Sequence alignment for CL0401

PF13109

A6Q385_NITSB/623-836--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRFC/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B7VIB8_VIBA3/1027-1268--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
A0A6N4SMJ8_CYTH3/532-755--------------------------------------------------------------------------------
A0A6N4SME1_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_PARXL/1154-1409--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q3IFH7_PSET1/1008-1245--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_DOKS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570MKTARRILILLLVVLIVLP----ATIIALLTTSYANSTWQW-VSPYLGLPIQAERV--------------HYDFPY-HLS
Q9KNJ9_VIBCH/1-570MRKILAIGVAGIALLLILV----LAGFGIMHTRYFTPSAQWIVQQLWPETLRFAKI--------------EYLYPF-KLR
Q9HU38_PSEAE/1-636MKAFGKVLGLFFLGLLLLVVALGFALTHLFDPNDYKDEIRQIARDKANLELDLKGDIG------------WSLFPWLGLE
Q9KT66_VIBCH/1-595MKK----LFISLLGLVVLIVGALLALVLLVNPNQFKPLIVEQAKKQTGLDLVIEGDIG------------WQFFPSIGFE
Q9JY87_NEIMB/8-615HKYRLKYAVAVLTILLLAAVGLHASVYRTFTPENIRSRLQQSIA-HTHRKISFDADIQ------------RRLLPRPTVI
Q9ZDI1_RICPR/1-711MPKALKYSLIIFITIILLL----IIIPFFIPLNNYKGVLIDKVKEATNRNLTINGDIK------------LSLLPTPTIS
Q9HUT4_PSEAE/1-577MTRGRKILTWSLASLVLLLA-ALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFS
YHJG_ECOLI/1-582MSKAGKITAAISGAFLLLIV-VAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVH

PF05359

B2JQ93_PARP8/874-1021--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_ALIF1/399-549--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_PARP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_PARXL/640-791--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_PARP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLAQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
A0A6N4SXE7_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_RHOFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_RHOFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
Q5DZ89_ALIF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
Q1LGA7_CUPMC/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_CUPMC/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_RHOFT/710-857--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_RHOFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
A0A6N4SQC4_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_DOKS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_HYDCU/496-774--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
Q3IFH7_PSET1/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B7VIB8_VIBA3/505-791--------------------------------------------------------------------------------
Q5E7X4_ALIF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
A0A2S9PIN0_YERPE/511-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A6Q385_NITSB/623-836----------------------------------E------------------------------T--------------
C5ZX33_9HELI/638-852----------------------------------D------------------------------E--------------
D3UGW6_HELM1/730-943----------------------------------Q------------------------------R--------------
Q30RQ8_SULDN/697-907----------------------------------D------------------------------I--------------
Q7MRT1_WOLSU/616-829----------------------------------E------------------------------N--------------
Q7VFV2_HELHP/731-944----------------------------------G------------------------------I--------------
O25308_HELPY/745-958----------------------------------D------------------------------R--------------
Q0PAY6_CAMJE/635-848-----------------------------------------------------------------A--------------

PF13502

A0KFB2_AERHH/999-1241--------------------LGEVKGELIP----G--AD-----------------------KLSL--------------
A1S2S6_SHEAM/1130-1371--------------------LGHLVLQGQP----E--PG-----------------------RYNF--------------
A1STZ9_PSYIN/1024-1262--------------------LSPMRLHIFP----N--KK-----------------------NLNI--------------
A1TW53_ACIAC/1117-1369--------------------LGRIEVEAQN----R--GGAG------------AP------REWRL--------------
A1WCZ7_ACISJ/1139-1390--------------------LGRIEIEARN----R--GTEG------------GQ------REWRL--------------
A1WSB5_VEREI/1101-1362--------------------LGQLEMQARN----Q--GTDG-------G-DAGLQ------REWRL--------------
A1WYY8_HALHL/891-1129--------------------AGVGRVRLRP----R--GE-----------------------VLYL--------------
A2U2U5_9FLAO/567-793--------------------LKNVSGIIYV----K--DE-----------------------TINL--------------
A3HUH0_9BACT/675-900--------------------LKEMKGEMLL----K--DG-----------------------ILTF--------------
E0TB83_PARBH/837-1047--------------------LHDLTVSGLF----D--GE-----------------------RVER--------------
A4AMF6_MARSH/560-785--------------------LKNVRGNLRI----V--DE-----------------------KAVL--------------
A4CG41_ROBBH/574-799--------------------LRNVSGNLQI----R--DQ-----------------------ELQL--------------
A4VIB7_PSEU5/1014-1255--------------------LGAWALKLRP----V--GT-----------------------GVEF--------------
A5CF63_ORITB/620-836--------------------IQDFISKFSV----Q--DS-----------------------IIQV--------------
A5FUN1_ACICJ/745-973--------------------ARHASFSLAL----D--QGKL-------------A------PRIAV--------------
A6GWN8_FLAPJ/560-787--------------------LKAVSGKMII----R--DE-----------------------AVTL--------------
A7HEC2_ANADF/581-801--------------------ARNVAVRVRV----K--GD-----------------------EVTF--------------
A9CIC7_AGRFC/884-1105--------------------VTGVSAKLTH----D--AG-----------------------SLSL--------------
A9H3V6_GLUDA/474-684--------------------LTGVHA--HL----E--DN-----------------------GVRL--------------
B7VIB8_VIBA3/1027-1268--------------------VGKVDVEMTR----Q--ED-----------------------RIEW--------------
C1D9M5_LARHH/1015-1258--------------------MGKLTLMSTR----Q--KN-----------------------EWKL--------------
C3L4A9_AMOA5/534-754--------------------GNKIRGRFKI----V--EQ-----------------------QLIA--------------
C4L8L8_TOLAT/989-1232--------------------LGQFRGHLYP----V--KQ-----------------------GGEI--------------
E8RSC3_ASTEC/1136-1358--------------------LVDISAVRTS----Q--DG-----------------------VFSE--------------
D9SHW3_GALCS/1021-1263--------------------LGRFELIGTP----E--GQ-----------------------NWRL--------------
D5CU11_SIDLE/1024-1263--------------------LGKLEMNMSE----S--DG-----------------------DVLL--------------
C6WWM2_METML/1053-1294--------------------LGSLELIAYP----E--ND-----------------------NWDI--------------
C6XD69_METGS/1043-1284--------------------LGRLELQASE----Q--ND-----------------------DWSI--------------
C6XK02_HIRBI/884-1092--------------------LLNSKIVLDM----N--PE-----------------------TLER--------------
C7PC84_CHIPD/564-796--------------------MSNLSGNLLL----K--DE-----------------------TVSM--------------
D2UF54_XANAP/1023-1265--------------------FGAASLRTRK----L--AD-----------------------GMQV--------------
Q0ABM3_ALKEH/1048-1290--------------------LGRLDLRVTP----E--GD-----------------------SARF--------------
Q0AQ38_MARMM/879-1092--------------------LDQFNLIWRS----E--AA-----------------------GIRA--------------
A0A6N4SMJ8_CYTH3/532-755--------------------ASKITSKIEW----N--FP-----------------------YLNF--------------
A0A6N4SME1_CYTH3/698-925--------------------MTNMKGAIIV----R--NG-----------------------IVKM--------------
Q145G0_PARXL/1154-1409--------------------VGRLEVDAHN----F--DEDG-------------V------PVWQL--------------
Q211X0_RHOPB/871-1087--------------------LRPVSGLLRS----D--GG-----------------------SLII--------------
Q28TM9_JANSC/371-572--------------------LSEIDLRSTL----T--RG-----------------------RLVF--------------
Q2KY05_BORA1/936-1183--------------------LGELQLLGTN----TEVGH-----------------------RWRL--------------
Q3IFH7_PSET1/1008-1245--------------------LGKVSASLLG----D--GK-----------------------RLVI--------------
Q5R0H7_IDILO/1003-1244--------------------LGEVELVLAP----L--ED-----------------------GFSI--------------
Q7UYB4_RHOBA/752-985--------------------AGNAHSALVA----T--ANFQ-------S----SK------WSVNF--------------
Q8EA16_SHEON/1025-1268--------------------FGKLVVQASP----Q--AS-----------------------GYRI--------------
Q9ZDH9_RICPR/624-849--------------------FRNVKFYLAN----H--NN-----------------------LLQF--------------
E0SHA8_DICD3/1031-1273---------------------GQVKGTLQP----E--PN-----------------------KLVL--------------
F4AYZ2_DOKS4/566-791--------------------LSNTKGSVTI----A--NE-----------------------QASL--------------
G2J3B5_PSEUL/1018-1258---------------------GKLELHAVQ----S--GK-----------------------DWLL--------------
M1FEQ6_9ALTE/970-1216--------------------LGQWSFLLRP----Q--AG-----------------------GVSI--------------
Q0KCK4_CUPNH/1119-1370----------------------KLEVKAHTGTSSA--DP-----------------------VWTL--------------
Q0VS66_ALCBS/1022-1263--------------------FGQWQAELRP----T--EQ-----------------------GLRI--------------
Q32B94_SHIDS/1009-1252--------------------FGRIDSDITI----S--GN-----------------------TLTL--------------
Q5ZUN8_LEGPH/1014-1261--------------------IGNITLKSHS----T--SE-----------------------QWKI--------------
Q63R38_BURPS/1120-1377--------------------IGRLEVDARN----V--DENG-------------I------PVWQL--------------
Q6LMA6_PHOPR/1035-1276--------------------LGKVSGKLRK----D--NN-----------------------TLVL--------------
Q8P7K3_XANCP/1032-1273---------------------GAATLRSSR----L--TD-----------------------GMQV--------------
Q9KUU5_VIBCH/1028-1269--------------------IGQANVDFQR----Q--GD-----------------------TLLW--------------
Q9PEA2_XYLFA/983-1225--------------------FGRMELRTRH----M--SD-----------------------GMQV--------------

PF05170

Q87TE2_VIBPA/1-570LQNVRSQDAQ----------LPYIEQVDVWLNPDIRRDG-----------------------KWII--------------
Q9KNJ9_VIBCH/1-570LSGVQIASEP----------TIELQQMDLWLNPYGLLEQ-----------------------QLEI--------------
Q9HU38_PSEAE/1-636LHDTSIASAATPTKP-----FADLQMLGLSVRVLPLLRK-----------------------DVQM--------------
Q9KT66_VIBCH/1-595LGKTELKNPQGFASP----NLFKVESVGIDVSVMPLLDK-----------------------QLKI--------------
Q9JY87_NEIMB/8-615LKNLTITEPGGDQT------AVSVQETKIGLSWKNLWSD-----------------------QIQI--------------
Q9ZDI1_RICPR/1-711LSEIKLSSINGAKVP----HLVSVEAVKASLRLFPLFRG-----------------------VIEV--------------
Q9HUT4_PSEAE/1-577AEDITLGNPEWTAGKTKASEFASLERIEFRLAPLPLLWQ-----------------------TIRI--------------
YHJG_ECOLI/1-582AEDIILGNPPDIPEV----TMVHLPRVEATLAPLALLTK-----------------------TVWL--------------

PF05359

B2JQ93_PARP8/874-1021----------------------------------V---------------------------RLHF--------------
Q72DG8_DESVH/963-1109----------------------------------D---------------------------RFTL--------------
A9BMN7_DELAS/883-1036----------------------------------P---------------------------VIKI--------------
Q2LUD1_SYNAS/534-687----------------------------------W---------------------------QYGV--------------
A8ZWF7_DESOH/636-783----------------------------------T---------------------------PIQI--------------
Q3A6W6_PELCD/375-529----------------------------------L---------------------------PLHL--------------
Q5NYY7_AROAE/382-536----------------------------------P---------------------------VFLL--------------
Q2KWF8_BORA1/759-906----------------------------------P---------------------------DMSV--------------
A2SI01_METPP/870-1017----------------------------------P---------------------------QLRW--------------
Q8Y0Z7_RALSO/615-766----------------------------------W---------------------------AVTV--------------
Q5QWM2_IDILO/380-527----------------------------------F---------------------------GITI--------------
Q0VP61_ALCBS/592-737----------------------------------W---------------------------QVTV--------------
Q63NS2_BURPS/645-797----------------------------------W---------------------------RYRI--------------
A0KK00_AERHH/368-522----------------------------------W---------------------------RWSL--------------
Q0JZH1_CUPNH/670-829----------------------------------W---------------------------KADI--------------
Q2LUD1_SYNAS/785-932----------------------------------V---------------------------PIKI--------------
A1ARF1_PELPD/790-937----------------------------------H---------------------------QISI--------------
Q39RS7_GEOMG/568-719----------------------------------F---------------------------RYRI--------------
B9M3X2_GEODF/795-942----------------------------------P---------------------------EIRI--------------
Q8Y0Z7_RALSO/185-339----------------------------------A---------------------------RFVF--------------
Q3JBN6_NITOC/584-731----------------------------------L---------------------------PIAI--------------
Q5DZ89_ALIF1/399-549----------------------------------W---------------------------LVTL--------------
A9BMN7_DELAS/165-317----------------------------------V---------------------------GFAL--------------
A9BMN7_DELAS/379-538----------------------------------W---------------------------KVSL--------------
Q87WR1_PSESM/386-537----------------------------------W---------------------------QVLL--------------
B2JQ93_PARP8/616-770----------------------------------W---------------------------HYSI--------------
A1K6C3_AZOSB/734-881----------------------------------F---------------------------PLRV--------------
Q603H4_METCA/718-865----------------------------------W---------------------------LVTV--------------
Q88DW4_PSEPK/365-516----------------------------------W---------------------------QVLL--------------
A0KK00_AERHH/578-725----------------------------------P---------------------------RVSI--------------
B5ECC6_GEOBB/569-721----------------------------------F---------------------------AYRV--------------
Q2LUD1_SYNAS/159-313----------------------------------M---------------------------RFSL--------------
A4VPN2_PSEU5/551-698----------------------------------L---------------------------AIRI--------------
Q0VP61_ALCBS/382-530----------------------------------W---------------------------VTRL--------------
A1K7K6_AZOSB/583-736----------------------------------W---------------------------SVGV--------------
Q3JBN6_NITOC/369-521----------------------------------W---------------------------RAAI--------------
Q5NYY7_AROAE/832-979----------------------------------P---------------------------PISI--------------
Q13S79_PARXL/640-791----------------------------------W---------------------------HYKI--------------
Q316X0_DESAG/862-1008----------------------------------S---------------------------DVRL--------------
Q602F3_METCA/416-565----------------------------------W---------------------------AFSL--------------
Q2Y5K5_NITMU/673-818----------------------------------L---------------------------PISI--------------
B3E4B8_GEOLS/816-963----------------------------------G---------------------------QIKI--------------
A4VPN2_PSEU5/341-492----------------------------------W---------------------------QVLL--------------
Q5NYY7_AROAE/153-307----------------------------------A---------------------------RFSL--------------
Q30NX8_SULDN/563-715----------------------------------Y---------------------------NVKL--------------
Q5NYY7_AROAE/604-757----------------------------------W---------------------------SFAL--------------
Q602F3_METCA/623-770----------------------------------F---------------------------AVTV--------------
Q316X0_DESAG/389-538----------------------------------F---------------------------SIQL--------------
A5G9K9_GEOUR/137-293----------------------------------P---------------------------RFSL--------------
B2JHK1_PARP8/152-309----------------------------------A---------------------------EKLI--------------
A5G9K9_GEOUR/551-702----------------------------------L---------------------------SYRI--------------
A0KK00_AERHH/151-307----------------------------------L---------------------------LVQI--------------
Q1H1L3_METFK/780-927----------------------------------F---------------------------PVAI--------------
B9M7L7_GEODF/383-534----------------------------------L---------------------------RYGI--------------
A4SXW3_POLAQ/414-561----------------------------------F---------------------------GLDI--------------
B9M3X2_GEODF/564-715----------------------------------F---------------------------HYTV--------------
A4G9D7_HERAR/154-308----------------------------------A---------------------------RFSV--------------
Q21F55_SACD2/584-731----------------------------------M---------------------------ALTI--------------
Q7NY28_CHRVO/704-851----------------------------------P---------------------------QVDV--------------
Q0JZH1_CUPNH/164-317----------------------------------A---------------------------RFSV--------------
B3E4B8_GEOLS/367-514----------------------------------L---------------------------QLMV--------------
Q2IFA1_ANADE/563-710----------------------------------W---------------------------RTAI--------------
A0A6N4SXE7_CYTH3/142-298----------------------------------L---------------------------PIEI--------------
Q9HV64_PSEAE/140-291----------------------------------F---------------------------PLRI--------------
Q3SGZ4_THIDA/733-880----------------------------------F---------------------------PLSV--------------
Q3A6W6_PELCD/162-316----------------------------------F---------------------------GVML--------------
Q316X0_DESAG/600-751----------------------------------W---------------------------SFTV--------------
B9M7L7_GEODF/592-739----------------------------------G---------------------------MIRI--------------
Q222N5_RHOFT/496-646----------------------------------W---------------------------VAVA--------------
Q3A6W6_PELCD/805-951----------------------------------V---------------------------TLGI--------------
A5G9K9_GEOUR/769-916----------------------------------R---------------------------LVRI--------------
A2SI01_METPP/623-775----------------------------------W---------------------------Q--V--------------
Q083W9_SHEFN/492-642----------------------------------W---------------------------LVTL--------------
Q083W9_SHEFN/725-872----------------------------------M---------------------------KLNI--------------
Q12MK5_SHEDO/654-801----------------------------------L---------------------------SFEI--------------
Q3SGZ4_THIDA/517-669----------------------------------M---------------------------ALHL--------------
A1ARF1_PELPD/573-725----------------------------------F---------------------------SYRL--------------
Q39RS7_GEOMG/801-948----------------------------------R---------------------------QIAI--------------
Q603H4_METCA/502-653----------------------------------W---------------------------RYAV--------------
Q222N5_RHOFT/149-300----------------------------------P---------------------------RVIV--------------
A8ZWF7_DESOH/412-569----------------------------------F---------------------------VVDV--------------
A4XYD1_PSEMY/354-505----------------------------------W---------------------------QVLL--------------
Q21F55_SACD2/154-306----------------------------------P---------------------------RIRI--------------
Q3SGZ4_THIDA/147-307----------------------------------V---------------------------RLLV--------------
A7I315_CAMHC/662-807----------------------------------F---------------------------DFTL--------------
Q74FC9_GEOSL/787-934----------------------------------R---------------------------AITI--------------
A7H8M2_ANADF/367-518----------------------------------W---------------------------RWSV--------------
Q5DZ89_ALIF1/610-757----------------------------------F---------------------------ALSV--------------
A4XYD1_PSEMY/562-709----------------------------------L---------------------------AIRI--------------
B3E4B8_GEOLS/583-736----------------------------------L---------------------------SWQV--------------
Q1LGA7_CUPMC/681-840----------------------------------W---------------------------KVRV--------------
B5ECC6_GEOBB/807-954----------------------------------R---------------------------QVSV--------------
Q2IFA1_ANADE/358-509----------------------------------W---------------------------RWSV--------------
A4XYD1_PSEMY/140-291----------------------------------F---------------------------PLRI--------------
A7H8M2_ANADF/165-318----------------------------------P---------------------------RVSI--------------
Q3A6W6_PELCD/588-738----------------------------------W---------------------------QTQL--------------
A7H8M2_ANADF/579-726----------------------------------W---------------------------RTAI--------------
A8ETY5_ARCB4/612-759----------------------------------T---------------------------KLNI--------------
Q30NX8_SULDN/772-919----------------------------------L---------------------------SYKL--------------
A4VPN2_PSEU5/125-276----------------------------------F---------------------------PLRI--------------
Q1LGA7_CUPMC/173-326----------------------------------A---------------------------RFSV--------------
Q1H1L3_METFK/561-712----------------------------------W---------------------------AFDL--------------
Q222N5_RHOFT/710-857----------------------------------F---------------------------PVRI--------------
D0J281_COMT2/165-316--------------------------------------------------------------SFAL--------------
M1FB64_9ALTE/585-727--------------------------------------------------------------IFRI--------------
Q63NS2_BURPS/160-304--------------------------------------------------------------RFSV--------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------RFSL--------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306----------------------------------F---------------------------PLRI--------------
Q88DW4_PSEPK/140-291----------------------------------F---------------------------PLRI--------------
Q88DW4_PSEPK/581-725---------------------------------------------------------------IHI--------------
Q8EDF6_SHEON/666-811---------------------------------------------------------------LDI--------------
Q9HV64_PSEAE/476-627----------------------------------W---------------------------NIVL--------------
Q9HV64_PSEAE/692-837---------------------------------------------------------------IHI--------------

PF04357

A2U1I0_9FLAO/1175-1633--------SK--FTILD---ANRNSLVLSG-KILT-----E-------S-FINPE------FDLQL--------------
Q83EW1_COXBU/570-928--------EG-Y--------SQNQPIQITG-QTRL-------------D-APGRP------TTLTV--------------
Q8YZJ8_NOSS1/1412-1829--------QG--IQATY----NQGLVSASG-NLPIF--ATG----------ETVT------NPLTV--------------
A4CK93_ROBBH/998-1431--------QNIRLTDR----AEGTTAVLDG-TISH-----Q-------F-FSDWR------LNLDV--------------
A3U6I2_CROAH/1185-1647--------DNFKIAD-----EKKNTFTVDG-DVFT-----E-------S-LINPA------FNLSF--------------
A0LGH5_SYNFM/889-1254--------DRAGMK------VLGGHVELTG-RLDY---------------PSFQT------AKLSA--------------
A3HZ37_9BACT/1160-1620--------SQFTVKD-----ADNNTFIVDG-SILT-----N-------D-FTNPE------FDLTL--------------
A5GSG8_SYNR3/973-1387--------ER--FSARS---GE-GSIDGQG-NLA-F--RQE----------GGE-------PGLNF--------------
A6L590_BACV8/1012-1461--------GSLDFRNVKVYDREGHDGLVNG-YLHH-----T-------K-LKNLM------YHFNI--------------
Q2S2D2_SALRD/1057-1516--------RTLRVQD------EEGTATVDG-SILF-----N-------D-YQYFS------FDLSA--------------
Q21Y28_RHOFT/928-1291--------QG--AG--G---ASGGQLSITG-SVLWL---PP-------T-GPDAKVAARLRMELDA--------------
Q6MKB2_BDEBA/958-1321--------NS--INGQI----AGGTLTGDG-GIQI-----N-------G-IKDIP------TTIRA--------------
Q39RU7_GEOMG/1016-1376--------ES--L-RAK---SGAGTLTATA-VIGL-------------D-RWRVA-----SYRGTV--------------
Q7VBL9_PROMA/867-1309--------QT--LTARI---GDKGVVKANG-GMYIF--RDD----------KEIS------KELNL--------------
Q8KFW2_CHLTE/1034-1479--------GR--LEVKD---AENGTGAVSG-MIGL-----D-------G-LKPVT------VNLSG--------------
A6H009_FLAPJ/1018-1446--------RNIKITDS----KYSTKGILSG-GIKH-----H-------N-FGDWF------LDLNL--------------
B5E9K2_GEOBB/1121-1484--------ER--L-RAR---SGEGELVGNL-LVQL-------------N-GREIA-----GYTGTL--------------
Q11I59_CHESB/1185-1538--------RS--ASAAL---AAGGLLSLSG-TIST-----S-------A-AAGFP------ADLML--------------
A0A6N4SQC4_CYTH3/1167-1624--------KSFNILD-----SLNNEAIING-TVGI-----E-------K-FDNAT------FNLTV--------------
A7HQ23_PARL1/1042-1395--------T---MSARD---SGDGRLTGEG-TVSL-----A-------A-DASPA------VDIRT--------------
Q7MT86_PORGI/1036-1486--------TRMRFENMLVSDPDGHTARLNA-HISH-----R-------A-FDDIK------VDLKV--------------
Q3AQ57_CHLCH/1053-1500--------RN--ITLSD---NNNGKGSIRG-FVHL-----E-------K-LQPSR------LELAA--------------
A1BDC7_CHLPD/1048-1494--------RD--LRIAD---LQNGTGSLNG-LLKI-----E-------N-LKPKT------ITLGA--------------
Q2RSJ7_RHORT/1146-1500--------D---LDARD---GGKGRVSLKG-RVLL-----V-------D-LTRPI------GRIDL--------------
Q2S346_SALRD/1311-1689--------EQARLRT-----PNGGSLRADG-TISL-----P-------E-LTVGE------YDLTL--------------
Q2INP6_ANADE/946-1304--------ED--LGALL----NGGHARFTG-EVEL-----A-------R-LAPSR------LRVEG--------------
Q9RUC9_DEIRA/223-627--------DA--RSRSTNPVTGAGTLTLSG-ALTP-------------------R------WDLNL--------------
Q1LSN0_BAUCH/634-981--------QG--FIG-----TTHGQIYLNG-YADW-----C-------N-LHTWH------IYVTL--------------
B3ELK5_CHLPB/1036-1483--------RD--IQIKD---VRGGTGRING-SATL-----E-------N-LEAST------IDLTA--------------
Q8YUC2_NOSS1/1659-2048--------EG--LEGKF----SRGQVQASG-AIPVFD-NSS----------VAIE------NPLTV--------------
Q1MQI4_LAWIP/1025-1382--------SHIQATASD---GKQGSIQLIG-NIGS-------------S-KEHFP------LSING--------------
Q7VQN5_BLOFL/933-1286--------DG--VVNV----MNGGRLYLDGRIINF-----N-------V-IQNFK------ILLNI--------------
Q31MA1_SYNE7/1177-1568--------ET--LSSNF----NGGTLTAQG-ILPIAQLLPA-------S-DPDRE------QPLTI--------------
E3G0N9_STIAD/1177-1560---------E--LFAR----AGAGELKLTA-DAKA-------------T-RGVFE------LTGKT--------------
F4B3D6_DOKS4/1021-1426--------------------KYKTLGALNG-SISH-----K-------S-FSDWK------LDLGI--------------
Q46LW1_PROMT/887-1319---------D--LKANM---GANGIISSQG-GISL----FD-------S-QLSES------EPLAL--------------
TAMB_HAEIN/952-1298----------------------DSHLNLTG-RANW-----A-------N-IEHWT------TELNA--------------
Q5NNB3_ZYMMO/1036-1389---------K--MTGK----AGKGTLTAKG-YASF-----D-------A-ASDYD------SALNI--------------

PF13116

C6XK02_HIRBI/457-744---------KASPQQIIS-YWP---VKLGSGARDWAKRNIK-------D-GRATKLNFFMDFPPGTNSKPI-----VPD-
Q7NW94_CHRVO/514-796---------QIKAARVAA-YLP---RHVGEHTSSWLRQGLQ-------D-GIARNVRMKLAGNLDQ-FPFP-----GGK-
Q7N037_PHOLL/501-786---------VYDAGDAWR-YFPE--PLMGTPLTDYLTASII-------K-GQIENATFVFQGNPKD-FPFA-----KNN-
A4XQL3_PSEMY/513-798---------DGDAAYTEK-YLPSRSPGMSAELDKWLKTAIR-------S-GRVEEGYFQYQGSLNK-GASL-----GARS
Q3J7T7_NITOC/517-810---------KIDLAALPQ-YLPS--PAMKPGLVRWLKQAFP-------Q-GGAAEGSLVFQGPWSH-FPSS-----RDG-
D5CU11_SIDLE/524-805---------RVAVQRTGR-YTPL--PAVNKATHDWLQAALQ-------G-GQADKFRVRLRGDLRD-FPFV-----GNK-
A1AVR0_RUTMC/242-525---------RMNVINISD-YLPM--VLIGDINHQWIKHAFQ-------S-GELDNINISIKKNLSTQLP-----------
Q31FH6_HYDCU/496-774---------PDKLSFVKQ-YLPY--GLMSSKLENWLKAALV-------K-GDGIKGRLRVKGDLND-FPFR-----HQE-
B8GV04_THISH/540-825---------DGDGSRTAA-YLPV--GIMPQNTSRWLRESIK-------A-GRVTEGTVVYRGPFTR-LPFE-----EGE-
Q07WQ4_SHEFN/504-791---------INDVSHLGR-YFPL--MAMSPNLTTYLNDGLV-------A-GQINDAQVVWHGALGD-YPYQ-----DSS-
Q5ZUN8_LEGPH/507-795---------GKNLQKWMP-YLPK--KHMKAKLFAWLNNDIK-------R-LGQATGKITINGMAKD-FPFD-----NGN-
Q7VFV2_HELHP/222-511---------LYNLESIKP-YILK---LNNPTLNNWLFKNVH-------Y-DVLKLHSLRFQSTLNKHFFAQ--------L
Q12IX1_SHEDO/530-817---------VKQAQHLGD-YFPL--AAMSPELVEYLNGAII-------K-GQIPDASVVWHGALSH-YPYE-----DNS-
A6Q385_NITSB/202-483---------NRQLQNLFV-QIPI-----NEEIKSWSCKKIR-------A-KKYRLQFFEGKIDLKKGFDP----------
Q3IFH7_PSET1/493-781---------APDASIAGH-YFPL--KAMSPELVSYLNGAIK-------G-GEVSKAQVLFAGPLTG-FPFS-----DGS-
D9SHW3_GALCS/523-805---------HGEIGHAAR-YIPL--VALDKKDSDWLNDALL-------S-GKTEDFRLRLKGNLSD-FPLN-----GST-
Q21FT5_SACD2/542-827---------ASNASSHRR-YVP---KVVPQALYRWLDKSIQ-------G-GDIKNVGFLYSGSVMK----------DPEV
C6XD69_METGS/519-799---------QADAQYARF-YYP---KILGEHTLAWLDSAIL-------K-GRGQDINVTVKGNLHD-FPYP-----NNK-
A7I2E8_CAMHC/213-497---------AKSIKNFMDEIALK--TDMSRTTKNWIYGNII-------A-DNYEIKKFVAKINLKSGEIFK---------
Q6LMA6_PHOPR/509-794---------ISNAGEAWR-YLPT--LALGHDLTDYLSAAIR-------G-GKADAAQLLWYGELSD-FPYQ-----NNE-
D0L1I5_HALNC/561-853---------DIHVARVPA-YLPR--NLLGKNVLHWLDTNLELPEQGGGQPGRVDRGHFVFNGDPAR-FPFI-----KGG-
A8EUE5_ARCB4/193-478---------FENLKFLKEH------LDLPQEANEWMYNNVT---------GDFKLDWLYGEYDLKKNELVQ---------
C5ZX33_9HELI/208-498---------FKNINFLLP-LLPP---FKNQLLKEWIFNNYQ-------I-TSAQIKEFSLTLPLDSKNLIK-------DS
Q1H0H5_METFK/520-800---------RVDGQYARF-YYP---VMLGEHTLSWLDNAIL-------A-GKSEDVSIIVKGNMRE-FPFA-----DNK-
Q7MRT1_WOLSU/187-475---------FDSLRFLKD-VVEI----ENPNIRAWLYDNIH-------S-PGMELASFSFDSELNEKAILE-------SI
A4G3G0_HERAR/587-887---------GLELNKIGN-YLP---LGMNAQFRTWLSDALI-------A-GTLNDGYIRLKGDLNQ-FPFHTQKAAEKS-
D1B1Z5_SULD5/203-493---------NVELSNFMDFLAPK--VELEQIVKDWIHTNIV-------G-KNYVLHFLEGILDIQTGEYFP---------
D3VKA4_XENNA/501-791---------LDDSGEAWR-YFPK--PLMGESLTNYLTTSLI-------K-GKVDNATLIFQGNPHD-FPFK-----QNN-
Q0ABM3_ALKEH/531-818---------DGDASRTAR-YLPL--RHLPPAAREWVAAAVI-------G-GEVTEARVHWDGPLSG-ERFR-----QGE-
A0KFB2_AERHH/486-771----------KNAANADR-YYPL--QVMDKSLVDYLSGAIK-------G-GKAKGADLLWYGEFRD-FPYR-----KGE-
A6TER2_KLEP7/497-781----------NDGGQAWR-YFPE--NLMGKALVDYLSGAIK-------A-GQASDATLVYGGNPHL-FPYP-----HNE-
B7VIB8_VIBA3/505-791----------YNVGETWR-YLPT--LALGQDLTDYLSTAIQ-------A-GKADTVKLLWHGELAQ-YPYT-----NHD-
Q5E7X4_ALIF1/495-780----------FNADQTWR-YLPT--LALGQDLTDYLSAAVQ-------G-GNAKTVQLLWYGELND-FPYT-----KYD-
Q6DAI1_PECAS/504-784----------TDAADAWR-YYPE--LFMGTDLVDYLSGALK-------G-GRVDNATLIFAGNPQH-FPYT-----HSE-
A0A2S9PIN0_YERPE/511-794----------YDATDAWR-YFPV--SLMGEKLADYLTEALQ-------G-GQVDNATLVYNGNPHD-FPYK-----NKE-
Q83BN5_COXBU/480-760----------KNINAIKN-YLPS--RGLSPHLRAWLNQAFS-------T-GEITSGTVNFKGPLDR-FPFL-----HQE-
Q8ZLP4_SALTY/504-786----------DDGSQAWR-YFPE--NLMGKALVDYLSGAIQ-------G-GEADNATLVYGGNPHL-FPYK-----HNE-
Q9KUU5_VIBCH/504-791----------FNAGETWR-YLPT--LALGRELTDYLSTAIQ-------A-GQVNTAKLIWYGALDQ-FPYR-----MHN-

PF13109

A6Q385_NITSB/623-836-----IH--FSGNYGPTRY---------------------V-FM---YQN------------------------------
C5ZX33_9HELI/638-852-----LK--ATLKHKNGQA---------------------Q-IY---KKG------------------------------
D3UGW6_HELM1/730-943-----TL--ASLTYKNGIA---------------------N-VD---FLD------------------------------
Q30RQ8_SULDN/697-907-----FS--AELKYKAGKA---------------------T-FL---SKN------------------------------
Q7MRT1_WOLSU/616-829-----IS--ATLSYKNGTL---------------------K-AN---LQN------------------------------
Q7VFV2_HELHP/731-944-----IR--ADVTYGNGVA---------------------N-VD---MAY------------------------------
O25308_HELPY/745-958-----VK--IDGNYKNAMI---------------------M-AD---LVH------------------------------
Q0PAY6_CAMJE/635-848-----LD--LKGSRGNAKF---------------------D-LY---YSS------------------------------

PF13502

A0KFB2_AERHH/999-1241-----KG--LEMRLAGSQL-N-----G-------------S-AE---WLA------------G----------ADGM-Q-
A1S2S6_SHEAM/1130-1371-----QT--LSLSSGAATL-K-----G-------------Q-GG---WLM------------D-----------V-N-Q-
A1STZ9_PSYIN/1024-1262-----NY--IKIGNEKEFT-E-----I-------------S-GV---WDQ--------------------------Y-K-
A1TW53_ACIAC/1117-1369-----SK--LNLTVPEATF-T-----S-------------S-GN---WVL-L----------G----------GG-A-TA
A1WCZ7_ACISJ/1139-1390-----SK--FNLTAPEAVL-T-----S-------------Q-GH---WAL-V----------GS-------GAQAQR-R-
A1WSB5_VEREI/1101-1362-----TR--FNLLTPEASL-S-----A-------------Q-GNWARLNA------------TG-------PGA----GP
A1WYY8_HALHL/891-1129-----DE--ASIRGPTLHL-V-----T-------------S-GE---WRS------------T---------------G-
A2U2U5_9FLAO/567-793-----QN--LNSDVFGGKI-G-----F-------------N-GN---VST------------K----------NNAS-T-
A3HUH0_9BACT/675-900-----RD--ASMSTMGGRI-A-----L-------------T-GS---YDS------------RD--------LST-P-K-
E0TB83_PARBH/837-1047-----LI--ADGRLGEGTF-A-----S-------------R-LA---PAG------------E---------------G-
A4AMF6_MARSH/560-785-----TD--VTSSLFNGNV-S-----F-------------D-GE---VST------------K----------NQLP-N-
A4CG41_ROBBH/574-799-----RD--VRSDALDGKL-A-----L-------------N-GT---VAT------------G----------EGLP-R-
A4VIB7_PSEU5/1014-1255-----HD--LALQLKGLRI-S-----G-------------N-GG---WGA------------G----------QS-----
A5CF63_ORITB/620-836-----KD--INCRIDNGEF-Q-----A-------------K-GS---ILM-----------------------SP-L-A-
A5FUN1_ACICJ/745-973-----TL--NRAEVVGGRL-S-----G-------------R-AI---LTG------------AA--------GSTPA-T-
A6GWN8_FLAPJ/560-787-----QN--IKTNIFDGQI-G-----L-------------S-GL---VST------------K----------GKVP-T-
A7HEC2_ANADF/581-801-----EQ--ARLEAFGGAV-S-----A-------------A-GTH-LAVA------------R----------PD-A-P-
A9CIC7_AGRFC/884-1105-----DD--VAGTFMGGKL-A-----G-------------R-LA---MST------------G----------EG-AGI-
A9H3V6_GLUDA/474-684-----TR--MRFAMAGPSP-A-----S----------AILT-PE---SDG------------R----------HLWASV-
B7VIB8_VIBA3/1027-1268-----NK--IQVRSGGNKA-D-----I-------------S-GW---WEL------------Q----------GDKS-H-
C1D9M5_LARHH/1015-1258-----DR--FQLSNGDGQI-N-----L-------------R-GV---QRT------------Q----------DGQM-R-
C3L4A9_AMOA5/534-754-----DA--IELIFAGGKA-R-----L-------------A-GS---IST------------K----------ADSL-E-
C4L8L8_TOLAT/989-1232-----RD--LHWQVANSHF-D-----G-------------Q-AG---WSI------------K----------NYQP-L-
E8RSC3_ASTEC/1136-1358-----VE--LKAGWDGRNLIA-----G-------------E-GS---ALT------------R----------LG-S-L-
D9SHW3_GALCS/1021-1263-----RR--LHITNPDGTL-T-----G-------------D-GL---WRS------------E----------QTSM-Q-
D5CU11_SIDLE/1024-1263-----DN--LQLVNPDGVL-S-----M-------------S-GK---WQA-----------------------KP-E-Q-
C6WWM2_METML/1053-1294-----QK--IKFNTPEGTI-S-----A-------------E-GQ---WNN-W----------V----------RN-A-N-
C6XD69_METGS/1043-1284-----EK--LKIINPDSTL-T-----A-------------E-GE---WHN------------W----------KRNP-N-
C6XK02_HIRBI/884-1092-----GL--VSGTISRGKGVE-----A-------------T-FE---RDG------------G-----------------
C7PC84_CHIPD/564-796-----QQ--IKANALQGNM-E-----V-------------N-GS---YST------------KN--------SKTNP-D-
D2UF54_XANAP/1023-1265-----DQ--LHLRSDQQQI-D-----I-------------S-GD---WRG------------K----------GAAA-H-
Q0ABM3_ALKEH/1048-1290-----ES--IRLDTPSFAL-Q-----G-------------D-MA---WHY------------R----------DGGH-R-
Q0AQ38_MARMM/879-1092-----VS--VSGNAFDGPF-Q-----A-------------S-FG---ASE------------T----------GG-Q---
A0A6N4SMJ8_CYTH3/532-755-----TN--SNLIFCNGFY-S-----G-------------K-TA---LRILN----------E----------KT-V-E-
A0A6N4SME1_CYTH3/698-925-----DK--LNFNSLGGSF-L-----F-------------S-GD---YNT------------QD--------ITK-P-S-
Q145G0_PARXL/1154-1409-----DK--LDITNPAATL-S-----A-------------T-AN---WRT------------STDL----GSSA----DE
Q211X0_RHOPB/871-1087-----DK--LTGKIGGGDA-V-----G-------------D-IA---VRR------------S----------ADGV-A-
Q28TM9_JANSC/371-572-----DI--ASIRTYEGQL-A-----G-------------Q-FV---ING------------R----------GG-L-S-
Q2KY05_BORA1/936-1183-----DK--LQIRNDDATL-N-----A-------------T-GE---WRL------------A----------GEQR-G-
Q3IFH7_PSET1/1008-1245-----SE--LVVDKNDHIL-R-----T-------------H-GQ---WQN------------G---------------Q-
Q5R0H7_IDILO/1003-1244-----EK--MALKKGSDEL-A-----V-------------T-GY---WRY------------T----------DEQA-L-
Q7UYB4_RHOBA/752-985-----PS--VRSRVGGGQL-E-----G-------------G-LL---LSS------------G---------RSGGV-D-
Q8EA16_SHEON/1025-1268-----QT--LSLTTPEVSL-Q-----G-------------N-GI---WQQ------------Q----------NGQN-Q-
Q9ZDH9_RICPR/624-849-----NN--IEAELLGGKF-Q-----G-------------S-GN---ILL-----------------------EP-Y-S-
E0SHA8_DICD3/1031-1273-----AN--GLVDNGKAKL-T-----L-------------D-GS---WQE------------S----------GEGT-R-
F4AYZ2_DOKS4/566-791-----SN--LNSGIFGGAA-G-----L-------------S-GS---VTT------------R----------DGAP-T-
G2J3B5_PSEUL/1018-1258-----DR--FVLRSDSGLL-Q-----G-------------A-AR---ASD------------G----------VT-P-R-
M1FEQ6_9ALTE/970-1216-----ES--IEGKLESLAL-A-----G-------------E-FN---WLL------------Q----------GQNQ-V-
Q0KCK4_CUPNH/1119-1370-----EK--LQIEQPGATL-T-----G-------------S-GS---WRV------------PRQL---RADANAER-R-
Q0VS66_ALCBS/1022-1263-----ND--LQGRWRASRI-L-----G-------------T-VD---WTE------------D----------DGAQ-Y-
Q32B94_SHIDS/1009-1252-----TN--GLIDTGFSRL-T-----A-------------D-GE---WIN------------N----------PGNE-R-
Q5ZUN8_LEGPH/1014-1261-----DY--CRIDSPYYQA-N-----F-------------E-GE---WLQ------------K----------GKFN-Q-
Q63R38_BURPS/1120-1377-----DK--LELANPAAKL-T-----A-------------T-AN---WRT------------SRRALAHGADEEDAPRR-
Q6LMA6_PHOPR/1035-1276-----QN--LQVKSGATAL-N-----L-------------D-AH---WTL------------D----------GDQN-E-
Q8P7K3_XANCP/1032-1273-----DQ--LQLRSDDQNI-G-----L-------------T-GA---WRG------------K----------GEAA-S-
Q9KUU5_VIBCH/1028-1269-----KS--IDFTSGTNQL-H-----V-------------N-GT---WTL------------T----------DTQS-R-
Q9PEA2_XYLFA/983-1225-----DQ--LQTNSPSQRL-S-----M-------------F-AT---WRG------------K----------GEAA-S-

PF05170

Q87TE2_VIBPA/1-570-----DS--LLIDGVSLKKGI-----P----------TQPN-L------ESI----------Q----------FHQIALK
Q9KNJ9_VIBCH/1-570-----DS--VLIDGANLAHGL------------------PN-FT---LPESV----------H----------LNQLALH
Q9HU38_PSEAE/1-636-----SA--IRVEGLSLDLVR-----D----------KQGK-GN---WENIG----------K----------PAQPQAP
Q9KT66_VIBCH/1-595-----GN--IRLDGAEFHLET-----L----------KDGR-SN---LDALT----------Q----------AQSKPAS
Q9JY87_NEIMB/8-615-----EK--WVVSSAELALTR-----D----------GKGV-WN---IQDLI----------D----------SQKRQAS
Q9ZDI1_RICPR/1-711-----AL--IELQKPTISLEV-----L----------DNGQ-KS---WQLYI----------S----------NNNNTIN
Q9HUT4_PSEAE/1-577-----PQ--IKLTQPRAELLR-----L----------ADGR-AN---WDFDL----------P----------ASDSDEP
YHJG_ECOLI/1-582-----PW--IKLEKPDARLIR-----L----------SEKN-NN---WTFNL----------A----------NDDNKDA

PF05359

B2JQ93_PARP8/874-1021-----GQ--LVLQNGRVNYTD-----N----------FIKP-NYS--ANL------------------------------
Q72DG8_DESVH/963-1109-----GE--VTVRGGKIAFRD-----E----------RFSP-AFD--TSL------------------------------
A9BMN7_DELAS/883-1036-----GP--IVLTGGRVQFSD-----Y----------FIQP-NYS--ADL------------------------------
Q2LUD1_SYNAS/534-687-----KK--VALNDIGVHWED-----Q----------MPSAGTAE--IGI------------------------------
A8ZWF7_DESOH/636-783-----GR--FLMNNTELKFAD-----R----------SVDP-HYA--TRL------------------------------
Q3A6W6_PELCD/375-529-----KR--FELRDARLLWQD-----Q----------KVKG-GFK--AEA------------------------------
Q5NYY7_AROAE/382-536-----DE--AKISGATVRFED-----R----------AASA-PFR--TEL------------------------------
Q2KWF8_BORA1/759-906-----NS--VTLKRGRMSFTD-----R----------FVQP-NYT--AEL------------------------------
A2SI01_METPP/870-1017-----RE--IRLAGGTVDFTD-----N----------FIRP-NYS--AKL------------------------------
Q8Y0Z7_RALSO/615-766-----QA--LRLDNGAIGFED-----Q----------TNSR-PVK--VRV------------------------------
Q5QWM2_IDILO/380-527-----EG--VELSDGDVQFAD-----K----------SLPL-PFS--TSI------------------------------
Q0VP61_ALCBS/592-737-----DK--LRLVGSQVRHED-----L----------SLSP-HFR--IGL------------------------------
Q63NS2_BURPS/645-797-----DE--LNVKDAKANFTD-----R----------STPR-PVK--LAI------------------------------
A0KK00_AERHH/368-522-----KQ--TRIEQGQLKLTE-----S----------SSGKPLL---REL------------------------------
Q0JZH1_CUPNH/670-829-----GK--VTVEGGSARLADYQPAGA----------NRGR-PVI--HQF------------------------------
Q2LUD1_SYNAS/785-932-----NR--VTLQGGRVNFSD-----R----------FIKP-NYN--ANL------------------------------
A1ARF1_PELPD/790-937-----GA--VTIQDGTIAFSD-----H----------HLRQ-QFT--STF------------------------------
Q39RS7_GEOMG/568-719-----AS--VAASGLGLTFTD-----R----------KAVG-NPR--FDL------------------------------
B9M3X2_GEODF/795-942-----DT--VTLQEGTVSFLD-----Q----------HTPQ-QFG--TTM------------------------------
Q8Y0Z7_RALSO/185-339-----AN--LQLNNGAIQFVD-----Q------------PL-GAQ--HTV------------------------------
Q3JBN6_NITOC/584-731-----NS--IRIKKGSANFAD-----L----------SVSP-KFS--MGI------------------------------
Q5DZ89_ALIF1/399-549-----DG--IEIKDYQLNVEE-----K----------VITKKANL--WQI------------------------------
A9BMN7_DELAS/165-317-----YN--IALRDGRVELQD-----E------------VQ-RRQ--HML------------------------------
A9BMN7_DELAS/379-538-----DR--LSVAHATVHWRD-----A----------APDAGKSGAALQA------------------------------
Q87WR1_PSESM/386-537-----RD--VQLRNYTVHLTD-----R----------VPKE-PVA--LDV------------------------------
B2JQ93_PARP8/616-770-----AE--LNLKNGAATFTD-----N----------TTAR-PVK--VAV------------------------------
A1K6C3_AZOSB/734-881-----ER--VELRDGIVEFAD-----F----------SLVL-PFS--TRV------------------------------
Q603H4_METCA/718-865-----EA--VRVEKGDIDFSD-----G----------SLVL-PFA--THI------------------------------
Q88DW4_PSEPK/365-516-----KD--VQLRNYLVHLAD-----R----------SQKE-PVA--LDI------------------------------
A0KK00_AERHH/578-725-----AQ--VRTEQGNLRFAD-----R----------SLSP-EFV--VDI------------------------------
B5ECC6_GEOBB/569-721-----QR--LQLDGFKLAFTD-----K----------TYEE-PPR--FTL------------------------------
Q2LUD1_SYNAS/159-313-----NN--IRITQGRIEFDD-----R------------PK-YRR--HEI------------------------------
A4VPN2_PSEU5/551-698-----GG--INIADGSANFAD-----F----------SLRP-PFV--TAI------------------------------
Q0VP61_ALCBS/382-530-----DN--LAIEGNTLRLTD-----R----------TLNPAQT---MTL------------------------------
A1K7K6_AZOSB/583-736-----QK--LALSDASLRLED-----R----------MQAK-PVT--LAV------------------------------
Q3JBN6_NITOC/369-521-----KK--IKVENVSASLQD-----R----------TIEP-PAT--LNI------------------------------
Q5NYY7_AROAE/832-979-----GK--ILIKQGNIAFSD-----R----------FIRP-NYD--ANL------------------------------
Q13S79_PARXL/640-791-----GE--LVLKDATANFTD-----N----------TTPQ-PVK--LNI------------------------------
Q316X0_DESAG/862-1008-----GG--AFISDGTVHFRD-----V----------SVSP-PFE--LTL------------------------------
Q602F3_METCA/416-565-----GE--GVIRNYRLNLAD-----H----------GVDP-PAR--IGL------------------------------
Q2Y5K5_NITMU/673-818-----GR--IVMQGGHVNFQD-----Q----------FIQP-NYR--AYL------------------------------
B3E4B8_GEOLS/816-963-----DT--LTVQDGTIAFSD-----V----------HLPQ-QFR--STF------------------------------
A4VPN2_PSEU5/341-492-----HD--AQLRDYRMHLAD-----R----------VPDD-EVQ--LEL------------------------------
Q5NYY7_AROAE/153-307-----NN--IRVIDGKLLVED-----R----------PVGL---E--HEL------------------------------
Q30NX8_SULDN/563-715-----DS--FDMNGAKLLFDD-----K----------SIQD-NSK--TII------------------------------
Q5NYY7_AROAE/604-757-----ER--LAFDDWAVRFED-----R----------TQGA-PIV--LQA------------------------------
Q602F3_METCA/623-770-----GS--LLVRDGSADFSD-----L----------SLQP-SVS--VDI------------------------------
Q316X0_DESAG/389-538-----DA--ASVTGGSVALHD-----N----------MVEG-GFN--HTF------------------------------
A5G9K9_GEOUR/137-293-----NN--IAVTNGSIDFID-----R----------GLPV-EKL--HAL------------------------------
B2JHK1_PARP8/152-309-----DH--IAFADGRFVFYD-----E----------TISKPPYK--VVV------------------------------
A5G9K9_GEOUR/551-702-----GR--VSGAGMNIVFTD-----G----------LLEE-RPS--FVL------------------------------
A0KK00_AERHH/151-307-----NQ--LAAEQGHITYQD----SR----------KQSSPGWVPSLTL------------------------------
Q1H1L3_METFK/780-927-----ER--IRIDNANLEFAD-----L----------SLTP-QFG--THI------------------------------
B9M7L7_GEODF/383-534-----GR--ISGTGVNVVFTD-----E----------MLAG-RPS--FTF------------------------------
A4SXW3_POLAQ/414-561-----KT--LGMKNGEVFFTD-----L----------AMRP-NFK--VDI------------------------------
B9M3X2_GEODF/564-715-----SS--VVGKGIDVSFRD-----E----------ARSS-APR--FDL------------------------------
A4G9D7_HERAR/154-308-----FN--IELDKGRIEFDD-----R------------PA-QTV--HKI------------------------------
Q21F55_SACD2/584-731-----GK--IEILQSAGHFAD-----L----------SLPL-PFD--THI------------------------------
Q7NY28_CHRVO/704-851-----HS--IHVQNGAVEFAD-----H----------GMTP-DFA--TRM------------------------------
Q0JZH1_CUPNH/164-317-----NN--IAVTGSSFGYDD-----K------------QL-GSS--LRV------------------------------
B3E4B8_GEOLS/367-514-----EN--LALTDGAVSFHD-----R----------QPAG-GFK--SRL------------------------------
Q2IFA1_ANADE/563-710-----GS--VEVVGGRVALVD-----R----------SVTP-AAV--VNL------------------------------
A0A6N4SXE7_CYTH3/142-298-----NR--FEIHNGKIKYND-----F----------HASP-KVD--IFV------------------------------
Q9HV64_PSEAE/140-291-----DR--IQLAEGSLHFQD-----L----------RPSE-PVD--FSF------------------------------
Q3SGZ4_THIDA/733-880-----GR--LRITGANAEFAD-----L----------SLTP-QFG--TVM------------------------------
Q3A6W6_PELCD/162-316-----TD--LEITGGLIHFRD-----D----------IRV---TE--HTV------------------------------
Q316X0_DESAG/600-751-----QK--AALQNSECVLLD-----E----------TLPR-AAR--LTV------------------------------
B9M7L7_GEODF/592-739-----GT--ITMQSGTLSFTD-----R----------HVAG-GYT--TTF------------------------------
Q222N5_RHOFT/496-646-----KT--VELSKFGADVAD-----E----------GAG---VK--VQV------------------------------
Q3A6W6_PELCD/805-951-----GG--LQISDANLVMRD-----E----------RYQP-AVI--NRL------------------------------
A5G9K9_GEOUR/769-916-----DT--VTMQDGTLAFTD-----R----------YVPR-EYS--TIL------------------------------
A2SI01_METPP/623-775-----GE--LSCSNCRVTLSD-----R----------SVKP-VAV--FGV------------------------------
Q083W9_SHEFN/492-642-----DK--ISIAQYQVKLGE-----G----------IASDKIIL--WQI------------------------------
Q083W9_SHEFN/725-872-----NK--IGFTDSSAFFAD-----N----------SLTP-NFA--SGI------------------------------
Q12MK5_SHEDO/654-801-----ER--IRFDKSSAFFAD-----N----------SLNP-NFS--SGI------------------------------
Q3SGZ4_THIDA/517-669-----GR--LGLNDIAVEVVD-----R----------SPPT-PVR--LDV------------------------------
A1ARF1_PELPD/573-725-----RR--FQTDRLNLAFTD-----K----------SREE-KPR--FTL------------------------------
Q39RS7_GEOMG/801-948-----DT--VILQEGTLAFSD-----H----------HMSR-EYD--TTF------------------------------
Q603H4_METCA/502-653-----QQ--FVLEDFGLALAD-----R----------TFAP-AIA--YDL------------------------------
Q222N5_RHOFT/149-300-----EQ--LALEQGTVDMHD-----R----------RAGY---D--NTF------------------------------
A8ZWF7_DESOH/412-569-----DR--FVLTGGTARFVDFAVAGP----------EDGPVEN----AI------------------------------
A4XYD1_PSEMY/354-505-----QD--VQLRDYKAHLAD-----R----------VPQQ-EVA--VDV------------------------------
Q21F55_SACD2/154-306-----SD--IQFSIARIDLLD-----Q----------VPAT-PFA--TQL------------------------------
Q3SGZ4_THIDA/147-307-----DH--IRIADGRVAYRD-----A----------NRAGEPFT--ALL------------------------------
A7I315_CAMHC/662-807-----KN--IKLLGGEIDFID-----H----------SLMI-PFD--IKI------------------------------
Q74FC9_GEOSL/787-934-----GA--VTMQAGTLDFSD-----R----------HMPK-PYA--TTF------------------------------
A7H8M2_ANADF/367-518-----GA--LAVTGLAVELED-----R----------TPAR-PVV--LPL------------------------------
Q5DZ89_ALIF1/610-757-----RK--IAFNNGSAFFAD-----N----------SLTP-NFS--SGI------------------------------
A4XYD1_PSEMY/562-709-----GG--VAINDGSANFAD-----F----------SLTP-SFA--TAI------------------------------
B3E4B8_GEOLS/583-736-----KK--INVTGLSTTFAD-----K----------QFSE-PPV--FTL------------------------------
Q1LGA7_CUPMC/681-840-----GK--MAVDGGSARLADYEPAEA----------NRGR-PVI--HQF------------------------------
B5ECC6_GEOBB/807-954-----GS--VTIQNGTLSFTD-----N----------HLPQ-TFN--STF------------------------------
Q2IFA1_ANADE/358-509-----GA--LAVSGLAVDVED-----R----------STAR-PVR--LPL------------------------------
A4XYD1_PSEMY/140-291-----DN--LHLREKALHFQD-----L----------RPSE-PVE--FAY------------------------------
A7H8M2_ANADF/165-318-----GR--LAVEEASVTFRD-----A----------TRRP-AFD--TLL------------------------------
Q3A6W6_PELCD/588-738-----AE--LKLVDGQISIGL-----E----------GPRQ-TST--AVF------------------------------
A7H8M2_ANADF/579-726-----GA--VQVVRGRASFVD-----R----------SVSP-PAL--VNV------------------------------
A8ETY5_ARCB4/612-759-----GP--VNIKNAVLDFED-----K----------NLPI-PFK--TTV------------------------------
Q30NX8_SULDN/772-919-----LN--LKVTNGSANFAD-----Y----------SLPL-DFK--TAI------------------------------
A4VPN2_PSEU5/125-276-----DQ--LQLVRGHLAFRD-----R----------RPSE-PIE--LVY------------------------------
Q1LGA7_CUPMC/173-326-----SN--IAVTNTSFVYED-----K------------LL-NTV--QRV------------------------------
Q1H1L3_METFK/561-712-----KR--FAIEDAGLHFRD-----Q----------SANS-PVA--LDI------------------------------
Q222N5_RHOFT/710-857-----RR--LRLQNAKLDFTD-----L----------SLRP-QFS--AKI------------------------------
D0J281_COMT2/165-316-----YN--IALRDGRIELND-----E----------FVQR---K--HEL------------------------------
M1FB64_9ALTE/585-727-----GE--LQLDNADVDYTD-----R----------TLKP-ELT--TRF------------------------------
Q63NS2_BURPS/160-304-----SN--IQVNDGRIEFDD-----R------------LL-NAR--HVV------------------------------
Q7VVF7_BORPE/156-309-----NN--MVLEGGEITLDD-----K----------VSG---RQ--QRI------------------------------
Q7VVF7_BORPE/538-685-----EG--AALRLSDLSLRD-----E----------SVKP-AVP--VSV------------------------------
Q87WR1_PSESM/155-306-----GE--IKLADGYVHFQD-----V----------RPSE-PIE--FLY------------------------------
Q88DW4_PSEPK/140-291-----GS--IKLIDGYLHFED-----L----------RPSE-PIE--FLY------------------------------
Q88DW4_PSEPK/581-725-----GQ--IDINDGSANFAD-----L----------SLTP-NFA--TAI------------------------------
Q8EDF6_SHEON/666-811-----QK--ISFNQGSAFFAD-----N----------SLTP-NFA--SGI------------------------------
Q9HV64_PSEAE/476-627-----RD--AQLRGYKAHLVD-----R----------QPAT-EVP--LEV------------------------------
Q9HV64_PSEAE/692-837-----GG--VRINNGSANFAD-----L----------TLMP-PFG--TAI------------------------------

PF04357

A2U1I0_9FLAO/1175-1633--RA-KD--FRLLNAKKEDNPSLYGLA----------T-F-NAN---ADLTG--DL-----QI-----------------
Q83EW1_COXBU/570-928--HG-EN--LLIVNTHQYI-------I----------Y-G-SGE---LKIDI--VD----R-N-----------------
Q8YZJ8_NOSS1/1412-1829--AIQNQ--LNFQVAGLYT-------G----------D-V-SGN---AVIRG--TA----L-R-----------------
A4CK93_ROBBH/998-1431--DT-QGERFLLLNTEYDEEE--LYYG----------TAFAEGT---GRIFG--PT----N-A-----------------
A3U6I2_CROAH/1185-1647--KA-KD--FKVLNSTKEDND--LYYG----------TAIFDLD---ATLNG--DL----E-L-----------------
A0LGH5_SYNFM/889-1254--SG-RD--LRVSKVYGIE-------G----------K-I-SGK---ADLSR--TP-----QG-----------------
A3HZ37_9BACT/1160-1620--LA-KN--FMVVNSTDKDNE--LVYG----------RGTIDAD---VSIKG--DL----N-L-----------------
A5GSG8_SYNR3/973-1387--TI-KA--FPIRRPDA-R-------L----------Q-V-DGS---LKLQG--SL----R-Q-----------------
A6L590_BACV8/1012-1461--RG-NN--LLMYNTYEAGNM--PFYG----------KVYGTGN---VVLDGGNN-------A-----------------
Q2S2D2_SALRD/1057-1516--SL-DG--ITVIDVSQAEDL--PFYG----------RIRGSGP---LHLNG--PL----P-D-----------------
Q21Y28_RHOFT/928-1291--TL-AA--LRVSARADRR-------L----------V-V-SGQ---LSARL--NE----S-K-----------------
Q6MKB2_BDEBA/958-1321--RL-EG--VTFNVPDKVR-------S----------S-G-SAD---LLFSGRWFP------------------------
Q39RU7_GEOMG/1016-1376--TG-DR--FQTVNIPEVQ-------M----------L-A-TPK---LTFEG--TP----A-K-----------------
Q7VBL9_PROMA/867-1309--VI-KS--IEFDQNNF-D-------F----------K-V-SSN---LNVKG--SI----L-Q-----------------
Q8KFW2_CHLTE/1034-1479--SF-SN--LLLYNKKDMKDD--TSFG----------T-I-RGTTGNLRFYG--EL----S-A-----------------
A6H009_FLAPJ/1018-1446--AS-NR--LLALDTKDAEEV--LYYG----------TAFIDGD---ATIKG--PT----N-G-----------------
B5E9K2_GEOBB/1121-1484--SG-QG--FQTVYLPELR-------M----------T-T-SPQ---LTFKG--EG----D-R-----------------
Q11I59_CHESB/1185-1538--RL-NE--ARYADGEMVT-------A----------T-V-SGG---LQLTG--PI----TRD-----------------
A0A6N4SQC4_CYTH3/1167-1624--TT-ND--FMILNTTAVNNK--LYYG----------RVFLDSK---ISIRG--DQ----N-L-----------------
A7HQ23_PARL1/1042-1395--QF-SD--MQVVRRQDLV-------L----------A-V-NGA---LALTA-PALPPSLDQP-----------------
Q7MT86_PORGI/1036-1486-SEA-RN--ILAYNVPERDNP--NIHG----------RVYVSGAAYLRDVPG----------G-----------------
Q3AQ57_CHLCH/1053-1500--SC-NN--LLFYNKKDQQDD--TSFG----------S-I-VGSTRNFTLTG--SL----R-S-----------------
A1BDC7_CHLPD/1048-1494--NL-SK--LLLFHKKDTRDE--KPFG----------T-I-IGSTRNLLLNG--DI----S-S-----------------
Q2RSJ7_RHORT/1146-1500--DI-TQ--AVVVRRDDAV-------A----------E-I-SAD---LAMVL--AA-----DQ-----------------
Q2S346_SALRD/1311-1689--NA-SE--FLAINTAAYR-------R----------A-VIDGD---MTLRG--TV----R-R-----------------
Q2INP6_ANADE/946-1304--AL-DE--VPVALPSYLP-------A----------T-L-SGR---IEARG--TP----E-A-----------------
Q9RUC9_DEIRA/223-627--SA-RNYNLPVSAIYARE-------S----------A-L-TGD---FRLRD--SG----D-F-----------------
Q1LSN0_BAUCH/634-981--KG-NK--IRIYMPSMRF-------D----------V---SPN---IIFEAKPNL------------------------
B3ELK5_CHLPB/1036-1483--SF-EN--LLLFNKQDKKDE--TSFG----------T-I-TGTSDRIRYYG--DT----A-Q-----------------
Q8YUC2_NOSS1/1659-2048--NL-EQ--LQLNLKGLYQ-------G----------G-A-NGN---IQVTG--SA----L-N-----------------
Q1MQI4_LAWIP/1025-1382--SF-TN--LAPLQRKDLS-------L----------T-L-SGA---ATLEG--TL-----KQ-----------------
Q7VQN5_BLOFL/933-1286--QG-NQ--VDFYLSPTMY-------V----------K-I-FPK---LTCTI--TV----N-T-----------------
Q31MA1_SYNE7/1177-1568--AL-RD--ATIALPNLFT-------G----------K-T-EAD---LQILG--SA----L-E-----------------
E3G0N9_STIAD/1177-1560--HL-KD--FPIISDDQLL-------A----------V-V-SLD---STLAG--TL----SAQ-----------------
F4B3D6_DOKS4/1021-1426--SA-TR--IAVLDTEEDLES--LYYG----------TAFLEGE---AFIKG--PT----D-N-----------------
Q46LW1_PROMT/887-1319--SI-EK--TRIKTAFT-D-------I----------R-A-SSS---LVVKG--SI----L-K-----------------
TAMB_HAEIN/952-1298--QA-NN--FNVDIPSMAK-------L----------R-F-SPN---ITIKA--NP----K-E-----------------
Q5NNB3_ZYMMO/1036-1389--TL-DK--ATLARADEMK-------S----------T-V-SGN---LDITS--NR----KDG-----------------

PF13116

C6XK02_HIRBI/457-744-KALTLD--FRVEDAEVKFLE-----D----------LPPITEASGVGRLRG----------------------------
Q7NW94_CHRVO/514-796DGEFLVE--ADIEKARLSYQQ-----G----------WPTIDDIDARLRFHN----------------------------
Q7N037_PHOLL/501-786-GQFQVF--APLRHATFQYQP-----N----------WPALLDFNIDLNFQN----------------------------
A4XQL3_PSEMY/513-798LSLF-----FQVKDAELAFQP-----D----------WPSLREGNGEVLIED----------------------------
Q3J7T7_NITOC/517-810-SQLTVE--LDIRGAKLNYAR-----G----------WPVLERVAAHLHSDG----------------------------
D5CU11_SIDLE/524-805RGIFKLE--ARAKDVEMEFAK-----G----------WPRIEDAQTDLLIEG----------------------------
A1AVR0_RUTMC/242-525-AKIKFD--AHLSNTELLFNT-----D----------WQSLKQLDANIAIDG----------------------------
Q31FH6_HYDCU/496-774-GLFEAT--ADIHKAELKFQP-----D----------WPALDDFSAKLKFTP----------------------------
B8GV04_THISH/540-825-GEFEVR--ARVEEGLLDYQR-----G----------WPAIDALAGELIFTD----------------------------
Q07WQ4_SHEFN/504-791-GVFQAD--FTLDKGIFKFQP-----D----------WPAVSSLTLSALFEN----------------------------
Q5ZUN8_LEGPH/507-795-GEFSIV--SHVVGGDILITP-----E----------WRLIKDLEGYIKLKN----------------------------
Q7VFV2_HELHP/222-511QKTLALD--LAIESPKVYLAP-----H----------LKPIEATRAILYMRD----------------------------
Q12IX1_SHEDO/530-817-GVFQAG--FTLENAVYRFEP-----D----------WPVITELRLDALFEN----------------------------
A6Q385_NITSB/202-483-NLFKGR--AVAYDGTIDFQK-----G----------IAPVVVKQIILDYKS----------------------------
Q3IFH7_PSET1/493-781-GQFDVL--AQIDNATYQFDP-----D----------WPAVTNASAQLHFAN----------------------------
D9SHW3_GALCS/523-805PSLFEIG--ARAHDVSMQFAP-----D----------WPKIENLSGEFQIHN----------------------------
Q21FT5_SACD2/542-827RPTIQVF--GDVENATLKFDP-----E----------WPALEKINAHLFVDN----------------------------
C6XD69_METGS/519-799TGLFRVT--AKINDGELDYAP-----G----------WPKILGIKLDMLFEG----------------------------
A7I2E8_CAMHC/213-497-DDFLAD--GILQNVSVKFDK-----K----------LPAVMIGEANVSLRN----------------------------
Q6LMA6_PHOPR/509-794-GIFQAK--VPLKKAKFSFDT-----A----------WPILTDLQLDLLFEN----------------------------
D0L1I5_HALNC/561-853-GWFSVV--FDFKHLVLPFLP-----D----------WPALKDADGNIAFVN----------------------------
A8EUE5_ARCB4/193-478-NSIEGK--AHIKDGKIRFHK-----D----------VDEIFTKSIDVTYKD----------------------------
C5ZX33_9HELI/208-498LDSLYVV--GEIRDAKVTFQK-----G----------LSPILSPNVKLIFQN----------------------------
Q1H0H5_METFK/520-800NSLFQVK--AKIHDGELRFSP-----E----------WPKIENIALDMLFES----------------------------
Q7MRT1_WOLSU/187-475EKRLKAR--LEIASPEVTFHP-----D----------LPPLHGRGVSVIYDE----------------------------
A4G3G0_HERAR/587-887KGEFIFG--GKIDNGGLNYAP-----DMFGRDGKAPLWPLLENVKGTILFDR----------------------------
D1B1Z5_SULD5/203-493-MQMRGH--ATVQEATIIFEK-----S----------VPPAYAKEIGITLTE----------------------------
D3VKA4_XENNA/501-791-GQFQVF--VPLRDAIFQYQP-----D----------WPALFDLDIDLNFQN----------------------------
Q0ABM3_ALKEH/531-818-VAFQAG--GRVIDGELAYQP-----D----------WPRLTGAEAELDFRG----------------------------
A0KFB2_AERHH/486-771-GIFQVA--VPLQQASYEFFP-----G----------WQPLTDLQIDLLFQN----------------------------
A6TER2_KLEP7/497-781-GQFQVY--VPLKNATFAFQP-----D----------WPALTGLNIDLNFIN----------------------------
B7VIB8_VIBA3/505-791-GIFQVW--VGLEDAKFSFDT-----A----------WPLITDLQLDLLFEN----------------------------
Q5E7X4_ALIF1/495-780-GIFQVK--VGLKDAQFAFDT-----A----------WPPLTNLQLDLMFQN----------------------------
Q6DAI1_PECAS/504-784-GQFEVW--VPVKDATFEFQP-----G----------WPALTPLDINLDFAN----------------------------
A0A2S9PIN0_YERPE/511-794-GQFQVY--VPLRNAVFQFQP-----D----------WPALDNLAIDLNFLN----------------------------
Q83BN5_COXBU/480-760-GSFDAI--ANVDRVTLNYHS-----G----------WPALQNIKAKVMFHN----------------------------
Q8ZLP4_SALTY/504-786-GQFEVL--VPLRNATFAFQP-----D----------WPALKNLNIELDFLN----------------------------
Q9KUU5_VIBCH/504-791-GVFQAW--VGLKEAKFAFDT-----A----------WPPITDLQLDLLFEN----------------------------

PF13109

A6Q385_NITSB/623-836--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369P-------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362R-------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRFC/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B7VIB8_VIBA3/1027-1268--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
A0A6N4SMJ8_CYTH3/532-755--------------------------------------------------------------------------------
A0A6N4SME1_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_PARXL/1154-1409A-------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q3IFH7_PSET1/1008-1245--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_DOKS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570NIDYAGP-----RFSVTGLSIQIQDPTWLNAQQLWPYGAIQASAEQMYWHGEAIQKVLVDVDYQAQNSTLYGTS------
Q9KNJ9_VIBCH/1-570NIDWADQ-----GIIARGVSLQIKQPVWDSPQQQLPYGKIQLAADQITIDGEAFNQVLVDANYQAQDSTVYGFS------
Q9HU38_PSEAE/1-636AAPSETPPAADGKGAQAQAPEQAPQNDSPRTPIKLDIDSLNVNNARVTYTDEASGKQYNVEGIELSTGAIREGSSIPLKL
Q9KT66_VIBCH/1-595APAT-----------TDSAPASQPSSSEPAAAWSIELGGVSVSNAVLEITDKKAGSHTKLYDVQLSVAEFVP--------
Q9JY87_NEIMB/8-615V------------------------------------NRIIVENSTVRLNFLQEQLILKEINLNLQSPDSSGQP------
Q9ZDI1_RICPR/1-711N-----------------NNTVQSNYTQTVLELPILISHLKIKGGKVIYIEKNNEKIFNDINLETKMKSIKGPIDFTIAL
Q9HUT4_PSEAE/1-577S------------------------------AWQLDIREIGFDKGSVSLDDQRLKT-----RLEVLVDPLGKP-------
YHJG_ECOLI/1-582N--------------------------AKPSAWSFRLDNILFDQGRIAIDDKVSKA-----DLEIFVDPLGKP-------

PF05359

B2JQ93_PARP8/874-1021--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_ALIF1/399-549--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_PARP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_PARXL/640-791--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_PARP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLAQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
A0A6N4SXE7_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_RHOFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_RHOFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
Q5DZ89_ALIF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
Q1LGA7_CUPMC/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_CUPMC/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_RHOFT/710-857--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_RHOFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
A0A6N4SQC4_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_DOKS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_HYDCU/496-774--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
Q3IFH7_PSET1/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B7VIB8_VIBA3/505-791--------------------------------------------------------------------------------
Q5E7X4_ALIF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
A0A2S9PIN0_YERPE/511-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A6Q385_NITSB/623-836--------------------------------NNVNISMKNMHDEVLH--------------------------------
C5ZX33_9HELI/638-852--------------------------------DYITLDAKEFGDTFVN--------------------------------
D3UGW6_HELM1/730-943--------------------------------GSIYIKASNFSADFIN--------------------------------
Q30RQ8_SULDN/697-907--------------------------------NDFHLHGEKFNDEFME--------------------------------
Q7MRT1_WOLSU/616-829--------------------------------KRLKIEARHFNDEFVN--------------------------------
Q7VFV2_HELHP/731-944--------------------------------SRAVLRLSNFSDKFLN--------------------------------
O25308_HELPY/745-958--------------------------------GALYLKAHNFSGDYIN--------------------------------
Q0PAY6_CAMJE/635-848--------------------------------NDLNLNVSNIDDNYLN--------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------TRARAHISSNNSELLL--------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------TRMEFSLKADKFDALA--------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------TNLIVKSVGNEVNDIV--------------------------------
A1TW53_ACIAC/1117-1369-----------------------------RRRTSMDFRLDIRDSGQLL--------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------TVMDFELDIRDCGALL--------------------------------
A1WSB5_VEREI/1101-1362---------------------------PAERRTALSFELDIRDAGALL--------------------------------
A1WYY8_HALHL/891-1129--------------------------------TALRGRLRSGDAGDLF--------------------------------
A2U2U5_9FLAO/567-793--------------------------------FKVDLDLKELNIKESF--------------------------------
A3HUH0_9BACT/675-900--------------------------------FNFDLNVSDLSISEAFSTL-N---------------------------
E0TB83_PARBH/837-1047--------------------------------QDAKLMVETSDFGQLL--------------------------------
A4AMF6_MARSH/560-785--------------------------------FRMKLNMDQLGIGESF--------------------------------
A4CG41_ROBBH/574-799--------------------------------FNMDLGIDGFRIRETL--------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------W-YKGRLEGGNLADVL--------------------------------
A5CF63_ORITB/620-836--------------------------------MTLVYAYNSFYIPTFS--------------------------------
A5FUN1_ACICJ/745-973--------------------------------LSLQASLTGARASAVA--------------------------------
A6GWN8_FLAPJ/560-787--------------------------------FSMNLDLNKVDIAKTF--------------------------------
A7HEC2_ANADF/581-801--------------------------------FEVALDLKGVAGEEAL--------------------------------
A9CIC7_AGRFC/884-1105--------------------------------FRSKIAVTDANPEPIL--------------------------------
A9H3V6_GLUDA/474-684--------------------------------QDLGLMLRGLDVTTQF--------------------------------
B7VIB8_VIBA3/1027-1268--------------------------------SSLTLDVEGENNSELM--------------------------------
C1D9M5_LARHH/1015-1258--------------------------------SQLNVQLDSASLGKLL--------------------------------
C3L4A9_AMOA5/534-754--------------------------------IYTYANLQNVQLPALFYTFEN---------------------------
C4L8L8_TOLAT/989-1232--------------------------------STLKGKFVSNNTEVFL--------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------VTLDFKPQN-DYTAFT--------------------------------
D9SHW3_GALCS/1021-1263--------------------------------TQVNLLLTISNAGKIL--------------------------------
D5CU11_SIDLE/1024-1263--------------------------------TQVKLRVDISDAGKIL--------------------------------
C6WWM2_METML/1053-1294--------------------------------TSLNVRWDIKDLGQTL--------------------------------
C6XD69_METGS/1043-1284--------------------------------TRITLNWDIKDLGKTL--------------------------------
C6XK02_HIRBI/884-1092---------------------------------DIAFQLRSDDAGYIL--------------------------------
C7PC84_CHIPD/564-796--------------------------------INMAYSVQNVDVQQTF--------------------------------
D2UF54_XANAP/1023-1265--------------------------------TQLSARVESQDLGALM--------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------TELKSRLQGERAGDIL--------------------------------
Q0AQ38_MARMM/879-1092--------------------------------RD--FRIEAQSLQRIS--------------------------------
A0A6N4SMJ8_CYTH3/532-755--------------------------------INADARIRAMNIDSLFYVFEN---------------------------
A0A6N4SME1_CYTH3/698-925--------------------------------FAMDMLMKDVAAKEAY--------------------------------
Q145G0_PARXL/1154-1409---------------------------T-ARRTVFDFKLDIKDAGALL--------------------------------
Q211X0_RHOPB/871-1087--------------------------------LDARLKWSGVDGAALR--------------------------------
Q28TM9_JANSC/371-572--------------------------------VGGDLILANVALQPLL--------------------------------
Q2KY05_BORA1/936-1183--------------------------------LTVQAKAEFKDAGKFL--------------------------------
Q3IFH7_PSET1/1008-1245--------------------------------TQLSGELKSEDIGALF--------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------SALSGRLEAGDLGDLL--------------------------------
Q7UYB4_RHOBA/752-985--------------------------------MTSHWKTRRMDFVRLT--------------------------------
Q8EA16_SHEON/1025-1268--------------------------------TELSVSLNASQFHHLS--------------------------------
Q9ZDH9_RICPR/624-849--------------------------------INFVYAVNTIDLNKIL--------------------------------
E0SHA8_DICD3/1031-1273--------------------------------TAIKGQLSGGSLSDNA--------------------------------
F4AYZ2_DOKS4/566-791--------------------------------FNMTVDLSSIDIDRSF--------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------VDVDFKLESANLGELL--------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------SRFKGSVTGGQLAELG--------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------TLLSFSIDVRDAGATL--------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------TRFNGSLTSDNLGRSL--------------------------------
Q32B94_SHIDS/1009-1252--------------------------------TSLKGKLRGQKIDAAA--------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------TKLQSKMYLKDLAKSL--------------------------------
Q63R38_BURPS/1120-1377--------------------------------TVFDFTLAIDDAGALL--------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------TQLAFDVEGENSSDLM--------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------TRLSARVDSRNLGNLL--------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------TQMNLDMKGDNNSDLM--------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------IRLSARVDSRDLGELA--------------------------------

PF05170

Q87TE2_VIBPA/1-570---------------------------FKWRNSQISGQGEQYPQGW-S--------------------------------
Q9KNJ9_VIBCH/1-570---------------------------FNWRNSPISGQAEQYPQGW-S--------------------------------
Q9HU38_PSEAE/1-636N------------------AYLGTNQPVVRVKTELTGNLRFDTALRRY--------------------------------
Q9KT66_VIBCH/1-595---------------------------DNWTKATFAAKGDKDQQKFAA--------------------------------
Q9JY87_NEIMB/8-615---------------------------FESSGILVWGKLSVPWKSRGL--------------------------------
Q9ZDI1_RICPR/1-711NALQQQIHIDGHVKEIGKIIPLSTNINLAGAKIKIDGKFDSKNNSFIG--------------------------------
Q9HUT4_PSEAE/1-577---------------------------VPFGQLAGKALATGDAANAQD--------------------------------
YHJG_ECOLI/1-582---------------------------LPFSEVTGS-KGKADKEKVGD--------------------------------

PF05359

B2JQ93_PARP8/874-1021--------------------------------IAIQGTVGAFG-TES---------------------------------
Q72DG8_DESVH/963-1109--------------------------------DKVDAAVTGFT-MAP---------------------------------
A9BMN7_DELAS/883-1036--------------------------------SELAGRLSAFS-SEQP--------------------------------
Q2LUD1_SYNAS/534-687--------------------------------EKIQGRIDNIS-SVP---------------------------------
A8ZWF7_DESOH/636-783--------------------------------TLTDLKVTGLT-SED---------------------------------
Q3A6W6_PELCD/375-529--------------------------------EHIAVTLTDL--DLPG--------------------------------
Q5NYY7_AROAE/382-536--------------------------------KDLVLEAKNVG-SAP---------------------------------
Q2KWF8_BORA1/759-906--------------------------------SAIEGSISAVS-SRN---------------------------------
A2SI01_METPP/870-1017--------------------------------TDIGGEVSALA-WDS---------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------EPLNVLVQNAS-TDL---------------------------------
Q5QWM2_IDILO/380-527--------------------------------HTLSGEVSTLS-SDS---------------------------------
Q0VP61_ALCBS/592-737--------------------------------YQLAGTVSNLD-TRS---------------------------------
Q63NS2_BURPS/645-797--------------------------------APLALNVRQIS-EDL---------------------------------
A0KK00_AERHH/368-522--------------------------------SALALALGPL--GSQS--------------------------------
Q0JZH1_CUPNH/670-829--------------------------------RNIALSTGSVAWPLT---------------------------------
Q2LUD1_SYNAS/785-932--------------------------------VQIGGRISGLS-SNL---------------------------------
A1ARF1_PELPD/790-937--------------------------------HNLGGRVSGMS-SDD---------------------------------
Q39RS7_GEOMG/568-719--------------------------------RRIGFNASNIT-GPR---------------------------------
B9M3X2_GEODF/795-942--------------------------------YNLGGRISGLS-SED---------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------DGLQIGVPFLA-SLP---------------------------------
Q3JBN6_NITOC/584-731--------------------------------HSLQSEIQNLS-SMD---------------------------------
Q5DZ89_ALIF1/399-549--------------------------------SPINLTTSQIV-SDL---------------------------------
A9BMN7_DELAS/165-317--------------------------------EQLQLRLPFIS-NLE---------------------------------
A9BMN7_DELAS/379-538--------------------------------RELSLQVRDI--RWPL--------------------------------
Q87WR1_PSESM/386-537--------------------------------GPLNLDMQNFD-SLN---------------------------------
B2JQ93_PARP8/616-770--------------------------------TPLNLKVQKIS-DDL---------------------------------
A1K6C3_AZOSB/734-881--------------------------------EQLAGQMLGID-NRP---------------------------------
Q603H4_METCA/718-865--------------------------------HDFFGTAAGLS-TRS---------------------------------
Q88DW4_PSEPK/365-516--------------------------------GPLNADLQGFD-SLN---------------------------------
A0KK00_AERHH/578-725--------------------------------AALSGQSRHIS-NIP---------------------------------
B5ECC6_GEOBB/569-721--------------------------------KNTSLTLSNLQ-GPK---------------------------------
Q2LUD1_SYNAS/159-313--------------------------------HDLSLAIPFLS-NLF---------------------------------
A4VPN2_PSEU5/551-698--------------------------------QSLNGDIGVLS-NRE---------------------------------
Q0VP61_ALCBS/382-530--------------------------------TDGGLTLSNLIIGE----------------------------------
A1K7K6_AZOSB/583-736--------------------------------DGLSVKADNLS-TAK---------------------------------
Q3JBN6_NITOC/369-521--------------------------------SDLGLQLIDVT-SVP---------------------------------
Q5NYY7_AROAE/832-979--------------------------------TGMEGEVVGLS-SDP---------------------------------
Q13S79_PARXL/640-791--------------------------------TPLQLKVQNIS-DDL---------------------------------
Q316X0_DESAG/862-1008--------------------------------AGLNATLSSVS-LSA---------------------------------
Q602F3_METCA/416-565--------------------------------DDLEIRLQGVD-------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------TDLAGRIGPLN---P---------------------------------
B3E4B8_GEOLS/816-963--------------------------------HNLGGMVSGLS-SDM---------------------------------
A4VPN2_PSEU5/341-492--------------------------------GPLNLDISDFD-SLA---------------------------------
Q5NYY7_AROAE/153-307--------------------------------SAINIGLPFLS---NL--------------------------------
Q30NX8_SULDN/563-715--------------------------------DNINISAKNID-SKE---------------------------------
Q5NYY7_AROAE/604-757--------------------------------AGIKLKADGLS-TAK---------------------------------
Q602F3_METCA/623-770--------------------------------RGLTGVVQSLS-SRP---------------------------------
Q316X0_DESAG/389-538--------------------------------GPLDITLNNLSTTG----------------------------------
A5G9K9_GEOUR/137-293--------------------------------RKVELTIPFVT-TIP---------------------------------
B2JHK1_PARP8/152-309--------------------------------SDASASVDHIHLPDL---------------------------------
A5G9K9_GEOUR/551-702--------------------------------KKMAFTLDKLT-GPT---------------------------------
A0KK00_AERHH/151-307--------------------------------SGLDLQLPTFS-TAP---------------------------------
Q1H1L3_METFK/780-927--------------------------------NSLSGVINGMS-TNP---------------------------------
B9M7L7_GEODF/383-534--------------------------------KKTSFSLEQLT-GPP---------------------------------
A4SXW3_POLAQ/414-561--------------------------------KKFNATLIGVS-NAP---------------------------------
B9M3X2_GEODF/564-715--------------------------------KSIDVSATGIT-DIL---------------------------------
A4G9D7_HERAR/154-308--------------------------------ADLKIGVPFVS-SLP---------------------------------
Q21F55_SACD2/584-731--------------------------------TKLHGELSTLA-SAS---------------------------------
Q7NY28_CHRVO/704-851--------------------------------HHLRGSIQNLS-TRA---------------------------------
Q0JZH1_CUPNH/164-317--------------------------------DNLTLTLPFLS-NLP---------------------------------
B3E4B8_GEOLS/367-514--------------------------------QAINVKLSNLS-TTA---------------------------------
Q2IFA1_ANADE/563-710--------------------------------TGAQATVTRLS-SDP---------------------------------
A0A6N4SXE7_CYTH3/142-298--------------------------------NQFELLLTNIT-NVED--------------------------------
Q9HV64_PSEAE/140-291--------------------------------DPLGFELHNLS-TLP---------------------------------
Q3SGZ4_THIDA/733-880--------------------------------HDLGGVVTGLS-NDP---------------------------------
Q3A6W6_PELCD/162-316--------------------------------ADLGFYVPFTS-TLK---------------------------------
Q316X0_DESAG/600-751--------------------------------TGINLDVTGAG-SDA---------------------------------
B9M7L7_GEODF/592-739--------------------------------FNLGGRISGLS-SED---------------------------------
Q222N5_RHOFT/496-646--------------------------------TDLALKLEGAS-SDL---------------------------------
Q3A6W6_PELCD/805-951--------------------------------DKLAVTVEAVE-NTP---------------------------------
A5G9K9_GEOUR/769-916--------------------------------YNLGGRISGLS-SEE---------------------------------
A2SI01_METPP/623-775--------------------------------TRTDLKLRQLD-SDL---------------------------------
Q083W9_SHEFN/492-642--------------------------------GPIDFTTGVIK-SDL---------------------------------
Q083W9_SHEFN/725-872--------------------------------EMLNGQITNLS-SNP---------------------------------
Q12MK5_SHEDO/654-801--------------------------------EELKGEITNLS-SKL---------------------------------
Q3SGZ4_THIDA/517-669--------------------------------AEGFVTFEDLS-LDM---------------------------------
A1ARF1_PELPD/573-725--------------------------------RNTAFSLADLS-GPK---------------------------------
Q39RS7_GEOMG/801-948--------------------------------YNLGGRISGLS-SEA---------------------------------
Q603H4_METCA/502-653--------------------------------ENLRLSLGPIA-SDE---------------------------------
Q222N5_RHOFT/149-300--------------------------------APIDFSLSNFS-TLP---------------------------------
A8ZWF7_DESOH/412-569--------------------------------SDLNVTVAPF--TTAP--------------------------------
A4XYD1_PSEMY/354-505--------------------------------GPLNLDLKNFD-SLG---------------------------------
Q21F55_SACD2/154-306--------------------------------GPIHFGVSDFS-TLP---------------------------------
Q3SGZ4_THIDA/147-307--------------------------------EPLGIELDGLS-TLP---------------------------------
A7I315_CAMHC/662-807--------------------------------SKVRTAVNKVA-SKG---------------------------------
Q74FC9_GEOSL/787-934--------------------------------YNLGGRVSGLT-SEE---------------------------------
A7H8M2_ANADF/367-518--------------------------------TEVQLRLEQLR-PDV---------------------------------
Q5DZ89_ALIF1/610-757--------------------------------EQLKGNIGHVS-SIP---------------------------------
A4XYD1_PSEMY/562-709--------------------------------QQMNGRIGVLD-NQK---------------------------------
B3E4B8_GEOLS/583-736--------------------------------SNIRLSTGNLT-GPT---------------------------------
Q1LGA7_CUPMC/681-840--------------------------------RNIGFTSGTVTWPLS---------------------------------
B5ECC6_GEOBB/807-954--------------------------------YNLGGRVSGLS-SEE---------------------------------
Q2IFA1_ANADE/358-509--------------------------------TDVAVTLEGIR-PGP---------------------------------
A4XYD1_PSEMY/140-291--------------------------------DSLDVELHNLS-TLA---------------------------------
A7H8M2_ANADF/165-318--------------------------------GPLTVRLESFR-TRG---------------------------------
Q3A6W6_PELCD/588-738--------------------------------HKLTGSITGYD-SAT---------------------------------
A7H8M2_ANADF/579-726--------------------------------TGADASVTRLS-SDP---------------------------------
A8ETY5_ARCB4/612-759--------------------------------TKLNGKISEIK-NTK---------------------------------
Q30NX8_SULDN/772-919--------------------------------HGLNGNVYAIS-SAK---------------------------------
A4VPN2_PSEU5/125-276--------------------------------DSLDLELHNLA-TRT---------------------------------
Q1LGA7_CUPMC/173-326--------------------------------ENFTLTLPFLS-NLP---------------------------------
Q1H1L3_METFK/561-712--------------------------------ENANLEVKDVS-LDT---------------------------------
Q222N5_RHOFT/710-857--------------------------------YELNGVINGLS-SNR---------------------------------
D0J281_COMT2/165-316--------------------------------KDLQLSIPFIS-NLAS--------------------------------
M1FB64_9ALTE/585-727--------------------------------GQLYGNLSGLS-NIP---------------------------------
Q63NS2_BURPS/160-304--------------------------------DQWTVGIPFIA-TLP---------------------------------
Q7VVF7_BORPE/156-309--------------------------------DEIALGVPFIS-TFG---------------------------------
Q7VVF7_BORPE/538-685--------------------------------KQFEARFDRLA--LD---------------------------------
Q87WR1_PSESM/155-306--------------------------------DALNFELKNLS-TLP---------------------------------
Q88DW4_PSEPK/140-291--------------------------------DNMNLELKNLS-TLP---------------------------------
Q88DW4_PSEPK/581-725--------------------------------QQLNGQIGTID-NRK---------------------------------
Q8EDF6_SHEON/666-811--------------------------------EQLEGHISHLS-SKP---------------------------------
Q9HV64_PSEAE/476-627--------------------------------GPLDLDLQNVD-SLG---------------------------------
Q9HV64_PSEAE/692-837--------------------------------QQLSGEVGTLD-TRN---------------------------------

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------PKLSANV-TLGSDTNVTYVLP-TAYASVE-NRD--------DVVVFVN
Q83EW1_COXBU/570-928--------------------------------IDITGTL-TVPRAILKPTTFS-RAAALTG-------------DVVFIG
Q8YZJ8_NOSS1/1412-1829--------------------------------PRIGGEI-TLSNGQVTIGNTT-ANSKQTT--TTETNTRATTIELNSNI
A4CK93_ROBBH/998-1431--------------------------------LNINFEG-STARGTSLKIPIS-DVASLGD-YS----------FINFIE
A3U6I2_CROAH/1185-1647--------------------------------PKLNATL-NVGSETNVTYVLP-PSQVAVESRD---------GVVIFVN
A0LGH5_SYNFM/889-1254--------------------------------IELSGNL-LLSDAEMNLGRLE-SDLARSI-------------TVVEGD
A3HZ37_9BACT/1160-1620--------------------------------PIVRAKL-NVRESTDLSLLIP-ESQLDIVERD---------GVVLFVN
A5GSG8_SYNR3/973-1387--------------------------------PALGGEV-KLSQGSITVSPSE-LSSA------GG-----PSVPVDQAV
A6L590_BACV8/1012-1461--------------------------------MTVDASL-TTGNNTSFTYITG-VTTEAASNQ-----------FITFVD
Q2S2D2_SALRD/1057-1516--------------------------------ATLESNAARTTPDSELYIPVS-GRTVEED-AG----------FIVFAD
Q21Y28_RHOFT/928-1291--------------------------------LALRGTL-KADSALFILPEDT-APQL-GG-------------DVLVRR
Q6MKB2_BDEBA/958-1321--------------------------------FTLSGTY-HVTSAMVEKEFTE-DGGGVTG-VR----------QSLYLP
Q39RU7_GEOMG/1016-1376--------------------------------VAVRGEI-TVPELLVTAAGTG-GPVKSSP-------------DVVLEG
Q7VBL9_PROMA/867-1309--------------------------------PLLGGDI-TIEQGSISTKRSR-VDKKNST--STQKISTNSTQRYFNQL
Q8KFW2_CHLTE/1034-1479--------------------------------PVAEGDL-VLNSVNFSLYRKG-SNESAKY-IGV-------EKFIKFVP
A6H009_FLAPJ/1018-1446--------------------------------LVITVNA-KSEKGTSVKIPIT-DSEVSSE-ND----------YIKFKS
B5E9K2_GEOBB/1121-1484--------------------------------VTLQGEI-GVPEMLILGSPAH-QAETASS-------------DVILEG
Q11I59_CHESB/1185-1538--------------------------------PLLSGNI-EVSRAEILVPDGF-G-GSAA---S---------ID--VQH
A0A6N4SQC4_CYTH3/1167-1624--------------------------------PVINATI-DIEKGSHFTFAIP-DSKISVDRGD---------GIVIFTT
A7HQ23_PARL1/1042-1395--------------------------------MLLEGEL-TTTTARFHVPEQL-PGGVAH-------------IDVILVR
Q7MT86_PORGI/1036-1486--------------------------------MRCDVNL-ISEKGTHIVLNFT-QPTTAEEYR-----------FLRFVD
Q3AQ57_CHLCH/1053-1500--------------------------------PIVEGEV-QIDRADYSLYSAG-ANESAQY-VGI-------DNTISFVA
A1BDC7_CHLPD/1048-1494--------------------------------PVVEGDI-TINSADFTMYRPG-ANESAKY-IGV-------EKFIEFVP
Q2RSJ7_RHORT/1146-1500--------------------------------MTVSGTV-TTGPVEIRLVGGG-GPSIAE-------------LDVVEIG
Q2S346_SALRD/1311-1689--------------------------------PVLSGGL-QVQSASVYYAEAL-AEGAAAM-GAVEL----TAQDQLTLE
Q2INP6_ANADE/946-1304--------------------------------TDVTGRL-HVVRARYTADVDL-EGSLLEL-RR----------------
Q9RUC9_DEIRA/223-627--------------------------------VRVSGEG-DFARLVLGRVDAP-TTLPAAP-GSTGN----GAKDTFVSP
Q1LSN0_BAUCH/634-981--------------------------------LTLNGQV-NIPWMRIKVKEWQ-QTTADIS-LD----------DAILLD
B3ELK5_CHLPB/1036-1483--------------------------------PVLTGNL-LITNADFTLYRTG-SNESTKY-VGA-------ERFITFVP
Q8YUC2_NOSS1/1659-2048--------------------------------PRIGGKV-DLYSGQILLAESS-DPNQPAN--NVS------AI------
Q1MQI4_LAWIP/1025-1382--------------------------------SEVKGDI-VINQGEFQLTEGL-TSNIPTL-NV---------VDSTQQQ
Q7VQN5_BLOFL/933-1286--------------------------------IDIQGDI-NVPYGYIKIKDFQ-RNIMGVS-S-----------EEIVLN
Q31MA1_SYNE7/1177-1568--------------------------------PAIAGDI-RVNQANIQLPGPD-RLT-----------------------
E3G0N9_STIAD/1177-1560--------------------------------SVNIRDL-HIPEAHIELPEVK-RKDLQAL-ERP--------GDIVLVR
F4B3D6_DOKS4/1021-1426--------------------------------LVIDVFG-ETARGTTFKIPID-DSEALGD-NS----------YIKFLS
Q46LW1_PROMT/887-1319--------------------------------PQLSGEV-FISEGSIFAKRAK-NPSKTSS-EKSDRY-QDSKVRIIRRL
TAMB_HAEIN/952-1298--------------------------------LNLSGTV-DIPWARIKIDSLPDTAEPVSE-------------DEVILN
Q5NNB3_ZYMMO/1036-1389--------------------------------GSIKGKL-KLPETRYRFIMDN-K-ETVHD-LS----------GVKRK-

PF13116

C6XK02_HIRBI/457-744--------------------------------NSMKINLESGKFGDWL--------------------------------
Q7NW94_CHRVO/514-796--------------------------------EGMQVLAQRASTVGVP--------------------------------
Q7N037_PHOLL/501-786--------------------------------NGLWMFAPQTALGEVK--------------------------------
A4XQL3_PSEMY/513-798--------------------------------DAVRVRLQSGRLLDSR--------------------------------
Q3J7T7_NITOC/517-810--------------------------------QYMTIHANEGQMFSAR--------------------------------
D5CU11_SIDLE/524-805--------------------------------NKLEIKAATATTAGAH--------------------------------
A1AVR0_RUTMC/242-525--------------------------------RKITVMVNHTMLNDMF--------------------------------
Q31FH6_HYDCU/496-774--------------------------------YNLQITSKKVMLGNVT--------------------------------
B8GV04_THISH/540-825--------------------------------RGMRAQSASGRLFGAQ--------------------------------
Q07WQ4_SHEFN/504-791--------------------------------DMMDLHIDQGKLDNVV--------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------RNLDIDIIDGDAQGTL--------------------------------
Q7VFV2_HELHP/222-511--------------------------------EKLTFLLKEPFFTNMN--------------------------------
Q12IX1_SHEDO/530-817--------------------------------AAMDLWVTQGQLQDVA--------------------------------
A6Q385_NITSB/202-483--------------------------------NNLYFTLRKPIFQKRS--------------------------------
Q3IFH7_PSET1/493-781--------------------------------ERMDIYSQQGKLVNLAV-------------------------------
D9SHW3_GALCS/523-805--------------------------------NKLQVRAPTANMLGAH--------------------------------
Q21FT5_SACD2/542-827--------------------------------ADLTVQVTQAEMQGNH--------------------------------
C6XD69_METGS/519-799--------------------------------NRMELNATDGTILGTR--------------------------------
A7I2E8_CAMHC/213-497--------------------------------QSLKFNMENATYLDKN--------------------------------
Q6LMA6_PHOPR/509-794--------------------------------DFMYLDSRHAITMGAT--------------------------------
D0L1I5_HALNC/561-853--------------------------------QQFHASIDHGTLADVP--------------------------------
A8EUE5_ARCB4/193-478--------------------------------DNLHFNLIEPKFKDKN--------------------------------
C5ZX33_9HELI/208-498--------------------------------NTLEFHPNQPTYEHIN--------------------------------
Q1H0H5_METFK/520-800--------------------------------NRMELNASKGSTLGTD--------------------------------
Q7MRT1_WOLSU/187-475--------------------------------RGVSFELYEPSFEGFS--------------------------------
A4G3G0_HERAR/587-887--------------------------------TRMEIKGESGSTHGAQ--------------------------------
D1B1Z5_SULD5/203-493--------------------------------DKLLFDISAPEYEQKS--------------------------------
D3VKA4_XENNA/501-791--------------------------------NGLRMQALKARLGGVD--------------------------------
Q0ABM3_ALKEH/531-818--------------------------------RSMHIRGHGGRLAGTS--------------------------------
A0KFB2_AERHH/486-771--------------------------------ASLDMNSRATQLGKAS--------------------------------
A6TER2_KLEP7/497-781--------------------------------NGLWMRADKAMLGNVT--------------------------------
B7VIB8_VIBA3/505-791--------------------------------DAMYLDSRSAQLMDVA--------------------------------
Q5E7X4_ALIF1/495-780--------------------------------ASMFLSSHSADLMDVH--------------------------------
Q6DAI1_PECAS/504-784--------------------------------NGLWMFAPQIWLGKVE--------------------------------
A0A2S9PIN0_YERPE/511-794--------------------------------EGLWMNAPHTLLGKVI--------------------------------
Q83BN5_COXBU/480-760--------------------------------NQLRIVASHANISGNP--------------------------------
Q8ZLP4_SALTY/504-786--------------------------------DGLWMRSDSVDLGGVK--------------------------------
Q9KUU5_VIBCH/504-791--------------------------------DAMYLDSRSATLMEVS--------------------------------

PF13109

A6Q385_NITSB/623-836---------------------------------------------KLF-----K-M------------------------
C5ZX33_9HELI/638-852---------------------------------------------ALA-----N-K------------------------
D3UGW6_HELM1/730-943---------------------------------------------MVA-----K-K------------------------
Q30RQ8_SULDN/697-907---------------------------------------------KIF-----S-L------------------------
Q7MRT1_WOLSU/616-829---------------------------------------------TFF-----N-K------------------------
Q7VFV2_HELHP/731-944---------------------------------------------RVW-----Q-R------------------------
O25308_HELPY/745-958---------------------------------------------TIL-----Q-K------------------------
Q0PAY6_CAMJE/635-848---------------------------------------------EFL-----Q-K------------------------

PF13502

A0KFB2_AERHH/999-1241---------------------------------------------KRL-----G-Y------------------------
A1S2S6_SHEAM/1130-1371---------------------------------------------QQL-----G-I------------------------
A1STZ9_PSYIN/1024-1262---------------------------------------------KRL-----GYS------------------------
A1TW53_ACIAC/1117-1369---------------------------------------------ARF-----G-M------------------------
A1WCZ7_ACISJ/1139-1390---------------------------------------------ARF-----G-M------------------------
A1WSB5_VEREI/1101-1362---------------------------------------------ERL-----G-L------------------------
A1WYY8_HALHL/891-1129---------------------------------------------GLL-----Q-A------------------------
A2U2U5_9FLAO/567-793---------------------------------------------SSL-----E-M------------------------
A3HUH0_9BACT/675-900-------------------------------------------TVKAF-----API------------------------
E0TB83_PARBH/837-1047---------------------------------------------RGL-----F-G------------------------
A4AMF6_MARSH/560-785---------------------------------------------KSL-----E-L------------------------
A4CG41_ROBBH/574-799---------------------------------------------ESI-----E-L------------------------
A4VIB7_PSEU5/1014-1255---------------------------------------------LAW-----GFA------------------------
A5CF63_ORITB/620-836---------------------------------------------FIL-----Q-D------------------------
A5FUN1_ACICJ/745-973---------------------------------------------SIA-----A-T------------------------
A6GWN8_FLAPJ/560-787---------------------------------------------TQL-----D-M------------------------
A7HEC2_ANADF/581-801---------------------------------------------KLL-----G-D------------------------
A9CIC7_AGRFC/884-1105---------------------------------------------WAN-----A-N------------------------
A9H3V6_GLUDA/474-684---------------------------------------------E-------G-G------------------------
B7VIB8_VIBA3/1027-1268---------------------------------------------ERF-----G-I------------------------
C1D9M5_LARHH/1015-1258---------------------------------------------ARI-----G-E------------------------
C3L4A9_AMOA5/534-754-------------------------------------------FNQRF-----L-E------------------------
C4L8L8_TOLAT/989-1232---------------------------------------------GHF-----G-F------------------------
E8RSC3_ASTEC/1136-1358---------------------------------------------FEA-----D-D------------------------
D9SHW3_GALCS/1021-1263---------------------------------------------SRS-----G-Y------------------------
D5CU11_SIDLE/1024-1263---------------------------------------------SRS-----G-Y------------------------
C6WWM2_METML/1053-1294---------------------------------------------ARL-----G-Y------------------------
C6XD69_METGS/1043-1284---------------------------------------------ERF-----G-Y------------------------
C6XK02_HIRBI/884-1092---------------------------------------------KTL-----F-K------------------------
C7PC84_CHIPD/564-796---------------------------------------------NAF-----N-T------------------------
D2UF54_XANAP/1023-1265---------------------------------------------QSL-----DFG------------------------
Q0ABM3_ALKEH/1048-1290---------------------------------------------ATL-----GYL------------------------
Q0AQ38_MARMM/879-1092---------------------------------------------ALL-----G-M------------------------
A0A6N4SMJ8_CYTH3/532-755-------------------------------------------FSQNF-----I-T------------------------
A0A6N4SME1_CYTH3/698-925---------------------------------------------KTF-----N-S------------------------
Q145G0_PARXL/1154-1409---------------------------------------------ERF-----G-Q------------------------
Q211X0_RHOPB/871-1087---------------------------------------------YRA-----L-A------------------------
Q28TM9_JANSC/371-572---------------------------------------------GAM-----A-D------------------------
Q2KY05_BORA1/936-1183---------------------------------------------DRV-----G-L------------------------
Q3IFH7_PSET1/1008-1245---------------------------------------------NEF-----D-L------------------------
Q5R0H7_IDILO/1003-1244---------------------------------------------RDY-----G-L------------------------
Q7UYB4_RHOBA/752-985---------------------------------------------DQL-----G-R------------------------
Q8EA16_SHEON/1025-1268---------------------------------------------DQL-----G-I------------------------
Q9ZDH9_RICPR/624-849---------------------------------------------ALM-----HNI------------------------
E0SHA8_DICD3/1031-1273---------------------------------------------DWL-----G-L------------------------
F4AYZ2_DOKS4/566-791---------------------------------------------KEL-----D-M------------------------
G2J3B5_PSEUL/1018-1258---------------------------------------------GRF-----G-Y------------------------
M1FEQ6_9ALTE/970-1216---------------------------------------------GLF-----G-A------------------------
Q0KCK4_CUPNH/1119-1370---------------------------------------------ERL-----G-L------------------------
Q0VS66_ALCBS/1022-1263---------------------------------------------RAW-----G-L------------------------
Q32B94_SHIDS/1009-1252---------------------------------------------EFF-----G-V------------------------
Q5ZUN8_LEGPH/1014-1261---------------------------------------------DRW-----A-I------------------------
Q63R38_BURPS/1120-1377---------------------------------------------ERV-----G-L------------------------
Q6LMA6_PHOPR/1035-1276---------------------------------------------GRF-----G-I------------------------
Q8P7K3_XANCP/1032-1273---------------------------------------------QNL-----T-L------------------------
Q9KUU5_VIBCH/1028-1269---------------------------------------------ARF-----G-I------------------------
Q9PEA2_XYLFA/983-1225---------------------------------------------QAI-----G-Y------------------------

PF05170

Q87TE2_VIBPA/1-570---------------------------------------------LVN-----VTI-DKLAITNAQRQSLLS--------
Q9KNJ9_VIBCH/1-570---------------------------------------------LIN-----VTL-SRLNLNLDEWRHH----------
Q9HU38_PSEAE/1-636---------------------------------------------QLE-----DAR-LSGEASGEPLQGKTATFSAQ---
Q9KT66_VIBCH/1-595---------------------------------------------QGE-----AEVRLSADFKQYALRNI----------
Q9JY87_NEIMB/8-615---------------------------------------------FLS-----NGI-GPPEISPFHFEASTSLDGH----
Q9ZDI1_RICPR/1-711---------------------------------------------NAN-----IKG-NTKTLGMPYDLNNDYTLTMSISA
Q9HUT4_PSEAE/1-577---------------------------------------------YVF-----GWK-VKGTYKGQALAGSGKVGGM----
YHJG_ECOLI/1-582---------------------------------------------YVF-----GLK-AQGRYNGEPLTGTGKIGGM----

PF05359

B2JQ93_PARP8/874-1021---------------------------------------------KQS-----APV------------------------
Q72DG8_DESVH/963-1109---------------------------------------------ESR-----AEV------------------------
A9BMN7_DELAS/883-1036---------------------------------------------ASQQAPQLADV------------------------
Q2LUD1_SYNAS/534-687---------------------------------------------NSA-----ANL------------------------
A8ZWF7_DESOH/636-783---------------------------------------------FKA-----ADV------------------------
Q3A6W6_PELCD/375-529---------------------------------------------SDP-----AEL------------------------
Q5NYY7_AROAE/382-536---------------------------------------------DAI-----AEV------------------------
Q2KWF8_BORA1/759-906---------------------------------------------PKP-----ATV------------------------
A2SI01_METPP/870-1017---------------------------------------------PQP-----ATV------------------------
Q8Y0Z7_RALSO/615-766---------------------------------------------GKP-----VDV------------------------
Q5QWM2_IDILO/380-527---------------------------------------------SEP-----ARV------------------------
Q0VP61_ALCBS/592-737---------------------------------------------GRT-----ANV------------------------
Q63NS2_BURPS/645-797---------------------------------------------SKP-----LPV------------------------
A0KK00_AERHH/368-522---------------------------------------------GQR-----SPL------------------------
Q0JZH1_CUPNH/670-829---------------------------------------------PAA-----VPL------------------------
Q2LUD1_SYNAS/785-932---------------------------------------------ATT-----ADL------------------------
A1ARF1_PELPD/790-937---------------------------------------------SKF-----ADV------------------------
Q39RS7_GEOMG/568-719---------------------------------------------MET-----IPY------------------------
B9M3X2_GEODF/795-942---------------------------------------------FRY-----ADV------------------------
Q8Y0Z7_RALSO/185-339---------------------------------------------AD------VDI------------------------
Q3JBN6_NITOC/584-731---------------------------------------------QGR-----SSI------------------------
Q5DZ89_ALIF1/399-549---------------------------------------------SKP-----IDF------------------------
A9BMN7_DELAS/165-317---------------------------------------------SK------REI------------------------
A9BMN7_DELAS/379-538---------------------------------------------EQPLQ-LAASM------------------------
Q87WR1_PSESM/386-537---------------------------------------------KSP-----FTL------------------------
B2JQ93_PARP8/616-770---------------------------------------------SRA-----LPV------------------------
A1K6C3_AZOSB/734-881---------------------------------------------GSE-----AVV------------------------
Q603H4_METCA/718-865---------------------------------------------EAR-----ALL------------------------
Q88DW4_PSEPK/365-516---------------------------------------------QSP-----FTL------------------------
A0KK00_AERHH/578-725---------------------------------------------GQR-----SEL------------------------
B5ECC6_GEOBB/569-721---------------------------------------------FAP-----MPM------------------------
Q2LUD1_SYNAS/159-313---------------------------------------------YR------VDK------------------------
A4VPN2_PSEU5/551-698---------------------------------------------QKA-----ASV------------------------
Q0VP61_ALCBS/382-530---------------------------------------------EAT-----FTW------------------------
A1K7K6_AZOSB/583-736---------------------------------------------GAN-----ARL------------------------
Q3JBN6_NITOC/369-521---------------------------------------------GLA-----STF------------------------
Q5NYY7_AROAE/832-979---------------------------------------------ATL-----ARL------------------------
Q13S79_PARXL/640-791---------------------------------------------SRP-----LPV------------------------
Q316X0_DESAG/862-1008---------------------------------------------ASR-----PDL------------------------
Q602F3_METCA/416-565---------------------------------------------TRQ-----GKF------------------------
Q2Y5K5_NITMU/673-818---------------------------------------------RKT-----GEV------------------------
B3E4B8_GEOLS/816-963---------------------------------------------NTR-----AEV------------------------
A4VPN2_PSEU5/341-492---------------------------------------------NRP-----FSL------------------------
Q5NYY7_AROAE/153-307---------------------------------------------PSK-----VEL------------------------
Q30NX8_SULDN/563-715---------------------------------------------KSW-----FDY------------------------
Q5NYY7_AROAE/604-757---------------------------------------------GAA-----TKF------------------------
Q602F3_METCA/623-770---------------------------------------------DAE-----AEV------------------------
Q316X0_DESAG/389-538-----------------------------------------------------GKG------------------------
A5G9K9_GEOUR/137-293---------------------------------------------YL------ADR------------------------
B2JHK1_PARP8/152-309---------------------------------------------SEP-----TGI------------------------
A5G9K9_GEOUR/551-702---------------------------------------------FGP-----IPF------------------------
A0KK00_AERHH/151-307---------------------------------------------GRA-----NPF------------------------
Q1H1L3_METFK/780-927---------------------------------------------STT-----AQV------------------------
B9M7L7_GEODF/383-534---------------------------------------------FGM-----IPF------------------------
A4SXW3_POLAQ/414-561---------------------------------------------GHF-----ATV------------------------
B9M3X2_GEODF/564-715---------------------------------------------RIP-----IPV------------------------
A4G9D7_HERAR/154-308---------------------------------------------SQ------VDV------------------------
Q21F55_SACD2/584-731---------------------------------------------TQP-----SQL------------------------
Q7NY28_CHRVO/704-851---------------------------------------------GGR-----GRI------------------------
Q0JZH1_CUPNH/164-317---------------------------------------------HD------VEI------------------------
B3E4B8_GEOLS/367-514---------------------------------------------NTQ-----SAY------------------------
Q2IFA1_ANADE/563-710---------------------------------------------KVR-----SSV------------------------
A0A6N4SXE7_CYTH3/142-298---------------------------------------------KEKA--LPSDL------------------------
Q9HV64_PSEAE/140-291---------------------------------------------DDG-----AKM------------------------
Q3SGZ4_THIDA/733-880---------------------------------------------ATT-----AQV------------------------
Q3A6W6_PELCD/162-316---------------------------------------------RHR-----ERA------------------------
Q316X0_DESAG/600-751---------------------------------------------AAP-----VEF------------------------
B9M7L7_GEODF/592-739---------------------------------------------NRF-----ADV------------------------
Q222N5_RHOFT/496-646---------------------------------------------KQT-----VKF------------------------
Q3A6W6_PELCD/805-951---------------------------------------------DSL-----AKI------------------------
A5G9K9_GEOUR/769-916---------------------------------------------NRF-----ADV------------------------
A2SI01_METPP/623-775---------------------------------------------TKP-----LSF------------------------
Q083W9_SHEFN/492-642---------------------------------------------SSP-----IDY------------------------
Q083W9_SHEFN/725-872---------------------------------------------ETT-----ASV------------------------
Q12MK5_SHEDO/654-801---------------------------------------------DSR-----ATV------------------------
Q3SGZ4_THIDA/517-669---------------------------------------------DKA-----VPL------------------------
A1ARF1_PELPD/573-725---------------------------------------------FTP-----AQL------------------------
Q39RS7_GEOMG/801-948---------------------------------------------SRF-----ADV------------------------
Q603H4_METCA/502-653---------------------------------------------GRP-----MSF------------------------
Q222N5_RHOFT/149-300---------------------------------------------EQN-----DAH------------------------
A8ZWF7_DESOH/412-569---------------------------------------------EKE-----SRF------------------------
A4XYD1_PSEMY/354-505---------------------------------------------DKP-----FEL------------------------
Q21F55_SACD2/154-306---------------------------------------------NKT-----GKQ------------------------
Q3SGZ4_THIDA/147-307---------------------------------------------EDR-----GAY------------------------
A7I315_CAMHC/662-807-----------------------------------------------L-----TKL------------------------
Q74FC9_GEOSL/787-934---------------------------------------------SKF-----ADV------------------------
A7H8M2_ANADF/367-518---------------------------------------------DAT-----WPL------------------------
Q5DZ89_ALIF1/610-757---------------------------------------------GTK-----ATV------------------------
A4XYD1_PSEMY/562-709---------------------------------------------PQA-----ASV------------------------
B3E4B8_GEOLS/583-736---------------------------------------------FSA-----MPL------------------------
Q1LGA7_CUPMC/681-840---------------------------------------------PGA-----VPM------------------------
B5ECC6_GEOBB/807-954---------------------------------------------SKF-----ADV------------------------
Q2IFA1_ANADE/358-509---------------------------------------------ETA-----CPL------------------------
A4XYD1_PSEMY/140-291---------------------------------------------GDN-----ARM------------------------
A7H8M2_ANADF/165-318---------------------------------------------GGD-----SPY------------------------
Q3A6W6_PELCD/588-738---------------------------------------------NPP-----LDI------------------------
A7H8M2_ANADF/579-726---------------------------------------------RVR-----STV------------------------
A8ETY5_ARCB4/612-759---------------------------------------------LGK-----TNL------------------------
Q30NX8_SULDN/772-919---------------------------------------------EEV-----SYV------------------------
A4VPN2_PSEU5/125-276---------------------------------------------DGS-----ADA------------------------
Q1LGA7_CUPMC/173-326---------------------------------------------HD------VTL------------------------
Q1H1L3_METFK/561-712---------------------------------------------KRA-----LPV------------------------
Q222N5_RHOFT/710-857---------------------------------------------EAR-----SQI------------------------
D0J281_COMT2/165-316---------------------------------------------KRE-----IKV------------------------
M1FB64_9ALTE/585-727---------------------------------------------PQQ-----GRV------------------------
Q63NS2_BURPS/160-304---------------------------------------------SK------TDI------------------------
Q7VVF7_BORPE/156-309---------------------------------------------YA------TDI------------------------
Q7VVF7_BORPE/538-685---------------------------------------------AQP-----SPF------------------------
Q87WR1_PSESM/155-306---------------------------------------------EDN-----ADM------------------------
Q88DW4_PSEPK/140-291---------------------------------------------NDN-----ADM------------------------
Q88DW4_PSEPK/581-725---------------------------------------------PQP-----AKV------------------------
Q8EDF6_SHEON/666-811---------------------------------------------NTK-----ASV------------------------
Q9HV64_PSEAE/476-627---------------------------------------------KTP-----FDL------------------------
Q9HV64_PSEAE/692-837---------------------------------------------SQP-----AKV------------------------

PF04357

A2U1I0_9FLAO/1175-1633RE-------------NPDAILTQ------------TEEKSAVITGFDIFAKLNVNK------------------------
Q83EW1_COXBU/570-928AD------------------------------------------EKQTPWRTNINI------------------------
Q8YZJ8_NOSS1/1412-1829PE--------------------A----------TVTQQPPTRPNL--PVE--FADL------------------------
A4CK93_ROBBH/998-1431KDERRT-----IEAQRTLRE----------------------YEGLELEFDLDVTP------------------------
A3U6I2_CROAH/1185-1647KDNPDS-----ILTQTQEEESA-------------I------ISGFDIKTNIKVGK------------------------
A0LGH5_SYNFM/889-1254AE--------------------S----------DFVEIGSSDKTHDRYYSSLKTDV------------------------
A3HZ37_9BACT/1160-1620KENPDD-----ILTGQTEETTT-------------A------FSGYDIQAQLTADP------------------------
A5GSG8_SYNR3/973-1387PEASWD-----FQQPVVVRGPRVES-------ADGAAVRRRVPT-FGPLS--FRNL------------------------
A6L590_BACV8/1012-1461KTPKRI-----HDNVETNLYHHSN--------VRKTKEDDGPPMDLRINMLIEATP------------------------
Q2S2D2_SALRD/1057-1516STGRTP-----SVSQLTRRPNILA---------DRPAGVPSFVEGLNLDLNVIAPD------------------------
Q21Y28_RHOFT/928-1291PG-------------PSQAGTAA----------PTAPTASTAAAQ--ERVTPDVAI------------------------
Q6MKB2_BDEBA/958-1321KL-----------------------------------------LREGQFEAILLDL------------------------
Q39RU7_GEOMG/1016-1376---------------APPHEET-------------E-----------FPLALDIRI------------------------
Q7VBL9_PROMA/867-1309PEQNWD-----YKDPLVLFIEDKNS-------PANKLLRSGLPKGLSFIG--FDSL------------------------
Q8KFW2_CHLTE/1034-1479RR------------------PAPKP------VEAAAPPEKLEFHYNLLDILQIKNL------------------------
A6H009_FLAPJ/1018-1446RKDDFV-----NKTKNKKQKT---------------------YKGVELNFELDITK------------------------
B5E9K2_GEOBB/1121-1484---------------APAESARK------------P-----------FPLVLDGRV------------------------
Q11I59_CHESB/1185-1538LNP----------PPAVERTLEKA--------RVADDGTPM--PSQRPSVM-RLNV------------------------
A0A6N4SQC4_CYTH3/1167-1624DSSSLD-----PIMLRQNEEVIA-----------EK------ITGLDLSAKIHIDR------------------------
A7HQ23_PARL1/1042-1395GP---------------------------------GEADIVEEPEEAPPLPLMLDV------------------------
Q7MT86_PORGI/1036-1486PKSSRE-----RARQETSPDRPSL---------LLPATGGDPETDFHLVMNVGVTP------------------------
Q3AQ57_CHLCH/1053-1500RN----------------PKPKAPK------AKELKSGGSKEFYYSLIDILTIHNL------------------------
A1BDC7_CHLPD/1048-1494RY----------------PSQQSMV------AQTDLDSDPVGFNYSLIDILQLKDL------------------------
Q2RSJ7_RHORT/1146-1500GK------------------GQATS------ATQAVADREALRMAAQTPIPVLLDI------------------------
Q2S346_SALRD/1311-1689ER--------------------F-----------GLRLTSADTTTFDAYEALALDL------------------------
Q2INP6_ANADE/946-1304------------------------------------RPPPPPKPYDKSGEWLRFDL------------------------
Q9RUC9_DEIRA/223-627LPEEY------TTFPKPAAGSGQGK------GTTGTGSSTSPATTPLLERFLFEDV------------------------
Q1LSN0_BAUCH/634-981EQ--------------------L------------NLIPMLTNYKRIIALPIVTNL------------------------
B3ELK5_CHLPB/1036-1483RY---------------PEKIDPDQ------PENPEKPVNPEFYYTLIDIITIKNL------------------------
Q8YUC2_NOSS1/1659-2048----------------------S----------LTKFNKQDTPT-TASANTSFNNL------------------------
Q1MQI4_LAWIP/1025-1382NT----------------------------------------KTKKATYQQPTLSI------------------------
Q7VQN5_BLOFL/933-1286DK-----------------------------------FKPITNKPKNVGMLTISNL------------------------
Q31MA1_SYNE7/1177-1568----------------------N-----------LASGDLGAPTL--PVR--FQQL------------------------
E3G0N9_STIAD/1177-1560NGLLM-------NKRR---KPATAPAGTGGTGNAGTAEENA-SEEEKPAVQRTYEL------------------------
F4B3D6_DOKS4/1021-1426PE-------------EKEARIN------------GVQVITEAVKGLSVNFDLDIDP------------------------
Q46LW1_PROMT/887-1319PEQNWNQKEPLVLFIQD-----EDA-------PASRIVSAGLPNG--FESLTFDNL------------------------
TAMB_HAEIN/952-1298GP------------HKSKEE----------------LIKREFAAKTKSGMEIRSDL------------------------
Q5NNB3_ZYMMO/1036-1389-G-------------QVEDTAAH-----------QTKESSASASM--LASAWKLDI------------------------

PF13116

C6XK02_HIRBI/457-744---------------------------------------------IDEGSVDLPAF------------------------
Q7NW94_CHRVO/514-796---------------------------------------------LRQVTAVIDQL------------------------
Q7N037_PHOLL/501-786---------------------------------------------ASNLSAVIPNY------------------------
A4XQL3_PSEMY/513-798---------------------------------------------VSEVTANIPLL------------------------
Q3J7T7_NITOC/517-810---------------------------------------------VAEATVQITDL------------------------
D5CU11_SIDLE/524-805---------------------------------------------LQNIKVSIPDL------------------------
A1AVR0_RUTMC/242-525---------------------------------------------LQGMKVQILDM------------------------
Q31FH6_HYDCU/496-774---------------------------------------------GHDVVVDIKAL------------------------
B8GV04_THISH/540-825---------------------------------------------IQDATVVIEDY------------------------
Q07WQ4_SHEFN/504-791---------------------------------------------VDGARVSIPHL------------------------
Q5ZUN8_LEGPH/507-795---------------------------------------------LKQMNLRIDDI------------------------
Q7VFV2_HELHP/222-511---------------------------------------------LDGSEVTISNI------------------------
Q12IX1_SHEDO/530-817---------------------------------------------IDGAHVYIPEL------------------------
A6Q385_NITSB/202-483---------------------------------------------LQGSKVTIYHL------------------------
Q3IFH7_PSET1/493-781---------------------------------------------GSSVRVSISDL------------------------
D9SHW3_GALCS/523-805---------------------------------------------LHNLLITQPDM------------------------
Q21FT5_SACD2/542-827---------------------------------------------ISGAVIDLVKA------------------------
C6XD69_METGS/519-799---------------------------------------------ITKANIAIPGL------------------------
A7I2E8_CAMHC/213-497---------------------------------------------LTNSEVEIYKI------------------------
Q6LMA6_PHOPR/509-794---------------------------------------------ASRVTG-VSEL------------------------
D0L1I5_HALNC/561-853---------------------------------------------VDGSRVSIFDL------------------------
A8EUE5_ARCB4/193-478---------------------------------------------IEGSFVTIHNL------------------------
C5ZX33_9HELI/208-498---------------------------------------------LQGSQVAITNI------------------------
Q1H0H5_METFK/520-800---------------------------------------------ITKSKVVITNL------------------------
Q7MRT1_WOLSU/187-475---------------------------------------------LEGSQVGLRDI------------------------
A4G3G0_HERAR/587-887---------------------------------------------VSNVKAVVADL------------------------
D1B1Z5_SULD5/203-493---------------------------------------------IEKADVFIYNL------------------------
D3VKA4_XENNA/501-791---------------------------------------------INQVSAVIPDY------------------------
Q0ABM3_ALKEH/531-818---------------------------------------------VQRVEVTLADL------------------------
A0KFB2_AERHH/486-771---------------------------------------------SDSVHAWIPDL------------------------
A6TER2_KLEP7/497-781---------------------------------------------ASNLDAAIPDY------------------------
B7VIB8_VIBA3/505-791---------------------------------------------ADRITGRIPYL------------------------
Q5E7X4_ALIF1/495-780---------------------------------------------ATRVTGRIANL------------------------
Q6DAI1_PECAS/504-784---------------------------------------------GKNISAVIPDY------------------------
A0A2S9PIN0_YERPE/511-794---------------------------------------------GSNISAIIPDY------------------------
Q83BN5_COXBU/480-760---------------------------------------------LDHLKAVIPDL------------------------
Q8ZLP4_SALTY/504-786---------------------------------------------ASKLAAAIPDY------------------------
Q9KUU5_VIBCH/504-791---------------------------------------------AERITGRIPEL------------------------

PF13109

A6Q385_NITSB/623-836--------------NF--------------------------------LSK-G-EYE---L---------VLHGP--V-G
C5ZX33_9HELI/638-852--------------NI--------------------------------VTQ-G-RFS---I---------NANTNP-K-G
D3UGW6_HELM1/730-943--------------EL--------------------------------LHG-G-LFT---L---------IGAYK--D-S
Q30RQ8_SULDN/697-907--------------SK--------------------------------FKG-G-KME---FYI-------SGQLD--E--
Q7MRT1_WOLSU/616-829--------------EI--------------------------------ASG-G-RFD---L---------IGEYG--G-G
Q7VFV2_HELHP/731-944--------------DI--------------------------------FRG-G-LFN---F---------KGIYD--E-G
O25308_HELPY/745-958--------------DF--------------------------------VEG-G-LFT---L---------IGALE--D-Q
Q0PAY6_CAMJE/635-848--------------QA--------------------------------VQD-G-VFN---L---------SIKGS--GLE

PF13502

A0KFB2_AERHH/999-1241--------------TS-------P------------------------IGD-A-PGK---M---------ALDLSW-R-D
A1S2S6_SHEAM/1130-1371--------------TP-------G------------------------IKD-S-PLD---I---------SAELFW-Q-G
A1STZ9_PSYIN/1024-1262--------------SP-------M------------------------I-Y-S-KAE---L---------SGALNW-I-G
A1TW53_ACIAC/1117-1369--------------EG-------V------------------------LRR-G-KGR---M---------EGQVAW-M-G
A1WCZ7_ACISJ/1139-1390--------------DG-------V------------------------VRH-G-KGR---I---------GGQVGW-L-G
A1WSB5_VEREI/1101-1362--------------AH-------V------------------------VRH-G-KGL---L---------QGRVAW-L-G
A1WYY8_HALHL/891-1129--------------PR-------A------------------------V-TVA-DVD---I---------SAELGW-P-Q
A2U2U5_9FLAO/567-793--------------LESIAPIANT------------------------I-G-G-KMN---S---------KVNVSG-V-L
A3HUH0_9BACT/675-900--------------AQ-------N------------------------L-T-G-TFN---S---------NLNFSGVL-G
E0TB83_PARBH/837-1047--------------IE-------S------------------------V-W-GAAAA---F---------EATLPA-E-G
A4AMF6_MARSH/560-785--------------FKFLAPVASA------------------------L-Q-G-RMN---S---------DIELSG-S-L
A4CG41_ROBBH/574-799--------------FETLAPIASI------------------------V-E-G-KLN---S---------RVQLSG-L-L
A4VIB7_PSEU5/1014-1255--------------PS-------V------------------------T-S-E-SFR---L---------DADGRW-P-G
A5CF63_ORITB/620-836--------------KE-------SFL----------------------P-K-G-FAS---M---------QGTITT-N-G
A5FUN1_ACICJ/745-973--------------HGLA---LPL------------------------S-G-G-TVD---L---------GANLMA-Q-G
A6GWN8_FLAPJ/560-787--------------LKKIAPIAGI------------------------I-N-G-KLN---S---------NIKLSG-N-L
A7HEC2_ANADF/581-801--------------RK-------V------------------------I-G-G-TLD---A---------VLKLGG-T-G
A9CIC7_AGRFC/884-1105--------------GP-------V------------------------A-T-G-RVA---I---------DLTAES-T-G
A9H3V6_GLUDA/474-684--------------RT-------V------------------------L-Q-G-VFDDRQP---------SAPFAG-V-L
B7VIB8_VIBA3/1027-1268--------------TS-------G------------------------IQK-A-PFE---L---------EGQLTW-D-G
C1D9M5_LARHH/1015-1258--------------AD-------L------------------------VRG-G-KFR---S---------TGQLEW-Q-G
C3L4A9_AMOA5/534-754--------------DR-------H------------------------L-G-G-HVC---S---------DIELTI-Q-T
C4L8L8_TOLAT/989-1232--------------DP-------G------------------------L-T-GTKSQ---L---------DIDVSW-P-G
E8RSC3_ASTEC/1136-1358--------------LG-------D------------------------L-V-A-TAL---G---------DKRLSG-G-D
D9SHW3_GALCS/1021-1263--------------PN-------T------------------------VKN-G-SGK---M---------IANLSW-D-G
D5CU11_SIDLE/1024-1263--------------PE-------S------------------------LKD-G-SGS---L---------QSDLHW-A-G
C6WWM2_METML/1053-1294--------------AD-------T-I----------------------M-E-G-EGK---L---------TGQLRW-P-G
C6XD69_METGS/1043-1284--------------PG-------T------------------------VKG-G-EAD---L---------TGQLKW-P-G
C6XK02_HIRBI/884-1092--------------TD-------Y-L----------------------I-G-G-TLN---M---------NGVFGK-E-F
C7PC84_CHIPD/564-796--------------VQALMPVAKF------------------------L-N-G-KIN---S---------HLELTG-KLG
D2UF54_XANAP/1023-1265--------------GQ-------L------------------------R-G-G-EGR---L---------NLRAAW-P-G
Q0ABM3_ALKEH/1048-1290--------------PS-------V------------------------S-R-G-RTE---I---------DNDVAW-D-N
Q0AQ38_MARMM/879-1092--------------EG-------Y------------------------A-R-GGQVS---V---------LGS-AP-P-L
A0A6N4SMJ8_CYTH3/532-755--------------NK-------N------------------------L-K-G-DIS---A---------DVSLLM-Q-V
A0A6N4SME1_CYTH3/698-925--------------VKKMAPIANY------------------------V-E-G-NVN---L---------ALVMNG-L-L
Q145G0_PARXL/1154-1409--------------PR-------T------------------------LKA-G-AGS---L---------SGKMVW-Q-G
Q211X0_RHOPB/871-1087--------------MP----------------------------------A-G-KTS---L---------QMTLSS-Q-G
Q28TM9_JANSC/371-572--------------YE-------R------------------------L-Q-G-TGS---A---------SVEFLG-V-G
Q2KY05_BORA1/936-1183--------------KQ-------V------------------------MSG-G-SGS---V---------EANLSW-R-N
Q3IFH7_PSET1/1008-1245--------------TT-------A------------------------IKD-S-NAT---I---------NYNLAW-Q-A
Q5R0H7_IDILO/1003-1244--------------ET-------A------------------------V-R-DSAAV---I---------DFNLNW-R-D
Q7UYB4_RHOBA/752-985--------------SS-------S------------------------LAS-G-EIS---G---------EIS--L-R-G
Q8EA16_SHEON/1025-1268--------------NP-------G------------------------VDE-A-PLK---V---------NADLAW-Q-G
Q9ZDH9_RICPR/624-849--------------FT-------W------------------------S-G-G-KVS---I---------SGSLWT-N-G
E0SHA8_DICD3/1031-1273--------------AT-------P------------------------LRA-G-AFK---I---------DYDLYW-H-G
F4AYZ2_DOKS4/566-791--------------LQGLAPIAKA------------------------L-Q-G-ALN---T---------KIQLQG-Q-L
G2J3B5_PSEUL/1018-1258--------------GD-------T------------------------FRK-G-EGT---L---------GGKLHW-P-G
M1FEQ6_9ALTE/970-1216--------------DV-------P------------------------LEN-L-ATN---I---------ELALEW-P-G
Q0KCK4_CUPNH/1119-1370--------------AH-------T------------------------LSD-G-KGK---L---------EGRVAW-R-G
Q0VS66_ALCBS/1022-1263--------------PE-------M------------------------IES-E-DAT---A---------KVSLGW-A-Q
Q32B94_SHIDS/1009-1252--------------TT-------P------------------------IRQ-S-SFN---V---------DYDLHW-R-K
Q5ZUN8_LEGPH/1014-1261--------------NP-------A------------------------VDA-G-KGY---I---------EFHGGW-Q-G
Q63R38_BURPS/1120-1377--------------PR-------T------------------------VEN-G-RGT---L---------SGKVAW-R-G
Q6LMA6_PHOPR/1035-1276--------------SS-------G------------------------IQD-A-SFS---S---------YASIQW-Q-G
Q8P7K3_XANCP/1032-1273--------------GG-------Q------------------------LRG-G-EGQ---L---------ELNAGW-Q-G
Q9KUU5_VIBCH/1028-1269--------------NS-------G------------------------IQR-A-PFE---I---------TASTQW-D-G
Q9PEA2_XYLFA/983-1225--------------GE-------Q------------------------LRG-G-EGQ---I---------QLSAGW-N-G

PF05170

Q87TE2_VIBPA/1-570--------------KPWQELPFTINH----------------------INS-L-DLL-------------NADIEW-G-E
Q9KNJ9_VIBCH/1-570--------------SLWQTIAPSIYH----------------------INS-L-DLL-------------NSQLTL-N-G
Q9HU38_PSEAE/1-636-------------GQLLLDQSAQIAE----------------------WNG-L-KLS-------------VNQLRA-L-G
Q9KT66_VIBCH/1-595--------------NLDASFSDPSNQ----------------------IDS-A-KLK-------------LDTFEF-D-K
Q9JY87_NEIMB/8-615-------------GITISTTGSPSVR----------------------FNA-G-GAD-------------AAGLGLRA-D
Q9ZDI1_RICPR/1-711CSKNINIRDARLHYPNIELLANTNYD----------------------MER-N-NLE-------------SNIIVN-P-G
Q9HUT4_PSEAE/1-577--------------LALQDASKPFPL----------------------QAE-V-SAG-------------STRAAV-V-G
YHJG_ECOLI/1-582--------------LALRGEGTPFPV----------------------QAD-F-RSG-------------NTRVAF-D-G

PF05359

B2JQ93_PARP8/874-1021--------------D--V----SAK-----------------------LAA---N----------------GPITI-R-G
Q72DG8_DESVH/963-1109--------------S--A----GGT-----------------------LEG--------------------VPVKL-T-G
A9BMN7_DELAS/883-1036--------------E--L----RGR-----------------------AQG---T----------------ASLEI-T-G
Q2LUD1_SYNAS/534-687--------------F--L----KAR-----------------------VSP---R----------------GNVDV-T-G
A8ZWF7_DESOH/636-783--------------M--A----KGT-----------------------IDG---Y----------------APVRI-T-G
Q3A6W6_PELCD/375-529--------------Q--A----DLT-----------------------LNR---T----------------AHLSL-Q-G
Q5NYY7_AROAE/382-536--------------A--L----DFV-----------------------TDA---G----------------EKSSH-R-D
Q2KWF8_BORA1/759-906--------------K--V----GGR-----------------------VYT---T----------------APFSI-S-G
A2SI01_METPP/870-1017--------------K--I----SGK-----------------------VDG---A----------------APLEI-G-G
Q8Y0Z7_RALSO/615-766--------------Q--I----GAG-----------------------LGS---K----------------GKLDV-R-G
Q5QWM2_IDILO/380-527--------------K--F----EGE-----------------------VAE---Y----------------GLAQV-N-G
Q0VP61_ALCBS/592-737--------------N--L----SAQ-----------------------VDR---Y----------------APFSV-K-G
Q63NS2_BURPS/645-797--------------R--L----TAT-----------------------LNR---K----------------GSLEL-S-G
A0KK00_AERHH/368-522--------------T--L----SWA-----------------------LNN---Q----------------AKLDF-D-G
Q0JZH1_CUPNH/670-829--------------K--L----HAE-----------------------SGR---R----------------GVIGV-D-G
Q2LUD1_SYNAS/785-932--------------E--I----RGK-----------------------VDN---S----------------APVEI-L-G
A1ARF1_PELPD/790-937--------------D--L----RGN-----------------------LEN---R----------------SPLQI-T-G
Q39RS7_GEOMG/568-719--------------R--F----SAG-----------------------YGK---G----------------GALAA-S-G
B9M3X2_GEODF/795-942--------------D--L----RGD-----------------------LDK---H----------------SPLQI-T-G
Q8Y0Z7_RALSO/185-339--------------F--V----QPL-----------------------LAA---RID-------------GAPLHF-A-G
Q3JBN6_NITOC/584-731--------------S--L----EGT-----------------------VES---Y----------------GEMSM-T-G
Q5DZ89_ALIF1/399-549--------------D--F----FAS-----------------------VNS---K----------------GDISV-K-G
A9BMN7_DELAS/165-317--------------K--V----LPH-----------------------LSF---ALN-------------GSRFES-S-A
A9BMN7_DELAS/379-538--------------Q--VQPESAGE-----------------------GAK---P----------------AELQL-S-G
Q87WR1_PSESM/386-537--------------K--L----DTG-----------------------LGK---Q----------------GNLTA-T-G
B2JQ93_PARP8/616-770--------------D--L----QAT-----------------------VNG---K----------------GTLGV-K-G
A1K6C3_AZOSB/734-881--------------D--A----RGR-----------------------IQP---H----------------GEARA-E-G
Q603H4_METCA/718-865--------------Q--F----HGQ-----------------------VDR---Y----------------GAVDV-Y-G
Q88DW4_PSEPK/365-516--------------K--L----DTG-----------------------VGK---Q----------------GKLQA-A-G
A0KK00_AERHH/578-725--------------A--F----NGK-----------------------VDR---Y----------------APVTI-R-G
B5ECC6_GEOBB/569-721--------------T--F----AST-----------------------YGK---G----------------AGLKA-R-G
Q2LUD1_SYNAS/159-313--------------Y--I----EPE-----------------------FSA---VVN-------------GAPFHL-T-G
A4VPN2_PSEU5/551-698--------------N--I----AGK-----------------------VDQ---Y----------------APVSI-K-G
Q0VP61_ALCBS/382-530--------------Q--G----KAT-----------------------LQE---Q----------------GSLTH-S-G
A1K7K6_AZOSB/583-736--------------S--V----GAR-----------------------INR---A----------------GRLGI-E-G
Q3JBN6_NITOC/369-521--------------N--L----QFH-----------------------LNK---Q----------------GQLLA-R-G
Q5NYY7_AROAE/832-979--------------D--L----QGK-----------------------VDD---T----------------APVTI-S-G
Q13S79_PARXL/640-791--------------D--L----QAT-----------------------LNR---K----------------GTLGV-K-G
Q316X0_DESAG/862-1008--------------R--V----DGR-----------------------LNG--------------------VPLTL-Q-G
Q602F3_METCA/416-565--------------ALRL----ESV-----------------------VDR---K----------------GRISV-Q-G
Q2Y5K5_NITMU/673-818--------------D--I----RGA-----------------------VDK---T----------------APLKI-S-G
B3E4B8_GEOLS/816-963--------------D--L----RGN-----------------------LEN---H----------------SPLQI-T-G
A4VPN2_PSEU5/341-492--------------K--L----DTG-----------------------VGR---Q----------------GALQA-Q-G
Q5NYY7_AROAE/153-307--------------F--VEPELSAL-----------------------VNG---R-----------------PLQV-T-G
Q30NX8_SULDN/563-715--------------A--L----GLR-----------------------VNS---N----------------GSISS-N-G
Q5NYY7_AROAE/604-757--------------E--L----GAR-----------------------VNK---R----------------GRAAV-S-G
Q602F3_METCA/623-770--------------S--I----KGS-----------------------ISD---T----------------SPVTI-S-G
Q316X0_DESAG/389-538--------------S--V----GIS-----------------------MQG---A----------------GTAAL-K-G
A5G9K9_GEOUR/137-293--------------Y--I----TPR-----------------------FSA---VVN-------------GAPLHV-E-G
B2JHK1_PARP8/152-309--------------S--M----KGA-----------------------IKG---PSH-------------TGRVTF-D-G
A5G9K9_GEOUR/551-702--------------R--M----SAA-----------------------YAQ---G----------------GSLRA-S-G
A0KK00_AERHH/151-307--------------V--L----AAT-----------------------LNQ---Q----------------SPLKA-S-G
Q1H1L3_METFK/780-927--------------E--L----DGK-----------------------VDD---Y----------------GSARI-R-G
B9M7L7_GEODF/383-534--------------M--V----TGA-----------------------YGK---G----------------GSLKA-S-G
A4SXW3_POLAQ/414-561--------------A--M----DGV-----------------------VAN---S----------------GSMRA-K-G
B9M3X2_GEODF/564-715--------------R--F----NAS-----------------------YGG---G----------------AKLSA-K-G
A4G9D7_HERAR/154-308--------------Y--V----EPL-----------------------LSA---SIN-------------GSPLLI-K-G
Q21F55_SACD2/584-731--------------S--L----EGQ-----------------------VDE---Y----------------GLMRA-N-G
Q7NY28_CHRVO/704-851--------------T--L----DGA-----------------------VDQ---Y----------------GEVKV-R-G
Q0JZH1_CUPNH/164-317--------------V--T----RPT-----------------------LSA---RVN-------------GTPLAL-D-G
B3E4B8_GEOLS/367-514--------------E--I----SFN-----------------------GDS---A----------------ETFAA-S-G
Q2IFA1_ANADE/563-710--------------D--V----RLQ-----------------------VEG---A----------------SPVRV-T-G
A0A6N4SXE7_CYTH3/142-298--------------T--V----SGS-----------------------SIG---G----------------GNLSI-L-G
Q9HV64_PSEAE/140-291--------------T--L----VAT-----------------------GPN---G----------------GRLDW-E-G
Q3SGZ4_THIDA/733-880--------------E--L----DGK-----------------------VDD---Y----------------GSARV-R-G
Q3A6W6_PELCD/162-316--------------ITPY----LEA-----------------------VIN---G----------------RPLRV-D-G
Q316X0_DESAG/600-751--------------S--F----SGN-----------------------WLP---H----------------GRLAA-E-G
B9M7L7_GEODF/592-739--------------D--L----RGN-----------------------LEN---Q----------------SPLRI-T-G
Q222N5_RHOFT/496-646--------------N--T----DLK-----------------------LRE---G----------------GQFTA-Q-G
Q3A6W6_PELCD/805-951--------------S--F----AGE-----------------------LDD--------------------APIQG-E-G
A5G9K9_GEOUR/769-916--------------D--L----RGN-----------------------LEN---Q----------------SPLRI-T-G
A2SI01_METPP/623-775--------------E--L----ATA-----------------------LQH---G----------------GRLRA-S-G
Q083W9_SHEFN/492-642--------------Q--F----SAG-----------------------INQ---Q----------------SLLTS-T-G
Q083W9_SHEFN/725-872--------------D--L----AGK-----------------------IDK---Y----------------APVTL-K-G
Q12MK5_SHEDO/654-801--------------L--L----DGK-----------------------IDK---Y----------------APVVL-K-G
Q3SGZ4_THIDA/517-669--------------E--A----GFA-----------------------LRQ---G----------------GRVAA-S-G
A1ARF1_PELPD/573-725--------------R--C----STT-----------------------YGT---N----------------SPIRV-R-G
Q39RS7_GEOMG/801-948--------------D--L----RGN-----------------------LQN---L----------------SPLQI-T-G
Q603H4_METCA/502-653--------------D--A----AFV-----------------------VGQ---G----------------GEFKA-S-G
Q222N5_RHOFT/149-300--------------T--F----TAQ-----------------------SAR---G----------------GKMRW-K-G
A8ZWF7_DESOH/412-569--------------D--V----SAL-----------------------ING---A----------------APLNV-S-G
A4XYD1_PSEMY/354-505--------------R--L----DSG-----------------------LGR---Q----------------GKLQA-S-G
Q21F55_SACD2/154-306--------------E--F----SFA-----------------------TEQ---G----------------AKLSW-S-G
Q3SGZ4_THIDA/147-307--------------LLAA-----RL-----------------------PAQ---G----------------GTVKW-K-G
A7I315_CAMHC/662-807--------------D--F----NGL-----------------------VGK---N----------------GTGKI-K-I
Q74FC9_GEOSL/787-934--------------D--L----RGN-----------------------LEN---H----------------SPISI-T-G
A7H8M2_ANADF/367-518--------------A--L----SLV-----------------------WNG---R----------------GRLSV-K-G
Q5DZ89_ALIF1/610-757--------------D--I----SGN-----------------------IEK---Y----------------APVKV-K-G
A4XYD1_PSEMY/562-709--------------D--I----QGK-----------------------VDR---Y----------------APMSI-K-G
B3E4B8_GEOLS/583-736--------------Q--F----SSV-----------------------FNK---N----------------APIKV-S-G
Q1LGA7_CUPMC/681-840--------------K--L----HAE-----------------------SGR---K----------------GVMNI-D-G
B5ECC6_GEOBB/807-954--------------D--L----RGN-----------------------LEN---H----------------SPMQI-T-G
Q2IFA1_ANADE/358-509--------------T--A----SLA-----------------------WNG---R----------------GRLAV-K-G
A4XYD1_PSEMY/140-291--------------T--L----TAR-----------------------GPY---G----------------GHVDW-Q-G
A7H8M2_ANADF/165-318--------------A--F----AGT-----------------------TES---G----------------ETFRW-T-G
Q3A6W6_PELCD/588-738--------------A--L----SGR-----------------------EKQ---G----------------GTLRI-D-G
A7H8M2_ANADF/579-726--------------D--V----KLQ-----------------------VEG---A----------------SPVRV-A-G
A8ETY5_ARCB4/612-759--------------E--I----NGV-----------------------VDN---Y----------------GVAKI-T-G
Q30NX8_SULDN/772-919--------------E--I----DGG-----------------------VDE---Y----------------GSAKL-K-G
A4VPN2_PSEU5/125-276--------------R--L----TAT-----------------------GAS---G----------------GRIDW-Q-G
Q1LGA7_CUPMC/173-326--------------N--T----APS-----------------------LFA---KIN-------------GSPLAL-A-G
Q1H1L3_METFK/561-712--------------S--L----AFR-----------------------AKQ---G----------------GSFNA-S-G
Q222N5_RHOFT/710-857--------------E--L----DGR-----------------------VDE---F----------------GLARI-R-G
D0J281_COMT2/165-316--------------LPHL----AFD-----------------------LNG--------------------SKFDT-S-G
M1FB64_9ALTE/585-727--------------S--L----KGK-----------------------VNQ---V----------------GNLDM-S-G
Q63NS2_BURPS/160-304--------------F--V----EPK-----------------------LRA---RLD-------------GSPIAI-D-G
Q7VVF7_BORPE/156-309--------------D--V----QPR-----------------------VHM---RIN-------------GSPFDL-T-G
Q7VVF7_BORPE/538-685--------------T--L----KADG----------------------VQG---E----------------GALAM-Q-G
Q87WR1_PSESM/155-306--------------T--L----VAA-----------------------GPD---G----------------GQIDW-V-G
Q88DW4_PSEPK/140-291--------------T--L----VAS-----------------------GPN---G----------------GRIDW-K-G
Q88DW4_PSEPK/581-725--------------D--V----KGK-----------------------VDR---Y----------------APVTI-K-G
Q8EDF6_SHEON/666-811--------------D--I----KGK-----------------------IDR---Y----------------APVTL-K-G
Q9HV64_PSEAE/476-627--------------K--L----KTG-----------------------LGN---R----------------GQVQA-S-G
Q9HV64_PSEAE/692-837--------------D--I----KGK-----------------------VDK---Y----------------APVTI-A-G

PF04357

A2U1I0_9FLAO/1175-1633--------------EASV----TVVI---------------DEDTGDNFNV---SGDG-EFIF--NMVP-NGRLSL-T-G
Q83EW1_COXBU/570-928--------------KIIL-GD-QILL---------------DSLG---AKG---RLAG-ELTL--LKPP-NQVMTA-N-G
Q8YZJ8_NOSS1/1412-1829--------------RLNL-GD-DVRVTSQSLLGFLPGGEVFSQPI---LSF---DAEG-DLII--NGTL-AS-PLP-E-G
A4CK93_ROBBH/998-1431--------------EAEV----EIVV---------------DPQTGSSLKG---TGAG-LIFM--EINT-NGKFNM-W-G
A3U6I2_CROAH/1185-1647--------------EAVV----NVII---------------DEQTGDNLRI---QGDA-DLKF--NIYP-NGRTTL-T-G
A0LGH5_SYNFM/889-1254--------------VLDLPAS-GMAV---------------RGKG---LNA---QIVG-SLKI--EKSV-NGPVRL-V-G
A3HZ37_9BACT/1160-1620--------------KAKF----TVII---------------DPKTGDNLLV---SGSA-NLQM--DINP-NGRITL-S-G
A5GSG8_SYNR3/973-1387--------------RVAL-GP-QLRI--------------AAPPV---AEF---LTGG-LLTF--NGPAGPD-VRI-S-G
A6L590_BACV8/1012-1461--------------SATM----KIIM---------------DPVAGDNITA---TGNG-NLQV--NFFN-KGDFRM-F-G
Q2S2D2_SALRD/1057-1516--------------ESTV----NLVF---------------DPLVGDVVTV---VGSG-RVQL--QRE--EGDFSV-Y-G
Q21Y28_RHOFT/928-1291--------------TLDL-GP-DFQV---------------RGRG---LAT---RLEG-SLELRSAGR--SLTPSL-T-G
Q6MKB2_BDEBA/958-1321--------------QILL-SR-NIVI---------------KNSL---IDG---SVTG-QLQV--KGP--PTNPVL-L-G
Q39RU7_GEOMG/1016-1376--------------GVTL-GD-RVIV---------------KTEG---IDA---QLGG-SVDL--AILG-PDRVTS-T-G
Q7VBL9_PROMA/867-1309--------------KLRL-GP-DLRI--------------VSQPI---ASF---DAAG-TLIL--DGALDDT-LDL-R-G
Q8KFW2_CHLTE/1034-1479--------------RLSN-SA-PVKGTMI--------FDRIRGER---VEA---QMNNLSLVV--NKT--GQRFSL-F-G
A6H009_FLAPJ/1018-1446--------------DAEI----EVII---------------DKNSGHSLKG---RGAG-TLAL--EINT-LGKFKM-N-G
B5E9K2_GEOBB/1121-1484--------------KVVL-GD-KVRV---------------EASG---IDA---RLVG-DMDL--VLKG-IDNIES-S-G
Q11I59_CHESB/1185-1538--------------NINA-PA-RIFV---------------RGRG---LDA---ELGG-SVQV--TGPV-TSVQ-P-V-G
A0A6N4SQC4_CYTH3/1167-1624--------------NSTL----KILV---------------DPISGDSLSV---RGDA-DLNF--KMDA-SGQTNL-T-G
A7HQ23_PARL1/1042-1395--------------RLAI-GNPPARV---------------TGRG---INS---LWTG-SVTL--TGLA-EDPT-V-N-G
Q7MT86_PORGI/1036-1486--------------DAEV----DLIL---------------DPQTGDGLRG---SAGG-DLRI--DYHT-LGDLNV-F-G
Q3AQ57_CHLCH/1053-1500--------------RISS-PM-PLKYTTI--------FDRIRGEE---LET---TLSNLSLVV--NKN--SQRYRM-F-G
A1BDC7_CHLPD/1048-1494--------------KIRS-AE-QLKFRVI--------FDRTRGEE---LEA---AISGMQLMV--NKS--QQRYRL-F-G
Q2RSJ7_RHORT/1146-1500--------------TVSL-PR-RVYV---------------RGRG---VDS---EWEG-KLNV--GGTA-AAPK-V-V-G
Q2S346_SALRD/1311-1689--------------AVQI-QS-NTWL---------------RSSSNPEMNV---QFTG-DLDV--QKAA-LEDPQV-F-G
Q2INP6_ANADE/946-1304--------------QLVV-DG-DARI---------------ENDL---VRG---TVTG-DLTL--TGT--LASPGL-V-G
Q9RUC9_DEIRA/223-627--------------QLRA-SG-GIRL---------------DENL---ARA---EFSTPGLVV--SGT--AARPQV-R-G
Q1LSN0_BAUCH/634-981--------------LLHL-NN-DVQI---------------NAFG---LTA---NLLG-NLQI--TKSK-NRPLSM-N-G
B3ELK5_CHLPB/1036-1483--------------RLTS-AV-PLQYSMI--------FDRTRGEK---LEA---TLQNLSLNV--NKN--QQNYRL-F-G
Q8YUC2_NOSS1/1659-2048--------------ELEL-GK-NVEI--------------ARPPL---LSF---AATG-NLKV--NGSL-AD-PVP-V-G
Q1MQI4_LAWIP/1025-1382--------------ALSI-PN-RFFV---------------RSSM---FES---EWGG-NLTI--NKVI-TSPV-I-T-G
Q7VQN5_BLOFL/933-1286--------------IIHI-GS-DVNF---------------NGFG---LDV---KLKG-DLEI--SYD--ENNLNI-T-G
Q31MA1_SYNE7/1177-1568--------------KIAL-EE-GVSV--------------QSEPL---FRF---GATG-DLTL--DGPLGST-LSP-N-G
E3G0N9_STIAD/1177-1560--------------HVRA-PR-NLWV---------------RGAD---VNV---EIGM-PLND--FYVAYRHEAEI-F-G
F4B3D6_DOKS4/1021-1426--------------DAEV----EVVVD------------KANGST---LRG---RGVG-TLLI--QLDT-NGKFIM-N-G
Q46LW1_PROMT/887-1319--------------KLAL-GP-SLRL--------------VSQPL---ASF---ETNG-FLIL--NGAF-DETLDV-S-G
TAMB_HAEIN/952-1298--------------RINI-GK-DVSL---------------DAYG---LKT---NLDG-LLSV--KQD--KGNLGL-F-G
Q5NNB3_ZYMMO/1036-1389--------------RISA-PD-QLFV---------------AGMG---LES---EWEA-DLRV--RGT--ATAPNI-T-G

PF13116

C6XK02_HIRBI/457-744--------------HPAGAI---SE-----------------------YSA---TGRG-NL---------KALMEI-L-E
Q7NW94_CHRVO/514-796--------------GADVPW---LK-----------------------IDG---QVED-RL---------DRMLAF-T-V
Q7N037_PHOLL/501-786---------------RSKK----LL-----------------------IDA---DLLG-DG---------KDIHEY-F-T
A4XQL3_PSEMY/513-798--------------HDGKPP--RLK-----------------------LDG---KVQS-SL---------GDAIKL-L-R
Q3J7T7_NITOC/517-810--------------GAAIVP---LT-----------------------ITV---RAQG-GA---------EDAWRF-I-Q
D5CU11_SIDLE/524-805--------------LANNLL---LQ-----------------------VRG---EAAD-AT---------QRCLDY-I-G
A1AVR0_RUTMC/242-525---------------SKDKL--EIS-----------------------VVG---KINT-QS---------EILTQF-L-K
Q31FH6_HYDCU/496-774--------------DTKNIA---VQ-----------------------IKG---KAEG-DG---------KEAVAY-L-L
B8GV04_THISH/540-825--------------HNT-----VLQ-----------------------IQG---QVDG-PL---------QDMLRY-V-R
Q07WQ4_SHEFN/504-791---------------GKESL---LR-----------------------VEA---DITT-DA---------QAATKV-I-N
Q5ZUN8_LEGPH/507-795---------------GKDRE--TLL-----------------------IHG---IVHG-KA---------QQMLNF-V-M
Q7VFV2_HELHP/222-511--------------FTQPFGV-QIA-----------------------IRS---HNAM-LN---------NELSDL-L-H
Q12IX1_SHEDO/530-817---------------GENSL---LR-----------------------VEA---KLNT-QA---------LAATRV-L-Q
A6Q385_NITSB/202-483--------------GQSKSYI-DIL-----------------------IKI---KTR--FD---------KEIKKV-L-A
Q3IFH7_PSET1/493-781---------------MHADE---LV-----------------------VKI---DKQA-EL---------EKMHDF-F-A
D9SHW3_GALCS/523-805--------------SSAEPI---LE-----------------------LKG---EAEA-AN---------TTFLQF-I-Q
Q21FT5_SACD2/542-827--------------KDGKGH--GLR-----------------------IVG---AITG-NA---------AAAMKL-L-N
C6XD69_METGS/519-799--------------HVAEPV---LN-----------------------ITG---EASG-LV---------SDGIRF-I-N
A7I2E8_CAMHC/213-497--------------FDDDSGI-KIN-----------------------LHT---SAP--FD---------VKFNKI-L-E
Q6LMA6_PHOPR/509-794---------------SADGD---LK-----------------------LTV---DIAA-EG---------DAVRDY-M-L
D0L1I5_HALNC/561-853--------------DKAA-----LD-----------------------IAV---TAKA-PL---------SQLLGF-V-G
A8EUE5_ARCB4/193-478--------------TDEINGNVEVN-----------------------IKT---NSK--LD---------DNILGI-L-K
C5ZX33_9HELI/208-498--------------FQIPT-L-EIF-----------------------IQT---RST--LD---------DTISNL-L-K
Q1H0H5_METFK/520-800--------------ASHQPV---VS-----------------------IAS---EGQG-PV---------SHGIQY-L-N
Q7MRT1_WOLSU/187-475--------------WGEKPWL-DLL-----------------------IKT---EAV--LD---------ERIHKV-L-K
A4G3G0_HERAR/587-887--------------LANEPV---LE-----------------------IDG---RAAG-SL---------QDMVQY-T-V
D1B1Z5_SULD5/203-493--------------LTKGTGI-VVD-----------------------LKT---HAK--LD---------ASIHKI-L-H
D3VKA4_XENNA/501-791---------------SQKN----LF-----------------------IDA---ELSG-EG---------QNIHDY-F-N
Q0ABM3_ALKEH/531-818-----------------FEP--VLA-----------------------VQG---EVHG-SG---------EAYLDY-L-R
A0KFB2_AERHH/486-771---------------YPGAH---LY-----------------------VDA---KVEG-EG---------KAISDY-L-Q
A6TER2_KLEP7/497-781---------------AQEK----LL-----------------------IDA---DIKG-PG---------KEVGPY-F-N
B7VIB8_VIBA3/505-791---------------GEGGH---IE-----------------------IEA---KATA-SG---------NAVRNY-M-T
Q5E7X4_ALIF1/495-780---------------SEDGK---LT-----------------------IRA---TANG-SG---------KAVREY-M-T
Q6DAI1_PECAS/504-784---------------EKE-M---LL-----------------------IDG---ELDG-PG---------PEVGNY-F-H
A0A2S9PIN0_YERPE/511-794--------------LKEK-----LY-----------------------VDA---DVLG-EG---------RDVHDY-F-T
Q83BN5_COXBU/480-760----------------KDPV---LS-----------------------VSG---HSTS-NL---------ANGFKF-L-K
Q8ZLP4_SALTY/504-786---------------SKEK----LL-----------------------IDA---DING-PG---------KAVGPY-F-D
Q9KUU5_VIBCH/504-791---------------AELGH---IE-----------------------IEA---VASAQQG---------NAIRNY-M-M

PF13109

A6Q385_NITSB/623-836KM-RG-------RF-------SVQRAYIKNLQAFN---------------------------------------------
C5ZX33_9HELI/638-852AL-IG-------KL-------GILNTNINQLSILQ---------------------------------------------
D3UGW6_HELM1/730-943IF-SG-------EL-------KMQNTLFKNFVVLQ---------------------------------------------
Q30RQ8_SULDN/697-907-Y-SG-------TV-------NIVDTTIQDYKILN---------------------------------------------
Q7MRT1_WOLSU/616-829VF-KG-------KS-------FIWDTTLKNLNTLQ---------------------------------------------
Q7VFV2_HELHP/731-944IL-KG-------EI-------SMQNTIYQDLAIVQ---------------------------------------------
O25308_HELPY/745-958VF-NG-------EL-------KFQNTSLKNFALMQ---------------------------------------------
Q0PAY6_CAMJE/635-848YF-DG-------QI-------DFKNTYVKDLKGIN---------------------------------------------

PF13502

A0KFB2_AERHH/999-1241VP-YR-------PN--------V-PTLSGTADYQL---------------------------------------------
A1S2S6_SHEAM/1130-1371AP-HE-------FD--------L-GSLSGGLKFAL---------------------------------------------
A1STZ9_PSYIN/1024-1262AP-WS-------FN--------L-DSLKGTFSAKL---------------------------------------------
A1TW53_ACIAC/1117-1369AP-LN-------PD--------Y-RSMAGQINVNV---------------------------------------------
A1WCZ7_ACISJ/1139-1390SP-LS-------PD--------Y-RTMSGQMNVNV---------------------------------------------
A1WSB5_VEREI/1101-1362AP-FN-------PD--------Y-RSMTGQTHLNI---------------------------------------------
A1WYY8_HALHL/891-1129AP-WG-------VE--------L-ADLVGAVRVRM---------------------------------------------
A2U2U5_9FLAO/567-793DENMA-------PS--------L-KTITGNLFGKL---------------------------------------------
A3HUH0_9BACT/675-900QD-MM-------PL--------L-ASLDGNGLLKV---------------------------------------------
E0TB83_PARBH/837-1047GL-YG-------EF--------R----TGDLILRR---------------------------------------------
A4AMF6_MARSH/560-785KD-DF------TPD--------L-KTITGKVLAEL---------------------------------------------
A4CG41_ROBBH/574-799NSDFS-------PD--------L-MSLAGNVVAEV---------------------------------------------
A4VIB7_PSEU5/1014-1255SP-AW-------FA--------M-ARYSGSMQPRL---------------------------------------------
A5CF63_ORITB/620-836EN-LA-------DI--------M-NNFNVTAKFVA---------------------------------------------
A5FUN1_ACICJ/745-973DS-GR-------AW--------Q-RSLAGSLTASS---------------------------------------------
A6GWN8_FLAPJ/560-787NA-IE-M----TPD--------L-NTISGDLLGQL---------------------------------------------
A7HEC2_ANADF/581-801WN-AG-------LL--------T-KSVTGGVDGTL---------------------------------------------
A9CIC7_AGRFC/884-1105KS-VG-------EM--------L-KSAGGSGEVRA---------------------------------------------
A9H3V6_GLUDA/474-684TI-DP-------MT--------L-HKAPGAVRLA----------------------------------------------
B7VIB8_VIBA3/1027-1268SP-WG-------IK--------M-DTLDGNVKTQF---------------------------------------------
C1D9M5_LARHH/1015-1258GM-TS-------IQ--------W-PSLSGEITLSA---------------------------------------------
C3L4A9_AMOA5/534-754DK-QL-------HI-------DV-NSLKADIAVQL---------------------------------------------
C4L8L8_TOLAT/989-1232AL-VQ-------PR--------L-SALDGQIRMET---------------------------------------------
E8RSC3_ASTEC/1136-1358AV-IE-------GV--------Y-RNGQIDATLKG---------------------------------------------
D9SHW3_GALCS/1021-1263QP-FD-------FN--------Y-ASLDGTLKLDT---------------------------------------------
D5CU11_SIDLE/1024-1263AP-DT-------FA--------Y-SKLNGEIHLNV---------------------------------------------
C6WWM2_METML/1053-1294SP-HQ-------FD--------T-TRLSGELKFEV---------------------------------------------
C6XD69_METGS/1043-1284SP-HE-------FN--------S-AGLSGNLQLDA---------------------------------------------
C6XK02_HIRBI/884-1092GT-AE-------MF--------M-KDIRLKGAPIL---------------------------------------------
C7PC84_CHIPD/564-796QD-MM-------PL--------L-SSLTGDGNLLV---------------------------------------------
D2UF54_XANAP/1023-1265NP-DA-------VQ--------L-PILQGQLDVAV---------------------------------------------
Q0ABM3_ALKEH/1048-1290LP-HR-------FT--------L-AEMEGAVSLRI---------------------------------------------
Q0AQ38_MARMM/879-1092GT-DG-------PL---------------TARVEI---------------------------------------------
A0A6N4SMJ8_CYTH3/532-755DN-HL-------AI--------LPSSIICDADVTV---------------------------------------------
A0A6N4SME1_CYTH3/698-925DK-EM------MPI--------Y-STLNGKGSLGS---------------------------------------------
Q145G0_PARXL/1154-1409GP-TR-------ID--------Y-PTLNGNLAVDL---------------------------------------------
Q211X0_RHOPB/871-1087RS-GS-------AL--------A-SALTGSGLLTI---------------------------------------------
Q28TM9_JANSC/371-572ND-LH-------TI--------M-DGLEAEGDIAL---------------------------------------------
Q2KY05_BORA1/936-1183LP-WT-------HS--------L-VDISGHASLSL---------------------------------------------
Q3IFH7_PSET1/1008-1245AP-YN-------LD--------V-ASLSGNIDWRL---------------------------------------------
Q5R0H7_IDILO/1003-1244HL-YQ-------PD--------W-SSLSGEVVWDL---------------------------------------------
Q7UYB4_RHOBA/752-985KS-IQ-------SI----------DDLFGRFDFKL---------------------------------------------
Q8EA16_SHEON/1025-1268AP-YA-------FS--------L-ETLNGKVKFEL---------------------------------------------
Q9ZDH9_RICPR/624-849NS-LQ-------SQ--------L-YNLSTKSQFVI---------------------------------------------
E0SHA8_DICD3/1031-1273SP-WA-------PH--------I-PSLSGILKTDI---------------------------------------------
F4AYZ2_DOKS4/566-791DDNFS-------PI--------L-STISGDAFAEI---------------------------------------------
G2J3B5_PSEUL/1018-1258GL-TD-------YE--------L-PRVSGEMTVDF---------------------------------------------
M1FEQ6_9ALTE/970-1216RP-DQ-------FG--------L-KQLSGDISMTL---------------------------------------------
Q0KCK4_CUPNH/1119-1370SP-LS-------ID--------Y-PTLSGKLSLDL---------------------------------------------
Q0VS66_ALCBS/1022-1263WP-LA-------PN--------Y-LALNGQARVDI---------------------------------------------
Q32B94_SHIDS/1009-1252AP-WQ-------PD--------E-ATLNGIIHTQL---------------------------------------------
Q5ZUN8_LEGPH/1014-1261SL-YD-------FS--------L-SKLNGSMYLQL---------------------------------------------
Q63R38_BURPS/1120-1377GP-TA-------ID--------Y-PTLNGRLSLDL---------------------------------------------
Q6LMA6_PHOPR/1035-1276SP-WS-------IH--------R-ETLTGEIKTET---------------------------------------------
Q8P7K3_XANCP/1032-1273SP-TG-------FA--------L-GSLEGNLTVDA---------------------------------------------
Q9KUU5_VIBCH/1028-1269AP-WS-------MQ--------V-NTLQGKVDTKL---------------------------------------------
Q9PEA2_XYLFA/983-1225PP-VG-------FQ--------L-ASLSGDLKVTA---------------------------------------------

PF05170

Q87TE2_VIBPA/1-570WH-WQ-N----L---------EL-SIEDASLPASLWNA-TAKVSLQA-DSVRFQEQTAIEPRLNAIFTPENIQLQELSLD
Q9KNJ9_VIBCH/1-570VA-WE-N----L---------NL-SVEDYDLRHSLWQQQQAYLSLNA-DSAQWLATQWVEPSAELTLTPQGIELDGHSQV
Q9HU38_PSEAE/1-636EL-------------------KA-RELDKDTKFSGGLSIAP----------MNLREFLAGIGVTLPAMADANTLGKFELN
Q9KT66_VIBCH/1-595AN-AL-T----FSV-------AG-KAADMKLNAQGSASLMVNQAISK-VGLDALKLQAELEGAALPQSPMKLSLDS-QIA
Q9JY87_NEIMB/8-615TS-FR-N----LHL-------TA-QIPALALRNNSIKIETVNGAFTAGGEYARWDGSFKLDKANLHSGIANIGNAEISGS
Q9ZDI1_RICPR/1-711NL-IT-K----IQS-------NL-DKTNILLQADSLKPILDALKLKT-DELPPIINQKLILTTNVIRDPQAIKLQNINLS
Q9HUT4_PSEAE/1-577TL-TD-P----L---------NL-GALDLRLKLSG----------------TSMANLYPLTGITLPDTPAYSTDGHLLAR
YHJG_ECOLI/1-582VV-ND-P----M---------KM-GGVDLRLKFSG----------------DSLGDLYELTGVLLPDTPPFETDGRLVAK

PF05359

B2JQ93_PARP8/874-1021SVN---------PL-------I--PKPALDLTATA---------------------------------------------
Q72DG8_DESVH/963-1109TLN---------PV-------S--TPPFADIVFSM---------------------------------------------
A9BMN7_DELAS/883-1036QVN---------PL-------A--KPLALDIRAQM---------------------------------------------
Q2LUD1_SYNAS/534-687PVI---------MA-------P-RMSVR--LQVKA---------------------------------------------
A8ZWF7_DESOH/636-783AIN---------PL-------G--TDLFMDLDVKL---------------------------------------------
Q3A6W6_PELCD/375-529TLL---------PD-------P--LQGD--LLLQL---------------------------------------------
Q5NYY7_AROAE/382-536RLR---------LN-------P--FELE--GRVVA---------------------------------------------
Q2KWF8_BORA1/759-906TVQ---------PF-------A--QYLALDLKASA---------------------------------------------
A2SI01_METPP/870-1017TMH---------PL-------G--PRLATDITASA---------------------------------------------
Q8Y0Z7_RALSO/615-766NVV---------PQ-------P--LKAE--LRVNA---------------------------------------------
Q5QWM2_IDILO/380-527TVH---------AW-------H--PTRQTTINVRF---------------------------------------------
Q0VP61_ALCBS/592-737RLS------------------S--EPFSTDMQVSL---------------------------------------------
Q63NS2_BURPS/645-797NVT---------AQ-------P--LKVG--LKLNG---------------------------------------------
A0KK00_AERHH/368-522DFV---------LA-------P--FSLN--GEIKQ---------------------------------------------
Q0JZH1_CUPNH/670-829TVL---------PT-------V--PASR--LQLDL---------------------------------------------
Q2LUD1_SYNAS/785-932KIN---------PL-------S--GNLFLDLAASA---------------------------------------------
A1ARF1_PELPD/790-937TIN---------PL-------R--DDLFVDLTISF---------------------------------------------
Q39RS7_GEOMG/568-719RVT---------PV-------P--LAAK--GEITL---------------------------------------------
B9M3X2_GEODF/795-942KIN---------PL-------S--RELFADLKVRF---------------------------------------------
Q8Y0Z7_RALSO/185-339KTKPF-------AQ-------S--LESS--LNIKL---------------------------------------------
Q3JBN6_NITOC/584-731KSN---------LF-------A--LERATEFSAFA---------------------------------------------
Q5DZ89_ALIF1/399-549QAD---------AK-------Q--QAVM--ADIDV---------------------------------------------
A9BMN7_DELAS/165-317QSTPF-------TE-------Q--RQTA--VDLSL---------------------------------------------
A9BMN7_DELAS/379-538AL----------------------TDKQ--GQLAI---------------------------------------------
Q87WR1_PSESM/386-537DVN---------LN-------P--VSAR--LNVTT---------------------------------------------
B2JQ93_PARP8/616-770DVT---------AT-------P--LKLA--LKVDA---------------------------------------------
A1K6C3_AZOSB/734-881RIR---------PF-------A--PDELTDLEVRF---------------------------------------------
Q603H4_METCA/718-865QLS---------PL-------A--PKHFGDVSVAF---------------------------------------------
Q88DW4_PSEPK/365-516QVN---------LA-------P--IWAK--LDVST---------------------------------------------
A0KK00_AERHH/578-725GTN---------LL-------I--EQPVLDVAVTF---------------------------------------------
B5ECC6_GEOBB/569-721TLT---------PA-------P--FRYQ--GMMSV---------------------------------------------
Q2LUD1_SYNAS/159-313KSKPF-------DA-------D--REAS--LNLKL---------------------------------------------
A4VPN2_PSEU5/551-698SLT---------PF-------D--PLQSLDIATSF---------------------------------------------
Q0VP61_ALCBS/382-530EGQ---------LA-------P--LSIS--AKGAL---------------------------------------------
A1K7K6_AZOSB/583-736SLA---------LE-------P--LKGN--LELDL---------------------------------------------
Q3JBN6_NITOC/369-521HVT---------AL-------P--PSAD--LEIHL---------------------------------------------
Q5NYY7_AROAE/832-979EFN---------PF-------R--EDRYLDIAASV---------------------------------------------
Q13S79_PARXL/640-791DVT---------AT-------P--LKVA--VKVNA---------------------------------------------
Q316X0_DESAG/862-1008ALN---------PL-------V--SPPYSDLALRI---------------------------------------------
Q602F3_METCA/416-565SGS---------FD-------P--PEAE--LRLQV---------------------------------------------
Q2Y5K5_NITMU/673-818SVD---------AF-------G--RELNLDITASA---------------------------------------------
B3E4B8_GEOLS/816-963TVN---------PL-------R--DDLFVDLTISF---------------------------------------------
A4VPN2_PSEU5/341-492PLQ---------LN-------P--ISGQ--LAVTT---------------------------------------------
Q5NYY7_AROAE/153-307QS-RP-------FA-------P-DRETA--LGIDL---------------------------------------------
Q30NX8_SULDN/563-715SIK---------HT-------P--LEQK--GEFEF---------------------------------------------
Q5NYY7_AROAE/604-757TIA---------LD-------P--LKGN--LRVDL---------------------------------------------
Q602F3_METCA/623-770RIN---------PF-------L--FGTFADLSIRF---------------------------------------------
Q316X0_DESAG/389-538TLG---------LN-------P--LSGE--IQASL---------------------------------------------
A5G9K9_GEOUR/137-293KLRPF-------PK-------A--VEAS--ATVDL---------------------------------------------
B2JHK1_PARP8/152-309WMT---------IA-------S--KDSK--TTTTL---------------------------------------------
A5G9K9_GEOUR/551-702SVT---------PI-------P--LKLR--GEVAV---------------------------------------------
A0KK00_AERHH/151-307ELD---------IM-------S--GAGK--GKISL---------------------------------------------
Q1H1L3_METFK/780-927SVQ---------PF-------Q--ATEFTDLKLVF---------------------------------------------
B9M7L7_GEODF/383-534NFT---------PA-------P--LKIK--GEMAV---------------------------------------------
A4SXW3_POLAQ/414-561QAS---------FD-------D--PRRNHDILMTF---------------------------------------------
B9M3X2_GEODF/564-715NIT---------RE-------P--LRYN--GAVQV---------------------------------------------
A4G9D7_HERAR/154-308KTHPF-------AD-------T--VDAV--VDLNL---------------------------------------------
Q21F55_SACD2/584-731YLS---------AM-------D--PTKNSDIKLVF---------------------------------------------
Q7NY28_CHRVO/704-851ALS---------PM-------S--PTDSTDILLDF---------------------------------------------
Q0JZH1_CUPNH/164-317EVLPF-------AD-------S--RQTR--LNVNL---------------------------------------------
B3E4B8_GEOLS/367-514TAS---------LS-------P--ISAT--SRFNL---------------------------------------------
Q2IFA1_ANADE/563-710TLN---------PL-------Q--QDAYTELVVAS---------------------------------------------
A0A6N4SXE7_CYTH3/142-298QVN---------LL-------K--QVPDADINMKF---------------------------------------------
Q9HV64_PSEAE/140-291DLT---------LV-------P--ITSR--GHLSV---------------------------------------------
Q3SGZ4_THIDA/733-880VIQ---------PF-------R--ATDFTDLTLSF---------------------------------------------
Q3A6W6_PELCD/162-316RLAPF-------AE-------Q--LHTE--FDIRL---------------------------------------------
Q316X0_DESAG/600-751SLT---------RD-------P--LRAD--VRSST---------------------------------------------
B9M7L7_GEODF/592-739QIN---------PL-------R--SDLFVDLRVNF---------------------------------------------
Q222N5_RHOFT/496-646SVV---------PA-------N--GEVQ--ADVRL---------------------------------------------
Q3A6W6_PELCD/805-951SIN---------PL-------R--ADAATELQAQL---------------------------------------------
A5G9K9_GEOUR/769-916QIN---------PL-------R--DDLYADLKASF---------------------------------------------
A2SI01_METPP/623-775TAR---------PQ-------P--LALR--SKIDL---------------------------------------------
Q083W9_SHEFN/492-642QVD---------AL-------A--QTVN--AEIDF---------------------------------------------
Q083W9_SHEFN/725-872DVN---------PL-------L--AQPYLDLNLNF---------------------------------------------
Q12MK5_SHEDO/654-801KVN---------PF-------A--NKPFLDVDLSF---------------------------------------------
Q3SGZ4_THIDA/517-669TVI---------PA-------A--GSGR--IDVRL---------------------------------------------
A1ARF1_PELPD/573-725SIT---------PL-------P--FRFR--GTVRV---------------------------------------------
Q39RS7_GEOMG/801-948KLN---------PL-------R--DDLYADITVRF---------------------------------------------
Q603H4_METCA/502-653SLS---------QS-------L--DQAE--GTVRL---------------------------------------------
Q222N5_RHOFT/149-300TAS---------VN-------P--IRAS--GEVTL---------------------------------------------
A8ZWF7_DESOH/412-569QMV---------LT-------P--LSVE--SDVRL---------------------------------------------
A4XYD1_PSEMY/354-505TVQ---------LS-------P--TSAQ--LKVAT---------------------------------------------
Q21F55_SACD2/154-306NIS---------LA-------P--LASE--GSVAI---------------------------------------------
Q3SGZ4_THIDA/147-307DLA---------LN-------P--LASR--GEIGL---------------------------------------------
A7I315_CAMHC/662-807ITL---------PF-------N--YDQRSHMEVIF---------------------------------------------
Q74FC9_GEOSL/787-934RIN---------PL-------R--DDLYADIKVRF---------------------------------------------
A7H8M2_ANADF/367-518PVQ---------PF-------A--SKGT--LELDA---------------------------------------------
Q5DZ89_ALIF1/610-757EIN---------PL-------L--KQPYLDLDVVF---------------------------------------------
A4XYD1_PSEMY/562-709KLT---------PF-------D--PLNSLDIATSF---------------------------------------------
B3E4B8_GEOLS/583-736TVT---------PL-------P--FRFN--GTTSF---------------------------------------------
Q1LGA7_CUPMC/681-840QVT---------PT-------G--PAAQ--LQLDL---------------------------------------------
B5ECC6_GEOBB/807-954RLN---------PL-------R--DDLFVDLKISF---------------------------------------------
Q2IFA1_ANADE/358-509EVR---------PF-------G--DRGT--LALEA---------------------------------------------
A4XYD1_PSEMY/140-291QVS---------LS-------P--LASS--GSLQI---------------------------------------------
A7H8M2_ANADF/165-318TVR---------TE-------P--LRSA--GTLAF---------------------------------------------
Q3A6W6_PELCD/588-738KGT---------LA-------P--LAMN--LRVRT---------------------------------------------
A7H8M2_ANADF/579-726TLN---------PL-------Q--KEAYTQLTVAS---------------------------------------------
A8ETY5_ARCB4/612-759VVN---------PK-------N--IKILTDINMKF---------------------------------------------
Q30NX8_SULDN/772-919SVE---------AS-------N--IKSYMDLLFSF---------------------------------------------
A4VPN2_PSEU5/125-276DLN---------LQ-------P--LASR--GQLQV---------------------------------------------
Q1LGA7_CUPMC/173-326TMQPF-------AD-------S--REAN--LNINL---------------------------------------------
Q1H1L3_METFK/561-712KLA---------PA-------P--MQGD--IKVKL---------------------------------------------
Q222N5_RHOFT/710-857ELN---------PF-------A--PRNNTDINVVF---------------------------------------------
D0J281_COMT2/165-316EST---------PF-------T--DTRQTAMQLKW---------------------------------------------
M1FB64_9ALTE/585-727SIA---------TL-------G--TDQQSDLVLNL---------------------------------------------
Q63NS2_BURPS/160-304KTK---------PF-------A--QSRESSINLKF---------------------------------------------
Q7VVF7_BORPE/156-309VAR---------PF-------DTVPSST--LDVSF---------------------------------------------
Q7VVF7_BORPE/538-685SLT---------AQ-------P--LALK--SSVDL---------------------------------------------
Q87WR1_PSESM/155-306RIS---------LV-------P--ITSE--GTLKV---------------------------------------------
Q88DW4_PSEPK/140-291TLS---------LS-------P--IASE--GTLKV---------------------------------------------
Q88DW4_PSEPK/581-725ALN---------PF-------N--PLASLDIATSF---------------------------------------------
Q8EDF6_SHEON/666-811DIN---------PL-------L--DKPYLDLDLVF---------------------------------------------
Q9HV64_PSEAE/476-627QVV---------LD-------P--VSAR--LKVST---------------------------------------------
Q9HV64_PSEAE/692-837ELD---------PF-------D--PLKKLDITTSF---------------------------------------------

PF04357

A2U1I0_9FLAO/1175-1633TFEIA-S-GH-YELNLYGLV-NRRFNLATGGRVSW---------------------------------------------
Q83EW1_COXBU/570-928RITII-D-GT-FTT-----H-GRTLDIGPHSAVTF---------------------------------------------
Q8YZJ8_NOSS1/1412-1829VIRLT-G-GR-ISL-----F-TTEFTLA-RGYEQT---------------------------------------------
A4CK93_ROBBH/998-1431DFVVV-T-GS-YNLKY-GGVIDKTFRVEPGGTINW---------------------------------------------
A3U6I2_CROAH/1185-1647RYTVN-D-GH-YELSL-YNLVKRRFELRKGSTITW---------------------------------------------
A0LGH5_SYNFM/889-1254GLQTT-R-GT-YTF-----Q-DKELKIV-QGEVVF---------------------------------------------
A3HZ37_9BACT/1160-1620GYEIT-E-GH-YEMSL-YNLISKKFIINQGSRIVW---------------------------------------------
A5GSG8_SYNR3/973-1387VVKLL-K-GR-VSL-----L-TNVLKLD-ASNVNV---------------------------------------------
A6L590_BACV8/1012-1461SYVID-Q-GM-YKLSM-QEVIRKDFTLKSGGTVTF---------------------------------------------
Q2S2D2_SALRD/1057-1516SFDAT-S-GT-YLFTA-GEVFVRRFAI-SQGTITW---------------------------------------------
Q21Y28_RHOFT/928-1291SLRTV-R-GT-YRA-----Y-GQQLAIE-QGVLRF---------------------------------------------
Q6MKB2_BDEBA/958-1321KISME-RRSK-IIF-----K-DKVFDVQ-SGVIDF---------------------------------------------
Q39RU7_GEOMG/1016-1376AIRVI-K-GH-YST-----Y-GVKLEIV-RGRVFY---------------------------------------------
Q7VBL9_PROMA/867-1309LIRLR-K-GR-VNL-----F-TTTFALD-TREPNI---------------------------------------------
Q8KFW2_CHLTE/1034-1479SIDIT-G-GK-YTF-----S-NTSFELENSGRVAW---------------------------------------------
A6H009_FLAPJ/1018-1446DFQVY-E-GV-YNFKY-GGIIDKKFKIKPLGSISW---------------------------------------------
B5E9K2_GEOBB/1121-1484EIRVV-Q-GR-YRA-----Y-GMDLEIV-RGRIYY---------------------------------------------
Q11I59_CHESB/1185-1538GFRLI-R-GR-LSI-----L-TQRITFD-EGTVSL---------------------------------------------
A0A6N4SQC4_CYTH3/1167-1624TYVVN-D-GN-YKASL-ENLIVRKFNISRGSKIIW---------------------------------------------
A7HQ23_PARL1/1042-1395RIVSE-R-GT-LDF-----A-GKTFVLS-RGRVIF---------------------------------------------
Q7MT86_PORGI/1036-1486GLELL-S-GT-YNFNL-RQIVQKRFSIKEGSSVNF---------------------------------------------
Q3AQ57_CHLCH/1053-1500SVQVT-S-GT-YRF-----S-NASFELQPGGSITW---------------------------------------------
A1BDC7_CHLPD/1048-1494SVALS-D-GK-YRF-----S-NTNFDLEDGGKIVW---------------------------------------------
Q2RSJ7_RHORT/1146-1500TITTL-R-GQ-ADV-----L-GRTFSLR-KGEVRF---------------------------------------------
Q2S346_SALRD/1311-1689TIDVVERRSTLRQF-------GQEFQIT-EGSLTF---------------------------------------------
Q2INP6_ANADE/946-1304SLTMG-Q-GS-RAA-----FRGNEFTLT-HAVLEL---------------------------------------------
Q9RUC9_DEIRA/223-627QIVSQ-R-GS-VFL-----R-DNEFVIT-QSNVTF---------------------------------------------
Q1LSN0_BAUCH/634-981EIKIP-Y-GY-YHA-----Y-NKDLIIK-KGSLLF---------------------------------------------
B3ELK5_CHLPB/1036-1483AVNIS-S-GT-YRF-----S-NSNFDLEDGGRIVW---------------------------------------------
Q8YUC2_NOSS1/1659-2048TIRLR-K-GG-VNL-----F-TTQFNLT-RGYEHT---------------------------------------------
Q1MQI4_LAWIP/1025-1382ALTSI-R-GN-FNL-----L-GKQFSLA-KSTISF---------------------------------------------
Q7VQN5_BLOFL/933-1286QIQIP-S-GS-CKI-----Y-SKNLMVQ-KGQVLF---------------------------------------------
Q31MA1_SYNE7/1177-1568KLTLT-S-GQ-VNL-----F-TSTFVLD-RRQTSS---------------------------------------------
E3G0N9_STIAD/1177-1560TVRVL-R-GR-VDA-----L-GRRLDIQNNSEVRF---------------------------------------------
F4B3D6_DOKS4/1021-1426DFIAT-E-GV-FNFRYGGFI-TKDFILQQDANIRW---------------------------------------------
Q46LW1_PROMT/887-1319VIKLD-S-GY-VNL-----F-TTTFNLD-QSEPNV---------------------------------------------
TAMB_HAEIN/952-1298QINLT-K-GR-YAS-----F-GQDLLIR-KGLISF---------------------------------------------
Q5NNB3_ZYMMO/1036-1389DMRVI-R-GT-YTF-----A-GRRFDID-HGEIQF---------------------------------------------

PF13116

C6XK02_HIRBI/457-744GSRLNVCSR--YDL--------ACDQMRGEGGLEV---------------------------------------------
Q7NW94_CHRVO/514-796KSPVDGMLG--GFT--------GRIRAGGPASLKL---------------------------------------------
Q7N037_PHOLL/501-786RSPLANSVG--ETL--------DILQVGGQIAGNL---------------------------------------------
A4XQL3_PSEMY/513-798EAPI--GTA--EIV--------AGWQGEGPLSGRL---------------------------------------------
Q3J7T7_NITOC/517-810GSPLRKKYG--EFL--------EGIEVTGDTDLKL---------------------------------------------
D5CU11_SIDLE/524-805KSPVNGYLD--GFT--------EGIKASGDGRLGL---------------------------------------------
A1AVR0_RUTMC/242-525DAPLNDNVN--DVL--------GKFSLSGKVVGNV---------------------------------------------
Q31FH6_HYDCU/496-774KTPLAEKIGMASFL-------QEHTDLSGPVSVDL---------------------------------------------
B8GV04_THISH/540-825ESPLVRGLD--DLL--------DHSRAQGDSHLDL---------------------------------------------
Q07WQ4_SHEFN/504-791ASSLQDSVG--ATL--------DVVQIQKQINTTL---------------------------------------------
Q5ZUN8_LEGPH/507-795NSPLKKKLS--AL---------KILLIKGMLSLNL---------------------------------------------
Q7VFV2_HELHP/222-511TYHI--------NV--------PLRSVDSNLEVNL---------------------------------------------
Q12IX1_SHEDO/530-817ASPLKDSVG--ETL--------NSLQVRGAISARL---------------------------------------------
A6Q385_NITSB/202-483SYDV--------HI--------PIIHKKGILDSIV---------------------------------------------
Q3IFH7_PSET1/493-781ATPLASPLA--EIF--------KIVQGKGEASAGI---------------------------------------------
D9SHW3_GALCS/523-805QSPVRGYID--GFT--------DGMTASGNGHITL---------------------------------------------
Q21FT5_SACD2/542-827DSPIRAAIG--TAF--------DQWQVDGDVSAAI---------------------------------------------
C6XD69_METGS/519-799NSPLLHLAE--GFT--------PTLVTSGEGKLNL---------------------------------------------
A7I2E8_CAMHC/213-497AYDI--------RN--------PAVQSSGKAEIDV---------------------------------------------
Q6LMA6_PHOPR/509-794ATPLVDSVG--AAL--------TTVKVSGPVTSRL---------------------------------------------
D0L1I5_HALNC/561-853QTPLLGA----GSL--------NALKVTGQAGLDV---------------------------------------------
A8EUE5_ARCB4/193-478AYEI--------NL--------PVKQKSGITNANL---------------------------------------------
C5ZX33_9HELI/208-498SYHI--------SL--------PIKAPKTQIDANL---------------------------------------------
Q1H0H5_METFK/520-800SSPLIKITG--GFT--------EGLQASGTGKLAL---------------------------------------------
Q7MRT1_WOLSU/187-475AYKI--------KL--------PLHQKDSTTLAKL---------------------------------------------
A4G3G0_HERAR/587-887DSPVATWIG--HFT--------DETKASGNATLAL---------------------------------------------
D1B1Z5_SULD5/203-493AFKI--------DV--------PLTQTSGKTDAHV---------------------------------------------
D3VKA4_XENNA/501-791HSPLAGSIG--RAL--------DSLQLEGNVDGKL---------------------------------------------
Q0ABM3_ALKEH/531-818QMPLTARLL--NDV--------VPMALDGDHDLTL---------------------------------------------
A0KFB2_AERHH/486-771DSPLGGSVG--QAL--------REVEIRGPMKGSV---------------------------------------------
A6TER2_KLEP7/497-781TTPLKESLG--AAL--------DSLQLDGDVSARL---------------------------------------------
B7VIB8_VIBA3/505-791ASPLVDSVG--AAL--------TALKVSGDVSSEF---------------------------------------------
Q5E7X4_ALIF1/495-780ATPLVDSVG--AAL--------NSIQVDNRVDALL---------------------------------------------
Q6DAI1_PECAS/504-784QTPLKSSLG--TAL--------DELKIGGPVKGTL---------------------------------------------
A0A2S9PIN0_YERPE/511-794ATPLKDSVA--ETL--------DELQVGGKISGRL---------------------------------------------
Q83BN5_COXBU/480-760AAPL--SVA--KRM--------QSTTAQGPMNLNL---------------------------------------------
Q8ZLP4_SALTY/504-786ETPLKDSLG--STL--------AELQLDGDVNARL---------------------------------------------
Q9KUU5_VIBCH/504-791ATPLVDSVG--AAL--------TTIQVKGPVRSEF---------------------------------------------

PF13109

A6Q385_NITSB/623-836----------------------------------------------------------------N---LF---AF-----
C5ZX33_9HELI/638-852----------------------------------------------------------------N---LM---AF-----
D3UGW6_HELM1/730-943----------------------------------------------------------------N---LI---SL-----
Q30RQ8_SULDN/697-907----------------------------------------------------------------N---IL---AF-----
Q7MRT1_WOLSU/616-829----------------------------------------------------------------N---VI---AL-----
Q7VFV2_HELHP/731-944----------------------------------------------------------------N---VL---AL-----
O25308_HELPY/745-958----------------------------------------------------------------N---MI---NL-----
Q0PAY6_CAMJE/635-848----------------------------------------------------------------Q---LI---SF-----

PF13502

A0KFB2_AERHH/999-1241----------------------------------------------------------------E---GG---TL-----
A1S2S6_SHEAM/1130-1371----------------------------------------------------------------G---KG---SL-----
A1STZ9_PSYIN/1024-1262----------------------------------------------------------------T---DG---AI-----
A1TW53_ACIAC/1117-1369----------------------------------------------------------------E---SG---QF-----
A1WCZ7_ACISJ/1139-1390----------------------------------------------------------------E---AG---QF-----
A1WSB5_VEREI/1101-1362----------------------------------------------------------------E---SG---QF-----
A1WYY8_HALHL/891-1129----------------------------------------------------------------N---DG---RI-----
A2U2U5_9FLAO/567-793----------------------------------------------------------------I---NP---KL-----
A3HUH0_9BACT/675-900----------------------------------------------------------------A---ET---AL-----
E0TB83_PARBH/837-1047----------------------------------------------------------------A---PT---VA-----
A4AMF6_MARSH/560-785----------------------------------------------------------------L---SP---EI-----
A4CG41_ROBBH/574-799----------------------------------------------------------------L---AS---DI-----
A4VIB7_PSEU5/1014-1255----------------------------------------------------------------R---KG---QF-----
A5CF63_ORITB/620-836----------------------------------------------------------------K---DV---EI-----
A5FUN1_ACICJ/745-973----------------------------------------------------------------H---GI---TI-----
A6GWN8_FLAPJ/560-787----------------------------------------------------------------L---ST---TV-----
A7HEC2_ANADF/581-801----------------------------------------------------------------R---NG---AF-----
A9CIC7_AGRFC/884-1105----------------------------------------------------------------S---GL---VL-----
A9H3V6_GLUDA/474-684----------------------------------------------------------------N---DA---SI-----
B7VIB8_VIBA3/1027-1268----------------------------------------------------------------G---KG---II-----
C1D9M5_LARHH/1015-1258----------------------------------------------------------------E---SG---QF-----
C3L4A9_AMOA5/534-754----------------------------------------------------------------H---NG---LL-----
C4L8L8_TOLAT/989-1232----------------------------------------------------------------G---EG---IL-----
E8RSC3_ASTEC/1136-1358----------------------------------------------------------------E---DI---RI-----
D9SHW3_GALCS/1021-1263----------------------------------------------------------------G---QG---QF-----
D5CU11_SIDLE/1024-1263----------------------------------------------------------------G---KG---RF-----
C6WWM2_METML/1053-1294----------------------------------------------------------------R---KG---QI-----
C6XD69_METGS/1043-1284----------------------------------------------------------------R---HG---QI-----
C6XK02_HIRBI/884-1092----------------------------------------------------------------A---QV---FA-----
C7PC84_CHIPD/564-796----------------------------------------------------------------L---EG---AL-----
D2UF54_XANAP/1023-1265----------------------------------------------------------------R---NG---QL-----
Q0ABM3_ALKEH/1048-1290----------------------------------------------------------------D---DG---QI-----
Q0AQ38_MARMM/879-1092----------------------------------------------------------------R---DL---TL-----
A0A6N4SMJ8_CYTH3/532-755----------------------------------------------------------------Q---NG---EL-----
A0A6N4SME1_CYTH3/698-925----------------------------------------------------------------S---SL---KV-----
Q145G0_PARXL/1154-1409----------------------------------------------------------------R---HG---QI-----
Q211X0_RHOPB/871-1087----------------------------------------------------------------D---TA---RI-----
Q28TM9_JANSC/371-572----------------------------------------------------------------G---QG---AI-----
Q2KY05_BORA1/936-1183----------------------------------------------------------------E---KG---RF-----
Q3IFH7_PSET1/1008-1245----------------------------------------------------------------G---EG---HL-----
Q5R0H7_IDILO/1003-1244----------------------------------------------------------------E---KG---YL-----
Q7UYB4_RHOBA/752-985----------------------------------------------------------------G---DTRGAAV-----
Q8EA16_SHEON/1025-1268----------------------------------------------------------------G---KG---HL-----
Q9ZDH9_RICPR/624-849----------------------------------------------------------------N---NI---DV-----
E0SHA8_DICD3/1031-1273----------------------------------------------------------------G---KG---EI-----
F4AYZ2_DOKS4/566-791----------------------------------------------------------------L---TA---DV-----
G2J3B5_PSEUL/1018-1258----------------------------------------------------------------R---NG---RF-----
M1FEQ6_9ALTE/970-1216----------------------------------------------------------------E---DG---VI-----
Q0KCK4_CUPNH/1119-1370----------------------------------------------------------------E---NG---QI-----
Q0VS66_ALCBS/1022-1263----------------------------------------------------------------G---EC---RI-----
Q32B94_SHIDS/1009-1252----------------------------------------------------------------G---KG---EI-----
Q5ZUN8_LEGPH/1014-1261----------------------------------------------------------------K---NG---RI-----
Q63R38_BURPS/1120-1377----------------------------------------------------------------A---HG---QI-----
Q6LMA6_PHOPR/1035-1276----------------------------------------------------------------G---KG---II-----
Q8P7K3_XANCP/1032-1273----------------------------------------------------------------R---NG---QL-----
Q9KUU5_VIBCH/1028-1269----------------------------------------------------------------G---KG---VI-----
Q9PEA2_XYLFA/983-1225----------------------------------------------------------------R---NG---QL-----

PF05170

Q87TE2_VIBPA/1-570WQQGRVQVSGQFKPTHWQL---------------------------------------------D---TA---SV-----
Q9KNJ9_VIBCH/1-570WQ-GDVQVKGHITETSLNL---------------------------------------------A---QL---TI-----
Q9HU38_PSEAE/1-636TRLAGSRNSLNLEDLKLGL---------------------------------------------D---DT---AF-----
Q9KT66_VIBCH/1-595FDLTQNHLSVLLNKLTA-----------------------------------------------N---AL---SF-----
Q9JY87_NEIMB/8-615FKTPRHQTNFSLNSPLVWT---------------------------------------------E---NK---GL-----
Q9ZDI1_RICPR/1-711ATNSNITGEIVLKNLTENIIILHNLKINNFELFMSLIGVNNLSKIGILQLNGEVQKVKDTFNINN---KI---SV-----
Q9HUT4_PSEAE/1-577LKEEGGALF-------------------------------------------------------R---YE---NF-----
YHJG_ECOLI/1-582IDTEKSSVF-------------------------------------------------------D---YR---GF-----

PF05359

B2JQ93_PARP8/874-1021----------------------------------------------------------------H---GI---EL-----
Q72DG8_DESVH/963-1109----------------------------------------------------------------E---GL---DL-----
A9BMN7_DELAS/883-1036----------------------------------------------------------------R---DL---EL-----
Q2LUD1_SYNAS/534-687----------------------------------------------------------------D---GL---PI-----
A8ZWF7_DESOH/636-783----------------------------------------------------------------S---NM---EM-----
Q3A6W6_PELCD/375-529----------------------------------------------------------------D---GL---ST-----
Q5NYY7_AROAE/382-536----------------------------------------------------------------E---NF---QV-----
Q2KWF8_BORA1/759-906----------------------------------------------------------------K---GV---DL-----
A2SI01_METPP/870-1017----------------------------------------------------------------R---GI---DI-----
Q8Y0Z7_RALSO/615-766----------------------------------------------------------------Q---NL---SL-----
Q5QWM2_IDILO/380-527----------------------------------------------------------------R---NL---QI-----
Q0VP61_ALCBS/592-737----------------------------------------------------------------H---NY---EM-----
Q63NS2_BURPS/645-797----------------------------------------------------------------N---RL---DA-----
A0KK00_AERHH/368-522----------------------------------------------------------------Q---GL---PL-----
Q0JZH1_CUPNH/670-829----------------------------------------------------------------R---EV---EV-----
Q2LUD1_SYNAS/785-932----------------------------------------------------------------K---GV---DL-----
A1ARF1_PELPD/790-937----------------------------------------------------------------K---DI---EL-----
Q39RS7_GEOMG/568-719----------------------------------------------------------------R---RI---PL-----
B9M3X2_GEODF/795-942----------------------------------------------------------------T---DI---EL-----
Q8Y0Z7_RALSO/185-339----------------------------------------------------------------D---GL---EL-----
Q3JBN6_NITOC/584-731----------------------------------------------------------------R---NI---AL-----
Q5DZ89_ALIF1/399-549----------------------------------------------------------------K---SL---KL-----
A9BMN7_DELAS/165-317----------------------------------------------------------------Q---GV---DL-----
A9BMN7_DELAS/379-538----------------------------------------------------------------SARQ-L---PL-----
Q87WR1_PSESM/386-537----------------------------------------------------------------R---DI---DL-----
B2JQ93_PARP8/616-770----------------------------------------------------------------N---RL---DA-----
A1K6C3_AZOSB/734-881----------------------------------------------------------------D---NV---AM-----
Q603H4_METCA/718-865----------------------------------------------------------------R---NV---DM-----
Q88DW4_PSEPK/365-516----------------------------------------------------------------R---DI---DL-----
A0KK00_AERHH/578-725----------------------------------------------------------------N---NL---EL-----
B5ECC6_GEOBB/569-721----------------------------------------------------------------A---RL---PI-----
Q2LUD1_SYNAS/159-313----------------------------------------------------------------N---RL---GL-----
A4VPN2_PSEU5/551-698----------------------------------------------------------------R---QV---EL-----
Q0VP61_ALCBS/382-530----------------------------------------------------------------T---AL---PL-----
A1K7K6_AZOSB/583-736----------------------------------------------------------------R---DI---DL-----
Q3JBN6_NITOC/369-521----------------------------------------------------------------E---SL---SL-----
Q5NYY7_AROAE/832-979----------------------------------------------------------------K---DF---EL-----
Q13S79_PARXL/640-791----------------------------------------------------------------N---RL---DA-----
Q316X0_DESAG/862-1008----------------------------------------------------------------A---NL---DL-----
Q602F3_METCA/416-565----------------------------------------------------------------E---NL---GL-----
Q2Y5K5_NITMU/673-818----------------------------------------------------------------K---GI---DM-----
B3E4B8_GEOLS/816-963----------------------------------------------------------------K---DI---EL-----
A4VPN2_PSEU5/341-492----------------------------------------------------------------R---DI---DL-----
Q5NYY7_AROAE/153-307----------------------------------------------------------------D---GF---DF-----
Q30NX8_SULDN/563-715----------------------------------------------------------------K---NI---SL-----
Q5NYY7_AROAE/604-757----------------------------------------------------------------R---SV---DL-----
Q602F3_METCA/623-770----------------------------------------------------------------K---NV---DL-----
Q316X0_DESAG/389-538----------------------------------------------------------------N---NT---DL-----
A5G9K9_GEOUR/137-293----------------------------------------------------------------K---DI---AL-----
B2JHK1_PARP8/152-309----------------------------------------------------------------K---GV---DV-----
A5G9K9_GEOUR/551-702----------------------------------------------------------------Q---RI---PL-----
A0KK00_AERHH/151-307----------------------------------------------------------------G---KL---AL-----
Q1H1L3_METFK/780-927----------------------------------------------------------------R---NL---EM-----
B9M7L7_GEODF/383-534----------------------------------------------------------------Q---RI---PL-----
A4SXW3_POLAQ/414-561----------------------------------------------------------------R---NL---PL-----
B9M3X2_GEODF/564-715----------------------------------------------------------------K---NL---PI-----
A4G9D7_HERAR/154-308----------------------------------------------------------------D---NM---DL-----
Q21F55_SACD2/584-731----------------------------------------------------------------R---NV---SV-----
Q7NY28_CHRVO/704-851----------------------------------------------------------------H---NL---AL-----
Q0JZH1_CUPNH/164-317----------------------------------------------------------------D---GL---EV-----
B3E4B8_GEOLS/367-514----------------------------------------------------------------S---GI---KL-----
Q2IFA1_ANADE/563-710----------------------------------------------------------------E---GV---DL-----
A0A6N4SXE7_CYTH3/142-298----------------------------------------------------------------T---DI---QL-----
Q9HV64_PSEAE/140-291----------------------------------------------------------------K---DI---QL-----
Q3SGZ4_THIDA/733-880----------------------------------------------------------------R---NL---EM-----
Q3A6W6_PELCD/162-316----------------------------------------------------------------D---NL---DL-----
Q316X0_DESAG/600-751----------------------------------------------------------------R---NM---SL-----
B9M7L7_GEODF/592-739----------------------------------------------------------------T---GI---EL-----
Q222N5_RHOFT/496-646----------------------------------------------------------------K---QL---AL-----
Q3A6W6_PELCD/805-951----------------------------------------------------------------K---TL---DL-----
A5G9K9_GEOUR/769-916----------------------------------------------------------------T---DI---EL-----
A2SI01_METPP/623-775----------------------------------------------------------------D---SL---DL-----
Q083W9_SHEFN/492-642----------------------------------------------------------------S---NM---LL-----
Q083W9_SHEFN/725-872----------------------------------------------------------------D---KV---EL-----
Q12MK5_SHEDO/654-801----------------------------------------------------------------K---RV---EL-----
Q3SGZ4_THIDA/517-669----------------------------------------------------------------S---GL---SL-----
A1ARF1_PELPD/573-725----------------------------------------------------------------G---RL---PI-----
Q39RS7_GEOMG/801-948----------------------------------------------------------------A---DI---DL-----
Q603H4_METCA/502-653----------------------------------------------------------------G---RI---DL-----
Q222N5_RHOFT/149-300----------------------------------------------------------------E---NA---SL-----
A8ZWF7_DESOH/412-569----------------------------------------------------------------S---DV---AL-----
A4XYD1_PSEMY/354-505----------------------------------------------------------------Q---DI---DL-----
Q21F55_SACD2/154-306----------------------------------------------------------------E---GP---YL-----
Q3SGZ4_THIDA/147-307----------------------------------------------------------------E---GV---RL-----
A7I315_CAMHC/662-807----------------------------------------------------------------K---NV---AL-----
Q74FC9_GEOSL/787-934----------------------------------------------------------------T---DI---EL-----
A7H8M2_ANADF/367-518----------------------------------------------------------------V---DL---DL-----
Q5DZ89_ALIF1/610-757----------------------------------------------------------------K---SV---EL-----
A4XYD1_PSEMY/562-709----------------------------------------------------------------K---NV---EL-----
B3E4B8_GEOLS/583-736----------------------------------------------------------------A---KL---PI-----
Q1LGA7_CUPMC/681-840----------------------------------------------------------------R---EL---DI-----
B5ECC6_GEOBB/807-954----------------------------------------------------------------R---DI---EL-----
Q2IFA1_ANADE/358-509----------------------------------------------------------------E---EL---DV-----
A4XYD1_PSEMY/140-291----------------------------------------------------------------T---DG---RL-----
A7H8M2_ANADF/165-318----------------------------------------------------------------E---GI---QL-----
Q3A6W6_PELCD/588-738----------------------------------------------------------------A---KL---NL-----
A7H8M2_ANADF/579-726----------------------------------------------------------------Q---GV---DL-----
A8ETY5_ARCB4/612-759----------------------------------------------------------------Q---NI---AM-----
Q30NX8_SULDN/772-919----------------------------------------------------------------R---NL---SL-----
A4VPN2_PSEU5/125-276----------------------------------------------------------------S---KL---PL-----
Q1LGA7_CUPMC/173-326----------------------------------------------------------------D---GL---EV-----
Q1H1L3_METFK/561-712----------------------------------------------------------------A---GF---SL-----
Q222N5_RHOFT/710-857----------------------------------------------------------------K---NV---DM-----
D0J281_COMT2/165-316----------------------------------------------------------------E---HI---DL-----
M1FB64_9ALTE/585-727----------------------------------------------------------------E---NL---EL-----
Q63NS2_BURPS/160-304----------------------------------------------------------------D---GL---DV-----
Q7VVF7_BORPE/156-309----------------------------------------------------------------A---GL---EL-----
Q7VVF7_BORPE/538-685----------------------------------------------------------------A---RL---DL-----
Q87WR1_PSESM/155-306----------------------------------------------------------------T---DG---KM-----
Q88DW4_PSEPK/140-291----------------------------------------------------------------T---DG---KM-----
Q88DW4_PSEPK/581-725----------------------------------------------------------------K---RV---EL-----
Q8EDF6_SHEON/666-811----------------------------------------------------------------K---SV---EL-----
Q9HV64_PSEAE/476-627----------------------------------------------------------------R---DI---DL-----
Q9HV64_PSEAE/692-837----------------------------------------------------------------K---RV---EL-----

PF04357

A2U1I0_9FLAO/1175-1633----------------------------------------------------------------S---GD---PF----D
Q83EW1_COXBU/570-928----------------------------------------------------------------I---QS---PI---TN
Q8YZJ8_NOSS1/1412-1829----------------------------------------------------------------A---RF---TPNQGLD
A4CK93_ROBBH/998-1431----------------------------------------------------------------D---GD---PL----E
A3U6I2_CROAH/1185-1647----------------------------------------------------------------A---GD---PL----D
A0LGH5_SYNFM/889-1254----------------------------------------------------------------L---GT---PK---PD
A3HZ37_9BACT/1160-1620----------------------------------------------------------------N---GD---PM----D
A5GSG8_SYNR3/973-1387----------------------------------------------------------------A---VF---TPSLGLL
A6L590_BACV8/1012-1461----------------------------------------------------------------S---GD---PY----Q
Q2S2D2_SALRD/1057-1516----------------------------------------------------------------D---GS---PT----N
Q21Y28_RHOFT/928-1291----------------------------------------------------------------F---G----SY---DN
Q6MKB2_BDEBA/958-1321----------------------------------------------------------------N---DP---DE---IN
Q39RU7_GEOMG/1016-1376----------------------------------------------------------------A---GG---PI---DR
Q7VBL9_PROMA/867-1309----------------------------------------------------------------A---LF---APSMGLI
Q8KFW2_CHLTE/1034-1479----------------------------------------------------------------N---NE---EI---RD
A6H009_FLAPJ/1018-1446----------------------------------------------------------------D---GD---PL----N
B5E9K2_GEOBB/1121-1484----------------------------------------------------------------V---ND---PV---NR
Q11I59_CHESB/1185-1538----------------------------------------------------------------V---GD---LD-----
A0A6N4SQC4_CYTH3/1167-1624----------------------------------------------------------------T---GD---PL----D
A7HQ23_PARL1/1042-1395----------------------------------------------------------------S---GE---KP---ID
Q7MT86_PORGI/1036-1486----------------------------------------------------------------A---GN---PM----H
Q3AQ57_CHLCH/1053-1500----------------------------------------------------------------N---NV---DM---RS
A1BDC7_CHLPD/1048-1494----------------------------------------------------------------N---NV---GI---HE
Q2RSJ7_RHORT/1146-1500----------------------------------------------------------------D---GG---MP---ID
Q2S346_SALRD/1311-1689----------------------------------------------------------------N---GD---PF----T
Q2INP6_ANADE/946-1304----------------------------------------------------------------V---DR---NK---IE
Q9RUC9_DEIRA/223-627----------------------------------------------------------------S---GA---GL----Y
Q1LSN0_BAUCH/634-981----------------------------------------------------------------S---DE---ID----K
B3ELK5_CHLPB/1036-1483----------------------------------------------------------------N---NV---EI---RD
Q8YUC2_NOSS1/1659-2048----------------------------------------------------------------A---TF---RANQPRD
Q1MQI4_LAWIP/1025-1382----------------------------------------------------------------S---GS---VP---PN
Q7VQN5_BLOFL/933-1286----------------------------------------------------------------S---GP---IN----Q
Q31MA1_SYNE7/1177-1568----------------------------------------------------------------V---IF---RPDLGLD
E3G0N9_STIAD/1177-1560----------------------------------------------------------------G---G----PP---LA
F4B3D6_DOKS4/1021-1426----------------------------------------------------------------D---GD---PA----K
Q46LW1_PROMT/887-1319----------------------------------------------------------------A---VF---VPSMGLV
TAMB_HAEIN/952-1298----------------------------------------------------------------S---GQ---AT----Q
Q5NNB3_ZYMMO/1036-1389----------------------------------------------------------------T---GG---NP---PN

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------NI---KR-----
Q7NW94_CHRVO/514-796--------------------------------------------------------------------KL---EV-----
Q7N037_PHOLL/501-786--------------------------------------------------------------------HL---DI-----
A4XQL3_PSEMY/513-798--------------------------------------------------------------------QL---DV-----
Q3J7T7_NITOC/517-810--------------------------------------------------------------------NL---AM-----
D5CU11_SIDLE/524-805--------------------------------------------------------------------QL---DI-----
A1AVR0_RUTMC/242-525--------------------------------------------------------------------DL---II-----
Q31FH6_HYDCU/496-774----------------------------------------------------------------S---KI---WI-----
B8GV04_THISH/540-825--------------------------------------------------------------------SL---RI-----
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------DL---SI-----
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------RL---EI-----
Q7VFV2_HELHP/222-511--------------------------------------------------------------------NI---DI-----
Q12IX1_SHEDO/530-817--------------------------------------------------------------------DL---NI-----
A6Q385_NITSB/202-483--------------------------------------------------------------------NV---KL-----
Q3IFH7_PSET1/493-781--------------------------------------------------------------------EL---LI-----
D9SHW3_GALCS/523-805--------------------------------------------------------------------SA---QI-----
Q21FT5_SACD2/542-827--------------------------------------------------------------------SL---LV-----
C6XD69_METGS/519-799--------------------------------------------------------------------QL---NI-----
A7I2E8_CAMHC/213-497--------------------------------------------------------------------LL---DI-----
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------KL---DI-----
D0L1I5_HALNC/561-853--------------------------------------------------------------------SV---RA-----
A8EUE5_ARCB4/193-478--------------------------------------------------------------------VL---NF-----
C5ZX33_9HELI/208-498--------------------------------------------------------------------AL---KF-----
Q1H0H5_METFK/520-800--------------------------------------------------------------------NL---QI-----
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------KL---EV-----
A4G3G0_HERAR/587-887--------------------------------------------------------------------NL---TL-----
D1B1Z5_SULD5/203-493--------------------------------------------------------------------TL---DI-----
D3VKA4_XENNA/501-791--------------------------------------------------------------------HL---DI-----
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------AL---AI-----
A0KFB2_AERHH/486-771--------------------------------------------------------------------KL---DI-----
A6TER2_KLEP7/497-781--------------------------------------------------------------------HL---NI-----
B7VIB8_VIBA3/505-791--------------------------------------------------------------------QL---NI-----
Q5E7X4_ALIF1/495-780--------------------------------------------------------------------RL---DI-----
Q6DAI1_PECAS/504-784--------------------------------------------------------------------HL---DI-----
A0A2S9PIN0_YERPE/511-794--------------------------------------------------------------------HL---DI-----
Q83BN5_COXBU/480-760--------------------------------------------------------------------KL---RI-----
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------HL---DI-----
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------QL---NI-----

PF13109

A6Q385_NITSB/623-836-----I--------------------------------------------------NSVPALITFQNPG-----------
C5ZX33_9HELI/638-852-----I--------------------------------------------------DTIPSLLTFKTPG-----------
D3UGW6_HELM1/730-943-----I--------------------------------------------------DTIPSLVVFRNPN-----------
Q30RQ8_SULDN/697-907-----V--------------------------------------------------NTVPSLVTFSLPG-----------
Q7MRT1_WOLSU/616-829-----I--------------------------------------------------DSIPSLLIFKAPG-----------
Q7VFV2_HELHP/731-944-----I--------------------------------------------------DTIPALLTFRKPG-----------
O25308_HELPY/745-958-----I--------------------------------------------------NTIPSLIVFRNPH-----------
Q0PAY6_CAMJE/635-848-----I--------------------------------------------------DTVPSLLMFKSPT-----------

PF13502

A0KFB2_AERHH/999-1241-----R------EVNDKG-------------ARLLSLL--SLDSLL--------------RKLRLDFRD-----------
A1S2S6_SHEAM/1130-1371-----T------EISDKGARI------FSLFSLDSLLRKLSL-----------------------DFTD-----------
A1STZ9_PSYIN/1024-1262-----T------EVNDNGARL------LSLFSLDGIRRTLNN-----------------------EFNN-----------
A1TW53_ACIAC/1117-1369-----L------K------------------------ADPGLAKLLGVLSL-----QSLPRRLTLDFRD-----------
A1WCZ7_ACISJ/1139-1390-----L------Q------------------------ADPGLAKLLSVLSL-----QSLPRRFALDFRD-----------
A1WSB5_VEREI/1101-1362-----L------K------------------------ADPGLAKLLGVLSL-----QSLPRRLTLDFRD-----------
A1WYY8_HALHL/891-1129-----T------D------------------------VDPGAGRLVGLLGL-----RMLPRRILLDFAD-----------
A2U2U5_9FLAO/567-793-----T------A------------------------ENSKLLQV-----------------LSNNVSF-----------
A3HUH0_9BACT/675-900-----KDSKILEG------------------------ITSL--------------------------TK-----------
E0TB83_PARBH/837-1047-----R------LLS------------------IASLDGLE--------------------------NI-----------
A4AMF6_MARSH/560-785-----N------T------------------------SQSKVLSA-----------------IGDKLNF-----------
A4CG41_ROBBH/574-799-----T------G------------------------TRAKVLEA-----------------LDARMDF-----------
A4VIB7_PSEU5/1014-1255-----V------EVDGSAQALR----VFGVLNFNSIGR--RLR---------------------LDFSD-----------
A5CF63_ORITB/620-836-----T------D------------------------ISLDYLIDRVTQNN-----YVYDNLKKDINIA-----------
A5FUN1_ACICJ/745-973-----S------G------------------------LDLAGVGQTLGAAIQAPHPVGPIATAHALRGL-----------
A6GWN8_FLAPJ/560-787-----N------S------------------------SNSKVLSA-----------------LGAQVKF-----------
A7HEC2_ANADF/581-801-----F------G------------------------KDLVASVASPL----------AAKLPFAASRL-----------
A9CIC7_AGRFC/884-1105-----K------GLNPGA------------LPPILQAA--DGLQQPID----------APKVRPLVDQS-----------
A9H3V6_GLUDA/474-684-----Y------G------------------------W--M--------------------------QA-----------
B7VIB8_VIBA3/1027-1268-----S------DVSGAARLL-------GLFSLDSIIRKMQL-----------------------DFSD-----------
C1D9M5_LARHH/1015-1258-----T------RAEPGVG-----------RLLGLTTL--QSLGR----------------RLRFDFKD-----------
C3L4A9_AMOA5/534-754-----R------D------------------------FEPMQRL-------------------SAYVPE-----------
C4L8L8_TOLAT/989-1232-----R------EVKNT---------------GGNRLL--SLFSLNAI-----------VSRISFDFRD-----------
E8RSC3_ASTEC/1136-1358-----K------QIPALGQ-----------VLTLASLRGLS--------------------------DT-----------
D9SHW3_GALCS/1021-1263-----L------KMEPGIGK---------LLGILSLQA--LPKR------------------ITLDFTD-----------
D5CU11_SIDLE/1024-1263-----L------K------------------------VDPGAAKLLGVLSL-----QSIPKRITLDFTD-----------
C6WWM2_METML/1053-1294-----L------QVQPGVGRL------LGLLSLQSLPR--RLT---------------------LDFRD-----------
C6XD69_METGS/1043-1284-----L------KIQPGVG----------RLFSMLSLQ--NLPRR-----------------LTFDFRD-----------
C6XK02_HIRBI/884-1092-----L------AS----------------------LRGLT--------------------------DV-----------
C7PC84_CHIPD/564-796-----Q------K------------------------FGPIDQL-------------------ASTLNV-----------
D2UF54_XANAP/1023-1265-----L------ELNPGAGRV------LGLLSVAQLPR--RLM---------------------FDFRD-----------
Q0ABM3_ALKEH/1048-1290-----P------DLSPGAGRL------FGLLSVTTLPRRLAL-----------------------DFSD-----------
Q0AQ38_MARMM/879-1092-----V------QVPVLAR-----------ILAAGSFQGLG--------------------------AL-----------
A0A6N4SMJ8_CYTH3/532-755-----N------N------------------------FETMKRI-------------------ARFLDT-----------
A0A6N4SME1_CYTH3/698-925-----L------SNPV-----------------LGTVASLT--------------------------KM-----------
Q145G0_PARXL/1154-1409-----L------K------------------------VDPGVAKLLGVLSL-----QSLARFATLNFRD-----------
Q211X0_RHOPB/871-1087-----A------G------------------------LDAGVFVRVIAAGQSG-AAVDEDRLLQIVDPL-----------
Q28TM9_JANSC/371-572-----L------G------------------------LDLAGMLR-----------------NFDASFQ-----------
Q2KY05_BORA1/936-1183-----L------SVNSRTA----------RLLELLSFQ--SLQRIA---------------KLDFNPAN-----------
Q3IFH7_PSET1/1008-1245-----T------EVSDGGARV------FSLLSLDSLVRKLKL-----------------------DFRD-----------
Q5R0H7_IDILO/1003-1244-----A------EVSDGGARI------FSLLSLDSILRKLTL-----------------------DFRD-----------
Q7UYB4_RHOBA/752-985-----P------G------------------------LLAASR----------------------FLGP-----------
Q8EA16_SHEON/1025-1268-----S------QVSDKGARI------FSLFSLDSLVRKLSL-----------------------DFSD-----------
Q9ZDH9_RICPR/624-849-----N------NFSIDSFIEKI---NKSDYNVQNLDNDIN--------------------------SS-----------
E0SHA8_DICD3/1031-1273-----V------NVGTGQA----------GQLLRLVSFDALLRK------------------LQFDFSD-----------
F4AYZ2_DOKS4/566-791-----D------ADKM-----------------PL-------LNL-----------------LSQKLDF-----------
G2J3B5_PSEUL/1018-1258-----A------KVNPGAARL------LGVISLQSL-------PR----------------RIRLDFTD-----------
M1FEQ6_9ALTE/970-1216-----L------QQNNS--------------AQLF--------RVFNLLNT-----DTLWRRLQLDFSD-----------
Q0KCK4_CUPNH/1119-1370-----L------SVEPGAA----------RLLGVLSLQ-----GLL--------------RFAMLDFRT-----------
Q0VS66_ALCBS/1022-1263-----P------DTDTKTSFLR----LLGILNLGTIQRRL-----------------------RLDFSD-----------
Q32B94_SHIDS/1009-1252-----T------EINTGHA----------GQLLRL----LSVDALM--------------RELRFDFRD-----------
Q5ZUN8_LEGPH/1014-1261-----T------HLSPETEEKLGLGKLLSILSLQT--------IPR---------------RLKLDFSD-----------
Q63R38_BURPS/1120-1377-----L------K------------------------VDPGAAKLLGVLSL-----QGLARFLTLDFRD-----------
Q6LMA6_PHOPR/1035-1276-----S------GVGGAGRLL-------GLFSLDSIMRKLQL-----------------------DFSG-----------
Q8P7K3_XANCP/1032-1273-----L------EVDPGAGRV------LGLLSVAQLPRRLM-----------------------FDFRD-----------
Q9KUU5_VIBCH/1028-1269-----S------DVSGAARLL-------GLFSLDSIIRKMQL-----------------------DFSD-----------
Q9PEA2_XYLFA/983-1225-----L------ELKPGAGRV------LGLLSVTQLPRRLML-----------------------DFRD-----------

PF05170

Q87TE2_VIBPA/1-570-----QGLKWVIQSDDNKDW---WKAATSALQ-EVDIQELDIERSQIIQLA---------HEPFWQLSG-----------
Q9KNJ9_VIBCH/1-570-----TGVKWIAEQPQD---LLPFSQPLPAWQ-NLQIEHLDINNLQMIQTV---------NRPFWQASG-----------
Q9HU38_PSEAE/1-636-----SGR--FGIADF----------ARQSLRAQLKGDKLDLDRYLPAKAKQAQDAASATRKAEVDATV-----------
Q9KT66_VIBCH/1-595-----DGKADVTLADI------------PKVRFNLHSPEIDLDAFLGTKAQ----ESQPAPAKEAAASS-----------
Q9JY87_NEIMB/8-615-----DAPRLYVSTLQDTVNRLPQPRFISRLDGSLSVPNLQNWNAELNGTFDRQTVAAKFRYTHEDAPH-----------
Q9ZDI1_RICPR/1-711-----LNTNISIKGDINLANQKPKANQKPNFNLKLYSPLVNLDKIFSSNSA----INTSNKTNNPSNHN-----------
Q9HUT4_PSEAE/1-577-----NGK--VGASDLHGSLTFVARQPRPKLSGKLTSEQLRFADLGPLIGA-------DSNAEKQKRGQ-----------
YHJG_ECOLI/1-582-----NGR--IGDSDIHGSLVYTTGKPRPKLEGDVESRQLRLADLGPLIGVDSGKGAEKSKRSEQKKGE-----------

PF05359

B2JQ93_PARP8/874-1021-----T--------------------------------------------------------------------------
Q72DG8_DESVH/963-1109-----V--------------------------------------------------------------------------
A9BMN7_DELAS/883-1036-----P--------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687-----L--------------------------------------------------------------------------
A8ZWF7_DESOH/636-783-----V--------------------------------------------------------------------------
Q3A6W6_PELCD/375-529-----P--------------------------------------------------------------------------
Q5NYY7_AROAE/382-536-----G--------------------------------------------------------------------------
Q2KWF8_BORA1/759-906-----P--------------------------------------------------------------------------
A2SI01_METPP/870-1017-----T--------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766-----A--------------------------------------------------------------------------
Q5QWM2_IDILO/380-527-----P--------------------------------------------------------------------------
Q0VP61_ALCBS/592-737-----T--------------------------------------------------------------------------
Q63NS2_BURPS/645-797-----A--------------------------------------------------------------------------
A0KK00_AERHH/368-522-----S--------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829-----S--------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932-----P--------------------------------------------------------------------------
A1ARF1_PELPD/790-937-----S--------------------------------------------------------------------------
Q39RS7_GEOMG/568-719-----T--------------------------------------------------------------------------
B9M3X2_GEODF/795-942-----S--------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339-----P--------------------------------------------------------------------------
Q3JBN6_NITOC/584-731-----P--------------------------------------------------------------------------
Q5DZ89_ALIF1/399-549-----A--------------------------------------------------------------------------
A9BMN7_DELAS/165-317-----T--------------------------------------------------------------------------
A9BMN7_DELAS/379-538-----Q--------------------------------------------------------------------------
Q87WR1_PSESM/386-537-----R--------------------------------------------------------------------------
B2JQ93_PARP8/616-770-----A--------------------------------------------------------------------------
A1K6C3_AZOSB/734-881-----P--------------------------------------------------------------------------
Q603H4_METCA/718-865-----P--------------------------------------------------------------------------
Q88DW4_PSEPK/365-516-----R--------------------------------------------------------------------------
A0KK00_AERHH/578-725-----T--------------------------------------------------------------------------
B5ECC6_GEOBB/569-721-----R--------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313-----S--------------------------------------------------------------------------
A4VPN2_PSEU5/551-698-----T--------------------------------------------------------------------------
Q0VP61_ALCBS/382-530-----A--------------------------------------------------------------------------
A1K7K6_AZOSB/583-736-----L--------------------------------------------------------------------------
Q3JBN6_NITOC/369-521-----L--------------------------------------------------------------------------
Q5NYY7_AROAE/832-979-----T--------------------------------------------------------------------------
Q13S79_PARXL/640-791-----A--------------------------------------------------------------------------
Q316X0_DESAG/862-1008-----V--------------------------------------------------------------------------
Q602F3_METCA/416-565-----R--------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818-----P--------------------------------------------------------------------------
B3E4B8_GEOLS/816-963-----S--------------------------------------------------------------------------
A4VPN2_PSEU5/341-492-----R--------------------------------------------------------------------------
Q5NYY7_AROAE/153-307-----T--------------------------------------------------------------------------
Q30NX8_SULDN/563-715-----K--------------------------------------------------------------------------
Q5NYY7_AROAE/604-757-----L--------------------------------------------------------------------------
Q602F3_METCA/623-770-----T--------------------------------------------------------------------------
Q316X0_DESAG/389-538-----R--------------------------------------------------------------------------
A5G9K9_GEOUR/137-293-----P--------------------------------------------------------------------------
B2JHK1_PARP8/152-309-----V--------------------------------------------------------------------------
A5G9K9_GEOUR/551-702-----T--------------------------------------------------------------------------
A0KK00_AERHH/151-307-----A--------------------------------------------------------------------------
Q1H1L3_METFK/780-927-----N--------------------------------------------------------------------------
B9M7L7_GEODF/383-534-----T--------------------------------------------------------------------------
A4SXW3_POLAQ/414-561-----T--------------------------------------------------------------------------
B9M3X2_GEODF/564-715-----P--------------------------------------------------------------------------
A4G9D7_HERAR/154-308-----T--------------------------------------------------------------------------
Q21F55_SACD2/584-731-----P--------------------------------------------------------------------------
Q7NY28_CHRVO/704-851-----N--------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317-----A--------------------------------------------------------------------------
B3E4B8_GEOLS/367-514-----Q--------------------------------------------------------------------------
Q2IFA1_ANADE/563-710-----S--------------------------------------------------------------------------
A0A6N4SXE7_CYTH3/142-298-----K--------------------------------------------------------------------------
Q9HV64_PSEAE/140-291-----K--------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880-----T--------------------------------------------------------------------------
Q3A6W6_PELCD/162-316-----V--------------------------------------------------------------------------
Q316X0_DESAG/600-751-----A--------------------------------------------------------------------------
B9M7L7_GEODF/592-739-----S--------------------------------------------------------------------------
Q222N5_RHOFT/496-646-----A--------------------------------------------------------------------------
Q3A6W6_PELCD/805-951-----T--------------------------------------------------------------------------
A5G9K9_GEOUR/769-916-----S--------------------------------------------------------------------------
A2SI01_METPP/623-775-----R--------------------------------------------------------------------------
Q083W9_SHEFN/492-642-----S--------------------------------------------------------------------------
Q083W9_SHEFN/725-872-----T--------------------------------------------------------------------------
Q12MK5_SHEDO/654-801-----T--------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669-----E--------------------------------------------------------------------------
A1ARF1_PELPD/573-725-----T--------------------------------------------------------------------------
Q39RS7_GEOMG/801-948-----T--------------------------------------------------------------------------
Q603H4_METCA/502-653-----K--------------------------------------------------------------------------
Q222N5_RHOFT/149-300-----P--------------------------------------------------------------------------
A8ZWF7_DESOH/412-569-----A--------------------------------------------------------------------------
A4XYD1_PSEMY/354-505-----R--------------------------------------------------------------------------
Q21F55_SACD2/154-306-----P--------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307-----A--------------------------------------------------------------------------
A7I315_CAMHC/662-807-----K--------------------------------------------------------------------------
Q74FC9_GEOSL/787-934-----S--------------------------------------------------------------------------
A7H8M2_ANADF/367-518-----A--------------------------------------------------------------------------
Q5DZ89_ALIF1/610-757-----T--------------------------------------------------------------------------
A4XYD1_PSEMY/562-709-----T--------------------------------------------------------------------------
B3E4B8_GEOLS/583-736-----Q--------------------------------------------------------------------------
Q1LGA7_CUPMC/681-840-----A--------------------------------------------------------------------------
B5ECC6_GEOBB/807-954-----S--------------------------------------------------------------------------
Q2IFA1_ANADE/358-509-----V--------------------------------------------------------------------------
A4XYD1_PSEMY/140-291-----R--------------------------------------------------------------------------
A7H8M2_ANADF/165-318-----P--------------------------------------------------------------------------
Q3A6W6_PELCD/588-738-----K--------------------------------------------------------------------------
A7H8M2_ANADF/579-726-----S--------------------------------------------------------------------------
A8ETY5_ARCB4/612-759-----Q--------------------------------------------------------------------------
Q30NX8_SULDN/772-919-----N--------------------------------------------------------------------------
A4VPN2_PSEU5/125-276-----K--------------------------------------------------------------------------
Q1LGA7_CUPMC/173-326-----A--------------------------------------------------------------------------
Q1H1L3_METFK/561-712-----K--------------------------------------------------------------------------
Q222N5_RHOFT/710-857-----V--------------------------------------------------------------------------
D0J281_COMT2/165-316-----A--------------------------------------------------------------------------
M1FB64_9ALTE/585-727-----P--------------------------------------------------------------------------
Q63NS2_BURPS/160-304-----P--------------------------------------------------------------------------
Q7VVF7_BORPE/156-309-----E--------------------------------------------------------------------------
Q7VVF7_BORPE/538-685-----A--------------------------------------------------------------------------
Q87WR1_PSESM/155-306-----K--------------------------------------------------------------------------
Q88DW4_PSEPK/140-291-----K--------------------------------------------------------------------------
Q88DW4_PSEPK/581-725-----T--------------------------------------------------------------------------
Q8EDF6_SHEON/666-811-----T--------------------------------------------------------------------------
Q9HV64_PSEAE/476-627-----R--------------------------------------------------------------------------
Q9HV64_PSEAE/692-837-----T--------------------------------------------------------------------------

PF04357

A2U1I0_9FLAO/1175-1633ASLD-VSAIYKIETTASPLMAAQISDEDPSVKNKFKQVLPF-----------NVYLNIDG---DLLQPK--------ISF
Q83EW1_COXBU/570-928PMLS-VRAIRTMKTS---------------PIVPQLGGPTV-----------TVGLDVEG---TLHHPE--------VAL
Q8YZJ8_NOSS1/1412-1829PILD-VRLVAIVPEASTRS------DRILESPFSAEISD-VSANNFGTLRTVRVQARATG---PASELTN------NLEL
A4CK93_ROBBH/998-1431AILN-MEAVYSLNANPA----------PLLESSGYTPSIPT-----------EVIVRLTG---ELEQPT--------VDF
A3U6I2_CROAH/1185-1647ATLD-ASAIYRVKTSASALMASTTSGADISTKQRFRQELPF-----------LVYLNVDG---QLDEPK--------LTF
A0LGH5_SYNFM/889-1254PALR-ILCEKQV--------------------------KDV-----------IVQVHVTG---PISQPK--------LVL
A3HZ37_9BACT/1160-1620ASMD-IQAIYEVDASASALMATQISGSSQSTQTQYQRRLPF-----------LVYLNVDG---ELLKPE--------ISF
A5GSG8_SYNR3/973-1387PYLD-VAFTTRVSDRVGGIDG---DQVVSSNELQGN-----FSNLD-RLNLIKVIVAYSG---PSDRLSL-----DTMTL
A6L590_BACV8/1012-1461ANLD-LQAVYTVNSASLS--------DLVVDPSRNQGTVKV-----------NCLMNLTG---NLSNPD--------IKF
Q2S2D2_SALRD/1057-1516AQLD-LDAEYRTRASPS----------GLPGFDGYSGRIPV-----------TVQLAISG---RVASPQ--------VDL
Q21Y28_RHOFT/928-1291PALD-ILALRPN---------------------L-----QQ-----------RVGVQISG---TALSPV--------VRL
Q6MKB2_BDEBA/958-1321PNLY-ISAASRI--------------------------NEY-----------DITLLAQG---PSKSPT--------ILL
Q39RU7_GEOMG/1016-1376PTLD-FLALRTE---------------------G-----DV-----------KAGVTVTG---TADQPV--------VKL
Q7VBL9_PROMA/867-1309PYLD-ITMTTRVPDVIQDPT-----KLDSTSDFASNGSG-AVGIG--GSRFVKVELVATG---PADRVSE------TFQL
Q8KFW2_CHLTE/1034-1479GRLIDIYGVKQVTA----------------TDVQTGERDNV-----------RLLIAVSG---TIEKPD--------VRM
A6H009_FLAPJ/1018-1446ATLN-MEAVYVTEANPG----------ILLENSSFTKKIPT-----------EVVIKLTD---KLTSPT--------PDI
B5E9K2_GEOBB/1121-1484PTLD-ILALRTV---------------------G-----DV-----------KAGVTVGG---FLNTPV--------VKL
Q11I59_CHESB/1185-1538PFLD-FVARSEG--------------------------RDI-----------TVFITVRG---RVSEPE--------VIF
A0A6N4SQC4_CYTH3/1167-1624ALID-IKATYTTKTAPDGLL----VNSAVIDSSAMRKPLPF-----------IVVMSMQG---ELLKPT--------ISF
A7HQ23_PARL1/1042-1395PRLD-IALDYSR--------------------------SDF-----------DATISVTG---RGSAPK--------IGL
Q7MT86_PORGI/1036-1486ATLN-VTAEYNLTANLNDL-------DESLVSDVRRTTIPV-----------NCLLQING---AMLQPA--------VSF
Q3AQ57_CHLCH/1053-1500GVLENLYGRKYINA----------------LNPQSGERDDV-----------HLLLAMTG---TLNEPQ--------VAM
A1BDC7_CHLPD/1048-1494GIMQNLYGTKYISA----------------LSPETGDRDNV-----------KLLLAISG---TISEPN--------VEM
Q2RSJ7_RHORT/1146-1500PLLD-VVAANDT--------------------------GEV-----------VALVSVSG---TASDPQ--------IGF
Q2S346_SALRD/1311-1689PYLD-LSAVYDQR-------------------AQGSQGSEV-----------RITLSLSG---RPDNLS--------PAL
Q2INP6_ANADE/946-1304IVLD-VNGDAQV--------------------------RDY-----------QVFMHAFG---PLEQPR--------VTL
Q9RUC9_DEIRA/223-627PTFT-LTARGTV--------------------PSPTTRQQV-----------PVALNVTGKFRTTDGLQGVLDLDTRLSC
Q1LSN0_BAUCH/634-981PDIN-IEAIRDP----------------------NTTEDNI-----------ITGVRVTG---KIQSPK--------LEI
B3ELK5_CHLPB/1036-1483GVMLNLFGRKYVNA----------------SNAQTGESDNV-----------RLLLAIQG---TLNNPD--------VQM
Q8YUC2_NOSS1/1659-2048PDLD-IQLLAKVLEVVQ----------NSDLNR-------VNSVGLGALETVRVEANIKG---PASRLNE------SLEL
Q1MQI4_LAWIP/1025-1382PLLN-ISLTYSS--------------------------PSI-----------TAIGIIKG---TTSNPN--------ITF
Q7VQN5_BLOFL/933-1286VYLN-VEAIQKIN------------------VVSCNMKDPV-----------IAGIRIIG---MVDKLK--------LEF
Q31MA1_SYNE7/1177-1568PFLN-VNLVASIPEFSGST------LQTGSDRIVLPFQSDPSQSGFGRFQLVRVRAQVNT---LASNLQS------SIQL
E3G0N9_STIAD/1177-1560PYLN-ITAEHDN------------------------ERENV-----------KVFIHVRG---QGKDFT--------IEP
F4B3D6_DOKS4/1021-1426ALLD-VSAIYRTQANPG----------TLLQTSTVNRKIPV-----------NVVINLDG---ELLKPD--------ITF
Q46LW1_PROMT/887-1319PYID-VTLNSRVPDNVRDVSN---FSSNGMASFGIGGSRFV-----------NVEVAASG---PADRISE------NFQL
TAMB_HAEIN/952-1298PTLN-IEAIRNP---------------------ETMEDSKI-----------TAGVRVIG---IADSPE--------VTI
Q5NNB3_ZYMMO/1036-1389PALD-ITAEATV--------------------------DDI-----------TATVKIGG---FANKPE--------ITF

PF13116

C6XK02_HIRBI/457-744-----PM-------------------------------------------------------------------------
Q7NW94_CHRVO/514-796-----PLA-----GKD--ST------------------------------------------------------------
Q7N037_PHOLL/501-786-----PLN-----GGN---V------------------------------------------------------------
A4XQL3_PSEMY/513-798-----PLQ-----KG----PKP----------------------------------------------------------
Q3J7T7_NITOC/517-810-----LLGNK--K------KRP----------------------------------------------------------
D5CU11_SIDLE/524-805-----PLD-----SDE--PV------------------------------------------------------------
A1AVR0_RUTMC/242-525-----SLD-------E---TEP----------------------------------------------------------
Q31FH6_HYDCU/496-774-----PVYGY-DKKEE----------------------------------------------------------------
B8GV04_THISH/540-825-----PLT-----RREGGTANT----------------------------------------------------------
Q07WQ4_SHEFN/504-791-----PLYE----GG-----EQ----------------------------------------------------------
Q5ZUN8_LEGPH/507-795-----PLY-----PEN---DDN----------------------------------------------------------
Q7VFV2_HELHP/222-511-----QSKDKRIHTFV----------------------------------------------------------------
Q12IX1_SHEDO/530-817-----PLYE----GE-----EE----------------------------------------------------------
A6Q385_NITSB/202-483-----YFHDY-STDV-----------------------------------------------------------------
Q3IFH7_PSET1/493-781-----GSKF----ANG---A------------------------------------------------------------
D9SHW3_GALCS/523-805-----PLL-----ENK--PA------------------------------------------------------------
Q21FT5_SACD2/542-827-----PINKE-FGAG-----------------------------------------------------------------
C6XD69_METGS/519-799-----PLH-----DPN--NT------------------------------------------------------------
A7I2E8_CAMHC/213-497-----DFTTENVKA------------------------------------------------------------------
Q6LMA6_PHOPR/509-794-----PFD-----GTD---V------------------------------------------------------------
D0L1I5_HALNC/561-853-----GLKQG-EKTDV----------------------------------------------------------------
A8EUE5_ARCB4/193-478-----PYALDKPMST-----------------------------------------------------------------
C5ZX33_9HELI/208-498-----NLKNDTIVYN-----------------------------------------------------------------
Q1H0H5_METFK/520-800-----PLH-----DAN--AT------------------------------------------------------------
Q7MRT1_WOLSU/187-475-----DLNDY-ETEA-----------------------------------------------------------------
A4G3G0_HERAR/587-887-----PLH-----QMT--EA------------------------------------------------------------
D1B1Z5_SULD5/203-493-----KFLPY-DINA-----------------------------------------------------------------
D3VKA4_XENNA/501-791-----PLE-----EGD---V------------------------------------------------------------
Q0ABM3_ALKEH/531-818-----PLRNF-DPNR----V------------------------------------------------------------
A0KFB2_AERHH/486-771-----PLD-----GES--EV------------------------------------------------------------
A6TER2_KLEP7/497-781-----PLD-----GEM---T------------------------------------------------------------
B7VIB8_VIBA3/505-791-----PFD-----SEQ---E-P----------------------------------------------------------
Q5E7X4_ALIF1/495-780-----PFS-----GED---V------------------------------------------------------------
Q6DAI1_PECAS/504-784-----PLV-----GDD---V------------------------------------------------------------
A0A2S9PIN0_YERPE/511-794-----PLE-----EES--IT------------------------------------------------------------
Q83BN5_COXBU/480-760-----PLDH---SNQE---V------------------------------------------------------------
Q8ZLP4_SALTY/504-786-----PLD-----GEQ---V------------------------------------------------------------
Q9KUU5_VIBCH/504-791-----PFHS----GAE---P------------------------------------------------------------

PF13109

A6Q385_NITSB/623-836---------------------FNT-----------------------------------------------KGL-FI---
C5ZX33_9HELI/638-852---------------------FNN-----------------------------------------------QGY-YL---
D3UGW6_HELM1/730-943---------------------LGV-----------------------------------------------KGY-EV---
Q30RQ8_SULDN/697-907---------------------YSK-----------------------------------------------QGI-TT---
Q7MRT1_WOLSU/616-829---------------------FSA-----------------------------------------------EGY-AI---
Q7VFV2_HELHP/731-944---------------------LGA-----------------------------------------------NGY-EI---
O25308_HELPY/745-958---------------------LGA-----------------------------------------------NGY-QI---
Q0PAY6_CAMJE/635-848---------------------FNQ-----------------------------------------------KGL-SL---

PF13502

A0KFB2_AERHH/999-1241---------------------VFD-----------------------------------------------KGF-YF---
A1S2S6_SHEAM/1130-1371---------------------VFG-----------------------------------------------KGM-FY---
A1STZ9_PSYIN/1024-1262---------------------VFS-----------------------------------------------KGL-NF---
A1TW53_ACIAC/1117-1369---------------------VFS-----------------------------------------------EGF-AF---
A1WCZ7_ACISJ/1139-1390---------------------VFS-----------------------------------------------EGF-AF---
A1WSB5_VEREI/1101-1362---------------------VFS-----------------------------------------------EGF-AF---
A1WYY8_HALHL/891-1129---------------------LSG-----------------------------------------------EGF-AF---
A2U2U5_9FLAO/567-793---------------------LDA-----------------------------------------------ERL-DL---
A3HUH0_9BACT/675-900---------------------LKD-----------------------------------------------VNTLQL---
E0TB83_PARBH/837-1047---------------------LNG-----------------------------------------------EGI-AF---
A4AMF6_MARSH/560-785---------------------INL-----------------------------------------------NKL-DL---
A4CG41_ROBBH/574-799---------------------FNM-----------------------------------------------EDL-DL---
A4VIB7_PSEU5/1014-1255---------------------LFG-----------------------------------------------KGL-SY---
A5CF63_ORITB/620-836---------------------ANH-----------------------------------------------GKT-IF---
A5FUN1_ACICJ/745-973---------------------LGK-----------------------------------------------GTT-TF---
A6GWN8_FLAPJ/560-787---------------------LDV-----------------------------------------------SKL-NL---
A7HEC2_ANADF/581-801---------------------PEA-----------------------------------------------GAT-KL-G-
A9CIC7_AGRFC/884-1105---------------------LWQ-----------------------------------------------GEI-AL---
A9H3V6_GLUDA/474-684---------------------PKG-----------------------------------------------PDF-LI---
B7VIB8_VIBA3/1027-1268---------------------VFD-----------------------------------------------NGM-AF---
C1D9M5_LARHH/1015-1258---------------------VFG-----------------------------------------------EGF-AF---
C3L4A9_AMOA5/534-754---------------------KEL-----------------------------------------------KLL-RF---
C4L8L8_TOLAT/989-1232---------------------IFG-----------------------------------------------DGL-YF---
E8RSC3_ASTEC/1136-1358---------------------LSG-----------------------------------------------AGI-KF---
D9SHW3_GALCS/1021-1263---------------------VFS-----------------------------------------------SGF-EF---
D5CU11_SIDLE/1024-1263---------------------VFS-----------------------------------------------GGF-QF---
C6WWM2_METML/1053-1294---------------------LFS-----------------------------------------------NGF-AF---
C6XD69_METGS/1043-1284---------------------VFS-----------------------------------------------SGF-TF---
C6XK02_HIRBI/884-1092---------------------LNG-----------------------------------------------DGV-FF---
C7PC84_CHIPD/564-796---------------------SQL-----------------------------------------------KNF-SL---
D2UF54_XANAP/1023-1265---------------------FFS-----------------------------------------------KGF-AF---
Q0ABM3_ALKEH/1048-1290---------------------IFG-----------------------------------------------RGF-AF---
Q0AQ38_MARMM/879-1092---------------------LNG-----------------------------------------------EGI-RF---
A0A6N4SMJ8_CYTH3/532-755---------------------DNL-----------------------------------------------DNI-KF---
A0A6N4SME1_CYTH3/698-925---------------------KNM-----------------------------------------------DPL-EI---
Q145G0_PARXL/1154-1409---------------------VIG-----------------------------------------------EGL-PF---
Q211X0_RHOPB/871-1087---------------------LAR-----------------------------------------------GTL-AV---
Q28TM9_JANSC/371-572---------------------GEG-----------------------------------------------QRT-VY---
Q2KY05_BORA1/936-1183---------------------LLR-----------------------------------------------DGF-PF---
Q3IFH7_PSET1/1008-1245---------------------VFS-----------------------------------------------KGF-FY---
Q5R0H7_IDILO/1003-1244---------------------IFS-----------------------------------------------QGM-FF---
Q7UYB4_RHOBA/752-985---------------------ISL-----------------------------------------------ANQ-SF---
Q8EA16_SHEON/1025-1268---------------------VFG-----------------------------------------------QGM-YF---
Q9ZDH9_RICPR/624-849---------------------ITT-----------------------------------------------GRT-NI---
E0SHA8_DICD3/1031-1273---------------------TFG-----------------------------------------------KGF-YF---
F4AYZ2_DOKS4/566-791---------------------INL-----------------------------------------------DDL-KL---
G2J3B5_PSEUL/1018-1258---------------------MFS-----------------------------------------------DGF-AF---