCPQ-------------------------------------CQCPFQKFHI-------NIHILKDCP---
A0A3L8SWV3_CHLGU/157-183------FSTVECLQ-------------------------------------CQRTFPKNYL-------KEHMTQECP---
A0A1S3FGD6_DIPOR/157-183------FALMNCPQ-------------------------------------CQHPLPKFQF-------NIHVLEDCP---
A0A1S2ZN24_ERIEU/157-183------FALINCPQ-------------------------------------CQRPFPKYQS-------KIHIHKECP---
F6Q0W8_XENTR/159-185------FAGVECSQ-------------------------------------CQSSFPKYSL-------QKHKFEECP---
G3WLM2_SARHA/157-183------FALVECSQ-------------------------------------CHLSFRKYLL-------HNHMLTECP---
A0A5N4DMY6_CAMDR/158-184------FALMNCPQ-------------------------------------CQCSFQKCQL-------NFHILEECP---
A0A091CRB5_FUKDA/185-211------FALVNCSQ-------------------------------------CQHPFQKCQL-------NVHILKDCP---
A0A212DIB6_CEREH/140-166------FALMSCPQ-------------------------------------CQRPFQKCHL-------NVHILKECP---
F6S636_ORNAN/157-183------YALVECPQ-------------------------------------CHISFQKNIL-------HDHVVSECP---
G1P0K0_MYOLU/157-183------FALTNCLQ-------------------------------------CNRPLQKCQL-------NTHILQECP---
TRAF6_RAT/157-183------FALVICPQ-------------------------------------CQRFFQKCQI-------NKHIIEDCP---
A0A402EZD4_9SAUR/160-186------FASEECPQ-------------------------------------CQGCFQKNQL-------QEHVMLECP---
A0A1U8C5B2_MESAU/157-183------FALMNCPQ-------------------------------------CQRPFQKCHF-------HMHIIEDCP---

PF03145

F7I459_CALJA/85-281-------IRNLAME-KVANS----VLFPCKYASS----------------GCEITLPHTEK-------ADHEE-LCEFRP
F4JDF6_ARATH/5-232-------INDLQVESRVHEL----LDFPVHTNQI----------------SSA---IYECP-------NDHIE-NPKKKP
D6W8F0_TRICA/89-285-------IRNLAME-KVANN----LMFPCKHKST----------------GCRMSLGLNEK-------AEHEE-ICEFRP
D6WQJ0_TRICA/55-244--------RNFSLE-SVCTV----LQYPCSNEMR----------------GCSHYMKLEEF-------AEHQE-RCDYRN
U3JRJ7_FICAL/62-258-------IRNLAME-KVASA----VLFPCKYATT----------------GCSLTLHHTEK-------PKHEA-ICEYRP
M0SES1_MUSAM/113-312-------IRCLALE-KLAVS----LHLPCAYHHL----------------GCEEMFPYYSK-------LQHET-RCTYRP
A0A1I7V834_LOALO/123-320-------VRNLVLE-KIANT----VMFPCKFAGS----------------GCPLTFSHVEK-------VEHEE-LCEFRP
W1PHN4_AMBTC/145-342-------IRCLALE-KVAAS----LELPCKNRNL----------------GCPEVLPYHSK-------LKHES-QCTYRL
W5NWR0_SHEEP/85-282-------VRNLAME-RVADL----VLFPCRYASS----------------GCGATMPPTEK-------VDHEE-QCEFRP
A0A0D3F068_9ORYZ/102-301-------IRCLALE-KVAES----LQLPCKYQSL----------------GCAEIHPYQNK-------LKHEE-LCRFRP
H0Y018_OTOGA/86-284-------IRNLAME-KLANS----LPFPCKYASS----------------GCGTSLPPVQK-------ARHEG-LCDFRP
M1C6R4_SOLTU/36-234-------IRCLALE-KVAES----LELPCRYQNL----------------GCHKILPYHRK-------LKHER-RCKFRP
K1RDH5_CRAGI/70-266-------IRNLAME-KVATT----VMFPCKYSSS----------------GCPVTLLHTDK-------QEHEE-TCEYRP
Q7QF99_ANOGA/180-384-------LRNYTLE-AIVSK----VQFPCRNAVK----------------GCSVRLPLQLL-------RWHKE-RCGYKL
H0Y1K4_OTOGA/82-279--------HNLALD-RVAYS----LSFPCKYTSA----------------GCGTILPPAEK-------ADHEE-VCDFRP
A0A1X7V5F7_AMPQE/69-267-------VRNLAMD-KVAET----VLFPCKYANS----------------GCSLRFLHNEK-------RKHEE-TCEFRP
H0XJR4_OTOGA/82-278-------VRNLAME-KLANS----VLFPCQYAPA----------------GCGITLPPVEK-------ADHEG-LCEFRP
H0XIX1_OTOGA/145-341-------IRNLAME-KVASS----VLFPCKYASS----------------GCGITLPPTEK-------ADHEE-LCEFKP
SINAL_DROME/147-341-------IRSLAME-KVASK----LIFPCKHSHF----------------GCRARLSYAEK-------TKHEE-DCECRP
G3X7V0_BOVIN/80-277-------IRNLAME-KLANS----VLFPCKYASS----------------GCEVTMPPTEK-------ADHEE-HCEFRP
Q7PZE6_ANOGA/33-226------------IE-KLLHQ----AMCPCRYAPN----------------GCTWKFVQSEM-------DAHLV-ECRFRP
H0Y0B7_OTOGA/82-279-------IRNLVMD-KVAYS----LTFPCKYAVF----------------GCGTTLSPAEK-------AEHEK-VCDFKP
H0XK85_OTOGA/82-279-------IRNLAME-KVADS----LSFPCKYAPS----------------GCRITLPPAGK-------ADHEE-VCDFRP
B4LE73_DROVI/110-304-------IRNLAME-KVGSK----LIFPCKHACY----------------GCRVRLSYADK-------KSHEE-DCEFRP
B4QNB8_DROSI/191-380---------------QVASN----VKFPCKHSGY----------------GCTASLVYTEK-------TEHEE-TCECRP
H9JRH4_BOMMO/72-263-------IRSAVLE-SLANK----VLFPCTNA------------------GCPKHATLPLL-------EKHTP-HCQFRI
H0XTM6_OTOGA/82-280-------IRNLVMD-KVAYS----LTFPCKYASF----------------GCGTSLPPAEK-------ADHEE-VCDFRP
M1D5F6_SOLTU/101-299-------IRCLALE-KIAES----LELPCRYQIY----------------GCQDIFTYHTR-------LRHEQ-NCRFRP
E3M5Q1_CAERE/208-407-------VRNLGLE-KIANT----VRFPCKFSNS----------------GCPLNFHHIDK-------MDHEE-LCEYRP
W1NE48_AMBTC/91-290-------IRCLALE-KLAVS----LHLPCAYHRL----------------GCEEMFPYYTK-------LKHED-QCVFRP
T1KZZ1_TETUR/128-324-------IRNLQME-KLAMN----LLFPCKYSSQ----------------GCLLNLTCSDK-------TDHED-SCDFKS
SINA_SCHMA/167-362-------IRNLAME-KLASS----VLFPCKYSTS----------------GCPETFHYTSK-------SEHEA-ACEYRP
H0XXJ8_OTOGA/83-277--------CNLAMD-KVASS----LTFPCKYTSS----------------GCGTSLPPEKK-------ARHEG-VCDFRP
M4CBD9_BRARP/5-207-------INHLQIESQVHEL----LDYPVCTNQITST-----------IYQCS-----NDY-------TGEVN-NDKENP
B3RLR7_TRIAD/93-285-------VRNLQME-KLART----LVFPCKFRQS----------------GCQLCFSPDER-------KIHED-SCPFRI
E0W112_PEDHC/92-276--------KNIMLA-QIAEY----VKYPCPNTIG----------------GCEEVYYLRDE-------ETHLK-KCGYIV
B9GYJ4_POPTR/105-304-------IRCLALE-KIAES----IELPCKYQSM----------------GCCDIFPYYSK-------PKHEK-NCKYRP
M0T9A8_MUSAM/95-294-------IRCLALE-KVAES----LELPCKYSTL----------------GCPEIFPYYSK-------LKHEA-RCNFRP
D6WZ00_TRICA/55-252--------RNYQLE-QIIENMPRDLKCPCFFADK----------------GCKYMLSPTEK-------ADHEV-ECKNRK
G1MN92_AILME/82-278-------IRNLAME-KVANS----VLFPCKYTAA----------------GCEITLPHTEK-------ADHEE-MCEFRP
I1H5D3_BRADI/95-294-------IRCLALE-KVAAS----LELPCKYQNF----------------GCVGIYPYYCK-------MKHES-QCQYRP

PF11529

Q1HBK6_MELLI/24-150MEDVPAELTGVSEGYTRFYRSPTASVTLSGLVNVKWD-----------NEQMTMPLFKWIG-------GEQAE-ELHFCV
Q6R659_MELLI/24-150MEHVPAELTGVSEGYTRFYRSSTASVILSGLVKVKWD-----------NEQMTMPLFKWIG-------GEQAE-ELHFDV
Q1HBK1_MELLI/24-150MEDVPAELTGVSEGYTRFYRSPTATVTLSRLVDVKWD-----------NEQMTMPLFKWTG-------GEQAE-ELHFCV

PF00917

TRF1B_ARATH/74-197-------IPKFSEIT-----KREHRSNVFEAGGYKWY----------------ILIYPQGCD---VCNHLSLFLCVANYD
Q93Z83_ARATH/66-193-------ITSFSVIK---GRGEPYESSVFEAAGYKWR----------------LVLYVNGNKNDGGNDHISLYARIEETN
Q940M1_ARATH/102-220-------IRDFSVLK-----QNDCISKTFAMGGKNWT----------------LTVYPKGDS--EADNEFCKYLHLADGE
DG17_DICDI/327-450-------ISNYSSVAKSKLNCQALSSPMLSILSHLFQ----------------VCVYPKGDE---NKEYISLYLRVNNIE
O76557_CAEEL/290-402-------VRNISSIN---GGNVYFT-DIETRFNVPWK----------------LSFVRQSG-------FIELYLRCEKK-
O16553_CAEEL/149-261-------VKNISSIE---EGDDYYT-EIATRHNVPWR----------------MQIKRNNG-------FFELYLRCEKE-
O16558_CAEEL/149-261-------VKNVSSIK---EGGNYFT-NTEKRFNIPWR----------------LQIQRFNE-------FFGLYLRCEKE-
O16559_CAEEL/157-269-------VKNVSSIK---EGGNYFT-KTEKRFNIPWK----------------LNIERKNG-------FFGLYLHCTKE-
O16560_CAEEL/140-252-------VKNVSRII---DGSDYFT-KIENRFNIPWQ----------------LKIQRRNG-------FFGIFLHCNKE-
O16562_CAEEL/108-218-------VKNMSSIK---EGEEYFS-DIQTRFNIPWY----------------LQVKRRDG-------FNGLFLHCSKH-
O17191_CAEEL/289-401-------VKNMSRIE---EGEEYYT-GIQTRFNIPWK----------------LKIKKQSG-------FFGLFLHCFKQ-
O17190_CAEEL/289-402-------VRNMSSIK---EGGDYLT-DIQTRFNIPWK----------------LKIQRLNG-------FIELFLRCAEN-
O76558_CAEEL/284-397-------VKNMSSIE---EGRIIFS-DTQTRFNILWK----------------LKIRKQDG-------FFELFLLCDKQ-
O76641_CAEEL/14-126-------VKNISRFV---NGENYYT-NLEDRFNIPWR----------------INIKKMSG-------NFEFYLRCEKEE
O76642_CAEEL/14-126-------VKNISRFV---DGESYYN-NLEDRFNIPWR----------------MTLERKNY-------QCGFYLRCEKE-
O16551_CAEEL/14-125-------VKNISRFV---DDESYFT-DTEERFNIPWR----------------IEIKKKDG-------NFELFLKCQKE-
U4PC47_CAEEL/14-126-------VRNISQFL---NGEQYFT-DVEERFNIPWR----------------IRIWRHNG-------YLVLYLQCDKEQ
O16555_CAEEL/11-123-------VRNISRFE---DQEQYST-DTETHFNIPWA----------------LQIRKNNG-------YLQFYLLCEKE-
O17303_CAEEL/12-125-------FKDVSKLD---EGGSYYS-DIEIRHNIPWRL--------------S--ISKKDG-------FLGVNLHCENK-
O17192_CAEEL/12-124-------FKDISKLG---EGESYFS-DKEERYNIPWR----------------LQIFRKGG-------FLGLNLKCEKKE
P91300_CAEEL/283-399-------FYDVSRIE---EGESRFS-AFEKRFNIPWR----------------IELKRVSG-------FLEIHLHCGEN-
O17193_CAEEL/11-126-------VKNIAAMK---EGDSQST-TSEQHFGLPWY----------------FKVFCKDK-------HLQLCVYYGAQL
O76610_CAEEL/166-276-------KYTFEKFD-----EDCVG-GYNVQLGFLWS----------------LNIHRKND-------HLRISLCCDKPE
O44817_CAEEL/14-126-------FKNVTKWK---TGEIFYS-PDEEHFNVPWQ----------------MCIHRENG-------NMCVILCCLKVE
O16567_CAEEL/26-139-------SSGLTPVA---APQPAYTGRSTENFNIPWF----------------IEILRKTN-------RLAVYFHCDKLK
O44815_CAEEL/14-128-------YKNVSKLE---DEGTLLS-PSEEHFNVQWY----------------MAVSHKKE-------DMAVYLHCNILG
O76568_CAEEL/14-130-------FTDVSKME---KDISVFS-PGEEHFNVSWN----------------MSISCEGD-------HLGVFLHCHKSR
O17297_CAEEL/14-127-------FKNVSKMK---DSDFLYS-PEENLFNVPWF----------------MLIARKDD-------HFGVFLHCQKIN
BAT15_CAEEL/14-125-------FKDVSQLE---DGDFFKS-PEEIHYNAEWF----------------ILVIRTKD-------QLEAYLHCDNEK
O44805_CAEEL/17-135-------FNDVSNMN---DNDMRFG-TVEEYFNVPWI----------------FQIQRNNG-------NLGIYLRCTNLK
O76611_CAEEL/30-142-------IKNISTLN----IGNTYTSDVEDHFGFLWH----------------LSYIYDGR-------FLRTTLNIDVNG
BAT38_CAEEL/86-206-------IPNFSNLR------SKVSTPFQYIGNLPWR----------------LAAKTEKTKRTSDVKFFSVYIDCNPES
O45623_CAEEL/38-168-------IDCFSKFM--SRSDNRIMSKPIIVRGIPWRILAICRNQQGSRHSMNSRVNRSNF-------NFGFFLQCNNDE

PF11584

M2URZ2_COCH5/46-160--------QGSCVSISRPANNPSINNIGQIDITSVVN-------------GGPGM--TWDL-------NNLVRVHVSREV
Q0TVA4_PHANO/61-177--------QGSCMSITINPSRPSVNNIGQVDIDSVIL-------------GRPGAIGSWEL-------NNFVTIGLNRVN

PF02176

TRAF6_MOUSE/204-261IPC---TFSV---FGCHEKMQRNHLARH----------------------------------------------------
DG17_DICDI/197-255IPC---KYFE---QGCKVEMKRSELQNH----------------------------------------------------
TRAF5_HUMAN/183-241QDC---PFKH---YGCAVTDKRRNLQQH----------------------------------------------------
TRAF2_MOUSE/178-235VLC---RFHT---VGCSEMVETENLQDH----------------------------------------------------
TRAF5_MOUSE/128-183EKC---LY-------CKRDIVVTNLQDH----------------------------------------------------
TRAF2_HUMAN/178-235VPC---RFHA---IGCLETVEGEKQQEH----------------------------------------------------
TRAF3_HUMAN/136-192ATC---SH-------CKSQVPMIALQKH----------------------------------------------------
TRAF4_HUMAN/102-156LKC---EF-------CGCDFSGEAYESH----------------------------------------------------
TRAF4_HUMAN/210-269VLC---PFKD---SGCKHRCPKLAMARH----------------------------------------------------

PF17848

A0A073CCX9_PLAAG/30-55--------------------------------------------------------------------------------
A0A140E654_9GAMM/28-53--------------------------------------------------------------------------------
J0L5Y7_9HELI/27-52--------------------------------------------------------------------------------
LYAR_HUMAN/3-28--------------------------------------------------------------------------------
E3PX51_ACESD/8-33--------------------------------------------------------------------------------
A0A098YBX8_9ACTN/20-45--------------------------------------------------------------------------------
A0A0S2W5T2_9FIRM/36-61--------------------------------------------------------------------------------
T2RED7_PAES9/32-57--------------------------------------------------------------------------------
ACCD_RUBXD/6-31--------------------------------------------------------------------------------
A0A165S9F9_9SPHN/24-49--------------------------------------------------------------------------------
F2I422_PELSM/30-55--------------------------------------------------------------------------------
D3PBT8_DEFDS/28-53--------------------------------------------------------------------------------
E6U768_ETHHY/33-58--------------------------------------------------------------------------------
A0A059KFR1_9BURK/28-53--------------------------------------------------------------------------------
A0A1V0DC26_9BACT/26-51--------------------------------------------------------------------------------
Q5NHS3_FRATT/28-53--------------------------------------------------------------------------------
Q1IWB3_DEIGD/24-49--------------------------------------------------------------------------------
A0A0F0CVK6_9BACT/23-48--------------------------------------------------------------------------------
A8PMD5_9COXI/26-51--------------------------------------------------------------------------------
R9IHW3_9FIRM/23-48--------------------------------------------------------------------------------
A0A089X303_STRGA/15-40--------------------------------------------------------------------------------
ACCD_ACHLI/36-61--------------------------------------------------------------------------------
M1Z2Q1_NITG3/21-46--------------------------------------------------------------------------------
ACCD_CLOBH/35-60--------------------------------------------------------------------------------
A7HDB6_ANADF/31-56--------------------------------------------------------------------------------
R6NF91_9CLOT/57-82--------------------------------------------------------------------------------
F8L6H8_SIMNZ/27-52--------------------------------------------------------------------------------
F0T0C5_SYNGF/39-64--------------------------------------------------------------------------------
A0A0R1PCR2_9LACO/30-54--------------------------------------------------------------------------------
R7GF07_9CLOT/28-53--------------------------------------------------------------------------------
A0A0M2UYG4_9BACT/15-40--------------------------------------------------------------------------------

PF15965

H2LB95_ORYLA/6-98VPC---LNAF---YGCPLTMQRQKLAKHL-EVC-----------------------------------------------
U3ICA7_ANAPP/14-106VPC---LNSD---YGCPFSMARFKLAKHL-QVC-----------------------------------------------
M3ZZZ2_XIPMA/36-128VPC---LNAE---YGCPVQLPRSSRAAHL-QVC-----------------------------------------------
W5KE54_ASTMX/10-102VPC---LNAQ---YGCPMSMPRHRLAQHL-ESC-----------------------------------------------
I3NGQ0_ICTTR/12-104VPC---LNSE---YGCPLLMSRHKLAKHL-QMC-----------------------------------------------
B7QIX1_IXOSC/11-103VPC---SNAV---NGCPASLLRSQLGSHL-QHC-----------------------------------------------
A7S9N8_NEMVE/9-97TPC---TNSF---YGCPAVLPRESIKSHL-SIC-----------------------------------------------
H3DNZ1_TETNG/7-99VAC---LNVL---YGCPLHVQRRRLAKHL-EVC-----------------------------------------------
C3ZBV3_BRAFL/1-93APC---INAV---NGCPKWMPRGQHARHL-AHC-----------------------------------------------
A0A1I7VQE8_LOALO/27-111VPC---LCAA---FGCPVLLRRDRMSQHL-KHC-----------------------------------------------
T1KF06_TETUR/33-126ILC---INHN---FGCPAFLPRKDLSKHI-SRC-----------------------------------------------
F1Q6V8_DANRE/12-104VPC---FNVE---YGCPFTMCRSNLAKHL-VVC-----------------------------------------------
H2ZZ11_LATCH/16-108VPC---LNSG---YGCPFDMPRFKLARHL-TTC-----------------------------------------------
W5MDX5_LEPOC/13-105VPC---LNAG---YGCPFSMARCKLSKHL-EVC-----------------------------------------------
E5S5E0_TRISP/811-899INC---LNAS---IGCPFRLKRKQLSKHLADQC-----------------------------------------------
M3X5C4_FELCA/7-99VPC---LNSD---FGCPFTMARNKVAEHL-EMC-----------------------------------------------
H3D3Y5_TETNG/8-100VPC---LNSS---NGCPASIVRNQLYAHL-EVC-----------------------------------------------
G3PEZ9_GASAC/7-99VPC---LNVE---YGCPLTLVRHRMAKHL-EVC-----------------------------------------------
F1QPK7_DANRE/5-97VPC---LNQS---IGCPFTLARGQMAEHL-EVC-----------------------------------------------
W4YYV2_STRPU/500-592TEC---VNAI---YGCPVDIQRRHICRHL-EVC-----------------------------------------------
I3ISU9_DANRE/12-104VPC---INAH---YGCPFTMCRSRLAKHL-EVC-----------------------------------------------
I3K6V1_ORENI/5-97IPC---LNSG---YGCPATLVRNQMYAHL-EVC-----------------------------------------------
B3RLD3_TRIAD/13-101VQC---INWY---YGCPQTMPRCRLNQHL-TVC-----------------------------------------------
E9HAM6_DAPPU/10-103EPC---INVN---YGCPHVLLRKHRGKHL-ESC-----------------------------------------------

PF18048

A0A5E4B0U9_MARMO/157-183--------------------------------------------------------------------------------
A0A2I3G7Q8_NOMLE/157-183--------------------------------------------------------------------------------
A0A3L8SWV3_CHLGU/157-183--------------------------------------------------------------------------------
A0A1S3FGD6_DIPOR/157-183--------------------------------------------------------------------------------
A0A1S2ZN24_ERIEU/157-183--------------------------------------------------------------------------------
F6Q0W8_XENTR/159-185--------------------------------------------------------------------------------
G3WLM2_SARHA/157-183--------------------------------------------------------------------------------
A0A5N4DMY6_CAMDR/158-184--------------------------------------------------------------------------------
A0A091CRB5_FUKDA/185-211--------------------------------------------------------------------------------
A0A212DIB6_CEREH/140-166--------------------------------------------------------------------------------
F6S636_ORNAN/157-183--------------------------------------------------------------------------------
G1P0K0_MYOLU/157-183--------------------------------------------------------------------------------
TRAF6_RAT/157-183--------------------------------------------------------------------------------
A0A402EZD4_9SAUR/160-186--------------------------------------------------------------------------------
A0A1U8C5B2_MESAU/157-183--------------------------------------------------------------------------------

PF03145

F7I459_CALJA/85-281YSC---PCPG---ASCKWQGSLDAVMPHLMHQH-KSITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
F4JDF6_ARATH/5-232YNC---PHSG---AKCDVTGDIQRLLLHLRNDH--NVEMSD----G-RSFSHRY-VHH-DPKHLHHATWMLTVSYITDYL
D6W8F0_TRICA/89-285YSC---PCPG---ASCSWQGQLDKVMVHLQHSH-KNITTLN----G-EDIVF---LAT-EIN-LAGAVDWVMM-------
D6WQJ0_TRICA/55-244YRC---MFE----KYCCWQGTRDKLKKHYVDKHDNNVLIGS----T-SMCLW----------KEDQPDYTVHL-------
U3JRJ7_FICAL/62-258YSC---PCPG---TSCDWEGSLEAVMSHLMHAH-KSITTLQ----G-EDIIF---LAT-DIN-LPGAVDWVMM-------
M0SES1_MUSAM/113-312YTC---PHPG---SDCPFTSDSLALLSHLRERH--KVDLQA----G-CTFNHRY-VKQ-DPCSVDSCSWTLTL-------
A0A1I7V834_LOALO/123-320YCC---PCPG---ASCKWQGSLSEVMGHLMKVH-KSITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
W1PHN4_AMBTC/145-342LSC---PYAG---SECTVVGDVPFLVAHLRDDH--KVDMHN----G-STFNHRY-VKS-NPHEVENAIWMLTV-------
W5NWR0_SHEEP/85-282CRC---PCPG---ASCGWQGAMDAVVPHVMQHYNNSVITLE----G-EVVVF---LAV-NIN-LAGTLDWVMV-------
A0A0D3F068_9ORYZ/102-301YSC---PYAG---SECLIAGDVPMLVSHLINDH--KVDLHE----G-CTFNHRY-VKS-NPYEVENATWMLTV-------
H0Y018_OTOGA/86-284YFC---PCPG---VLCPWEGSVDAVMPHLMDQHDDRITALQ----G-ETATF---LAM-DINNVPGTLYWVMM-------
M1C6R4_SOLTU/36-234YHC---PYAG---SECSITGDIPTLMLHLKEDH--KVDMHT----G-CTFNHRY-VKS-NAQQVDNAIWMLTV-------
K1RDH5_CRAGI/70-266YCC---PCPG---ASCKWQGSLEQVMGHLMQQH-KSITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
Q7QF99_ANOGA/180-384IEC---FMGKV-WGGCGWHGCERDWLAHCLAEHADHVHEDR----C-VELQWAYGAEAAQRAPELQLVVAYHV-------
H0Y1K4_OTOGA/82-279YPC---PCPG---VRCPWAGFLDAVMPHLMYQHGNRIITLQ----G-ETATY---FAM-NINGVHCPFEWVMI-------
A0A1X7V5F7_AMPQE/69-267YAC---PCPG---TTCRWQGSLDEVLDHLLNAH-KTITTLN----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
H0XJR4_OTOGA/82-278YSC---PCPG---VSCQWQGSLEAVMPHLLQQH-AYLKAIQ----G-EKTVF---LAM-DIN-VSGAFDWAMM-------
H0XIX1_OTOGA/145-341YSC---PCPG---VSCQWQGSLEAVMPHLMDQH-KPLIAPQ----G-ENILF---LAT-DIN-LPGAVDWVMM-------
SINAL_DROME/147-341YFC---PYPD---DKCSWQGPLRDVYQHLMSSH-ENVITME----G-NDIIF---LAT-NVN-LEGALDWTMV-------
G3X7V0_BOVIN/80-277CRC---PCPG---TSCGWQGSMDAVVPHLMQHYNESIITLQ----G-EVVVF---LAV-NIN-LAGALDWVMI-------
Q7PZE6_ANOGA/33-226YRC---VAASLNVIKCNWQGLQHEIEDHLAKGH-KEL--------G-EVFRFRESTSL--VFKEQISLGGLKL-------
H0Y0B7_OTOGA/82-279YSC---PCPN---VLCPWEGSLDAVMPHLRRQH-GSVTALE----G-QIAIF---LAT-NINNVHGTYQWVMT-------
H0XK85_OTOGA/82-279YSC---PCPG---VLCPWEGSVDAVMPHLMDQH-GSLTALE----G-ETAIF---LAM-NINNEHGTFYWVMM-------
B4LE73_DROVI/110-304YFC---PYPD---EKCVWQGALKDVYKHFVSTH-QNVITME----G-TDIIF---LAT-NVN-QVGALDWTMI-------
B4QNB8_DROSI/191-380YLC---PCPG---ASCKWQGPLDLVMQHLMMSH-KSITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
H9JRH4_BOMMO/72-263INC---FMARV-YGECTWEGRAGDWMDHCFSEHKQKV----------TDLPFITVKDK-WDAKRTEPILNYFL-------
H0XTM6_OTOGA/82-280YSC---PCPG---VRCPWAGSLDLVMPHLIHQHDDHITSVE----G-ETAIF---LAV-DVNNEHGPFYWVMT-------
M1D5F6_SOLTU/101-299YNC---PYAG---SECAVTGDIQHLVAHLKDDH--KVDMHD----G-CTFNHRY-VKS-NPQEVENATWMLTV-------
E3M5Q1_CAERE/208-407YSC---PCPG---ASCKWQGALSDVMDHLKKVH-KSITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMM-------
W1NE48_AMBTC/91-290YSC---PHPG---SDCPVTGDVPTLVAHLREVH--KVDLQT----E-CTFNHRY-VKK-DPCAVDNVSWTLTL-------
T1KZZ1_TETUR/128-324YSC---PCPG---SNCKWNGPLKQVMHHLMTQH-KSITTLQ----G-EDIVF---LAT-DIN-LSGAVDWVMI-------
SINA_SCHMA/167-362YDC---PCPG---ASCKWLGELEQVMPHLVHHH-KSITTLQ----G-EDIVF---LAT-DIS-LPGAVDWVMM-------
H0XXJ8_OTOGA/83-277YSC---PCPG---VLCQWEGSVDAVMPHLMDQHDDCVTAQE----G-ETAIF---LAT-DINNIRDAFYWVMI-------
M4CBD9_BRARP/5-207YNC---PYSG---SKCTATGDTQWLLQHLRNDH--HVEMHD----G-RSFSHRY-VHH-NPKHLHHATWMLTL-------
B3RLR7_TRIAD/93-285YSC---PFP----ITCRWQGSLDSVVSHIVNSH-KTVPMQD----G-EDVVFSFVITS-EVT------VWAMI-------
E0W112_PEDHC/92-276HRC---KI-----DNCDWIGKKDELKSHVENLHQEDIWKKEWNFAGSRKFEH-------NDTSSDEFGKLLVI-------
B9GYJ4_POPTR/105-304YNC---PYAG---AECSVTGDIPLLVKHLRNEH--KVDMHD----G-CTFNHRY-VKS-DPREIDNATWMLTV-------
M0T9A8_MUSAM/95-294YNC---PYAG---SECSVVGEIPFLVAHLRDDH--KVDMHT----G-CTFNHRY-VKS-NPREVENATWMLTV-------
D6WZ00_TRICA/55-252FLC---EGRKFAKWKCEWFGNYGELEQHFKDVH------------R-NSMEYKMQTEM-DIR-LDKDFRDVQI-------
G1MN92_AILME/82-278YVC---PCPG---AFCKWQGSLEAVMPHLMHQH-ESITTLQ----G-EDIVF---LAT-DIN-LPGAVDWVMT-------
I1H5D3_BRADI/95-294YSC---PYAG---SECTVAGDIPYLVNHLKDDH--KVDMHS----G-STFNHRY-VKS-NPHEVENATWMLTV-------

PF11529

Q1HBK6_MELLI/24-150HIA---HSIGPKLNLARTLGTVNSNMDQHWAQA-----------------------------------------------
Q6R659_MELLI/24-150HIA---HSSGRRLDRARTLGAVNSNMDQHWVEA-----------------------------------------------
Q1HBK1_MELLI/24-150HIA---HSSGRRLNSARTLGTVNSNMDQHWVEA-----------------------------------------------

PF00917

TRF1B_ARATH/74-197KLLPGSFAILEAGWSQFAQFTISVLSQDLKK-------------------------------------------------
Q93Z83_ARATH/66-193SLP--------LGWEVNVDLKLFVHNGKLHKYL-----------------------------------------------
Q940M1_ARATH/102-220VLS--------PGEMISVRAQLRALDPRGSK-------------------------------------------------
DG17_DICDI/327-450EPN---------SLKVEYSFTLVNVLDKSKS-------------------------------------------------
O76557_CAEEL/290-402-QC------LSRTWSIEAEFTLKLVSPHGRS-------------------------------------------------
O16553_CAEEL/149-261-EQ------PEWGWKIELDYDLRLVSLNGQS-------------------------------------------------
O16558_CAEEL/149-261-LS------NRRNWTIEVEYDLRLVSLNGQS-------------------------------------------------
O16559_CAEEL/157-269-LS------NKNNWTIEVEFDLRLVSLNGQS-------------------------------------------------
O16560_CAEEL/140-252-MS------NRSNWTIAVDFTLKLVSTNGQC-------------------------------------------------
O16562_CAEEL/108-218-LD------EFRNWSIKTEYQFKLVSTNGRN-------------------------------------------------
O17191_CAEEL/289-401-LD------EFRKWSIETEYQLKVVSSNGRS-------------------------------------------------
O17190_CAEEL/289-402-MC------ESRKWSIETEYQLKLVSTNGRS-------------------------------------------------
O76558_CAEEL/284-397-LC------KSRKWSIETVFQLKIVSSNGRS-------------------------------------------------
O76641_CAEEL/14-126CEN--------RKWSIETEYTLKLVSHNGKS-------------------------------------------------
O76642_CAEEL/14-126-EC------EARKWSIETEYTLKLVSQNGKS-------------------------------------------------
O16551_CAEEL/14-125-EC------ENRKWSIETEYTLKLVSQNGKC-------------------------------------------------
U4PC47_CAEEL/14-126CET--------RKLTVETEFTLKLVSPYGTS-------------------------------------------------
O16555_CAEEL/11-123-EC------ETRKWSIEVEFKLKLVSYNGKR-------------------------------------------------
O17303_CAEEL/12-125-ECS-----ETKKWSFQTKFTMKLVAVSGKF-------------------------------------------------
O17192_CAEEL/12-124CFG-------ERKWSFQTKFTMKLVAVSGKF-------------------------------------------------
P91300_CAEEL/283-399---A-----TFLYHQIETDCWFNLVSTNGKH-------------------------------------------------
O17193_CAEEL/11-126IAE---------EQSIEVECDFKMITPTGKI-------------------------------------------------
O76610_CAEEL/166-276PTP---------YWEVRADFQLVLPGQDEAP-------------------------------------------------
O44817_CAEEL/14-126EDR--------VPWKINFEYQLKIVNISGMS-------------------------------------------------
O16567_CAEEL/26-139EDE--------IDWSIDVEYEITLKSSDGKR-------------------------------------------------
O44815_CAEEL/14-128KAE--------ATWCIDAEFEFTLKNSCGKR-------------------------------------------------
O76568_CAEEL/14-130GKE--------TMWTIDTEHQFTLKTSSGKA-------------------------------------------------
O17297_CAEEL/14-127EAG--------PTWSVDTQNTIRVKTLSASK-------------------------------------------------
BAT15_CAEEL/14-125DDN--------VAWTVDAEFSLKIASSSGSY-------------------------------------------------
O44805_CAEEL/17-135DQE---------MWSIFSELELKLVSVYSDT-------------------------------------------------
O76611_CAEEL/30-142RSA---------LWSVGMKVRHMFVTKNGA--------------------------------------------------
BAT38_CAEEL/86-206EST---------LWSCDAVVEFRLVSRNRTIP------------------------------------------------
O45623_CAEEL/38-168LLQ------KRGMWRCYGTAVLEVLNADGPS-------------------------------------------------

PF11584

M2URZ2_COCH5/46-160DGS--------LSFDWTNTGSANRLIVTEWN-------------------------------------------------
Q0TVA4_PHANO/61-177ANT--------VRVNINNTGRTNRLIITQWD-------------------------------------------------

PF02176

TRAF6_MOUSE/204-261--------------------------------------------------------------------------------
DG17_DICDI/197-255--------------------------------------------------------------------------------
TRAF5_HUMAN/183-241--------------------------------------------------------------------------------
TRAF2_MOUSE/178-235--------------------------------------------------------------------------------
TRAF5_MOUSE/128-183--------------------------------------------------------------------------------
TRAF2_HUMAN/178-235--------------------------------------------------------------------------------
TRAF3_HUMAN/136-192--------------------------------------------------------------------------------
TRAF4_HUMAN/102-156--------------------------------------------------------------------------------
TRAF4_HUMAN/210-269--------------------------------------------------------------------------------

PF17848

A0A073CCX9_PLAAG/30-55--------------------------------------------------------------------------------
A0A140E654_9GAMM/28-53--------------------------------------------------------------------------------
J0L5Y7_9HELI/27-52--------------------------------------------------------------------------------
LYAR_HUMAN/3-28--------------------------------------------------------------------------------
E3PX51_ACESD/8-33--------------------------------------------------------------------------------
A0A098YBX8_9ACTN/20-45--------------------------------------------------------------------------------
A0A0S2W5T2_9FIRM/36-61--------------------------------------------------------------------------------
T2RED7_PAES9/32-57--------------------------------------------------------------------------------
ACCD_RUBXD/6-31--------------------------------------------------------------------------------
A0A165S9F9_9SPHN/24-49--------------------------------------------------------------------------------
F2I422_PELSM/30-55--------------------------------------------------------------------------------
D3PBT8_DEFDS/28-53--------------------------------------------------------------------------------
E6U768_ETHHY/33-58--------------------------------------------------------------------------------
A0A059KFR1_9BURK/28-53--------------------------------------------------------------------------------
A0A1V0DC26_9BACT/26-51--------------------------------------------------------------------------------
Q5NHS3_FRATT/28-53--------------------------------------------------------------------------------
Q1IWB3_DEIGD/24-49--------------------------------------------------------------------------------
A0A0F0CVK6_9BACT/23-48--------------------------------------------------------------------------------
A8PMD5_9COXI/26-51--------------------------------------------------------------------------------
R9IHW3_9FIRM/23-48--------------------------------------------------------------------------------
A0A089X303_STRGA/15-40--------------------------------------------------------------------------------
ACCD_ACHLI/36-61--------------------------------------------------------------------------------
M1Z2Q1_NITG3/21-46--------------------------------------------------------------------------------
ACCD_CLOBH/35-60--------------------------------------------------------------------------------
A7HDB6_ANADF/31-56--------------------------------------------------------------------------------
R6NF91_9CLOT/57-82--------------------------------------------------------------------------------
F8L6H8_SIMNZ/27-52--------------------------------------------------------------------------------
F0T0C5_SYNGF/39-64--------------------------------------------------------------------------------
A0A0R1PCR2_9LACO/30-54--------------------------------------------------------------------------------
R7GF07_9CLOT/28-53--------------------------------------------------------------------------------
A0A0M2UYG4_9BACT/15-40--------------------------------------------------------------------------------

PF15965

H2LB95_ORYLA/6-98--------------------PASVV------------------------------------------------------C
U3ICA7_ANAPP/14-106--------------------PASVV------------------------------------------------------C
M3ZZZ2_XIPMA/36-128--------------------PASVV------------------------------------------------------C
W5KE54_ASTMX/10-102--------------------PASVV------------------------------------------------------C
I3NGQ0_ICTTR/12-104--------------------PASVV------------------------------------------------------C
B7QIX1_IXOSC/11-103--------------------PASIL------------------------------------------------------S
A7S9N8_NEMVE/9-97--------------------PASAI------------------------------------------------------F
H3DNZ1_TETNG/7-99--------------------PASVV------------------------------------------------------C
C3ZBV3_BRAFL/1-93--------------------PASVV------------------------------------------------------R
A0A1I7VQE8_LOALO/27-111--------------------CASSI------------------------------------------------------C
T1KF06_TETUR/33-126--------------------PASVI------------------------------------------------------H
F1Q6V8_DANRE/12-104--------------------PASIV------------------------------------------------------S
H2ZZ11_LATCH/16-108--------------------PASVV------------------------------------------------------C
W5MDX5_LEPOC/13-105--------------------PASIV------------------------------------------------------C
E5S5E0_TRISP/811-899--------------------PACVV------------------------------------------------------Y
M3X5C4_FELCA/7-99--------------------PASVV------------------------------------------------------C
H3D3Y5_TETNG/8-100--------------------PAGVV------------------------------------------------------S
G3PEZ9_GASAC/7-99--------------------PASVV------------------------------------------------------C
F1QPK7_DANRE/5-97--------------------PAGVV------------------------------------------------------C
W4YYV2_STRPU/500-592--------------------PASVV------------------------------------------------------N
I3ISU9_DANRE/12-104--------------------PASIV------------------------------------------------------C
I3K6V1_ORENI/5-97--------------------PAGLV------------------------------------------------------C
B3RLD3_TRIAD/13-101--------------------PASIV------------------------------------------------------H
E9HAM6_DAPPU/10-103--------------------PASCL------------------------------------------------------P

PF18048

A0A5E4B0U9_MARMO/157-183--------------------------------------------------------------------------------
A0A2I3G7Q8_NOMLE/157-183--------------------------------------------------------------------------------
A0A3L8SWV3_CHLGU/157-183--------------------------------------------------------------------------------
A0A1S3FGD6_DIPOR/157-183--------------------------------------------------------------------------------
A0A1S2ZN24_ERIEU/157-183--------------------------------------------------------------------------------
F6Q0W8_XENTR/159-185--------------------------------------------------------------------------------
G3WLM2_SARHA/157-183--------------------------------------------------------------------------------
A0A5N4DMY6_CAMDR/158-184--------------------------------------------------------------------------------
A0A091CRB5_FUKDA/185-211--------------------------------------------------------------------------------
A0A212DIB6_CEREH/140-166--------------------------------------------------------------------------------
F6S636_ORNAN/157-183--------------------------------------------------------------------------------
G1P0K0_MYOLU/157-183--------------------------------------------------------------------------------
TRAF6_RAT/157-183--------------------------------------------------------------------------------
A0A402EZD4_9SAUR/160-186--------------------------------------------------------------------------------
A0A1U8C5B2_MESAU/157-183--------------------------------------------------------------------------------

PF03145

F7I459_CALJA/85-281--------------------QSCFG--FHFMLVLEKQEK---YDGHQQFFAIVQLIGTRKQAENFAYRLEL--NGH---R
F4JDF6_ARATH/5-232ALFLQLCEFLSFNPLETMQLLDCCG--RKFCLYFEAFHL----RKTPMYMAFMQFMGDEEEAMSFSYSLQV--GGN---G
D6W8F0_TRICA/89-285--------------------QSCFG--HHFMLVLEKQEK---NDGHTQFFAIVQLIGSRKQAEHFAYRLEL--NGN---R
D6WQJ0_TRICA/55-244--------------------LLAFD--ELFYVHKRLR--------DDVMHWAVQYIGRPEDVILYYFEIQI--FTDQFND
U3JRJ7_FICAL/62-258--------------------QSCFG--HHFMLVLKKQEK---CEGHQQFFATVLLIGTRKQAENFQYRLEL--HGS---C
M0SES1_MUSAM/113-312--------------------FNCFG--QYFCLHFEAFLL----GCEPVYMAFLRFMGEESEARRYNYCLEV--GGH---G
A0A1I7V834_LOALO/123-320--------------------QSCFG--YHFMLVLEKQEKF--QDGNQMFYAVVQLIGAKKESENFMYRLEL--ATH---R
W1PHN4_AMBTC/145-342--------------------FNCFG--HYFCLHFEAFML----GTFPVYIAFLRFMGEDDEAKDFRYVLEV--GHN---G
W5NWR0_SHEEP/85-282--------------------QSCFG--SQFLLILEKLEI---HAGYRKFFAAVQLIGTREQAEHFTYRLEL--NGT---R
A0A0D3F068_9ORYZ/102-301--------------------FKCFG--QHFCLHFEAFLL----GMAPVYMAFLRFMGEDSEARNFCYSLEV--GGN---G
H0Y018_OTOGA/86-284--------------------QSCFD--LHFMVVLQRQEN---HHGQERFCAMVRLLGTPQQVENFTYRLEM--KRG---R
M1C6R4_SOLTU/36-234--------------------FDCFG--RQFVLHFEAFSL----GMTPVYIAFLRFMGEDNEAKMFNYSLEV--GGF---G
K1RDH5_CRAGI/70-266--------------------QSCFG--HNFMLVLEKQEK---LEGQQMFYAIVQLIGTRKQAENFAYRLEL--NGH---R
Q7QF99_ANOGA/180-384--------------------VRAYG--EAFNLYQVYDQ-----DSRTVLWTVICATKESQVSGRYAFELEL--YSPVNTW
H0Y1K4_OTOGA/82-279--------------------QSCFG--LHFMVVLQKQEN---DDGEQRFCAMVRLLGTPQQAKNFTYQLEL--IGD---R
A0A1X7V5F7_AMPQE/69-267--------------------QCCFE--HHFMLVLEKQER---HEGHQQFFAVVQIIGTEKQAEQFRYKLELVDSRH---G
H0XJR4_OTOGA/82-278--------------------QSCFG--FHFMVVLQKQEN---DNGEQQFCAIVQLIGTPQQAENFTYRLEL--NGH---K
H0XIX1_OTOGA/145-341--------------------QSCFG--FHFMVVLEKQEN---HYGQEQFFAILQLIGTPKQAENFAYCLEL--NGH---R
SINAL_DROME/147-341--------------------QSCHG--RHFLLSLEKINL---GEDCQQYFTACRMIGSMKDAAEFVYNISL--EAY---N
G3X7V0_BOVIN/80-277--------------------QSCFG--FNFILILEKLES---YDGHQKFFAVVQLIGTREQAEQFTYRLEL--NGN---R
Q7PZE6_ANOGA/33-226--------------------VDAFS--KRFLFYFFSD------VAHKKLSFLMLYFGRREEAAQYCYELEI--SGRPVFS
H0Y0B7_OTOGA/82-279--------------------QSCFD--LHFMVVLQKQEN---YNGQEWFCAIVQLLGTSQQAANFTYQLEL--IGD---R
H0XK85_OTOGA/82-279--------------------QSCFD--LHFMVVLQKQEN---HHGEERFCAIVQLLGTPQQAQNFTYQLEV--KGD---R
B4LE73_DROVI/110-304--------------------QSCHG--RHFLLSLEKVQL---GEGCQQYFAACRMIGTMRDAADFDYLISL--EAN---N
B4QNB8_DROSI/191-380--------------------QSCFG--HHFMLVLEKQEK---YDGHQQFFAIVQLIGSRKEAENFVYRLEL--NGN---R
H9JRH4_BOMMO/72-263--------------------LRCFE--KVFNVYQIYDK-----RGGRMMWTVLV---NDDNAEKFYFEIDI--FLPNLPS
H0XTM6_OTOGA/82-280--------------------QSCFD--LHFMVVLQRQEN---DDGHVRFCAIVQLLGTLEQAQNFTYQLEL--NDD---Q
M1D5F6_SOLTU/101-299--------------------FNCFG--HQFCLHFEAFNL----GLAPVYMAFLRFMGDDDDAKRFSYSLEV--GGF---G
E3M5Q1_CAERE/208-407--------------------QSCFD--FNFMLVLEKQEKYDPAQSTQMFYAVVQLIGSKKEADNFVYRLEL--SAN---R
W1NE48_AMBTC/91-290--------------------FHCFG--HYFCLHFEAFRL----GGEAVYMAFVRFMGEESEARKFSYCLEV--GGN---G
T1KZZ1_TETUR/128-324--------------------QSCFN--HHFMLVLEKQER---FQAYQQFFAVVQLIGTPKQAEKFIYRLEL--NGQ---K
SINA_SCHMA/167-362--------------------QSCFG--HSFMLVLEKQER---V-PDQIFFALVQLIGTRKQADQFVYRLEL--NGH---R
H0XXJ8_OTOGA/83-277--------------------QSCFG--LHFMVVLQKKGN---NDGQEQFCAIVQLLGTPQQAKNFTYQLEL--IGV---R
M4CBD9_BRARP/5-207--------------------LDCYG--RQFCLYFEAFHL----KKTPMYIAYMQFMGDEEEATSFSYTLEI--SGN---G
B3RLR7_TRIAD/93-285--------------------QKCHD--QHFLVLVRKIEM---SHYIYQLYALVQVIAPKSIARNFAYVLTL--KDE---Q
E0W112_PEDHC/92-276--------------------EK-----ELFWMLSNYD------CEKKKLYKSFQYIGPKEAAKRFNYQICLKSSDD---R
B9GYJ4_POPTR/105-304--------------------FNCFG--RQFCLHFETFHL----GMSPVYMAFLRFMGTEDEAREFSYSLEV--GGN---G
M0T9A8_MUSAM/95-294--------------------FYCFG--QYFCLHFEAFQL----GIAPVYMAFLRFMGDENEARNFSYSLEV--GGN---G
D6WZ00_TRICA/55-252--------------------ISFFNGAQYFWYKFVVD------VALQRVFWVFQFIGPKKQAKNYYYEFEI-SNGP---I
G1MN92_AILME/82-278--------------------QSCFG--VHFMLVLEKHEK---YNGHQQFFAIVQLIGSHKQAENFVYRLEL--NGH---R
I1H5D3_BRADI/95-294--------------------FSCFG--EYFCLHFEAFQL----GMAPVYIAFLRFMGDDTEAKNYSYSLEV--GGG---G

PF11529

Q1HBK6_MELLI/24-150-------------------------------------------------------------------------------H
Q6R659_MELLI/24-150-------------------------------------------------------------------------------Y
Q1HBK1_MELLI/24-150-------------------------------------------------------------------------------Y

PF00917

TRF1B_ARATH/74-197---------------------------------------------------SKFSDT--LHRFWKK--EHDWGWKK----
Q93Z83_ARATH/66-193--------------------------------------------------TV--TDGLVKRYNNAK---KEWGFGQ----
Q940M1_ARATH/102-220--------------------------------------------------HKTVWLQ--QWIMAAT---KARGIPQ----
DG17_DICDI/327-450---------------------------------------------------ITKKED--KKVFISS---EGWGWGK----
O76557_CAEEL/290-402---------------------------------------------------LSLRKI---YSFEKS---IGNGYSK----
O16553_CAEEL/149-261---------------------------------------------------LSLTDS---GSFSKP---FCEGFEK----
O16558_CAEEL/149-261---------------------------------------------------LSIKGT---STFEKP---ISYGYCK----
O16559_CAEEL/157-269---------------------------------------------------LSIKLT---STYKEH---YGYGWDK----
O16560_CAEEL/140-252---------------------------------------------------LTSNMT---SVFNEP---DGYGLFK----
O16562_CAEEL/108-218---------------------------------------------------VAFYGE---KVFEKP---VGSGWGK----
O17191_CAEEL/289-401---------------------------------------------------VSFSFS---YLFDKP---FGYGWLK----
O17190_CAEEL/289-402--------------------------------------------------LSLKNIK---YVFDKP---FGYGWLT----
O76558_CAEEL/284-397--------------------------------------------------LVLLKTT---RVFNKA---TGYGWLK----
O76641_CAEEL/14-126---------------------------------------------------LKKNSK---DTFEKF---TGHGWSK----
O76642_CAEEL/14-126---------------------------------------------------LMKNSK---YTFEKP---KSYGWIN----
O16551_CAEEL/14-125---------------------------------------------------LMKNNK---YTFENQ---LGRGWE-----
U4PC47_CAEEL/14-126---------------------------------------------------LARNQV---HTFVEL---KGRGWHK----
O16555_CAEEL/11-123---------------------------------------------------LMTDCR---RTFEKP---SGLGSGD----
O17303_CAEEL/12-125---------------------------------------------------FQRTVQ---HEFQKP---EGHGMDK----
O17192_CAEEL/12-124---------------------------------------------------FQRAVQ---HEFQQP---KGHGMDK----
P91300_CAEEL/283-399---------------------------------------------------LMRQMS---AVFCRD---VDMESLKKSLK
O17193_CAEEL/11-126--------------------------------------------------FVEKTGV--R-KYGGETQYIGIGFPK----
O76610_CAEEL/166-276---------------------------------------------------VTKGYF---RNIDEE--LKCEELGR----
O44817_CAEEL/14-126--------------------------------------------------IVKAG-----NKICTE---KRR-FVRR---
O16567_CAEEL/26-139--------------------------------------------------ITKKTD----HQFTK-----NEGYGFP---
O44815_CAEEL/14-128--------------------------------------------------STKKT----AVKFTNS---ENIGYGWK---
O76568_CAEEL/14-130--------------------------------------------------YREDDNF--NFQFSNA---HSYGNGTT---
O17297_CAEEL/14-127---------------------------------------------------VSSEIF--KHKFEKN---E--GWGYF---
BAT15_CAEEL/14-125---------------------------------------------------AMKFQK---GCFDG----FGLGWND----
O44805_CAEEL/17-135--------------------------------------------------RDQKCKI--DMCFGHD---SGKFYSSYGWS
O76611_CAEEL/30-142---------------------------------------------------DHFHNS-TDHVFSQE---HNYGLTA----
BAT38_CAEEL/86-206--------------------------------------------------PFSRQFT---NKFNYN--SNNWGFPS----
O45623_CAEEL/38-168---------------------------------------------------IQKKIH---HSFHN----TEVDWG-----

PF11584

M2URZ2_COCH5/46-160--------------------------------------------------SSSSTSGNGYVLLGSYGLPTGTGNICFPVG
Q0TVA4_PHANO/61-177---------------------------------------------------NTLTRGDVYELFGDYALIQGRGSFCLNIR

PF02176

TRAF6_MOUSE/204-261-----------------------------------------------------
DG17_DICDI/197-255-----------------------------------------------------
TRAF5_HUMAN/183-241-----------------------------------------------------
TRAF2_MOUSE/178-235-----------------------------------------------------
TRAF5_MOUSE/128-183-----------------------------------------------------
TRAF2_HUMAN/178-235-----------------------------------------------------
TRAF3_HUMAN/136-192-----------------------------------------------------
TRAF4_HUMAN/102-156-----------------------------------------------------
TRAF4_HUMAN/210-269-----------------------------------------------------

PF17848

A0A073CCX9_PLAAG/30-55-----------------------------------------------------
A0A140E654_9GAMM/28-53-----------------------------------------------------
J0L5Y7_9HELI/27-52-----------------------------------------------------
LYAR_HUMAN/3-28-----------------------------------------------------
E3PX51_ACESD/8-33-----------------------------------------------------
A0A098YBX8_9ACTN/20-45-----------------------------------------------------
A0A0S2W5T2_9FIRM/36-61-----------------------------------------------------
T2RED7_PAES9/32-57-----------------------------------------------------
ACCD_RUBXD/6-31-----------------------------------------------------
A0A165S9F9_9SPHN/24-49-----------------------------------------------------
F2I422_PELSM/30-55-----------------------------------------------------
D3PBT8_DEFDS/28-53-----------------------------------------------------
E6U768_ETHHY/33-58-----------------------------------------------------
A0A059KFR1_9BURK/28-53-----------------------------------------------------
A0A1V0DC26_9BACT/26-51-----------------------------------------------------
Q5NHS3_FRATT/28-53-----------------------------------------------------
Q1IWB3_DEIGD/24-49-----------------------------------------------------
A0A0F0CVK6_9BACT/23-48-----------------------------------------------------
A8PMD5_9COXI/26-51-----------------------------------------------------
R9IHW3_9FIRM/23-48-----------------------------------------------------
A0A089X303_STRGA/15-40-----------------------------------------------------
ACCD_ACHLI/36-61-----------------------------------------------------
M1Z2Q1_NITG3/21-46-----------------------------------------------------
ACCD_CLOBH/35-60-----------------------------------------------------
A7HDB6_ANADF/31-56-----------------------------------------------------
R6NF91_9CLOT/57-82-----------------------------------------------------
F8L6H8_SIMNZ/27-52-----------------------------------------------------
F0T0C5_SYNGF/39-64-----------------------------------------------------
A0A0R1PCR2_9LACO/30-54-----------------------------------------------------
R7GF07_9CLOT/28-53-----------------------------------------------------
A0A0M2UYG4_9BACT/15-40-----------------------------------------------------

PF15965

H2LB95_ORYLA/6-98CSQEWNRWPV-------------------------------------------
U3ICA7_ANAPP/14-106CSMEWNRWPN-------------------------------------------
M3ZZZ2_XIPMA/36-128CSMEWNRWPS-------------------------------------------
W5KE54_ASTMX/10-102CSLEWNRWPV-------------------------------------------
I3NGQ0_ICTTR/12-104CSMEWNRWPN-------------------------------------------
B7QIX1_IXOSC/11-103CTVEWNRWI--------------------------------------------
A7S9N8_NEMVE/9-97CTMEWNRYPV-------------------------------------------
H3DNZ1_TETNG/7-99CSQEWNRWPV-------------------------------------------
C3ZBV3_BRAFL/1-93CTMEWNRWPV-------------------------------------------
A0A1I7VQE8_LOALO/27-111CAVQWNRR---------------------------------------------
T1KF06_TETUR/33-126CYIEWNRWPI-------------------------------------------
F1Q6V8_DANRE/12-104CSMEWNRWPV-------------------------------------------
H2ZZ11_LATCH/16-108CSMDWNRWPI-------------------------------------------
W5MDX5_LEPOC/13-105CSMDWNRWPV-------------------------------------------
E5S5E0_TRISP/811-899CSAGWNRWPV-------------------------------------------
M3X5C4_FELCA/7-99CTMEWNRWPV-------------------------------------------
H3D3Y5_TETNG/8-100CTMEWNRWPV-------------------------------------------
G3PEZ9_GASAC/7-99CSQEWNRWPV-------------------------------------------
F1QPK7_DANRE/5-97CSMEWNRWPV-------------------------------------------
W4YYV2_STRPU/500-592CTMEWNRWPV-------------------------------------------
I3ISU9_DANRE/12-104CSMEWNRWPV-------------------------------------------
I3K6V1_ORENI/5-97CTMEWNRWPV-------------------------------------------
B3RLD3_TRIAD/13-101CSKKWSRCP--------------------------------------------
E9HAM6_DAPPU/10-103CNAEWNRWPL-------------------------------------------

PF18048

A0A5E4B0U9_MARMO/157-183-----------------------------------------------------
A0A2I3G7Q8_NOMLE/157-183-----------------------------------------------------
A0A3L8SWV3_CHLGU/157-183-----------------------------------------------------
A0A1S3FGD6_DIPOR/157-183-----------------------------------------------------
A0A1S2ZN24_ERIEU/157-183-----------------------------------------------------
F6Q0W8_XENTR/159-185-----------------------------------------------------
G3WLM2_SARHA/157-183-----------------------------------------------------
A0A5N4DMY6_CAMDR/158-184-----------------------------------------------------
A0A091CRB5_FUKDA/185-211-----------------------------------------------------
A0A212DIB6_CEREH/140-166-----------------------------------------------------
F6S636_ORNAN/157-183-----------------------------------------------------
G1P0K0_MYOLU/157-183-----------------------------------------------------
TRAF6_RAT/157-183-----------------------------------------------------
A0A402EZD4_9SAUR/160-186-----------------------------------------------------
A0A1U8C5B2_MESAU/157-183-----------------------------------------------------

PF03145

F7I459_CALJA/85-281RRLTWEATPR-SIHEGIATAIMNSDCLVFDTSIAQLFAEN-----GNLGINVT
F4JDF6_ARATH/5-232RKLTWQGVPR-SIRDSHKTVRDSQDGLIITRKLALFFSTDNNTTDKELKLKVS
D6W8F0_TRICA/89-285RRLIWEAMPR-SSHEGVASAIMASDCLAFDNSIAQHFADN-----GNLGINVT
D6WQJ0_TRICA/55-244RKLEFSEICHDDIMENIDDIIDTGFCVSVRMPILQTYINNE----GVVFYKI-
U3JRJ7_FICAL/62-258HRLTWEASPC-SIHEGVPVAIRSSNCLVFDTATAHLFADN-----GNLGINVT
M0SES1_MUSAM/113-312RKLRWQGVPR-SIRTHHRMVRDSHDGLIVHRSLALYFSGGD---QKELKLRVS
A0A1I7V834_LOALO/123-320RRFSWEASPR-SIHEGVAHAISLSDCMAFDSQTAQLFAEN-----GNLGINVT
W1PHN4_AMBTC/145-342RKLIWQGVPR-SIRDSHRKVRDSHDGLIIQRNMALLFS-GD---RKELKLRL-
W5NWR0_SHEEP/85-282RRLMWEATPL-SIHERIETAFLNCDCLVFHPRVAELFAEN-----GDLSINVT
A0A0D3F068_9ORYZ/102-301RKLTWQGIPR-SIRDSHKKVRDSFDGLIIHRNMALFFSGGN---RQELKLRVT
H0Y018_OTOGA/86-284RQLTWEAPPR-SIRESIETATMSSDCLVFDTNTAQLFAEN-----GDLSIAVT
M1C6R4_SOLTU/36-234RKLTWQGVPR-SIRDSHRKIRDCQDGLIIPRTLAFFFSGGN---GEELTLKV-
K1RDH5_CRAGI/70-266RRLSWEATPR-SIHDGVQSAIVASDCLVFDTNIAQLFADH-----GNLGINVT
Q7QF99_ANOGA/180-384QLLVQRFPCH---SELDPDFLKDGHCAKLALADALRFMADD----KVLHYRVR
H0Y1K4_OTOGA/82-279QRLTWEAPPR-SIRERIETAMMSSDCLIFDNKTAQLFADN-----GELTITVT
A0A1X7V5F7_AMPQE/69-267RKLAWEAKPR-SIHDGISQVISGNDCLIFEPSMAQHFGEN-----GNLAINVT
H0XJR4_OTOGA/82-278RRLTWEATPP-SIREGIVTTIMKSNCLVFDTSLAQLCAGN-----GNLGIIVT
H0XIX1_OTOGA/145-341RRLTWEATPL-SIQEGIATAIMKSDCLVFDTSIAQLFAEN-----GNLGINVT
SINAL_DROME/147-341RTLRWQSKPR-SIRENFSS-FTNADFLVLNKHTVELFSED-----GNLALNV-
G3X7V0_BOVIN/80-277RRLIWEATPL-SIREGIATAFMTSDCLVLDPGVAERFAED-----GNLSIDVT
Q7PZE6_ANOGA/33-226RTVKFVERCN-SDSENLAELLDEERCVSLSHRQVKNYLHE-----GKLHMRYR
H0Y0B7_OTOGA/82-279RRLAWKATPR-SLREGIETAMMNGDCLVFDNNTAQLFVEN-----DELRITVT
H0XK85_OTOGA/82-279RRLTWRATPR-SIREGIETAMMSNDCLVFDTNTAQLFAEN-----NELSITVT
B4LE73_DROVI/110-304RTLKWKSKPR-SIRESFVT-YTNADFLVLNKSTVELFSED-----GNLALNI-
B4QNB8_DROSI/191-380RRLTWEAMPR-SIHEGVASAIHNSDCLVFDTSIAQLFADN-----GNLGINVT
H9JRH4_BOMMO/72-263KRIVYRRPCK---CEKDADFLEHTQNVYIPVENVFSMLDDS----EALNFI--
H0XTM6_OTOGA/82-280RRLTWESTPL-SLREDVETAIMNGDCLVFDNITAQLFAEN-----DELRITVT
M1D5F6_SOLTU/101-299RKLTWQGVPR-SIRDSHKTVRDSLDGLIIQRSMALFFSGGD---RKELKLKV-
E3M5Q1_CAERE/208-407RRMSWEATPR-SIHEGVAFAIQQSDCLAFDTSAAQLFAEN-----GNLGINVT
W1NE48_AMBTC/91-290RKLTWQGVPR-SIRDGHRKVRDSHDGLILQRSLALYFSGGD---RKELKLRIT
T1KZZ1_TETUR/128-324RRLTWEATPH-SIDEGVQSAINLSDCLVFDTSIANLFADG-----ANLGINVT
SINA_SCHMA/167-362RRLTWEACPR-SIHDGVQSAIAVSDCLVFDSNTAHSFAEN-----GNLGINVT
H0XXJ8_OTOGA/83-277RRLAWKATVQ-SIREGIETAMMNSDCLVFDTNTAQLFAEN-----DDLTF---
M4CBD9_BRARP/5-207RKMTWQGVPR-SIRDSHKTVRDSQDGLIITRKLALYFSADNS-NSKELKLKIS
B3RLR7_TRIAD/93-285RRLALESSPI-SINDCIDDAIAVRDCLSVDFVTAKSFSQD-----GNIRLLV-
E0W112_PEDHC/92-276RQFLFKSTMD-DDNRNGSDAFESPNCTVIDFSVLKSFST--------------
B9GYJ4_POPTR/105-304RKLTWQGVPR-SIRDSHQKVRDSQDGLIIQRNLALFFSGGE---RQELKLKVS
M0T9A8_MUSAM/95-294RKLTWEGTPR-SIRDGHRKVRDSHDGLVIQRNMALFFSGGD---RKELKLRVT
D6WZ00_TRICA/55-252RKFKVTEVCD-NDVVKAEDLFRDEKCVSLSFNSVKSYLNDN----GKLPIK--
G1MN92_AILME/82-278RRLTWEATPR-SIHQGIATAVMNSDCLVFDTSVAQHFAEN-----GNLGINVT
I1H5D3_BRADI/95-294RKMIWQGVPR-SIRDSHRKVRDSYDGLIIQRNMALFFSGGE---RKELKLRVT

PF11529

Q1HBK6_MELLI/24-150RHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPKT------------------
Q6R659_MELLI/24-150RSSGVTRCTIQDCHLFENDIPNFPDYIKIKLVPKT------------------
Q1HBK1_MELLI/24-150RSSGVTRCTIQDCHLFANDIPDFPDYIKIKLVPKT------------------

PF00917

TRF1B_ARATH/74-197-FMELPKLKDGF----IDESGCLTIEAK-------------------------
Q93Z83_ARATH/66-193-LIPRSTFYNANEGYLDQDTGSFGAEIFI------------------------
Q940M1_ARATH/102-220-SLSLADLQEAY---LDEDTLNVEIECEV------------------------
DG17_DICDI/327-450-FLLSDLINKENGWLSNDDKLIIEIYIKI------------------------
O76557_CAEEL/290-402-VMRWDEMKDKY---VVDNSIIIEAHVKI------------------------
O16553_CAEEL/149-261-FMRWNIMEENY---IVKDSIIIEARGKI------------------------
O16558_CAEEL/149-261-FIRWDDMENKY---MVNDSVIIGALVKI------------------------
O16559_CAEEL/157-269-FLRWDDMLEKY---TVNDSIIIAALVKI------------------------
O16560_CAEEL/140-252-FIRWDDMEEKY---LVNDSIGVEARVKI------------------------
O16562_CAEEL/108-218-LMRWENWSSR-----CNDNFVFEANVRI------------------------
O17191_CAEEL/289-401-LLRWDNLEEKY---IVNDTLVIEAHVKI------------------------
O17190_CAEEL/289-402-LLRWDSLEEKY---IVNDTLIIEAHVKI------------------------
O76558_CAEEL/284-397-LIRWDSLEEKY---IVDDTLTIEAHVKI------------------------
O76641_CAEEL/14-126-CISWKDLESDY---LVDDSIVVEAHVKI------------------------
O76642_CAEEL/14-126-FLSWKELESDY---VVDDSIVVEAHVKI------------------------
O16551_CAEEL/14-125-FVSWKELESEY---VVDDSIVVEAHVKI------------------------
U4PC47_CAEEL/14-126-FISWEELESDY---VIDDSTIIEAHVKI------------------------
O16555_CAEEL/11-123-FLSWEKFEREY---VVDDSIVIEAHVKI------------------------
O17303_CAEEL/12-125-LISWENMLRDY---VDEDSIIIEIHADI------------------------
O17192_CAEEL/12-124-FISWENMLRDY---VNNDSIIIEIHAD-------------------------
P91300_CAEEL/283-399KVIRWDDMMTDY---VINDSFIIEAHIEI------------------------
O17193_CAEEL/11-126-FMLWEKMMKEF---VVEDTVTVEVCLKI------------------------
O76610_CAEEL/166-276-EIEWEEIADKY---PVDGYLTIEARVNV------------------------
O44817_CAEEL/14-126QFISRNTLKSGY---LVDDIITVEATVKI------------------------
O16567_CAEEL/26-139KLMNWDTLIKDY---LIDDSITIEVTVKI------------------------
O44815_CAEEL/14-128KFISWEMLAKDY---IIDDIIIAEATVKV------------------------
O76568_CAEEL/14-130EFISWNKLIKDY---LIDDVITVEAAVKI------------------------
O17297_CAEEL/14-127KFISWDTLTNDY---LIDDCIIVEITVKI------------------------
BAT15_CAEEL/14-125-FVSWDSLTEDF---LYDNSFTIEACVKI------------------------
O44805_CAEEL/17-135EFISWNELETSF---MEAGSITVEARVLI------------------------
O76611_CAEEL/30-142-ITFFEDIKNKI---FDDDMVYVDVEVTI------------------------
BAT38_CAEEL/86-206-FMAWEDVNNSN--YVRNEMVTVTARVVV------------------------
O45623_CAEEL/38-168-FSNYDQYDTLC---NPKDGYVVNDTIKL------------------------

PF11584

M2URZ2_COCH5/46-160SGQGR-TWKMQLE----------------------------------------
Q0TVA4_PHANO/61-177SDSGRENWRMQLE----------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window