Sequence alignment for CL0525

PF01569

A4I568_LEIIN/102-249-----------------------------PAMNLILY-----LIL----SVCL-----NVV--------L----KATVR-
DOPP1_DICDI/54-178-----------------------------RTISIFLG-----LLF----SECT-----NYV--------L----KKSIK-
Q17D95_AEDAE/56-197-----------------------------LYSRLLLS-----VLL----TEYA-----NTL--------I----KWILA-
G6PC3_MOUSE/53-195-----------------------------LGISVLWI-----TFI----AEWL-----NLV--------F----KWFLF-
A0BM37_PARTE/91-226-----------------------------GALLYGGM-----ILF----SVAS-----NSL--------L----KNFYH-
Q23FV4_TETTS/102-237-------------------------------LYLLSI-----TVL----SLFQ-----MTF--------L----KSLYQ-
A0EE96_PARTE/81-240-----------------------------QIFKLITM-----NAI----AAAF-----GNL--------I----KMIMT-
A8FE89_BACP2/71-198-----------------------------YKRYYSIM-----MLF----LLYL----TEKT--------INHELKGLFA-
Q7MUE1_PORGI/58-185-----------------------------ALFIVGAV-----LLS----VLICDQ-LSSSF--------F----KPFFA-
A0K0K5_ARTS2/118-241-----------------------------RPMLLAGA-----MLT----GVAL-----AQI--------I----GRSVG-
A4XP73_PSEMY/98-234-----------------------------ALFAFLTA-----LLA----LLLLRV-GFAEL-------------VKVMG-
A4X1H8_SALTO/101-242-----------------------------PLLPPVAG-----VAL----IYLI-----VGA--------L----KVSTA-
Q9EWX3_STRCO/115-237-----------------------------PLLALGVS-----LLL----LNVT-----VGA--------A----KYGMG-
A1BJZ6_CHLPD/56-185-----------------------------GALIILFS-----LCA----LGIADY-TASGI--------L----KPLFQ-
A4FQA0_SACEN/76-196-----------------------------AALLAPVA-----TAV----AYLG-----SEL--------L----KTWWQ-
B0U8C7_METS4/61-186-----------------------------FAIGAVIS-----VFT----AILT-----SRL-------------TQNLLP
A1S1V4_SHEAM/77-196-----------------------------IFWKSLTA-----IAV----AALL-----INA--------L----KQGFD-
A1W5E3_ACISJ/72-191-----------------------------QLLQFVIG-----FGI----AIAI-----ASI--------L----KFWLD-
A5CF96_ORITB/78-203-----------------------------YLLYVGTA-----YTI----FLLV-----YSK--------L----KRLFS-
B4U5Z7_HYDS0/54-171-----------------------------KLKVYLVT-----LII----ETIL-----VTA--------L----KNIFD-
A5DBA1_PICGU/102-232-----------------------------LSRDLIYV-----LGL----GIYI-----SGN--------L----KDYMC-
Q4D544_TRYCC/102-225-----------------------------EVLDMCVL-----MCL----SQYI-----TGT--------L----KDAAG-
SSPA_DICDI/88-218-----------------------------LGVELCVV-----LAL----TIGG-----GNI--------L----KNTFTL
Q32GQ5_SHIDS/77-232---------------------------------VLFA-----ILA----AAILVGQGVKSW--------I----KDKVQ-
Q9CMX4_PASMU/75-237-----------------------------GVLVMAFA-----VIL----TQGI-----KSG--------L----KTLFS-
Q21JU9_SACD2/110-231-----------------------------AHWGIFLA-----AII----GGIV-----SNV--------S----KDYFD-
Q0K1U6_CUPNH/103-229-----------------------------KETPYLNI-----LLR----RSLV--------DA----GLSTYKAKDHYK-
Q65GX3_BACLD/179-304-----------------------------NVVSLVNT-----LRG----NYSS-----SNP--------A----KSYFN-
Q2IJN8_ANADE/141-265-----------------------------DLMILTET-----LAL---NSAAV-----MTV-------------KFAVQ-
Q6FEM9_ACIAD/65-182-----------------------------QILYLVVG-----GSV----GTGI-----YKF--------L----KNKTT-
A1K7H5_AZOSB/105-237-----------------------------QVGYLLVA-----MAL----GPGLF--VDVGL-------------KDYWG-
Q6MBQ7_PARUW/87-223-----------------------------LYLILVLA-----IGS----GIFV-----HAI--------F----KDHWG-
A8EX54_ARCB4/94-229-----------------------------GLVILLLS-----MIL----VPAL-----TVS--------I----KGVTN-
Q87X15_PSESM/102-231--------------------------------CLVLS-----MAL----STAF-----VTP--------V----KVVTS-
A8BDI5_GIAIC/110-282-----------------------------VLVAAIVY-----IGM----ANLT-----TLV--------L----KIALN-
A8BQZ4_GIAIC/121-285-----------------------------FPLSFCFY-----VIT----VQTV-----VIA--------L----KVLLR-
Q6MTZ1_MYCMS/144-270-----------------------------KAVIVLIT-----IIS----LLIV-----INI--------L----KLTFN-
R5TP42_9FIRM/95-216-----------------------------------IG-----MTI----FLLI-----STV--------F----PNGLT-
A3LWS4_PICST/248-396-----------------------------ALKLYALS-----IGA----QNILVV-LTHFVIPTAPPLFI----KLYGEH
Q127S7_POLSJ/95-224-----------------------------ELCRYGAA-----MAL-----MCL-----AGL-------------AIFYFW
A4CJ32_ROBBH/299-448-----------------------------DKTVFAYT-----KTSIALFDGFI----------------SCWDEKYRSN-
Q2HER5_CHAGB/260-418-----------------------------FYAQLNYA-----LAN----AGIA-----------------SWDAKYTYL-
A8L0R7_FRASN/276-428-----------------------------LQTARMFA-----MVDLTEADATT----------------ACFNEKAAWT-
Q6NJR5_CORDI/194-319-----------------------------RKAWLGVC-----YAL----TVALTW-APVVV--------M----KVVFQ-
A1SKJ7_NOCSJ/98-218-----------------------------PVVFIALV-----LAG----VGGC-----YGI--------A----TALIS-
Q82Z33_ENTFA/85-204-----------------------------LAFWAVSN-----LLA----VGFL-----GSV--------F----KHVVG-
A2DYB5_TRIVA/98-241-----------------------------FLWAFVAA-----EGI----SGFT-----VSI--------F----KNYVG-
A2EZZ9_TRIVA/91-236-----------------------------IICAHLSS-----IMF----AGDI-----CHV--------L----KTYVG-
A4H9E7_LEIBR/233-378-----------------------------WVLLQAFS-----VAL----SVMI-----VDA--------L----KVYAG-
Q6BYN9_DEBHA/112-272-----------------------------GLMALSGS-----MAT----QLMI-----TCI--------L----KNICG-
A7EIU4_SCLS1/134-294-----------------------------AVIGLLYS-----LIT----AAVF-----QVF--------L----KWLIG-
A7TF94_VANPO/122-266-----------------------------SLVCLGLI-----LTI----NGVI-----TNS--------L----KLFIG-
Q2TYI3_ASPOR/35-224-----------------------------GWLGLCLS-----LAG----AFFV-----VLG--------L----KDIVG-
A2EQG2_TRIVA/90-230-----------------------------ATASYIFS-----IAS----AMLV-----CAA--------I----GKIVG-
PLPR5_MOUSE/122-275-----------------------------FLGIYAFG-----LFA----TDIFVN-AGQVV--------TGNLAPHFLA-
Q9VNU2_DROME/65-225-----------------------------AEATFSFG-----FIA----TYLT-----TEL--------A----KHAVG-
A8WXP5_CAEBR/128-286-----------------------------TYLKYLLM-----YAA----CTFA-----MEF--------L----KCYVG-
A6X217_OCHA4/121-242-----------------------------WATLVLTS-----IVV----GSIP-----TEI--------G----KLAIG-
Q5NGF4_FRATT/116-236-----------------------------YAGFILAT-----VAI----SGIL-----GQI--------L----KMIIG-
Q5ZX13_LEGPH/91-208-------------------------------WYLLGC-----VLL----PNLL-----TFV--------L----KISFS-
Q6MH55_BDEBA/105-226-----------------------------WALNFFVA-----LLV----AGVI-----THI--------I----KFTVG-
Q7NZZ5_CHRVO/815-932-----------------------------TGLIALES-----AGV----AVAG-----SEM--------L----KFTSN-
Q89JR9_BRADU/79-199-----------------------------AGNHALLV-----TVA----ASLL-----PHG--------L----KLLFD-
B7VND8_VIBA3/235-351------------------------------ALKFGFT-----LIS----VTLL-----TLI--------A----HQGFG-
Q5E4L0_ALIF1/241-366-----------------------------SALTLLFG-----IIL----SIVL-----TGL--------A----KQGLG-
Q9RVR6_DEIRA/14-135-----------------------------GGRDLGVA-----FAL----SYLV-----NSA--------L----KYGLN-

PF14378

Q5K8D7_CRYNJ/128-311REIIAIERWLHIDCELSLQK-FVMKTNW-LLMFFNKT-----YAM----VHIP-----ATI--------A----FMAYSY
B0UG28_METS4/124-315PVLMRAEAALGFDWRAHVA--LVERHPA-VARALALA-----YHS----SGPQ-----IAL--------V----VIVLAA
A1SJR6_NOCSJ/50-230RDIVRVEERLGIDVEGAIQA-PVTLSPV-LETAANWV-----YIW----GHWP-----VIV--------L----TMAWLV
E4NIW3_KITSK/45-228LSLRSAERALHLAVEPAANG-WLAGHPL-LCHLAVYV-----YR-----GYYL-----VVL--------G----VLVWLF
G8WRV6_STREN/158-347EAIVRLEHTLRISPEHALNQ-LFTHQAW-LGVPACFA-----YAT----LHYV-----ITP--------A----VLVWLW
C7QD07_CATAD/71-251TWIWDTERDVFLPSEHWIQHLFFPAHPT-VVKFFNLY-----YAS----MHFT-----CMI--------I----FLIWLF
Q2G5H1_NOVAD/115-305PWLHAADRSIGFDFRWLSQ--VYADNPA-IMSISRFA-----YSS----LAIQ-----TIV--------I----PVVMAV
Q1IHV8_KORVE/153-330LFLYSFDASLGGQWTFRLAQ-FTAHHPG-AHFVSAMV-----YNV----VLVP-----PAL--------V----YAAL--
F2R3P1_STRVP/39-228LAVLRLERLLGVDVERPLNR-LFTDVPA-LGVPADFA-----YAS----LHYL-----VTP--------A----ILVWLF
A9HHP2_GLUDA/131-314ADLARFDRNLGFDWPEWIQ--GLKAHPF-VQVVMAAT-----YGS----LIFQ-----IIG--------S----LLVLAL
Q13PQ7_PARXL/110-293HAFIAADAALGFHWPDTYR--WVLAHPW-LHRALGWA-----YAS----GACQ-----LFV--------V----PVILAI
Q63V72_BURPS/125-308GALIRLDARLGFDWPAVYE--RIRAHPA-LRRALAFA-----YDS----AQWQ-----LIG--------I----PVWLGL
Q01VD1_SOLUE/159-330YYLYAFDGSLGLQPSFILGS-IVAPVPV-LVWLTAMV-----YNS----LGFW-----FCV--------M----YAAHS-
D1CA82_SPHTD/53-235REVMHLERKLGLFREIGVQA-WLLAQPW-IVHFLNWV-----YTY----THMA-----GLV--------L----FGIWLF
K0K1I4_SACES/40-223LQVQRLEQMLHIAIEQPLNQ-AILAHPA-AIHLTGYF-----YR-----LSIL-----AVP--------A----VLIWLY
D1C524_SPHTD/53-234ELVIAVERSVGLFWEAHVQA-WVLEHPR-LVDIFNWI-----YIY----VHLP-----ATL--------L----FGLGVL
W5TLL4_9NOCA/53-242HGLMRVEGWLGLHPELWLNG-VFVDHAW-IAIPADFA-----YAT----LHYV-----VTP--------A----ILIWVW
Q2JBQ4_FRACC/47-236HDLLRLETFLHLDPELGLNR-WLQSVPV-LAVVCCYY-----YAT----LHFV-----VTP--------A----LLVWMH
W0BEC4_9GAMM/94-276KYILKFESSLYINMEGIVR--WTREHPN-INTLLMYS-----YRT----LDYQ-----LNF--------I----PILVIA
Q220L9_RHOFT/109-292APLAAWDRALGFDWLALHG--WLQSHPP-AQTTLHIA-----YQS----GLIQ-----LAF--------V----ILFLGF
Q87M50_VIBPA/146-355QSLIELDRWLHFGNDPWVITHAILSSPW-ASLAINTA-----YNA----WFFF-----MWM--------T----LFFFVL
B1LSY3_METRJ/129-320PALARIETALGFDWTGHVA--FLARHPT-LSWWLALA-----YHS----SGPQ-----VGL--------V----VIALSA
A2BL06_HYPBU/51-224VALFGVPLAVYFQFHRLLV----------LDIYTGIV-----YA-----LHPV-----YFF--------A----FAVLLA
L0PFU2_PNEJ8/5-201IWVSVLPTLENIVYGASLSN-LLSKHTYFFLDILAWI----PYGI----IHFG-----APF--------V----TSIIVY
C9Z2S2_STRSW/63-253LAILRFEKALWLNAEHPLNR-LFTREPW-IGIPADFW-----YAS----LHYL-----VTP--------A----ILVWLF
E3JAH2_FRAIE/94-282RRLLHLEQVTHLNPEHPLNN-FLVHATV-LAVPACYF-----YAT----LHYI-----LTP--------V----VLAWMY
F8AWV4_9ACTN/47-236WDIMRIQADLHLDIELGLNH-WLQGVPA-LAVACCYY-----YAT----LHFI-----VTP--------A----VLVWLY
R7Y200_9ACTN/124-318RELHLMDRALFLGHEPATVLHTIFGTGP-SAHVLSSV-----YLW----FLPL-----VPL--------A----LAAWLV
A0LS47_ACIC1/69-252TGILDLEHRWGLDVERSLNT-FLARHPA-LGVAASWE-----YAT----TYVL-----VTF--------G----VLLWVW
E2Q4K3_STRCL/45-234LAILRAERALYLDFETPLND-LFTSTPA-IGIPADFF-----YAS----LHYA-----VTP--------V----VLIWLF
F8J559_HYPSM/123-309KILVAADAGLGIDWVALAF--WFRDHPE-LTRILSHA-----YAS----IEWQ-----PII--------L----VLTLAW
L0ET54_LIBCB/102-293NTLSLVDERLGFHWISFIR--FVDARPW-LSFWLKES-----YSS----FAFQ-----LLI--------W----PIILIF
Q89QL0_BRADU/109-300SEFAVLDQRLGFDWMAWLA--AMNAAPL-LHRILAGA-----YAS----FAVQ-----TTA--------V----VLVLAA
H0PVV4_9RHOO/74-256TQFSELDRAIGFSWLAWFE--LTRANIV-LDTLLRLA-----YHS----LIVQ-----ILV--------S----IILFAH
E3EJC2_PAEPS/1-162M-LINVDFALFH---------WINELADHLAFLNGTMRFLAQYAP----YLFG-----VAL--------L----MYWFTF
A1SDU3_NOCSJ/130-324RELHYLDRALLFGHDPAHVLHGLLGEGF-MAWPLSYI-----YLW----FLPL-----VPL--------A----VTAWLV
C7QBQ6_CATAD/84-272HDILRVEHFLGLNFERSFNH-WVYSVRW-LAFSMNVY-----YAT----LHFI-----VPI--------A----VLVWVY
A1SHK3_NOCSJ/128-322QELLAIERWFLLGHSPAVLLHGLLGEGQ-AAVVLAVV-----YRS----FTYL-----VPL--------S----VVGTLA
E3J0M0_FRAIE/110-299ETLLRWQSAMHLDIELSLNH-WLDTVPV-LAVICCYY-----YAT----LHFI-----VTP--------T----VILWMH
C8XDB0_NAKMY/22-205QALQSIERSLHLDIELAANQ-WLAERPA-LIQAAALY-----YR-----LYYL-----PLI--------G----VLLWVL
G7XGU5_ASPKW/117-299LSILSFEHFLHLDVELSVQRYVLEQKPW-LMGFLARV-----YYS-----HIV-----LGV--------I----FIVYCY
B1LVV6_METRJ/99-290STFHAWDRRLGLDWRAYLA--FVDGHPR-LGLALSLA-----YRS----LILQ-----TML--------A----VILLGF
Q5ZV46_LEGPH/101-283KQIIKLEAQLGINMISILE--WTNKYQH-FKYLLAII-----YDT----LPYQ-----MSI--------L----PLYVIV

PF14360

F6UTK5_XENTR/282-355------------------------------------------LCG----DYLY---------------------------
SMSR2_CAEEL/192-265------------------------------------------LCG----DLIV---------------------------
SLS2_TRYB2/201-275------------------------------------------HCG----DLMY---------------------------
B8C480_THAPS/431-503------------------------------------------GCG----DLMF---------------------------
IPCS3_ARATH/172-244------------------------------------------GCG----DLIF---------------------------
SAMD8_HUMAN/292-365------------------------------------------TCG----DYMF---------------------------
A2DHW8_TRIVA/46-124------------------------------------------QCG----DLIV---------------------------
SLS_LEIMA/211-286------------------------------------------HCG----DLMF---------------------------
A5K283_PLAVS/202-273------------------------------------------VCS----DLII---------------------------
A0A509ASM8_PLABA/201-272------------------------------------------VCS----DLIV---------------------------
A0A384LQJ1_PLAKH/276-347------------------------------------------ECT----DLII---------------------------
Q28DN3_XENTR/220-293------------------------------------------LCG----DFLY---------------------------
Q4N3L0_THEPA/182-253------------------------------------------PCT----GVLF---------------------------
A8XDY1_CAEBR/127-200------------------------------------------LCG----DLLF---------------------------
IPCS_ORYSJ/172-244------------------------------------------GCG----DLIF---------------------------
SMSR1_CAEEL/321-394------------------------------------------SCG----DYMF---------------------------
SMS2_CAEEL/201-274------------------------------------------LCG----DLMF---------------------------
A8X0T5_CAEBR/264-337------------------------------------------LCG----DYIY---------------------------
A9S9I4_PHYPA/275-346------------------------------------------GCN----DLVF---------------------------
B3SD02_TRIAD/279-352------------------------------------------TCG----DYLF---------------------------
A2DN61_TRIVA/170-240------------------------------------------TCG----DMIY---------------------------
B5YLZ6_THAPS/422-494------------------------------------------GCN----DLIL---------------------------
C6KT87_PLAF7/201-272------------------------------------------VCA----DLIV---------------------------
D0MWV3_PHYIT/192-264------------------------------------------GCG----DLMF---------------------------
B7FUU7_PHATC/326-397------------------------------------------GCN----DLII---------------------------
SLS11_TRYCC/193-267------------------------------------------HCG----DLMF---------------------------
D2VDJ4_NAEGR/246-319------------------------------------------TCG----DYMF---------------------------
D2VXN5_NAEGR/191-270------------------------------------------TCG----DYVF---------------------------
D2VKR1_NAEGR/196-272------------------------------------------TCG----DYVF---------------------------
B9HC73_POPTR/172-244------------------------------------------GCG----DLIF---------------------------
C6KT86_PLAF7/265-336------------------------------------------ECT----DLVI---------------------------
C4LV27_ENTHI/184-261------------------------------------------TCA----DLLF---------------------------
A2FIE9_TRIVA/168-238------------------------------------------TCG----DMIF---------------------------
B7QHG5_IXOSC/233-306------------------------------------------FCG----DYIY---------------------------
D0NII4_PHYIT/164-244------------------------------------------SCG----DHIF---------------------------
A7ANZ4_BABBO/239-311------------------------------------------TCT----DMII---------------------------
A0JMN0_DANRE/269-342------------------------------------------MCG----DYLY---------------------------
C3XQA8_BRAFL/273-346------------------------------------------LCG----DYLF---------------------------
F8W5G6_DANRE/232-307------------------------------------------MCG----DFLY---------------------------
H3CAZ2_TETNG/175-248------------------------------------------MCG----DFLY---------------------------
Q4U956_THEAN/200-270------------------------------------------NCT----DLIV---------------------------

PF02681

F2NNY3_MARHT/5-141-----------------------------LGNQILWT-----ALA----ANVI-----AQS--------L----KLVIY-
K9T6M6_9CYAN/8-143-----------------------------LSNRVLIV-----SLL----ACFI-----AQG--------L----KFFIE-
D4ZTL8_ARTPN/8-143-----------------------------LDNRVLLV-----ALF----ACLF-----AQA--------S----KLAIE-
K9WGM7_9CYAN/8-143-----------------------------LNNQVLLV-----AII----ACLV-----AQL--------C----KLLVE-
B7GI74_ANOFW/24-164-------------------------------NRAIQT-----ALC----TIAL-----AQF--------L----KIPLT-
B1WS33_CROS5/8-143-----------------------------FHNKILLV-----SLI----ACFS-----AQG--------L----KLIIE-
R5AEV3_9CLOT/9-146-----------------------------FSNRILIA-----AIV----AWAA-----AQL--------I----KTIIY-
Q31Q62_SYNE7/9-145-----------------------------LANDVLVA-----ALL----ACGL-----AQF--------S----KLIVE-
R5XG63_9CLOT/5-137-----------------------------FQNRILLI-----SIF----SCFL-----AQF--------L----KIFTG-
R7A3L4_9FIRM/8-144---------------------------------PLVS-----ALL----ANVV-----AQV--------G----KTIVY-
W0E929_9FIRM/8-143-----------------------------FQNEVLVS-----AIT----AWLV-----AQV--------I----KVLIN-
D3FYY4_ALKPO/4-149-----------------------------FHNFPLWA-----ALF----AIFF-----AQF--------I----KIPLA-
F0RVM2_SPHGB/6-143-----------------------------FGNAPFLS-----AAL----SFFL-----AQL--------L----KPFVN-
H6NB79_9BACL/2-142-------------------------------NRALWT-----SIA----GIGA-----AQA--------L----KVPMK-
Q7V6P1_PROMM/15-147-----------------------------LDNAVLAW-----GLA----ACGL-----AQL--------S----KLIVE-
Q18B69_CLOD6/8-140-----------------------------FNNGALGI-----SLI----ACFL-----AQF--------I----KIFTG-
G0GF41_SPITZ/9-149-----------------------------LSHPVFLS-----GFL----SWFC-----AQV--------I----KLLVE-
Q65FE5_BACLD/4-149-----------------------------LTNFPLLA-----SFA----AIFF-----AQF--------I----KVPIY-
U5LF62_9BACI/2-142-------------------------------NKGVIV-----ALL----SIII-----AQG--------M----KIPLH-
R7L0C2_9FIRM/5-149-------------------------------NYILVT-----SIV----GWCI-----AQL--------L----KTIIN-
Q5WDV5_BACSK/4-146-----------------------------LDNFPLWA-----AFM----AIII-----AQA--------I----KIPLA-
D6GSF2_FILAD/8-144-----------------------------LQNKVLGV-----AIL----CWFV-----AQT--------L----KVIFT-
E6U5K5_ETHHY/8-143-----------------------------FHNYILMA-----AVL----SWIF-----AQI--------I----KTVIT-
Q5SJ95_THET8/4-140-----------------------------LANAVFWT-----AVL----ANLT-----AQT--------L----KLLLY-
Q9RSQ8_DEIRA/8-143-----------------------------LSNRWLWA-----AVF----ASLG-----AQV--------L----KVLLI-
P73185_SYNY3/8-143-----------------------------FHNQVLLI-----SLA----ACFL-----AQG--------I----KAIVE-
D1AKQ0_SEBTE/7-143-----------------------------FGNRILDV-----AVI----ACFA-----AQF--------Y----KVFSP-
E0RXA3_BUTPB/8-144-----------------------------LNNRLLLA-----AFF----GWLS-----AQI--------L----KTIIY-
F5YE41_TREAZ/16-155-----------------------------IENPIVLS-----SLT----SWVM-----AQI--------V----KALVV-
V5WEJ9_9SPIO/6-144-------------------------------NPVFTS-----ALL----SWFA-----AQF--------I----KTILN-
U5LHE7_9BACI/5-149-----------------------------L-NFPLWS-----ALA----AIFF-----AQF--------V----KVPIQ-
K9XWG4_STAC7/8-143-----------------------------FHNQILLV-----AIL----ACFT-----AQG--------F----KLIIE-
E6U2C7_BACCJ/4-149-----------------------------LTNFPLWV-----ALF----TIGF-----AQF--------I----KVPLQ-
K9V3M2_9CYAN/8-143-----------------------------FNNRVLLV-----ALV----ACLL-----AQA--------I----KLVVE-
B9IAH9_POPTR/38-171-------------------------------NLPLLS-----ALL----ACAL-----AQF--------L----KLFTT-
M0RZC5_MUSAM/20-155------------------------------VNRPLFS-----AVL----AFAV-----AQF--------L----KLFTT-
R5ZD30_9FIRM/8-146---------------------------------PLVT-----AII----SNII-----AQI--------A----KTIVY-
R6Q3Q8_9FIRM/8-138-----------------------------L-NKPFWA-----AIL----SWAL-----AQG--------F----KTIRP-
C0ZKP9_BREBN/5-150-----------------------------FENFPLWA-----ALL----AIGI-----AQF--------I----KIPLH-
D8TLE7_VOLCA/33-168-----------------------------FVNGALVS-----AIV----AFFI-----AQL--------S----KVFTH-
R6SRI1_9FIRM/7-157-------------------------------NVILLI-----ALI----SWGT-----AQI--------L----KTLIH-
K9YEC7_HALP7/8-143-----------------------------VENHLLWV-----SLI----ACLV-----AQG--------L----KLVIE-
K3XML5_SETIT/24-159-----------------------------FHNYPLVA-----AML----GFAI-----AQS--------I----KFFVT-
K9RII7_9CYAN/8-143-----------------------------FDNHVLIV-----ALI----ACLT-----AQA--------L----KLLIE-
K4LIZ6_THEPS/40-169-----------------------------FQERYILS-----GLL----SVFC-----TQG--------M----KPFTY-
E6TWS5_BACCJ/5-142----------------------------------IFT-----ALL----AIGL-----AQF--------L----KIPIK-
Q73MW8_TREDE/10-150-----------------------------FSNPIFLS-----AIT----SWMM-----SQI--------I----KTIFA-
Q8Y4P9_LISMO/4-149-----------------------------FTNTPLIA-----SII----AIVF-----AQV--------V----KVPIH-
M0SK26_MUSAM/139-272------------------------------GNPTFVS-----GLV----AWSL-----AQT--------I----KMFLN-
G4KW10_OSCVS/4-137-----------------------------WNNHLLVN-----SMI----AWII-----AQI--------L----KVIIY-
R5CL70_9FIRM/8-147-----------------------------FHNPLFVA-----SAC----SWLV-----AQL--------S----KTILY-
I0I5M8_CALAS/5-139-----------------------------LSNTALWL-----PLS----IALI-----VQF--------Y----KVVAY-
D7CKU8_SYNLT/12-144------------------------------NHKLIVA-----PLT----ACGV-----TQL--------I----KGVYM-
R7IRJ9_9CLOT/8-142-----------------------------ITNRYLYI-----PLI----LWFC-----IQT--------F----KVIYE-
B8HXR8_CYAP4/8-143-----------------------------ITNRVLLV-----SLS----ASLI-----AQI--------L----KLVIE-
B0C3J0_ACAM1/8-143-----------------------------LNNQVLLV-----SLA----ASLI-----AQG--------L----KIIID-
I4DAH9_DESAJ/3-144-----------------------------HSNVLLFS-----ALF----SAIF-----AQI--------I----KVPIN-
Q46K07_PROMT/15-148-----------------------------LDNAVLAW-----GLA----ACGL-----AQF--------S----KLLFE-
R7A3G1_9CLOT/8-142-----------------------------ITNKYLYL-----PFL----VWFC-----IQT--------F----KVIYD-
Q24V03_DESHY/8-143-----------------------------LDNHILIS-----AMI----AWFI-----AQT--------L----KLIIN-
Q10X44_TRIEI/8-143-----------------------------MDNYVLWV-----ALV----ACLM-----AQF--------L----KIVVE-
A4RZ57_OSTLU/3-142-----------------------------LDNCGLIA-----AFV----AVVA-----AQA--------L----KPLTA-
D8QR56_SELML/24-159-----------------------------FSNLPLVA-----AFV----SFVA-----AQS--------L----KIVTT-
A0A3Q7ELN9_SOLLC/140-274-----------------------------AANPTFVS-----GFI----AWFM-----AQS--------M----KVFLN-
Q8ENX8_OCEIH/4-149-----------------------------FSNFPLWA-----ALC----AIVF-----AQV--------I----KIPIK-
K7V114_MAIZE/48-182-------------------------------NFPLAV-----ALL----AFAF-----ANF--------V----NLVSI-
Q01ES7_OSTTA/128-261------------------------------GNHVFLC-----AFL----SWLV-----AQV--------A----KIFTA-
E3HA83_ILYPC/7-143-----------------------------FGNRIIDV-----VFI----AWFI-----AQF--------Y----KVISA-
A6TR41_ALKMQ/8-144-----------------------------GNNKILGT-----ALL----AWFI-----AQT--------I----KVIHT-
I1KRZ5_SOYBN/9-144-----------------------------TSNYPLIS-----AIV----AFAL-----AQS--------I----KFFTT-
R5KDM7_9CLOT/8-150-----------------------------LHNPILVA-----PIL----GWLT-----AQI--------L----KVIIH-
R7I9S8_9FIRM/10-145-----------------------------FSNQVLLC-----CIT----AWFV-----AQA--------L----KIPTY-
R6BY11_9CLOT/8-144-----------------------------VQNKVLLS-----AVS----GWLI-----AQI--------L----KTLIH-
R5ITD2_9FIRM/8-144-----------------------------FSNRVLLS-----GLI----GWGA-----AQV--------L----KTIIY-
K9RQD3_SYNP3/8-143-----------------------------LHNDLLWL-----ALA----ASAI-----AQI--------L----KLLID-
K9SVF9_9SYNE/8-143-----------------------------LDNRVLLI-----AIA----ASFG-----AQC--------L----KLLLL-
Q7VBG6_PROMA/16-148-----------------------------LDNAVLAW-----ALI----ACGL-----AQF--------S----KLFVE-
O83188_TREPA/14-153-----------------------------FSGEVFLS-----ATC----SWLA-----SQV--------I----KVAIA-
G8QY16_SPHPG/6-143-----------------------------LHNIPFIA-----AAL----AVII-----AQA--------S----KPFIN-
D3EMZ3_ATETH/8-144-----------------------------IHNKILLV-----SLL----ACFS-----AQS--------L----KFLIE-
M0SG02_MUSAM/22-157-----------------------------LHNYPLIS-----AIL----AFAI-----AQS--------I----KVFTT-
F5YMS6_TREPZ/16-155-----------------------------VESPIFLS-----AVT----SWFL-----AQM--------V----KAVVL-
R7R6N9_9FIRM/8-144-----------------------------FHNQLLIA-----AVL----GWLV-----AQL--------L----KTGIH-
C7NE60_LEPBD/7-143-----------------------------FGNRLLDV-----AAI----SCFS-----AQF--------Y----KVFFP-
R5IDQ6_9CLOT/2-138-----------------------------LGNQVLVS-----AVV----GWTV-----AQV--------L----KTLID-
D9R8M4_CLOSW/8-144-----------------------------LGNQVLIT-----AVA----GWLV-----AQV--------L----KTIID-
D7BAF5_MEISD/5-141-----------------------------LSNQVLWT-----AVL----ASFI-----AQV--------L----KLLIY-
F8F1T7_TRECH/16-155-----------------------------FENPVFLS-----AIT----SLIF-----AQL--------L----KAIIV-
Q93ZZ7_ARATH/51-205-----------------------------IHNKVLIA-----AGT----SAVI-----GQL--------S----KPFTS-
D8U4F3_VOLCA/38-173-----------------------------LTNRVFLV-----GFW----SWFT-----AQF--------L----KIFTK-
J7IS94_DESMD/8-142-----------------------------FHNTILIS-----AIT----AWFS-----AQF--------L----KVIVN-
F9VBI0_LACGL/8-142-----------------------------ISNQILIT-----AIV----GWFA-----AQI--------I----KIIVD-
K9W0K1_9CYAN/16-151-----------------------------LDNQVLLV-----ALL----ACLI-----AQL--------L----KLLFE-
A9NHX4_ACHLI/6-144-------------------------------EAVLII-----SIS----AMLI-----AQV--------S----KFFID-
D1AXZ8_STRM9/7-141-----------------------------FGNKILDV-----VFI----SAFT-----AQI--------Y----KCFSP-
K9UG93_CHAP6/16-151-----------------------------LDNRILLV-----AVA----ACLI-----AQV--------L----KLIID-
F4LN44_TREBD/13-152-----------------------------FKNSVFLA-----CIF----SWFS-----AQF--------I----KTVIK-
R6NRL3_9CLOT/2-140--------------------------------KIFIV-----CFM----SWFI-----AQV--------L----KVIIN-
K0IWZ6_AMPXN/4-149-----------------------------LKNFPLII-----SLF----AILF-----AQG--------I----KVPIH-
W8TJV6_PEPAC/8-150-----------------------------ANNQVFII-----SVT----AWFV-----AQV--------I----KVLLT-
A8MFI8_ALKOO/8-144-----------------------------GKNEIFIV-----AVF----SWFI-----AQV--------I----KVVNT-
H9UHZ5_SPIAZ/13-152-----------------------------VRNPVFLS-----TFT----SWLT-----AQV--------I----KAFID-
B8CY18_HALOH/3-134---------------------------------LLEI-----SLL----SLFI-----AQV--------L----KIFTT-
B2A528_NATTJ/7-141-----------------------------LSNIYLIS-----ALI----GWFV-----AQL--------I----KFTIY-
R6ME09_9FIRM/8-142-----------------------------ISNSVLIT-----ALI----GWFA-----AQV--------L----KMIL--
F2NS18_TRES6/11-151-----------------------------FSQPAFLA-----CLF----SWLS-----AQL--------V----KTLIK-
R5PNP2_9CLOT/8-138--------------------------------RYLIV-----PFV----TWFC-----VQT--------F----KVLWE-
Q1J0I2_DEIGD/9-145-----------------------------LGNRWLWT-----AVL----ASIS-----AQL--------L----KVLLI-
R5MBG0_9CLOT/8-144-----------------------------TGNQVLMS-----GVI----GWIV-----AQV--------L----KTIID-
I4D8V5_DESAJ/8-142-----------------------------FYNTILIS-----AVT----AWLA-----AQL--------L----KVVIS-
R7A673_9FIRM/8-144-----------------------------LHNRIFVS-----AAL----GWMV-----AQV--------L----KTIIH-
R7FJ12_9CLOT/8-142-----------------------------IQNKYIYI-----PFL----LWFF-----IQL--------Y----KVLYD-
O51097_BORBU/6-146-----------------------------LTNDLFLS-----CLV----SGIS-----AQV--------I----KYGIQ-
K8GFC4_9CYAN/8-143-----------------------------LNNQVLLV-----AIA----ACLI-----AQL--------L----KVFVE-
M4CGY8_BRARP/134-268-----------------------------SANPTFVS-----AVF----AWFF-----AQT--------S----KMVIN-
R6N1H2_9CLOT/6-146-----------------------------RDNSVVFL-----GLL----SWFI-----AQL--------I----KFIIE-
D3FSU1_ALKPO/2-142-------------------------------NRPMLT-----ALL----TIGL-----AQS--------L----KVPIK-
B9DG97_ARATH/20-155-----------------------------FTNYPLIS-----AVT----SFTI-----AQF--------I----KLFTS-
Q9CGU3_LACLA/8-142-----------------------------FHNQILMT-----AIV----SWAL-----AQL--------I----KIIIE-
F2I5F0_AERUA/1-152-----------------------------MKNFPLTA-----TIV----AIIF-----TQI--------I----KYPIAY
R7N6H8_9FIRM/8-144-----------------------------THNSIFMS-----AIT----GWFV-----AQV--------L----KTIIH-
C1FDH6_MICCC/170-303------------------------------GNLVFMC-----AFW----SWLT-----AQT--------M----KYFTA-
R6SUP5_9CLOT/9-142-----------------------------FTNYVMMS-----AVF----SWLL-----AQL--------L----KVVTG-
A5GM29_SYNPW/13-145-----------------------------LDNASLAW-----GLA----ACGI-----AQL--------S----KLFIE-
Q2JKH6_SYNJB/6-142-----------------------------MANHVLWV-----ALL----ASVL-----AQA--------I----KLILS-
F2JMF4_CELLD/8-142-----------------------------LQNKILWV-----AIV----SWFI-----AQL--------F----KVIIT-
E6SHJ0_THEM7/12-146-------------------------------NQPLVS-----AVA----AAGL-----GQA--------T----KAVLA-
K9S6R1_9CYAN/8-143-----------------------------LSNRTLLV-----ALL----ACLI-----AQV--------L----KVIVE-
E3PRG0_ACESD/8-144-----------------------------IHNQVFIA-----CFL----AWFI-----AQL--------I----KVVLT-
R5N6N4_9CLOT/8-137-------------------------------YKYIIV-----PFV----TWFG-----IQL--------F----KVLYK-
R5GZB8_9FIRM/8-144-----------------------------IHNTVFMS-----AVT----GWFA-----AQV--------I----KTVIY-
D5WTV2_KYRT2/8-146-------------------------------NLPLLS-----ALA----SMLV-----AQG--------I----KIPFQ-
R6PRB8_9FIRM/8-139-----------------------------FQNKIIGI-----SIL----SWAV-----AQL--------I----KIIID-
C1N1Q0_MICPC/8-144-----------------------------FDNVGLVA-----AII----AVFV-----AQF--------L----KPFAE-
L0A6P8_DEIPD/5-141-----------------------------IHNKWLWT-----AVF----ASTG-----AQV--------I----KVLLI-
A0A3R7BI20_9CLOT/5-142--------------------------------YPLVA-----ALL----ANVI-----AQV--------L----KPIVL-
E3DMH7_HALPG/3-133---------------------------------LLEV-----SMF----SLFT-----AQF--------L----KIFFI-
E4U9L1_OCEP5/5-141-----------------------------LANEVLWA-----ALI----ANLV-----AQG--------L----KLVIH-
E8N0A2_ANATU/6-140-----------------------------LSNHVLWI-----SLI----AWGL-----AQF--------L----KPFLE-
K9SNJ2_9CYAN/8-142-----------------------------LDNQLLLI-----AVL----ASFL-----AQF--------L----KLIIV-
F0T097_SYNGF/8-149-----------------------------LANKVMLI-----SLL----AWFI-----AQL--------A----KVMMN-
A8FH06_BACP2/4-149-----------------------------LTNFPLLA-----SLA----AIFF-----AQF--------V----KVPIQ-
I0JQ19_HALH3/6-151-----------------------------LHNFPLWA-----SIA----SIFF-----AQI--------V----KIPIQ-
M4FCC5_BRARP/76-227--------------------------------KVLIA-----AGF----SGAI-----GQL--------L----KPFTS-
G8LW53_HUNCD/8-141-----------------------------INNRTITV-----PMF----AWFL-----AQL--------L----KVINV-
C8WVG2_ALIAD/12-152-----------------------------WGNTALMA-----AIC----AIVV-----TQI--------L----KVPIH-
R5ADD7_9CLOT/7-149-----------------------------FSNPLINA-----GVL----SWLC-----AQL--------I----KTVID-
K3YAI4_SETIT/11-145------------------------------VNYPLVA-----ALL----AFAI-----AQS--------S----KVFTT-
R7F8Q2_9CLOT/8-142-----------------------------ITNKFIYV-----PLL----TWFG-----IQL--------F----KVIWD-
A3DDN6_HUNT2/8-143-----------------------------LSNKTVTV-----PMI----AWFV-----AQF--------L----KVVNV-
K9Z2J9_CYAAP/8-142-----------------------------FSNKLLVI-----PLL----ACFL-----AQI--------I----KVSVD-
K9P352_CYAGP/15-157-----------------------------LANGVLAW-----GLA----ACGV-----AQL--------S----KLLIE-
K9XC51_9CHRO/8-143-----------------------------LDNSVLLV-----AVI----ACLI-----AQA--------S----KLVVE-
R6Y7H0_9FIRM/7-149-----------------------------LSNSLINV-----GVV----SWLV-----AQL--------I----KTALD-
E1RAI3_SEDSS/5-141-----------------------------LQNRILWL-----TLA----VTMT-----AQA--------L----KVLIE-
R5R4Q1_9FIRM/8-145-----------------------------LHNTILIN-----AVT----GWLC-----AQI--------L----KTITH-
B8E2Q0_DICTD/12-146-----------------------------LQNPVFII-----PMM----VAMI-----TQG--------I----KGLIR-
K4KZ53_9FIRM/8-148-----------------------------LNNNIMWV-----SLF----AWIL-----AQF--------L----KILIN-
R6EV23_9FIRM/8-145-----------------------------FSNHIFLT-----AAC----GWFV-----AQI--------L----KTLIH-
D6Y193_BACIE/4-149-----------------------------FTNFPLWA-----GLF----AIGF-----AQF--------V----KVPLE-
E7FY95_ERYRH/7-143---------------------------------PIIS-----ALV----ANIL-----AQV--------L----KPFFH-
C4L0Z0_EXISA/3-131-------------------------------NEPLLA-----AIL----AWFI-----AQA--------A----KLVTE-
D7GPW8_9FIRM/6-142-----------------------------LGNQILIS-----AVL----GWTV-----AQF--------L----KTVID-
D5E1E4_BACMQ/2-142-------------------------------NKGIVI-----ALS----SIGL-----AQA--------L----KIPIK-
A4J281_DESRM/9-144-----------------------------WLNKILFA-----PLS----AFLI-----AQI--------M----KGILA-
I0JIT0_HALH3/2-142-------------------------------NRGILT-----ALT----AIGV-----AQA--------L----KIVTY-
E1Z6N1_CHLVA/1-136------------------------------HNGAFVA-----AFL----GFFF-----AQS--------A----KVFTH-
Q8DMU2_THEEB/9-144-----------------------------LANHVLWV-----AFA----ASAI-----AQM--------L----KLLID-
A4RUH5_OSTLU/12-147-----------------------------VSSPALIA-----ALL----SFSI-----AQI--------A----KVFTH-
Q5L0A2_GEOKA/2-142-------------------------------NKGLKT-----ALA----TIAL-----AQF--------L----KIPIK-
W1NTD9_AMBTC/34-169-----------------------------LSNLPLLS-----SFL----AFAI-----AQF--------L----KLFTT-
K8EPQ0_CARML/4-150-----------------------------LTNYPLIA-----ALS----AICF-----SQF--------I----KVPIA-
C6CSF5_PAESJ/6-132---------------------------------YFLA-----PLI----GWFV-----SGI--------L----KFMIN-
G2TKM5_BACCO/4-146-------------------------------SYPILS-----ALL----GMLV-----AQI--------I----KVPIH-
K9TPQ7_9CYAN/8-143-----------------------------IDNRVLLV-----ATL----ACLI-----AQS--------A----KLAIE-
N0B1X3_9BACI/2-142-------------------------------NKGVSI-----ALI----SIGL-----AQA--------V----KIPLH-
V5WJH0_9SPIO/5-132----------------------------------FFT-----AVS----VQLV-----CQL--------T----KFIAY-
C9RC18_AMMDK/8-140------------------------------AHKLILA-----PLA----ACWV-----TQG--------I----KSFLA-
L7VUG0_THES1/9-141-----------------------------LSNRAITT-----PVL----TWFL-----AQS--------I----KFFHN-
R5J5K1_9FIRM/8-139-----------------------------FSNKMLWT-----SIF----ACFM-----AQF--------L----KVFSG-
C1E358_MICCC/7-142-----------------------------ISSPALVS-----ALL----AFTV-----AQV--------A----KVFTH-
R6B6R3_9CLOT/12-145--------------------------------RYLVV-----PFF----TWIG-----IQL--------F----KIIWE-
A5GRZ6_SYNR3/9-137-----------------------------LDNGPLAW-----GLA----ACGL-----AQL--------S----KLLIE-
R7B1C9_9CLOT/8-144-----------------------------TSNQTLMT-----GVT----GWVV-----AQV--------L----KTILD-

PF10261

Q5KDG2_CRYNJ/99-376-------------------------RVAYFARKSNIL-----NVIFVKRAWAW-----TSA-------------IYLLHL
G2QCT9_MYCTT/113-344--------------------------PSYFARKDNLL-----NVLFVKRGWAW-----ISV-------------AFWAFL
E3RV27_PYRTT/85-309-------------------------APSYFAQKKNVF-----NVYFVKVGWFW-----TTL-------------AFAFFV
R7YND5_CONA1/92-324--------------------------PSYFAQKRNVF-----NLFFVKQGWAW-----TTA-------------ALVLFL
G2XHJ1_VERDV/98-323-------------------------APGYFARKNNVF-----NVVYVKRGWFW-----TTV-------------VFGLFV
C4Y4H3_CLAL4/57-287-------------------------VYNYYNDKGNIF-----NQWFVKKGWAW-----TTG-------------AIALFY
C5DQ74_ZYGRC/35-359-----------------------------SVDKDGWI-----NTVFVKKGWFW-----TSL-------------VMWMCV
G8BYR0_TETPH/33-386--------------------------KTWDINRDSII-----NSVFVKRGWFW-----NSL-------------VLWYVI
E3KJ35_PUCGT/96-348--------------------------LPYFANKSNFL-----NQKFVKLGWAW-----TTF-------------VVWFHA
N1RPR7_FUSC4/66-290--------------------------PSYFARKSNIF-----NVLFVKRGWAW-----ITV-------------AFFVFI
F9WXZ1_ZYMTI/84-317-------------------------APSYFAKKSNIF-----NVYFVKVGWLW-----TTL-------------AFFLLI
G3BAX8_CANTC/92-323-------------------------VYNYYNDKNNVF-----NQLFVKRGWFW-----TTV-------------VMAAFY
G8BIE7_CANPC/69-321-------------------------VYNYYNNKHNFF-----NTVFVKRGWGW-----TTL-------------IIIVFY
C5FE12_ARTOC/64-296-------------------------PVNYFARKGNVF-----NVYFVKIGWLW-----MSL-------------AFLSLL
G8ZXV3_TORDC/32-356-------------------------DLQYRINKDGLL-----NSFFVKRGWFW-----TSA-------------IGWWCM
A5DKF9_PICGU/56-288-------------------------VYNYYNNKNNVF-----NQIFVKRGWFW-----TTV-------------VLVAFY
E3QPL9_COLGM/87-312-------------------------APSYFARKSNLF-----NIIFVKRGWFW-----ITA-------------AFFAFL
S3CVS7_OPHP1/100-357-------------------------APSYFARKSNVL-----NVLFVKRGWFW-----ITV-------------TFFAFV
A3LYM5_PICST/59-299-------------------------VYNYYTNKKNVL-----NQVFVKNGWFW-----TTA-------------NIVLFY
G0WG33_NAUDC/40-380-----------------------------TVDKDGLI-----NTLFVKKGWFW-----TTL-------------VGWFCI
M3IZX9_CANMX/56-283-------------------------VYNYYNNKGNIF-----NQYFVKKGWGW-----TTL-------------VILLFY
G3JBH7_CORMM/90-318-------------------------APNYFARKSNLF-----NVYFVKRGWGW-----TSA-------------ALLAFV
R9AQ78_WALI9/64-296--------------------------GAYFAARKNVF-----NKLFVKKAWGW-----TSV-------------SILSLV
C5E2P1_LACTC/32-359------------------------------VDKDGWL-----NTYFVKQGWFW-----TSL-------------VGWWCM
T0K1V0_COLGC/87-312-------------------------APSYFARKSNLF-----NVLFVKRGWFW-----ITA-------------AFFAFI
G8Y1H9_PICSO/62-313-------------------------VYNYYNDKRNIL-----NQFFVKKGWAW-----TTV-------------VIVVFY
C5G9K2_AJEDR/75-292-------------------------PVNYFARKGNIF-----NVYFVKVGWLW-----TTL-------------AFISLL
C5MI48_CANTT/55-284-------------------------IYNYYSNKKNIF-----NKLFVKQGWGW-----TTL-------------VILIFY
N1Q4W5_DOTSN/87-323-------------------------APSYFAKKSNVF-----NVYFVKIGWIW-----ITA-------------AFLLFI
S3DE95_GLAL2/81-314-------------------------APSYFAKKSNIF-----NKLFVKQGWAW-----ITF-------------SYLFFL
R9P3R6_PSEHS/103-383-------------------------ALNYWANRKNIV-----NQIFVKKAWLW-----TTI-------------AWLLQL
N1Q6I4_PSEFD/84-317-------------------------APSYFAKKSNVF-----NVWFVKIGWFW-----ITL-------------AFTLLI
K2R4W1_MACPH/94-328-------------------------APSYFAQKKNIF-----NVYFVKKGWAW-----TTG-------------ALLLFV
N1QNJ0_SPHMS/101-335-------------------------APSYFAKKSNVF-----NVYFVKIGWFW-----TTL-------------AFFTLI
F7WC52_SORMK/81-344--------------------------PSYFARKDNLF-----NVLFVKRAWFW-----ITV-------------SFFAFV
M2N8T6_BAUPA/89-327-------------------------APSYFAKKGNFF-----NVYFVKIGWFW-----TTL-------------AFVALI
K9G927_PEND2/67-311-------------------------PVNYFARKNNIF-----NLYFVKIGWLW-----TTA-------------AFVSLL
C4R337_KOMPG/57-293-------------------------VNNYFTDKRNLV-----NMVFVKNGWGW-----NLI-------------IFTIFC
A1CR84_ASPCL/74-313-------------------------PVNYFARKDNIF-----NLYFVKVGWLW-----TTI-------------AFASLL
A5E4A1_LODEL/62-350-------------------------VYNYYNDKRNVL-----NQWFVKRGWGW-----TTL-------------VVVLFY
E5R3U3_ARTGP/64-297-------------------------PVNYFARKGNVF-----NVYFVKIGWLW-----TSL-------------AFLSLL
K1WMV9_MARBU/113-341-------------------------APSYFAKKSNIF-----NVFFVKQGWAW-----VTV-------------SYLFFL
G0VEA6_NAUCC/39-386----------------------------HWANKDGLI-----NSIFVKKGWFW-----TTL-------------LTWFCI
Q6FR77_CANGA/32-368--------------------------GPIAVNKDGFV-----NRILVKRGWFW-----TTV-------------IGWLCI
E9EF85_METAQ/84-313-------------------------APSYFARKSNIF-----NVVFVKRGWGW-----TTF-------------AFYFFL
M9LJJ3_PSEA3/95-341-------------------------ALNYWANRKNIV-----NRIFVKKAWLW-----TTA-------------AWLAQL
M1VZ69_CLAP2/82-312-------------------------APSYFARKSNIF-----NVLFVKRGWGW-----TTF-------------AFYFFL
V5GE99_BYSSN/78-302-------------------------SVNYFARKNNIF-----NLYFVKIGWLW-----TTL-------------AFVALL
I2FTC6_USTH4/101-374-------------------------ALNYWANRKNIV-----NQIFVKNAWLW-----TTL-------------AWALQL
G8JR11_ERECY/38-363---------------------------FWVANKDGIL-----NVWFVKRGWFW-----TSV-------------IAWWCQ
Q6BUP0_DEBHA/108-353-------------------------VYNYYNNKRNVF-----NQVFVKRGWGW-----TTL-------------IIVVFY
Q4WJI3_ASPFU/73-304-------------------------PVNYFARKDNIF-----NLYFVKVGWIW-----TTL-------------AFLSLL
G2R9R1_THETT/97-341--------------------------PSYFARKDNLL-----NTLFVKRGWAW-----ITL-------------AFASFV
I4YGQ8_WALMC/41-264--------------------------ATYFATKKNIF-----NKLFVKKAWGW-----TTA-------------SVLALL
G2XPX9_BOTF4/55-288-------------------------APSYFAKKSNVF-----NQYFVKQGWAW-----ISA-------------SYFFFL
G3AEN0_SPAPN/55-285-------------------------VYNYYTDKRNIL-----NQLFVKNGWAW-----TTI-------------VIVVFY
C7Z7P3_NECH7/60-283-------------------------APSYFALKSNIF-----NVVFVKRGWAW-----ITV-------------AFALFI
SCS3_YEAST/33-370--------------------------LQATLNKDGLV-----NAMLVKKGWFW-----TSL-------------VGWWCI
G3YDY9_ASPNA/76-295-------------------------PVNYFARKDNIF-----NLYFVKVGWLW-----TTA-------------ALAFIL
L8FY78_PSED2/112-347-------------------------APSYFAKKSNLV-----NILFVKRGWFW-----VTM-------------SFFLFL
A7TR39_VANPO/62-394-------------------------ASNLNIDRDNFL-----NVIFVKKGWFW-----TTI-------------VVWYSL
N1JKB0_BLUG1/90-317-------------------------APSYFAKKDNIF-----NVFFVKRGWAW-----VTF-------------SYFLFL
B6Q6E7_TALMQ/81-304-------------------------PVNYFARKNNIF-----NLYFVKIGWVW-----ITA-------------AFLALL
B8M5R8_TALSN/84-316-------------------------PVNYFARKNNIF-----NLYFVKIGWVW-----ITF-------------AFLSLL
C8V5A4_EMENI/56-278--------------------------INYFARKNNIF-----NLFFVKLGWIW-----FTL-------------AFVALL
Q6CKM7_KLULA/25-334-----------------------------TADKDGIL-----NVYFVKFGWFW-----TSV-------------ISCLCV
Q75EB2_ASHGO/35-359-------------------------PNSWNADKDSTV-----NIWFIKQGWAW-----TSA-------------VCWWCV
M7SYX4_EUTLA/110-375-------------------------VPSYFARKDNLL-----NLLFVKRGWAW-----ITV-------------AFAAFV
E9CZW5_COCPS/67-291-------------------------PVNYFARKGNIF-----NVYFVKIGWLW-----TTV-------------AFLSIL
F0XPI2_GROCL/81-317-------------------------APSYFARKDNVL-----NVFFVKRGWFW-----ISL-------------AFAQFV
A7UX33_NEUCR/112-389--------------------------PSYFARKDNLF-----NVFFVKRAWFW-----ITV-------------SFFGFL
J3NLN2_GAET3/91-336-------------------------APSYFARKDNLV-----NVLFVKRGWAW-----VSA-------------AFAAFV
A7EQ03_SCLS1/55-288-------------------------APSYFAKKSNIF-----NQWFVKKGWAW-----ITA-------------SYFFFL
G9NCA4_HYPVG/72-300---------------------------GYFARKNNVF-----NVFFVKRGWGW-----ITF-------------AFVFSL

PF01569

A4I568_LEIIN/102-249-S-------------------------------------------------------PR----PAHPAAGMSYTTV-Y--
DOPP1_DICDI/54-178-E-------------------------------------------------------HR----PTMWKELRKQSY-----
Q17D95_AEDAE/56-197-E-------------------------------------------------------DR----PFWWVRETKEFTT-L--
G6PC3_MOUSE/53-195-G-------------------------------------------------------DR----PFWWVHESGYSTQTP--
A0BM37_PARTE/91-226-Q-------------------------------------------------------PR----PFFIVQEIEPYECNK--
Q23FV4_TETTS/102-237-D-------------------------------------------------------PR----PYFVNLDIKTDECGP--
A0EE96_PARTE/81-240-Q-------------------------------------------------------PR----PFYLDPEIKLDFC-Y--
A8FE89_BACP2/71-198-R-------------------------------------------------------ER----PAFDHLVNETYY-----
Q7MUE1_PORGI/58-185-R-------------------------------------------------------FR----PSHHPDFIDYVKTVY--
A0K0K5_ARTS2/118-241-R-------------------------------------------------------QR----PPLDLMLFGPDVTF---
A4XP73_PSEMY/98-234-W-------------------------------------------------------QR----PSASLVVEGSARLTE--
A4X1H8_SALTO/101-242-R-------------------------------------------------------PA----PSASVREPFLAPE-Q--
Q9EWX3_STRCO/115-237-R-------------------------------------------------------LG----PHYATTIGANEMWLG--
A1BJZ6_CHLPD/56-185-R-------------------------------------------------------IR----PCFVLEGCRLLVDQS--
A4FQA0_SACEN/76-196-Q-------------------------------------------------------ER----PCRAVRDIAATLAEC--
B0U8C7_METS4/61-186MR-------------------------------------------------------LR----PLHSGDSNFIAPIGT--
A1S1V4_SHEAM/77-196-V-------------------------------------------------------MR----PAAVLEHIRIVGAMR--
A1W5E3_ACISJ/72-191-F-------------------------------------------------------PR----PAAVFGHLNHVLGTV--
A5CF96_ORITB/78-203-F-------------------------------------------------------TR----PCCSLSSSEIQTVID--
B4U5Z7_HYDS0/54-171-Q-------------------------------------------------------PR----PASVLKHVHLLYKLY--
A5DBA1_PICGU/102-232-L-------------------------------------------------------PR----PRSPPLHRITMSSYT--
Q4D544_TRYCC/102-225-C-------------------------------------------------------PR----PPCPPVELRGRASAS--
SSPA_DICDI/88-218PR-------------------------------------------------------PP----PNIVWTNTAHQKDH---
Q32GQ5_SHIDS/77-232-E-------------------------------------------------------PR----PFVIWLEKTHHIPVD--
Q9CMX4_PASMU/75-237-E-------------------------------------------------------PR----PYIVYVAEASGISVE--
Q21JU9_SACD2/110-231-A-------------------------------------------------------LR----PPAVFTTDLFNLVGK--
Q0K1U6_CUPNH/103-229-R-------------------------------------------------------TR----PFVANKTQMCTPAET--
Q65GX3_BACLD/179-304-Y-------------------------------------------------------PR----PFRWKDNSIIVPTLI--
Q2IJN8_ANADE/141-265-R-------------------------------------------------------PL----PVTYAGRDGLVKQAQ--
Q6FEM9_ACIAD/65-182-R-------------------------------------------------------PR----PYQVHQVIVLGERPL--
A1K7H5_AZOSB/105-237-R-------------------------------------------------------AR----PAKVEAFGGASTFSP--
Q6MBQ7_PARUW/87-223-R-------------------------------------------------------PR----PKQIIEFGGAQPF-L--
A8EX54_ARCB4/94-229-M-------------------------------------------------------PC----PNNLAEYGGRYPDVR--
Q87X15_PSESM/102-231-V-------------------------------------------------------QC----PWSLTEFGGQETYSE--
A8BDI5_GIAIC/110-282-R-------------------------------------------------------PR----PRQIAEFTTVSGPTV--
A8BQZ4_GIAIC/121-285-R-------------------------------------------------------PR----PRNTHEFGILLETCK--
Q6MTZ1_MYCMS/144-270-R-------------------------------------------------------PR----PTNLELYRNWWNIKW--
R5TP42_9FIRM/95-216---------------------------------------------------------LR----PVVFPRDNIFTDM-V--
A3LWS4_PICST/248-396KV-------------------------------------------------------------PSFEMTYTDGITRQD--
Q127S7_POLSJ/95-224PT-----------------------------------------------------AAPQ----PNIDWSQYPDVGLLK--
A4CJ32_ROBBH/299-448-L-------------------------------------------------------IR----PETLINQHIDDSWKP--
Q2HER5_CHAGB/260-418-G-------------------------------------------------------WR----PVTAIHHPTPWVHSG--
A8L0R7_FRASN/276-428-S-------------------------------------------------------WR----PVTAIQLADTDGNPA--
Q6NJR5_CORDI/194-319-R-------------------------------------------------------PR----PDHALLRFPPEVTPA--
A1SKJ7_NOCSJ/98-218-R-------------------------------------------------------DR----PPVRILDPGLVPDD---
Q82Z33_ENTFA/85-204-R-------------------------------------------------------AR----PNLGALADRSSA-----
A2DYB5_TRIVA/98-241-R-------------------------------------------------------TR----PDLYSICGSQEINPS--
A2EZZ9_TRIVA/91-236-R-------------------------------------------------------AR----PDYYTFTTEILEA-S--
A4H9E7_LEIBR/233-378-R-------------------------------------------------------LR----PDFLSRLRNEGFNAS--
Q6BYN9_DEBHA/112-272-L-------------------------------------------------------PR----PDLISRCQPTQTEML--
A7EIU4_SCLS1/134-294-G-------------------------------------------------------LR----PHFLTVCKPNIPVTT--
A7TF94_VANPO/122-266-N-------------------------------------------------------LR----PDFLERCQPMIPK-G--
Q2TYI3_ASPOR/35-224-K-------------------------------------------------------PR----PDFLARCDPDLSNIS--
A2EQG2_TRIVA/90-230-R-------------------------------------------------------PR----PDTIAICGGDGSY-L--
PLPR5_MOUSE/122-275-L-------------------------------------------------------CK----PNYTALGCQQYTQ-F--
Q9VNU2_DROME/65-225-R-------------------------------------------------------LR----PHFFHGCQPRLDDGS--
A8WXP5_CAEBR/128-286-R-------------------------------------------------------LR----PHFVSVCKPDWSKVD--
A6X217_OCHA4/121-242-R-------------------------------------------------------AR----PFLLDDVGAAYFSPF--
Q5NGF4_FRATT/116-236-R-------------------------------------------------------AR----PKFFLEYGSHYFQHF--
Q5ZX13_LEGPH/91-208-R-------------------------------------------------------AR----PDLLFDNNLYGFYWF--
Q6MH55_BDEBA/105-226-R-------------------------------------------------------QR----PHKTPDFDPYVFDHF--
Q7NZZ5_CHRVO/815-932-R-------------------------------------------------------AR----PGDDNAPWRSQPAGT--
Q89JR9_BRADU/79-199-Q-------------------------------------------------------TR----PDRRTVIGHLHGVPF--
B7VND8_VIBA3/235-351-F-------------------------------------------------------PR----PHAYLPTLKLVMS-S--
Q5E4L0_ALIF1/241-366-L-------------------------------------------------------PR----PFVYIPQLQLTEA-V--
Q9RVR6_DEIRA/14-135-L-------------------------------------------------------PR----PFTDDPALASAAARA--

PF14378

Q5K8D7_CRYNJ/128-311RY-------------------------------------------------------FK----PYIFQSTRRTLVLCN--
B0UG28_METS4/124-315-T-------------------------------------------------------RR----MGRLWAFVRLFCAAL--
A1SJR6_NOCSJ/50-230-W-------------------------------------------------------HH----RPAFLRLRDGMLVSG--
E4NIW3_KITSK/45-228-V-------------------------------------------------------RD----GAAYRRARRALLAMT--
G8WRV6_STREN/158-347-R-------------------------------------------------------RH----SGSYLYMRTWLMIST--
C7QD07_CATAD/71-251-I-------------------------------------------------------RH----REHYASARTTMALAT--
Q2G5H1_NOVAD/115-305-T-------------------------------------------------------LP----PKRLLHFIAAYSLTL--
Q1IHV8_KORVE/153-330-L-------------------------------------------------------ND----ERRARTALWAFLIVG--
F2R3P1_STRVP/39-228-R-------------------------------------------------------RR----PAHYRAARTWLMAST--
A9HHP2_GLUDA/131-314-A-------------------------------------------------------RK----RGRNRELLVNMQVAL--
Q13PQ7_PARXL/110-293-T-------------------------------------------------------RN----TRDYAEFVVQFMVSA--
Q63V72_BURPS/125-308-T-------------------------------------------------------RR----DDDLSEFIALFMLTS--
Q01VD1_SOLUE/159-330-R-------------------------------------------------------VH----GQFRFSIVRLFVVSN--
D1CA82_SPHTD/53-235-W-------------------------------------------------------RH----TERYREFRNVFLGIL--
K0K1I4_SACES/40-223-I-------------------------------------------------------AR----RARYSHLRTVLVVMM--
D1C524_SPHTD/53-234-C-------------------------------------------------------LR----PHRFVETRNIYLTLL--
W5TLL4_9NOCA/53-242-W-------------------------------------------------------SH----REHYRAARTQLGIAT--
Q2JBQ4_FRACC/47-236-R-------------------------------------------------------RH----PPRYAQARWTLVITT--
W0BEC4_9GAMM/94-276-A-------------------------------------------------------KR----FQLMREYYFLLFSSA--
Q220L9_RHOFT/109-292-S-------------------------------------------------------AR----PAQLDEFMRLFIVAT--
Q87M50_VIBPA/146-355YK-------------------------------------------------------KA----RMLRLQFLLTFLLTW--
B1LSY3_METRJ/129-320-T-------------------------------------------------------RR----LGRLWTYIRLFSATL--
A2BL06_HYPBU/51-224-F-------------------------------------------------------RE----PKLFRRLLAAFLVAS--
L0PFU2_PNEJ8/5-201LF-------------------------------------------------------SP----PGTLPVFAKSFGYLN--
C9Z2S2_STRSW/63-253-R-------------------------------------------------------SR----AVRYRAARTWLLTST--
E3JAH2_FRAIE/94-282-R-------------------------------------------------------RN----PAHYRRARSTILLTT--
F8AWV4_9ACTN/47-236-R-------------------------------------------------------KR----ARSYLAARWTIVCTT--
R7Y200_9ACTN/124-318WS-------------------------------------------------------RN----ITFGYWFATSQCLAW--
A0LS47_ACIC1/69-252-R-------------------------------------------------------RR----PDVYPWARNTLAGLT--
E2Q4K3_STRCL/45-234-R-------------------------------------------------------SH----AVRYRAARTWLMVST--
F8J559_HYPSM/123-309---------------------------------------------------------AD----PERLRSVMTTSTVVL--
L0ET54_LIBCB/102-293-L-------------------------------------------------------KI----PERAYIMVTSYGVLC--
Q89QL0_BRADU/109-300-A-------------------------------------------------------GH----ALRLRIFMLSFVLTT--
H0PVV4_9RHOO/74-256-A-------------------------------------------------------ER----TSRNRELFWTAVIAL--
E3EJC2_PAEPS/1-162KM-------------------------------------------------------PH----RMMVLEAVITVCIGF--
A1SDU3_NOCSJ/130-324WS-------------------------------------------------------RN----LSYGYWFVTSQCIAW--
C7QBQ6_CATAD/84-272-F-------------------------------------------------------KF----PDRYRAIRTVMISMT--
A1SHK3_NOCSJ/128-322LL-------------------------------------------------------PR----VREAYVMLCSALWVW--
E3J0M0_FRAIE/110-299-R-------------------------------------------------------RH----GASYSRARWTLVFTT--
C8XDB0_NAKMY/22-205-F-------------------------------------------------------AR----ADVYPKVRRTFVVMA--
G7XGU5_ASPKW/117-299TC-------------------------------------------------------IQ----RDKYQAIRRTLAFEN--
B1LVV6_METRJ/99-290-S-------------------------------------------------------GR----LRALQDFVLAFALAG--
Q5ZV46_LEGPH/101-283-S-------------------------------------------------------GR----FYILKDYYFLLLCTT--

PF14360

F6UTK5_XENTR/282-355--------------------------------------------------------------------------------
SMSR2_CAEEL/192-265--------------------------------------------------------------------------------
SLS2_TRYB2/201-275--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
A0A509ASM8_PLABA/201-272--------------------------------------------------------------------------------
A0A384LQJ1_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
F8W5G6_DANRE/232-307--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------

PF02681

F2NNY3_MARHT/5-141-Y-----------------------------------------------------LING----RWE------W-ERFL--
K9T6M6_9CYAN/8-143-L-----------------------------------------------------IRNG----KVN------L-RYLV--
D4ZTL8_ARTPN/8-143-L-----------------------------------------------------IQHG----KIN------L-RVLV--
K9WGM7_9CYAN/8-143-L-----------------------------------------------------TKNR----KLN------L-RDLV--
B7GI74_ANOFW/24-164-K-----------------------------------------------------RKTK----KWD------W-SLFF--
B1WS33_CROS5/8-143-L-----------------------------------------------------IRHR----KIN------F-RYLV--
R5AEV3_9CLOT/9-146-L-----------------------------------------------------ILYH----EWR------F-ERLV--
Q31Q62_SYNE7/9-145-G-----------------------------------------------------VRDR----RLN------W-HVLI--
R5XG63_9CLOT/5-137--------------------------------------------------------KEK----KFD------F-KRII--
R7A3L4_9FIRM/8-144-Y-----------------------------------------------------FKSG----KWD------L-HWVI--
W0E929_9FIRM/8-143-F-----------------------------------------------------KIHH----TFD------L-YFLI--
D3FYY4_ALKPO/4-149-F-----------------------------------------------------LPTR----KLD------W-TLFT--
F0RVM2_SPHGB/6-143-A-----------------------------------------------------LFER----RFD------W-HLLI--
H6NB79_9BACL/2-142-L-----------------------------------------------------RQTG----RIE------W-KDLF--
Q7V6P1_PROMM/15-147-L-----------------------------------------------------IFYR----RWR------P-AVLL--
Q18B69_CLOD6/8-140--------------------------------------------------------KEK----RIE------L-SRIL--
G0GF41_SPITZ/9-149-------------------------------------------------------ALKR----RRRFASPLLP-VVLW--
Q65FE5_BACLD/4-149-F-----------------------------------------------------VVSK----KWD------W-RLVT--
U5LF62_9BACI/2-142-F-----------------------------------------------------LKKR----EWK------P-GLFF--
R7L0C2_9FIRM/5-149-L-----------------------------------------------------IKYK----KFS------F-ERLF--
Q5WDV5_BACSK/4-146-F-----------------------------------------------------FATK----KLD------F-SLFT--
D6GSF2_FILAD/8-144-I-----------------------------------------------------IIDR----RFD------F-TRFV--
E6U5K5_ETHHY/8-143-L-----------------------------------------------------IITK----RFD------P-ERIL--
Q5SJ95_THET8/4-140-Y-----------------------------------------------------FLEG----RFQ------W-HRFL--
Q9RSQ8_DEIRA/8-143-L-----------------------------------------------------LLER----RWH------P-GAFM--
P73185_SYNY3/8-143-I-----------------------------------------------------FRNG----KIN------L-RSLV--
D1AKQ0_SEBTE/7-143-L-----------------------------------------------------FKGR----GAS------W-VRLF--
E0RXA3_BUTPB/8-144-V-----------------------------------------------------LVNK----EFN------A-ERLT--
F5YE41_TREAZ/16-155-------------------------------------------------------LLGS----RKKSPRELVE-TIIW--
V5WEJ9_9SPIO/6-144-A-----------------------------------------------------IYKR----RLHNAADIIA-SLMW--
U5LHE7_9BACI/5-149-Y-----------------------------------------------------IATR----RLD------W-SLLT--
K9XWG4_STAC7/8-143-L-----------------------------------------------------IRNR----KVN------F-RYLV--
E6U2C7_BACCJ/4-149-Y-----------------------------------------------------LATK----RFD------W-SLLT--
K9V3M2_9CYAN/8-143-L-----------------------------------------------------VKNR----KLN------I-SVLF--
B9IAH9_POPTR/38-171-W-----------------------------------------------------YKEK----RWD------S-KRML--
M0RZC5_MUSAM/20-155-W-----------------------------------------------------YKEK----RWD------S-RRLL--
R5ZD30_9FIRM/8-146-F-----------------------------------------------------YKSG----EWD------L-HWVI--
R6Q3Q8_9FIRM/8-138-I-----------------------------------------------------VTER----KFD------A-SRLT--
C0ZKP9_BREBN/5-150-F-----------------------------------------------------FATK----TWQ------W-SLLM--
D8TLE7_VOLCA/33-168-Y-----------------------------------------------------YREQ----VWD------W-TRLV--
R6SRI1_9FIRM/7-157-F-----------------------------------------------------IKTK----NFK------A-ERLT--
K9YEC7_HALP7/8-143-F-----------------------------------------------------LREG----KFD------A-RSLF--
K3XML5_SETIT/24-159-W-----------------------------------------------------YKEN----RWD------P-KQLI--
K9RII7_9CYAN/8-143-F-----------------------------------------------------IKNR----KVS------A-SVLV--
K4LIZ6_THEPS/40-169---------------------------------------------------------------RSD--GGIAW-RQLF--
E6TWS5_BACCJ/5-142-Q-----------------------------------------------------LKTK----KWN------W-KTFF--
Q73MW8_TREDE/10-150-------------------------------------------------------LFNA----SIKTPIDFFE-LVFW--
Q8Y4P9_LISMO/4-149-I-----------------------------------------------------LVYR----KFN------L-GLMF--
M0SK26_MUSAM/139-272-F-----------------------------------------------------FVER----RWD------L-GMLF--
G4KW10_OSCVS/4-137-A-----------------------------------------------------LMNQ----KLD------I-RRLF--
R5CL70_9FIRM/8-147-M-----------------------------------------------------IINH----KFC------F-ERIF--
I0I5M8_CALAS/5-139-W-----------------------------------------------------VQTG----RFD------V-RVMA--
D7CKU8_SYNLT/12-144-Y-----------------------------------------------------LKER----CWR------W-YWLF--
R7IRJ9_9CLOT/8-142-L-----------------------------------------------------IKTK----KFN------F-KRIV--
B8HXR8_CYAP4/8-143-Y-----------------------------------------------------IKNR----KLN------F-RVLV--
B0C3J0_ACAM1/8-143-L-----------------------------------------------------IQNG----KIN------F-RVLV--
I4DAH9_DESAJ/3-144-Y-----------------------------------------------------WRNR----IWD------W-KAVF--
Q46K07_PROMT/15-148-L-----------------------------------------------------IFKQ----RWR------P-SVLI--
R7A3G1_9CLOT/8-142-L-----------------------------------------------------VTTK----KFN------F-KRII--
Q24V03_DESHY/8-143-F-----------------------------------------------------SIHR----TFD------V-AFLF--
Q10X44_TRIEI/8-143-L-----------------------------------------------------VQHR----QIN------L-RVLF--
A4RZ57_OSTLU/3-142-R-----------------------------------------------------VAGG----AWR------P-ALAL--
D8QR56_SELML/24-159-W-----------------------------------------------------YKEK----RWD------L-KRMA--
A0A3Q7ELN9_SOLLC/140-274-F-----------------------------------------------------CVER----KWD------F-RIMF--
Q8ENX8_OCEIH/4-149-L-----------------------------------------------------IFTK----EFQ------P-GLAF--
K7V114_MAIZE/48-182-W-----------------------------------------------------LKEK----RWD------A-RKFL--
Q01ES7_OSTTA/128-261-Y-----------------------------------------------------YREG----RWD------Y-RVMF--
E3HA83_ILYPC/7-143-I-----------------------------------------------------IFDK----TLD------F-KRFW--
A6TR41_ALKMQ/8-144-F-----------------------------------------------------IVDK----RFN------L-SRFV--
I1KRZ5_SOYBN/9-144-W-----------------------------------------------------FKDR----RWD------L-KQLV--
R5KDM7_9CLOT/8-150-L-----------------------------------------------------CMTK----KWN------W-ERVV--
R7I9S8_9FIRM/10-145-Y-----------------------------------------------------LVEK----KWD------W-HRFF--
R6BY11_9CLOT/8-144-L-----------------------------------------------------FFTK----KFV------A-ERLV--
R5ITD2_9FIRM/8-144-A-----------------------------------------------------LMHH----TLD------L-TRIF--
K9RQD3_SYNP3/8-143-V-----------------------------------------------------IRHQ----KLN------F-RVLV--
K9SVF9_9SYNE/8-143-Y-----------------------------------------------------IQSG----QIK------L-HVLF--
Q7VBG6_PROMA/16-148-L-----------------------------------------------------IFYQ----KWR------P-SVLL--
O83188_TREPA/14-153-------------------------------------------------------CRRS----AIRSVHGFFD-FAVW--
G8QY16_SPHPG/6-143-A-----------------------------------------------------IVDH----RFD------W-SLLH--
D3EMZ3_ATETH/8-144-L-----------------------------------------------------IHHR----KMN------F-NSLV--
M0SG02_MUSAM/22-157-W-----------------------------------------------------YKER----RWD------A-KQLI--
F5YMS6_TREPZ/16-155-------------------------------------------------------LLKT----KKRNGRELLE-TIIW--
R7R6N9_9FIRM/8-144-M-----------------------------------------------------YFNK----SFV------P-ERLV--
C7NE60_LEPBD/7-143-V-----------------------------------------------------FKGQ----KPQ------W-ARLV--
R5IDQ6_9CLOT/2-138-F-----------------------------------------------------ALNK----SFN------A-ERLV--
D9R8M4_CLOSW/8-144-L-----------------------------------------------------ALNK----NFN------P-ERLV--
D7BAF5_MEISD/5-141-Y-----------------------------------------------------AVER----EWQ------W-ERFV--
F8F1T7_TRECH/16-155-------------------------------------------------------LLKN----TKKSAKEIVA-TLLW--
Q93ZZ7_ARATH/51-205VV-----------------------------------------------------LYGK----NLD------F-RSVF--
D8U4F3_VOLCA/38-173-R-----------------------------------------------------FKKG----IWD------A-GAML--
J7IS94_DESMD/8-142-L-----------------------------------------------------IVIR----KLN------F-SLFF--
F9VBI0_LACGL/8-142-I-----------------------------------------------------FRYR----RLD------W-RLLF--
K9W0K1_9CYAN/16-151-L-----------------------------------------------------VIHR----KVN------I-RVLV--
A9NHX4_ACHLI/6-144-G-----------------------------------------------------LINR----KLN------E-SILI--
D1AXZ8_STRM9/7-141-V-----------------------------------------------------IFKR----KID------F-TRLF--
K9UG93_CHAP6/16-151-T-----------------------------------------------------IQNG----KFS------V-KVLT--
F4LN44_TREBD/13-152-------------------------------------------------------LFTG----KISSLRELFE-LLLW--
R6NRL3_9CLOT/2-140-Y-----------------------------------------------------VKYLVGKRKGINRSKVTL-ETLF--
K0IWZ6_AMPXN/4-149-Y-----------------------------------------------------IATK----EFK------P-GLAF--
W8TJV6_PEPAC/8-150-L-----------------------------------------------------LLEN----KLD------A-SRFV--
A8MFI8_ALKOO/8-144-F-----------------------------------------------------IAEG----RID------F-TRFV--
H9UHZ5_SPIAZ/13-152-------------------------------------------------------VLRR----RTDTTRDLMV-TVFW--
B8CY18_HALOH/3-134----------------------------------------------------------L----PPD------F-SRII--
B2A528_NATTJ/7-141-L-----------------------------------------------------IKHR----SLD------L-KLFV--
R6ME09_9FIRM/8-142-V-----------------------------------------------------WDKK----KFD------F-KRII--
F2NS18_TRES6/11-151-------------------------------------------------------LFSG----KVHSLKELFE-LLLW--
R5PNP2_9CLOT/8-138-L-----------------------------------------------------ATTK----KFN------F-KRII--
Q1J0I2_DEIGD/9-145-L-----------------------------------------------------LIEG----RWR------P-AAFF--
R5MBG0_9CLOT/8-144-I-----------------------------------------------------ALNR----SFN------P-ERLT--
I4D8V5_DESAJ/8-142-L-----------------------------------------------------IAAG----KLD------F-QLIW--
R7A673_9FIRM/8-144-M-----------------------------------------------------ILTK----QFV------A-ERMV--
R7FJ12_9CLOT/8-142-L-----------------------------------------------------ITTK----KFN------F-KRII--
O51097_BORBU/6-146-T-----------------------------------------------------VKTR----KLKLTPVHLLKKIFL--
K8GFC4_9CYAN/8-143-L-----------------------------------------------------AKNG----KVN------I-RSLV--
M4CGY8_BRARP/134-268-F-----------------------------------------------------FIER----KWD------L-SLLF--
R6N1H2_9CLOT/6-146-V-----------------------------------------------------STHR----RIN------W-RRFF--
D3FSU1_ALKPO/2-142-K-----------------------------------------------------MQTD----QWE------W-DTLL--
B9DG97_ARATH/20-155-W-----------------------------------------------------YRER----RWD------L-KQLI--
Q9CGU3_LACLA/8-142-L-----------------------------------------------------IRTH----RIN------W-QLIF--
F2I5F0_AERUA/1-152LF-----------------------------------------------------MGKK----ETK------L-SIIH--
R7N6H8_9FIRM/8-144-I-----------------------------------------------------IVNK----QFV------A-ERLV--
C1FDH6_MICCC/170-303-F-----------------------------------------------------YREG----KWD------W-RVMF--
R6SUP5_9CLOT/9-142-A-----------------------------------------------------FKVQ----KFT------LNSLLF--
A5GM29_SYNPW/13-145-L-----------------------------------------------------VTQR----RWR------P-QVLI--
Q2JKH6_SYNJB/6-142-Y-----------------------------------------------------VRSG----KVN------L-RVLV--
F2JMF4_CELLD/8-142-L-----------------------------------------------------LQEH----RLD------W-SKLW--
E6SHJ0_THEM7/12-146-A-----------------------------------------------------V-TG----KDD------PKAALV--
K9S6R1_9CYAN/8-143-F-----------------------------------------------------ARHG----KVN------L-RALV--
E3PRG0_ACESD/8-144-Y-----------------------------------------------------FFEN----RFD------A-SRFV--
R5N6N4_9CLOT/8-137-R-----------------------------------------------------VHEG----VWD------I-ERIL--
R5GZB8_9FIRM/8-144-T-----------------------------------------------------CITK----SFD------P-ERLV--
D5WTV2_KYRT2/8-146-R-----------------------------------------------------WREK----AWN------W-RLAF--
R6PRB8_9FIRM/8-139-V-----------------------------------------------------YTTK----KID------L-NLIM--
C1N1Q0_MICPC/8-144-W-----------------------------------------------------ARTR----RAR------P-SLAL--
L0A6P8_DEIPD/5-141-L-----------------------------------------------------LFER----RWR------P-DKFM--
A0A3R7BI20_9CLOT/5-142-Y-----------------------------------------------------FRTK----ELD------V-HQCI--
E3DMH7_HALPG/3-133----------------------------------------------------------R----PMN------F-YTFF--
E4U9L1_OCEP5/5-141-Y-----------------------------------------------------LFER----RWS------W-ERLL--
E8N0A2_ANATU/6-140-Y-----------------------------------------------------LETR----RWV------W-GLWF--
K9SNJ2_9CYAN/8-142-F-----------------------------------------------------IRVR----KIE------L-RVLF--
F0T097_SYNGF/8-149-F-----------------------------------------------------LIER----KID------F-RLIF--
A8FH06_BACP2/4-149-F-----------------------------------------------------IISR----RLD------W-SLIT--
I0JQ19_HALH3/6-151-F-----------------------------------------------------IASR----NFN------P-SLAF--
M4FCC5_BRARP/76-227VV-----------------------------------------------------FYKK----KLD------F-RTAL--
G8LW53_HUNCD/8-141-L-----------------------------------------------------VSSK----KID------F-TRFI--
C8WVG2_ALIAD/12-152-F-----------------------------------------------------VTTR----AWD------W-SRVF--
R5ADD7_9CLOT/7-149-A-----------------------------------------------------IKHR----SFN------R-QRLA--
K3YAI4_SETIT/11-145-W-----------------------------------------------------YKDN----RWD------A-RQFI--
R7F8Q2_9CLOT/8-142-L-----------------------------------------------------VTTK----KFN------F-KRIL--
A3DDN6_HUNT2/8-143-I-----------------------------------------------------VVER----KLD------F-TRFI--
K9Z2J9_CYAAP/8-142-T-----------------------------------------------------IANQ----KFS------F-RYIV--
K9P352_CYAGP/15-157-L-----------------------------------------------------VVHR----RWR------P-AVLV--
K9XC51_9CHRO/8-143-L-----------------------------------------------------IKNR----KLD------M-RVLV--
R6Y7H0_9FIRM/7-149-A-----------------------------------------------------VKHR----SFN------R-QRLA--
E1RAI3_SEDSS/5-141-L-----------------------------------------------------LIEK----KLD------L-RRMG--
R5R4Q1_9FIRM/8-145-L-----------------------------------------------------IINK----KFV------W-ERLV--
B8E2Q0_DICTD/12-146-S-----------------------------------------------------IQER----KFL------W-RAFF--
K4KZ53_9FIRM/8-148-F-----------------------------------------------------VIEK----EWD------F-DLLT--
R6EV23_9FIRM/8-145-L-----------------------------------------------------IISK----KFV------A-ERLV--
D6Y193_BACIE/4-149-F-----------------------------------------------------IATR----KFN------W-GLLT--
E7FY95_ERYRH/7-143-Y-----------------------------------------------------LKTG----EKN------L-SMIF--
C4L0Z0_EXISA/3-131-L-----------------------------------------------------IKTR----DFE------I-EIMF--
D7GPW8_9FIRM/6-142-M-----------------------------------------------------VINK----SFN------P-ERVF--
D5E1E4_BACMQ/2-142-K-----------------------------------------------------YQTG----KWD------M-RMIA--
A4J281_DESRM/9-144-S-----------------------------------------------------IKSK----KWH------W-DRFI--
I0JIT0_HALH3/2-142-K-----------------------------------------------------RLTG----KWD------V-KQVA--
E1Z6N1_CHLVA/1-136-Y-----------------------------------------------------YTEQ----KWD------F-TRLV--
Q8DMU2_THEEB/9-144-I-----------------------------------------------------AKHR----KLN------F-RVLV--
A4RUH5_OSTLU/12-147-Y-----------------------------------------------------HATG----KVD------Y-SRIV--
Q5L0A2_GEOKA/2-142-Q-----------------------------------------------------LETG----RWD------W-RLFF--
W1NTD9_AMBTC/34-169-R-----------------------------------------------------YKEK----RWD------A-KRLL--
K8EPQ0_CARML/4-150-F-----------------------------------------------------LLKK----NTT------W-ALAV--
C6CSF5_PAESJ/6-132-Y-----------------------------------------------------IRFG----KEA--------KQRV--
G2TKM5_BACCO/4-146-F-----------------------------------------------------ITSG----KFD------W-RMAF--
K9TPQ7_9CYAN/8-143-L-----------------------------------------------------ARNR----KFN------F-RVLV--
N0B1X3_9BACI/2-142-F-----------------------------------------------------MKSG----EWK------P-EMFF--
V5WJH0_9SPIO/5-132-S-----------------------------------------------------IRDK----KFT------P-SYLA--
C9RC18_AMMDK/8-140-W-----------------------------------------------------RRER----RWS------W-EWLY--
L7VUG0_THES1/9-141-Y-----------------------------------------------------VKTR----KLD------F-RKLI--
R5J5K1_9FIRM/8-139---------------------------------------------------------EK----KFD------L-TRII--
C1E358_MICCC/7-142-W-----------------------------------------------------HTTG----KLD------Y-GRLV--
R6B6R3_9CLOT/12-145-Y-----------------------------------------------------AETK----RLN------I-RRLW--
A5GRZ6_SYNR3/9-137-L-----------------------------------------------------VVHR----RWR------P-AVLI--
R7B1C9_9CLOT/8-144-I-----------------------------------------------------GLNH----SFN------P-ERLV--

PF10261

Q5KDG2_CRYNJ/99-376VT-------SPRNRSRMFSFST------------------------------PPNDGRIRRLLVWIAATACWAVFTRW--
G2QCT9_MYCTT/113-344LT-------HP--------AAG-----------------------------PGAKTRARAAV-RWAAVTAWWVFVTQW--
E3RV27_PYRTT/85-309TL-------HP----GFGRGA--------------------------------SARRVRAVL-RYGVVTTWWCFLTQW--
R7YND5_CONA1/92-324LT-------HP----SLGPPMRP----------------------------VLTPRRVRAVL-RYLLVTLWWAGVTQW--
G2XHJ1_VERDV/98-323AT-------HP----ALQNT----------------------------------KRRMQAGV-RWAVATALWFLVTQW--
C4Y4H3_CLAL4/57-287T------------------IEVSK--------------------------SGFRLKVLRGAVLRWLVATCWWYLFTQW--
C5DQ74_ZYGRC/35-359Y----------RYG-----------------------------------------KFNRQSFTRYLILTAWWYVFTQA-L
G8BYR0_TETPH/33-386LFTNITIVDEPKRNNSIEGRKTK---------------------------TRIHTLNIKKFIKRYVIVTMWWILFTQGIP
E3KJ35_PUCGT/96-348IAIATCYFGPPHPNQQQQQTQNS---------------------------RSHPSSHVPRILSLHLLATLLWIFLTQW--
N1RPR7_FUSC4/66-290FS-------HP----STTDT----------------------------------GRRVRASL-RWVAVTTMWFLVTQW--
F9WXZ1_ZYMTI/84-317LS-------HS----SLGPPLRL----------------------------QLTRRRWQATL-RYTCATLIWIFVTQW--
G3BAX8_CANTC/92-323GSVFYGKHPQLGTNRF---------------------------------------PVAKNAIISYTIATAWWILFTQW--
G8BIE7_CANPC/69-321AVIVMPKLYS---------NKNDTTS----------------------IQQQQKIEFLIKAVVRYAIATFWWILFTQW--
C5FE12_ARTOC/64-296LT-------QQ----AFISKRIS---------------------------ADCRLRRVGQALFRYSIVTFSWILTTQW--
G8ZXV3_TORDC/32-356I----------RYRSFN--------------------------------------RQNHHSLVRYAILTIWWYMFTQS-L
A5DKF9_PICGU/56-288GVI----FT----------STTHSYIK--------------------DTPYSQRMHLLRRTLMRYLVMTVWWVLFTQW--
E3QPL9_COLGM/87-312LT-------HP----GTKNA----------------------------------TVRLQATL-RWVLVTTWWFFVTQW--
S3CVS7_OPHP1/100-357AT-------HPYFTAVQKAPSK-----------------------------TLFGRRASAAI-RWSLVTGWWILVTQW--
A3LYM5_PICST/59-299GIV----LY----------KEKS---------------------------SAIRINIAKGAVIRYVLATVWWIFFTQW--
G0WG33_NAUDC/40-380Y----------RYNNRRPDF----------------------------------QKILWKAFKHYCVLTCWWYAFTQSIF
M3IZX9_CANMX/56-283SNL----LY----------KTPA----------------------------ADRIRVLRRAVTNYIIATVWWILFTQW--
G3JBH7_CORMM/90-318LL-------HP----AVASP----------------------------------GARARAAA-RWAAVTTWWVLVVQW--
R9AQ78_WALI9/64-296LT-------APNDDRSTSQ------------------------------------RWRVVSGLRWVAATSSWFLFTTW--
C5E2P1_LACTC/32-359I----------RYGGFGPR------------------------------------GTWKRTLLRYAILTVWWFVFTQS-L
T0K1V0_COLGC/87-312FT-------HP----ATVHS----------------------------------TRRIQATL-RWVLVTTWWFFVTQW--
G8Y1H9_PICSO/62-313ILILRSKHP----------KVQS---------------------------QQEKIRLLRNGLIKYSIMTFWWVLFTQW--
C5G9K2_AJEDR/75-292LT-------QP----AFNNRLLS---------------------------PGARLKRVGQATGRYILVTIAWWLTTQW--
C5MI48_CANTT/55-284SNL----IY----------KTSN---------------------------YSIRQKLIYKGILNYLLSTLWWILFTQW--
N1Q4W5_DOTSN/87-323LS-------HS----SLGPILRP----------------------------QLTRRRLQAGA-RYACITLAWFFVTQW--
S3DE95_GLAL2/81-314FT-------HP----SIGPPLSV----------------------------TLTPKRIRGLL-RYSIVTTWWIFVTQW--
R9P3R6_PSEHS/103-383FLLRLAPASGSATPTSTVGAAPSRASARVGARVDHKKQDDASSATEAAAAQATITSPVSIPVLRYMIATSAWLLFANW--
N1Q6I4_PSEFD/84-317FS-------HS----SLGPPLRP----------------------------QLTKRRIQAIL-RYICVTVIWIFVTQW--
K2R4W1_MACPH/94-328LT-------HP----SLGPPMRP----------------------------VLTPRRVRSVL-RWALVTLAWVFVTQW--
N1QNJ0_SPHMS/101-335FT-------HS----SHGPPFRL----------------------------QLTKRRVQAIF-RYMTITAVWVFVTQW--
F7WC52_SORMK/81-344FT-------HP----SYRST----------------------------------ERKLRATV-RWGLVTLWWIFVTQW--
M2N8T6_BAUPA/89-327LT-------HP----SLGPPLKP----------------------------ALTRRRLQAAV-RYVCITAVWVAVTQW--
K9G927_PEND2/67-311IF-------QPLYSSSRRESSSQ---------------------------QEARFRRTLQAILRYALTTTVWYLATQW--
C4R337_KOMPG/57-293VAKLR-KGV----------------------------------------------KIKPVTIVRLALITGWWWVFTQW--
A1CR84_ASPCL/74-313VS-------QP----AYTSPST------------------------------HQPRRLAQALLRYALATAAWYLTTQW--
A5E4A1_LODEL/62-350SLFAVPQILNSTLTTATAARTTTTARRVDENEDDSVLVSGKKEKKLYTTKSERLSKYFLGAIVRYLLLTIWWVLFTQW--
E5R3U3_ARTGP/64-297LT-------QD----AFTSKRVS---------------------------ADYRMRRVGQALLRYSLVTFSWILTTQW--
K1WMV9_MARBU/113-341FT-------HP----STGPASL-----------------------------TLTPKRLRGIF-RYAIVTGWWIFVTQW--
G0VEA6_NAUCC/39-386F----------KYSSTATASSA------------------------------RRHSRLTRSLIRYIILTLWWFMFTQN-L
Q6FR77_CANGA/32-368L----------RYDAK---------------------------------------RQWKSSLKRYLILTLWWYVFTQGIL
E9EF85_METAQ/84-313LT-------HP----SGGAGGL-----------------------------DMTPRRLRAML-RWAAVTAWWFLVTQW--
M9LJJ3_PSEA3/95-341FFLRLAAAT----------PRLKKEDA--------------------RSGQATITSPVSISVLRYMVATGAWLLFANW--
M1VZ69_CLAP2/82-312LT-------HP----SGGSGGL-----------------------------DLTPRRLRAIL-RWAAVTGWWFLVTQW--
V5GE99_BYSSN/78-302LT-------QP----AYTNSR-------------------------------ARGRKTVQALARYGIVTLSWILTTQW--
I2FTC6_USTH4/101-374FFLRLAPAS--TTPTSTSARPRTSAAVASQNTINN---KKDEDAISQAAQQATITSPLSISVLRYAIATGIWLLFADW--
G8JR11_ERECY/38-363I----------RYGDLSH-------------------------------------TNIKRTLIRYILLTVWWFTFTQS-V
Q6BUP0_DEBHA/108-353SFL----MY----------GNSHARI----------------------RTKQQRISVLKKAIFNYVVATLWWVLFTQW--
Q4WJI3_ASPFU/73-304VS-------QP----AYTAPSA------------------------------HQPRRLVQAALRYSVATLVWYLMTQW--
G2R9R1_THETT/97-341VT-------HP----AL--AGR-----------------------------RRRLRLLRAAVLRWALVTVWWVFVTQW--
I4YGQ8_WALMC/41-264VS-------APHDERTTNK------------------------------------RWRIVTVSRWVAATSSWFLFTNW--
G2XPX9_BOTF4/55-288LT-------HP----STGPPGVF----------------------------ILTARRARGTL-RYLVVTIWWIFVTQW--
G3AEN0_SPAPN/55-285VSILTQSRPRKS-------------------------------------------KVIREAVIRYAVITMWWILFTQW--
C7Z7P3_NECH7/60-283FT-------HP----STADA----------------------------------GRRLRAVY-RWAAVTTVWILVTQW--
SCS3_YEAST/33-370I----------RYRAVPGATG-------------------------------RDRRHIVQSFKRYAILTVWWYVFTQG-I
G3YDY9_ASPNA/76-295LS-------QP----AYTLAAS------------------------------HRARRTGQAVLRYVLATTVWYLTTQW--
L8FY78_PSED2/112-347FT-------NA----AIGARGSD----------------------------ALLRKRIQGAL-RWGLVTLWWVFVTQW--
A7TR39_VANPO/62-394FMTNVNLIN-------------------------------------------------KKFIKRYFALTFWWYVFTQGIS
N1JKB0_BLUG1/90-317FT-------HP----STRSSSSP----------------------------VFVTKRVHGFM-RYCVVTLWWIFVTQW--
B6Q6E7_TALMQ/81-304LT-------RP----YY--TRVP---------------------------GNLRGKRSVRAFLRYTIVTSAWFLTTQW--
B8M5R8_TALSN/84-316LT-------RP----YY--TKAP---------------------------GNLRGKRSVQALLRYAIVTCAWFLTTQW--
C8V5A4_EMENI/56-278LT-------YP--------PSP------------------------------HRGRRQFQAFVRYALATTAWYFVTQW--
Q6CKM7_KLULA/25-334I----------RYSN------------------------------------------IVNHWKRYLLLTLWWMIFTQE--
Q75EB2_ASHGO/35-359V----------RYKGLGG-------------------------------------RSLRQTALRYVALTAWWYAFTQA-I
M7SYX4_EUTLA/110-375LS-------HP----AFRSVPVGNS------------------------SGGSGGKTFRAAA-RWALVTTWWILVTQW--
E9CZW5_COCPS/67-291ST-------QP----AFVSRRID---------------------------PNKRLRRIYQALFRYAVVTLAWVLTTQW--
F0XPI2_GROCL/81-317LR-------HPSFTVSDSE------------------------------------RSVSGTSSSHTI-------------
A7UX33_NEUCR/112-389FS-------HP----GYNSNNNNNMTGT-----------------RGGDNGSGTGRKIKAVV-RWGLVTLWWVFVTQW--
J3NLN2_GAET3/91-336LT-------HPHHTKNTTTGRGGGQ------------------------QGGSSSRRLRAVL-RWALVTGWWVLVTQW--
A7EQ03_SCLS1/55-288LT-------HP----STGPPGVL----------------------------TVTPRRLRGFL-RYAVVTTWWIFVTQW--
G9NCA4_HYPVG/72-300LM-------QP----TGKTPPA-----------------------------VVLMRRIRAGL-RWVAVTGWWFFVTQW--

PF01569

A4I568_LEIIN/102-249--------------------------------------------------------------------------------
DOPP1_DICDI/54-178--------------------------------------------------------------------------------
Q17D95_AEDAE/56-197NRP-----KLYQNEL-----------------------------------------------------------------
G6PC3_MOUSE/53-195IQI-----HQFPS-------------------------------------------------------------------
A0BM37_PARTE/91-226--------------------------------------------------------------------------------
Q23FV4_TETTS/102-237E-------------------------------------------------------------------------------
A0EE96_PARTE/81-240T-------------------------------------------------------------------------------
A8FE89_BACP2/71-198--------------------------------------------------------------------------------
Q7MUE1_PORGI/58-185GYR-----GG----------------------------------------------------------------------
A0K0K5_ARTS2/118-241--------------------------------------------------------------------------------
A4XP73_PSEMY/98-234LFP-----DWEERWD-----------------------------------------------------------------
A4X1H8_SALTO/101-242TLP-----LFQHEL------------------------------------------------------------------
Q9EWX3_STRCO/115-237GD------------------------------------------------------------------------------
A1BJZ6_CHLPD/56-185HSF-----------------------------------------------------------------------------
A4FQA0_SACEN/76-196PEP-----G-----------------------------------------------------------------------
B0U8C7_METS4/61-186KIE-----IFE---------------------------------------------------------------------
A1S1V4_SHEAM/77-196LNH-----------------------------------------------------------------------------
A1W5E3_ACISJ/72-191EEH-----------------------------------------------------------------------------
A5CF96_ORITB/78-203FNT-----EYV---------------------------------------------------------------------
B4U5Z7_HYDS0/54-171WG------------------------------------------------------------------------------
A5DBA1_PICGU/102-232AQE-----------------------------------------------------------------------------
Q4D544_TRYCC/102-225REY-----------------------------------------------------------------------------
SSPA_DICDI/88-218--------------------------------------------------------------------------------
Q32GQ5_SHIDS/77-232EFY-----TLKRAERGNLVKE---------------------------------------------------QLAEEKNI
Q9CMX4_PASMU/75-237QFY-----AQERKQRSHFIDQ---------------------------------------------------FYQTKSDT
Q21JU9_SACD2/110-231GYT-----N-----------------------------------------------------------------------
Q0K1U6_CUPNH/103-229AKL-----EK----------------------------------------------------------------------
Q65GX3_BACLD/179-304PVI-----NPDP--------------------------------------------------------------------
Q2IJN8_ANADE/141-265GYR-----------------------------------------------------------------------------
Q6FEM9_ACIAD/65-182DHF-----------------------------------------------------------------------------
A1K7H5_AZOSB/105-237ALV-----PSNQ--------------------------------------------------------------------
Q6MBQ7_PARUW/87-223PYY-----KPRFNH------------------------------------------------------------------
A8EX54_ARCB4/94-229IFD-----SYPKD-------------------------------------------------------------------
Q87X15_PSESM/102-231LLS-----PRPAT-------------------------------------------------------------------
A8BDI5_GIAIC/110-282TFM-----PVFSRYT-----------------------------------------------------------------
A8BQZ4_GIAIC/121-285YEF-----KAIFTPY-----------------------------------------------------------------
Q6MTZ1_MYCMS/144-270TSW-----K-----------------------------------------------------------------------
R5TP42_9FIRM/95-216RML-----YLAD--------------------------------------------------------------------
A3LWS4_PICST/248-396MKF-----GSSMYRY-----------------------------------------------------------------
Q127S7_POLSJ/95-224SLD-----------------------------------------------------------------------------
A4CJ32_ROBBH/299-448VLQ-----T-----------------------------------------------------------------------
Q2HER5_CHAGB/260-418ADI-----SSPSWT------------------------------------------------------------------
A8L0R7_FRASN/276-428TTA-----DPTWAPL-----------------------------------------------------------------
Q6NJR5_CORDI/194-319DW------------------------------------------------------------------------------
A1SKJ7_NOCSJ/98-218--------------------------------------------------------------------------------
Q82Z33_ENTFA/85-204--------------------------------------------------------------------------------
A2DYB5_TRIVA/98-241DPS-----TCPGLS------------------------------------------------------------------
A2EZZ9_TRIVA/91-236VDE-----EKKLSDKRK---------------------------------------------------------------
A4H9E7_LEIBR/233-378SVG-----VDWCTV------------------------------------------------------------------
Q6BYN9_DEBHA/112-272IYG-----QLATVEICETFSR---------------------------------------------------D-------
A7EIU4_SCLS1/134-294QQE-----TGNGLNYIMYDRT-----------------------------------------------------------
A7TF94_VANPO/122-266QEK-----EYYNLDVCK---------------------------------------------------------------
Q2TYI3_ASPOR/35-224AHL-----AGGLGLRREGAAV---------------------------------------------------LV-----R
A2EQG2_TRIVA/90-230TCT-----GFLDQK------------------------------------------------------------------
PLPR5_MOUSE/122-275ISG-----EEACTGNP----------------------------------------------------------------
Q9VNU2_DROME/65-225SCS-----DLQNAELYVEQFH---------------------------------------------------C------T
A8WXP5_CAEBR/128-286CSD-----KESFIDPSDLVC------------------------------------------------------------
A6X217_OCHA4/121-242KGQ-----FL----------------------------------------------------------------------
Q5NGF4_FRATT/116-236HAP-----G-----------------------------------------------------------------------
Q5ZX13_LEGPH/91-208QLN-----DN----------------------------------------------------------------------
Q6MH55_BDEBA/105-226TTH-----WH----------------------------------------------------------------------
Q7NZZ5_CHRVO/815-932SRW-----Q-----------------------------------------------------------------------
Q89JR9_BRADU/79-199SGK-----S-----------------------------------------------------------------------
B7VND8_VIBA3/235-351G-------------------------------------------------------------------------------
Q5E4L0_ALIF1/241-366GF------------------------------------------------------------------------------
Q9RVR6_DEIRA/14-135TAG-----G-----------------------------------------------------------------------

PF14378

Q5K8D7_CRYNJ/128-311CL------AFIVFSSWPCMPP-----------------RLMP-------YEEFGYIDTLHTGKAAS--------------
B0UG28_METS4/124-315AC------AVAVSALLPAVGP-----------------YAAY------GLAPPDPDSVETVGALWHLH-----PLAQLRA
A1SJR6_NOCSJ/50-230GL------GLIVYVTYPVAPP-----------------RLV----------DPDLVDTVTESSHAY--------------
E4NIW3_KITSK/45-228AL------ILPVYWAVPMSPP-----------------RFA----------LPGAVDVVARYDVLS--------------
G8WRV6_STREN/158-347LL------GLIGFSLLPTAPP-----------------RLL--------PAAAGFQDTMAHFSHLG----------WWGA
C7QD07_CATAD/71-251AF------ALAI-QLIPVAPP-----------------RMI---------VKAHLVDTALYFHQSV--------------
Q2G5H1_NOVAD/115-305TI------TVAVFPLFPAEGP-----------------YVYY------NIPLERAPYLDRLFPWETGI-----KIEKLRL
Q1IHV8_KORVE/153-330PL------ACVCFLLFPATGP-----------------VYAF------KTFPMLAVPAGEIARLVP--------------
F2R3P1_STRVP/39-228LL------GLVGFTLLPTCPP-----------------RLL--------DPAYGFTDTMAHFSAYG----------WWGG
A9HHP2_GLUDA/131-314CL------TSVLVALMPAAGP-----------------WTYF-------S------------SAGHVKYSYIDSFMALRN
Q13PQ7_PARXL/110-293TL------VILISVPFPAESA-----------------FVHF-------G-------IHDPGTASTVS-----DFGLFRT
Q63V72_BURPS/125-308VM------VLLISTPFPAASA-----------------FLHF-------R-------VADPIALAGVS-----DFVRLRD
Q01VD1_SOLUE/159-330CI------GCALYFLFPAAGP-----------------MYAY------PTYPIPPAVVQAGAVLLA--------------
D1CA82_SPHTD/53-235GI------GLLIYALYPLAPP-----------------RFF---------PYNGFVDTLALYGKVN--------------
K0K1I4_SACES/40-223LL------DLLLVWLFPEAPP-----------------RFA----------QPGIVDYLATHDILF--------------
D1C524_SPHTD/53-234VV------AIPVYRLFPLAPP-----------------RYF---------PELGFVDTVKLFTSTN--------------
W5TLL4_9NOCA/53-242AA------GLIGFVLMPTAPP-----------------RLL--------ESASGFVDVMALHSSVG----------WWEG
Q2JBQ4_FRACC/47-236LI------CLVGFFLFPTAPP-----------------RLL---------TGTSYVDTMSHFEGWG----------WWSG
W0BEC4_9GAMM/94-276LI------GYTFYYFFPTTAP---------------------------------------ASVIDSPLFFEAQRATGLKF
Q220L9_RHOFT/109-292VL------TILMSGPFPAAGA-----------------WKHHALAGPFDLSS--------------LS-----HFELLRD
Q87M50_VIBPA/146-355MIN-----GSLFATAFSSVGPCYLELLNGDDLFAPLMQRLN-----------------EQSTFLENVGAFPLWALQTQDY
B1LSY3_METRJ/129-320LC------VIGLAALLPALGP-----------------YAHY------APRVVPSEPLETVGALWHLE-----PVARLRA
A2BL06_HYPBU/51-224AV------AITVYVLSPTAPP-----------------WIALPCIERPPNLVLKLVELVMGARIDP--------------
L0PFU2_PNEJ8/5-201LI------GVIIQLAFPCSPP--------------------WYQN-VYGNQPANYTMEGSAGGLAR------------ID
C9Z2S2_STRSW/63-253FI------GLIGFTLLPTCPP-----------------RLL--------DPSHGFVDTMAQYSSWG----------WWGG
E3JAH2_FRAIE/94-282IL------GLVGFWLLPTTPP-----------------RLL---------HGAGFHDTMAQVSDWG----------WWDD
F8AWV4_9ACTN/47-236VI------SLTGFFLVPTAPP-----------------RLL---------PSAGFIDTMASFHNWG----------WWAG
R7Y200_9ACTN/124-318SL------GTASYYALPTLGPGFQYSWLYRDLPDTGSGALM------------------------------------DSL
A0LS47_ACIC1/69-252LG------AITCFALWPTTPP-----------------RLL---------PGSDFADIVAANHPPG--------------
E2Q4K3_STRCL/45-234LL------GLVGFTLMPTCPP-----------------RLL--------DAKHGFVDTMAQYSSYG----------WWGA
F8J559_HYPSM/123-309AA------TIAIFLVAPAIGP-----------------YAHF------NFKSSDFPSVIVPAAWVAPG-----ITDGLRN
L0ET54_LIBCB/102-293FV------SSIVATWFPALGT-----------------YVYY------HIDPDTLKNIDSFYVYHFLQ-----QFDAVRD
Q89QL0_BRADU/109-300LL------TIGVSAFMPAQGV-----------------WGHL------HLSAVDSPAIVPMTRDLPLP-----VFFGLRD
H0PVV4_9RHOO/74-256VI------TSALSDVFPAAGT-----------------FYHF------NIELARAVH---------LP-----HLLNLLA
E3EJC2_PAEPS/1-162II------SWGLGHLFYRDRP-----------------------------------------------------------
A1SDU3_NOCSJ/130-324SL------GTASYYALPTLGPGLEYTWLYDSLPTTPTSRLM------------------------------------ESL
C7QBQ6_CATAD/84-272LI------ALFGFYFYSLAPP-----------------RLL---------ENGNFVDTFKLLNPWG-----------QTS
A1SHK3_NOCSJ/128-322IL------GVGSYYLVPSLGP-----------------------------------FASAPEEFAGLRPTAISATQVKYL
E3J0M0_FRAIE/110-299LL------CLLGFFLFPTAPP-----------------RLL---------PNAGFIDTMSRFSNYG----------WWSA
C8XDB0_NAKMY/22-205PL------ALLIFWLLPMSPP-----------------RFA----------LPGIVDIVAQHDLFG--------------
G7XGU5_ASPKW/117-299VI------AFTILTLWRCMPP-----------------RLL--------PEEYGFIDVLHSNAGGS--------------
B1LVV6_METRJ/99-290TV------TVLVSALTPALAN-----------------FVFL------GLSPADFPNLHPAASYVHVA-----DLTGLRD
Q5ZV46_LEGPH/101-283LM------GFSYYYFFPTTAP---------------------------------------ASELQSSLFAPEQIATGLKF

PF14360

F6UTK5_XENTR/282-355--------------------------------------------------------------------------------
SMSR2_CAEEL/192-265--------------------------------------------------------------------------------
SLS2_TRYB2/201-275--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
A0A509ASM8_PLABA/201-272--------------------------------------------------------------------------------
A0A384LQJ1_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
F8W5G6_DANRE/232-307--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------

PF02681

F2NNY3_MARHT/5-141ETG-----GM----------------------------------------------------------------------
K9T6M6_9CYAN/8-143TTG-----GM----------------------------------------------------------------------
D4ZTL8_ARTPN/8-143TTG-----GM----------------------------------------------------------------------
K9WGM7_9CYAN/8-143TTG-----GM----------------------------------------------------------------------
B7GI74_ANOFW/24-164ETG-----GM----------------------------------------------------------------------
B1WS33_CROS5/8-143TTG-----GM----------------------------------------------------------------------
R5AEV3_9CLOT/9-146GSG-----GM----------------------------------------------------------------------
Q31Q62_SYNE7/9-145ETG-----GM----------------------------------------------------------------------
R5XG63_9CLOT/5-137ISG-----GM----------------------------------------------------------------------
R7A3L4_9FIRM/8-144ASG-----GF----------------------------------------------------------------------
W0E929_9FIRM/8-143SSG-----GF----------------------------------------------------------------------
D3FYY4_ALKPO/4-149STG-----GM----------------------------------------------------------------------
F0RVM2_SPHGB/6-143STG-----GM----------------------------------------------------------------------
H6NB79_9BACL/2-142GTG-----GM----------------------------------------------------------------------
Q7V6P1_PROMM/15-147ETG-----GM----------------------------------------------------------------------
Q18B69_CLOD6/8-140ISG-----GM----------------------------------------------------------------------
G0GF41_SPITZ/9-149KTG-----GM----------------------------------------------------------------------
Q65FE5_BACLD/4-149STG-----GM----------------------------------------------------------------------
U5LF62_9BACI/2-142QTG-----GM----------------------------------------------------------------------
R7L0C2_9FIRM/5-149GAG-----GW----------------------------------------------------------------------
Q5WDV5_BACSK/4-146STG-----GM----------------------------------------------------------------------
D6GSF2_FILAD/8-144GSG-----GM----------------------------------------------------------------------
E6U5K5_ETHHY/8-143GAG-----GM----------------------------------------------------------------------
Q5SJ95_THET8/4-140DTG-----GM----------------------------------------------------------------------
Q9RSQ8_DEIRA/8-143ETG-----GM----------------------------------------------------------------------
P73185_SYNY3/8-143STG-----GM----------------------------------------------------------------------
D1AKQ0_SEBTE/7-143QTG-----GM----------------------------------------------------------------------
E0RXA3_BUTPB/8-144GDG-----GM----------------------------------------------------------------------
F5YE41_TREAZ/16-155RTG-----GM----------------------------------------------------------------------
V5WEJ9_9SPIO/6-144RTG-----GM----------------------------------------------------------------------
U5LHE7_9BACI/5-149STG-----GM----------------------------------------------------------------------
K9XWG4_STAC7/8-143TTG-----GM----------------------------------------------------------------------
E6U2C7_BACCJ/4-149STG-----GM----------------------------------------------------------------------
K9V3M2_9CYAN/8-143TTG-----GM----------------------------------------------------------------------
B9IAH9_POPTR/38-171DSG-----GM----------------------------------------------------------------------
M0RZC5_MUSAM/20-155GSG-----GM----------------------------------------------------------------------
R5ZD30_9FIRM/8-146ASG-----GF----------------------------------------------------------------------
R6Q3Q8_9FIRM/8-138GTG-----GM----------------------------------------------------------------------
C0ZKP9_BREBN/5-150STG-----GM----------------------------------------------------------------------
D8TLE7_VOLCA/33-168SSG-----GM----------------------------------------------------------------------
R6SRI1_9FIRM/7-157GAG-----GM----------------------------------------------------------------------
K9YEC7_HALP7/8-143TTG-----GM----------------------------------------------------------------------
K3XML5_SETIT/24-159GSG-----GM----------------------------------------------------------------------
K9RII7_9CYAN/8-143TTG-----GM----------------------------------------------------------------------
K4LIZ6_THEPS/40-169RCG-----GM----------------------------------------------------------------------
E6TWS5_BACCJ/5-142ESG-----GM----------------------------------------------------------------------
Q73MW8_TREDE/10-150RTG-----GM----------------------------------------------------------------------
Q8Y4P9_LISMO/4-149STG-----GM----------------------------------------------------------------------
M0SK26_MUSAM/139-272SCG-----GM----------------------------------------------------------------------
G4KW10_OSCVS/4-137GDG-----GM----------------------------------------------------------------------
R5CL70_9FIRM/8-147GAG-----GM----------------------------------------------------------------------
I0I5M8_CALAS/5-139QAG-----GM----------------------------------------------------------------------
D7CKU8_SYNLT/12-144SDG-----GM----------------------------------------------------------------------
R7IRJ9_9CLOT/8-142GAG-----GM----------------------------------------------------------------------
B8HXR8_CYAP4/8-143ETG-----GM----------------------------------------------------------------------
B0C3J0_ACAM1/8-143ETG-----GM----------------------------------------------------------------------
I4DAH9_DESAJ/3-144QPR-----GM----------------------------------------------------------------------
Q46K07_PROMT/15-148ETG-----GM----------------------------------------------------------------------
R7A3G1_9CLOT/8-142GAG-----GM----------------------------------------------------------------------
Q24V03_DESHY/8-143SSG-----GF----------------------------------------------------------------------
Q10X44_TRIEI/8-143TSG-----GM----------------------------------------------------------------------
A4RZ57_OSTLU/3-142ASG-----GF----------------------------------------------------------------------
D8QR56_SELML/24-159GSG-----GM----------------------------------------------------------------------
A0A3Q7ELN9_SOLLC/140-274ASG-----GM----------------------------------------------------------------------
Q8ENX8_OCEIH/4-149STG-----GM----------------------------------------------------------------------
K7V114_MAIZE/48-182TSA-----GV----------------------------------------------------------------------
Q01ES7_OSTTA/128-261DSG-----GM----------------------------------------------------------------------
E3HA83_ILYPC/7-143GTG-----GM----------------------------------------------------------------------
A6TR41_ALKMQ/8-144GSG-----GM----------------------------------------------------------------------
I1KRZ5_SOYBN/9-144GSG-----GM----------------------------------------------------------------------
R5KDM7_9CLOT/8-150GGG-----GM----------------------------------------------------------------------
R7I9S8_9FIRM/10-145GSG-----GM----------------------------------------------------------------------
R6BY11_9CLOT/8-144GSG-----GM----------------------------------------------------------------------
R5ITD2_9FIRM/8-144GDG-----GM----------------------------------------------------------------------
K9RQD3_SYNP3/8-143ETG-----GM----------------------------------------------------------------------
K9SVF9_9SYNE/8-143ETG-----GM----------------------------------------------------------------------
Q7VBG6_PROMA/16-148ETG-----GM----------------------------------------------------------------------
O83188_TREPA/14-153RTG-----GM----------------------------------------------------------------------
G8QY16_SPHPG/6-143STG-----SM----------------------------------------------------------------------
D3EMZ3_ATETH/8-144STG-----GM----------------------------------------------------------------------
M0SG02_MUSAM/22-157GSG-----GM----------------------------------------------------------------------
F5YMS6_TREPZ/16-155RTG-----GM----------------------------------------------------------------------
R7R6N9_9FIRM/8-144GSG-----GM----------------------------------------------------------------------
C7NE60_LEPBD/7-143QTG-----GM----------------------------------------------------------------------
R5IDQ6_9CLOT/2-138GSG-----GM----------------------------------------------------------------------
D9R8M4_CLOSW/8-144GSG-----GM----------------------------------------------------------------------
D7BAF5_MEISD/5-141ETG-----GM----------------------------------------------------------------------
F8F1T7_TRECH/16-155KTG-----GM----------------------------------------------------------------------
Q93ZZ7_ARATH/51-205QAG-----GF----------------------------------------------------------------------
D8U4F3_VOLCA/38-173ESG-----GM----------------------------------------------------------------------
J7IS94_DESMD/8-142SSG-----GF----------------------------------------------------------------------
F9VBI0_LACGL/8-142ATG-----GM----------------------------------------------------------------------
K9W0K1_9CYAN/16-151TTG-----GM----------------------------------------------------------------------
A9NHX4_ACHLI/6-144STG-----GM----------------------------------------------------------------------
D1AXZ8_STRM9/7-141STG-----GM----------------------------------------------------------------------
K9UG93_CHAP6/16-151TTG-----GM----------------------------------------------------------------------
F4LN44_TREBD/13-152RTG-----GM----------------------------------------------------------------------
R6NRL3_9CLOT/2-140KLG-----GM----------------------------------------------------------------------
K0IWZ6_AMPXN/4-149STG-----GM----------------------------------------------------------------------
W8TJV6_PEPAC/8-150GSG-----GM----------------------------------------------------------------------
A8MFI8_ALKOO/8-144GSG-----GM----------------------------------------------------------------------
H9UHZ5_SPIAZ/13-152KTG-----GM----------------------------------------------------------------------
B8CY18_HALOH/3-134GSG-----GM----------------------------------------------------------------------
B2A528_NATTJ/7-141ASG-----GM----------------------------------------------------------------------
R6ME09_9FIRM/8-142GSG-----GM----------------------------------------------------------------------
F2NS18_TRES6/11-151RTG-----SM----------------------------------------------------------------------
R5PNP2_9CLOT/8-138GAG-----GM----------------------------------------------------------------------
Q1J0I2_DEIGD/9-145ETG-----GM----------------------------------------------------------------------
R5MBG0_9CLOT/8-144GSG-----GM----------------------------------------------------------------------
I4D8V5_DESAJ/8-142SSG-----GF----------------------------------------------------------------------
R7A673_9FIRM/8-144GSG-----GM----------------------------------------------------------------------
R7FJ12_9CLOT/8-142GAG-----GM----------------------------------------------------------------------
O51097_BORBU/6-146ETG-----GM----------------------------------------------------------------------
K8GFC4_9CYAN/8-143ETG-----GM----------------------------------------------------------------------
M4CGY8_BRARP/134-268ASG-----GM----------------------------------------------------------------------
R6N1H2_9CLOT/6-146ESG-----GM----------------------------------------------------------------------
D3FSU1_ALKPO/2-142ETG-----GM----------------------------------------------------------------------
B9DG97_ARATH/20-155GSG-----GM----------------------------------------------------------------------
Q9CGU3_LACLA/8-142ATG-----GM----------------------------------------------------------------------
F2I5F0_AERUA/1-152TTG-----GM----------------------------------------------------------------------
R7N6H8_9FIRM/8-144GGG-----GM----------------------------------------------------------------------
C1FDH6_MICCC/170-303DSG-----GM----------------------------------------------------------------------
R6SUP5_9CLOT/9-142GSG-----GM----------------------------------------------------------------------
A5GM29_SYNPW/13-145ETG-----GM----------------------------------------------------------------------
Q2JKH6_SYNJB/6-142ETG-----GM----------------------------------------------------------------------
F2JMF4_CELLD/8-142ASG-----GM----------------------------------------------------------------------
E6SHJ0_THEM7/12-146KAG-----GM----------------------------------------------------------------------
K9S6R1_9CYAN/8-143ETG-----GM----------------------------------------------------------------------
E3PRG0_ACESD/8-144GSG-----GM----------------------------------------------------------------------
R5N6N4_9CLOT/8-137GAG-----GM----------------------------------------------------------------------
R5GZB8_9FIRM/8-144GSG-----GM----------------------------------------------------------------------
D5WTV2_KYRT2/8-146CSG-----GM----------------------------------------------------------------------
R6PRB8_9FIRM/8-139SSG-----GM----------------------------------------------------------------------
C1N1Q0_MICPC/8-144ASG-----GF----------------------------------------------------------------------
L0A6P8_DEIPD/5-141ETG-----GM----------------------------------------------------------------------
A0A3R7BI20_9CLOT/5-142ACG-----GF----------------------------------------------------------------------
E3DMH7_HALPG/3-133TSG-----GM----------------------------------------------------------------------
E4U9L1_OCEP5/5-141ESG-----GM----------------------------------------------------------------------
E8N0A2_ANATU/6-140SSG-----GM----------------------------------------------------------------------
K9SNJ2_9CYAN/8-142ETG-----GM----------------------------------------------------------------------
F0T097_SYNGF/8-149SSG-----GF----------------------------------------------------------------------
A8FH06_BACP2/4-149STG-----GM----------------------------------------------------------------------
I0JQ19_HALH3/6-151STG-----GM----------------------------------------------------------------------
M4FCC5_BRARP/76-227QAG-----GF----------------------------------------------------------------------
G8LW53_HUNCD/8-141GSG-----GM----------------------------------------------------------------------
C8WVG2_ALIAD/12-152GAG-----GM----------------------------------------------------------------------
R5ADD7_9CLOT/7-149GAG-----GM----------------------------------------------------------------------
K3YAI4_SETIT/11-145ASG-----GM----------------------------------------------------------------------
R7F8Q2_9CLOT/8-142GAG-----GM----------------------------------------------------------------------
A3DDN6_HUNT2/8-143GSG-----GM----------------------------------------------------------------------
K9Z2J9_CYAAP/8-142STG-----GM----------------------------------------------------------------------
K9P352_CYAGP/15-157ETG-----GM----------------------------------------------------------------------
K9XC51_9CHRO/8-143TTG-----GM----------------------------------------------------------------------
R6Y7H0_9FIRM/7-149GAG-----GM----------------------------------------------------------------------
E1RAI3_SEDSS/5-141ETG-----GM----------------------------------------------------------------------
R5R4Q1_9FIRM/8-145GDG-----GM----------------------------------------------------------------------
B8E2Q0_DICTD/12-146EWG-----GM----------------------------------------------------------------------
K4KZ53_9FIRM/8-148SSG-----GF----------------------------------------------------------------------
R6EV23_9FIRM/8-145GSG-----GM----------------------------------------------------------------------
D6Y193_BACIE/4-149STG-----GM----------------------------------------------------------------------
E7FY95_ERYRH/7-143ESG-----GF----------------------------------------------------------------------
C4L0Z0_EXISA/3-131ASG-----GM----------------------------------------------------------------------
D7GPW8_9FIRM/6-142GSG-----GM----------------------------------------------------------------------
D5E1E4_BACMQ/2-142ASG-----GM----------------------------------------------------------------------
A4J281_DESRM/9-144EAG-----GM----------------------------------------------------------------------
I0JIT0_HALH3/2-142TTG-----GM----------------------------------------------------------------------
E1Z6N1_CHLVA/1-136SSG-----GM----------------------------------------------------------------------
Q8DMU2_THEEB/9-144ETG-----GM----------------------------------------------------------------------
A4RUH5_OSTLU/12-147GSG-----GM----------------------------------------------------------------------
Q5L0A2_GEOKA/2-142ETG-----GM----------------------------------------------------------------------
W1NTD9_AMBTC/34-169GSG-----GM----------------------------------------------------------------------
K8EPQ0_CARML/4-150STG-----GM----------------------------------------------------------------------
C6CSF5_PAESJ/6-132GNG-----GF----------------------------------------------------------------------
G2TKM5_BACCO/4-146STG-----GM----------------------------------------------------------------------
K9TPQ7_9CYAN/8-143ETG-----GM----------------------------------------------------------------------
N0B1X3_9BACI/2-142STG-----GM----------------------------------------------------------------------
V5WJH0_9SPIO/5-132TAG-----GM----------------------------------------------------------------------
C9RC18_AMMDK/8-140ADG-----GM----------------------------------------------------------------------
L7VUG0_THES1/9-141GSG-----GM----------------------------------------------------------------------
R5J5K1_9FIRM/8-139TSG-----GM----------------------------------------------------------------------
C1E358_MICCC/7-142GSG-----GM----------------------------------------------------------------------
R6B6R3_9CLOT/12-145GAG-----GM----------------------------------------------------------------------
A5GRZ6_SYNR3/9-137ETG-----GM----------------------------------------------------------------------
R7B1C9_9CLOT/8-144GSG-----GM----------------------------------------------------------------------

PF10261

Q5KDG2_CRYNJ/99-376FFG---A-GLGDRIIALTGGNCALPLPPSISP-ILARHTFGKLFTAGPQGSSGQEKIYIALP------------------
G2QCT9_MYCTT/113-344FFG---P-ALIDRGFRWSGGKCEVAEE-----------VVRQGEAG----------TKEVVT------------------
E3RV27_PYRTT/85-309FFG---P-PLIDRGFRFTGGQCEL------------------L--RKPDAREDMSNTREYIT------------------
R7YND5_CONA1/92-324FFG---A-PLIDRGFLLTGGQCEL------------------I--KDPGAREEMSNTREYVT------------------
G2XHJ1_VERDV/98-323CFG---P-AIIDRSFRWTGGRCEVVVD-----------KVQDGDAD----------VGEFVS------------------
C4Y4H3_CLAL4/57-287CFG---L-PIMDKVFVLTGGKCASVSAE---------KLARLTESLHLFTLVDGVYESSAIS------------------
C5DQ74_ZYGRC/35-359WFH--TA-PIMDLIFLATGGLCR--------------------FDVLDADGN----LNSSFQDSDSRKSRSLSKIYSFLV
G8BYR0_TETPH/33-386FFK--IP-PIMDLCFVFTGGSCN--------------------FEIFDESNA----INIKFQDSEYRKLKSLKRIYKILK
E3KJ35_PUCGT/96-348CFG---S-SLIERVLILSGAKCIPSL--------------KPF-----HSSETTPTTPTTLE------------------
N1RPR7_FUSC4/66-290CFG---P-ALIDRGFRWTGGRCELARR-----------EVEFGSDT----------VGDKVT------------------
F9WXZ1_ZYMTI/84-317FFG---P-AIIDRSFRWTGGQCQVI---------------YGNSLADQKEREEMNDVREVFT------------------
G3BAX8_CANTC/92-323CFG---V-PIMDKIFLWTGGRCVSVAED----------RLAHHSEFFNKVED--LYESTVVG------------------
G8BIE7_CANPC/69-321CFG---L-PIMDKIFVLTGGVCVLEPHPTTQTTPPSTIANHALGQSFLQDLETLVWKSKDVS------------------
C5FE12_ARTOC/64-296CFG---P-PIIDRGFLATGGRCELI----------------QQKGLLEDPSRPGLNPALVLS------------------
G8ZXV3_TORDC/32-356WFG--SA-PIMDLIFTLTGGSCK--------------------FDVFDERGR----LSSLFHDTFPRRIRSLERIYHLLK
A5DKF9_PICGU/56-288CFG---L-PLMDKVFVYTGGKCANVSSA----------AVAGMEAFFTATSSPAVYESNKIT------------------
E3QPL9_COLGM/87-312FFG---P-AIIDRSFRWTGGKCELVED-----------KIKMGEGD----------AKEFFT------------------
S3CVS7_OPHP1/100-357FFG---P-ALIDRSFRLTGGGCEALQALA-------DEIEAEAVQQGRAGSTSAQFLNAASS------------------
A3LYM5_PICST/59-299FFG---L-PIMDKVFVYTGGSCVIEKETHPGQSRFLHLFEAAGEEVGNKLS------STSIT------------------
G0WG33_NAUDC/40-380IY----P-PLMDLIFLMTGGLCN--------------------FDVFNIASDGKIELNLEFQDNSTRRMKSLNKIYKILK
M3IZX9_CANMX/56-283CFG---L-PIMDKIFVWTGGKCKIDITNH--------DVNHVHSSFIHSLEN--IWESTGIT------------------
G3JBH7_CORMM/90-318CFG---A-PMIDRGFRWTGGQCQLAEL-----------DVAAGTAD----------AGAVLT------------------
R9AQ78_WALI9/64-296FFG---D-GLLHRLWLMTGAQCVI-----------------EDINAGIEGGTPATPLLVPVN------------------
C5E2P1_LACTC/32-359WSE--AA-PLMDLVFTATGGRCS--------------------FEVFDLSDSPTWGINEKFHDTFSRRQSSLQKLYNALK
T0K1V0_COLGC/87-312FFG---P-AIIDRGFRWTGGKCEIIEE-----------KVELGEGD----------AKEVFT------------------
G8Y1H9_PICSO/62-313CFG---L-PIMDKVFVWTGGKCQKVAEKELL----RHFPGALKDKFFSPSSDGESFEASSIT------------------
C5G9K2_AJEDR/75-292FFG---P-GIIDRSFIATGGRCE--------------------KSIAPGSTDSISELAVVLT------------------
C5MI48_CANTT/55-284CFG---L-PIMDKIFIWTGGKCKIEGIEI-------KNINHLHNSFIQTLEN--IWESTGIT------------------
N1Q4W5_DOTSN/87-323FFG---P-GIVDRSFRWTGGKCEQV---------------AYDDADDLARKVEAGDLKEIIT------------------
S3DE95_GLAL2/81-314FFG---P-AIIDRSFRLTGGQCEL------------------V-EQADKGHIEMDDTRQFVT------------------
R9P3R6_PSEHS/103-383FFG---P-PLSERILTATGAVCV----------------------------PSSNPGQSPVE------------------
N1Q6I4_PSEFD/84-317FFG---P-AIIDRSFRWTGGKCNQ------------------VLSDTLDEKMERGDVKEVFS------------------
K2R4W1_MACPH/94-328FFG---P-PLIDTLFRFTGGQCEL------------------V--RDPAARESMSDAREYIT------------------
N1QNJ0_SPHMS/101-335FFG---P-AIVDRSFRWTGGRCSQ------------------VLATGLTEKMEQGDAKDVFT------------------
F7WC52_SORMK/81-344FFG---P-AIVDRGFRVTGGKCAVAQAKVN------EQVKADSIPGPVGADVDVAGFKEFVT------------------
M2N8T6_BAUPA/89-327FFG---P-PIVDRSFRWTGGKCETI---------------LSDSAASQAEKADMGEVERAFT------------------
K9G927_PEND2/67-311FFG---P-AIVDRGFVATGGKCEQA---------------LEEVGKMAAGQSSPTGLETLFT------------------
C4R337_KOMPG/57-293CFG---L-PIMDRLFVFTGGKCSNIPTIQAE---RYIQRFPAFREFFSKKDSEPLVQEAIIS------------------
A1CR84_ASPCL/74-313FFG---P-AIIDRGFVVTGGKCEEIL-------------RETPVEVVEREGSVSRGLERLFT------------------
A5E4A1_LODEL/62-350CFG---L-PIMDKIFVVSGGACVIEPPQFAASQQKISNSQHLFGK-FIQDLETLVWRSSSVS------------------
E5R3U3_ARTGP/64-297CFG---A-PIIDRGFLATGGKCEI------------------TQQVFDDRSQAELPPTVVLT------------------
K1WMV9_MARBU/113-341FFG---P-AIIDRGFMLTGGQCEL------------------V-AQADVGDIEMDNTRQLVT------------------
G0VEA6_NAUCC/39-386IPGTQLP-PIMDIIFLLSGGKCQ--------------------FDVFDLEHDGS--LNESFQNVLGDQWRRRHKAWSRIY
Q6FR77_CANGA/32-368WFD--IP-PIMDLIFKYSGGSCN--------------------FDIYDSDGN----VNLKFQDSWRRRIKSWRMIYDKVK
E9EF85_METAQ/84-313CFG---P-PMIDRGFRWTGGKCDVAER-----------DVLQGSSD----------MGEAFT------------------
M9LJJ3_PSEA3/95-341FFG---P-PLAERILTATGAVCV----------------------------PSSNAGLGKVE------------------
M1VZ69_CLAP2/82-312FFG---A-PLIDRGFRWTGGRCDLVQQ-----------EIRMGDAG----------VGDILT------------------
V5GE99_BYSSN/78-302FFG---P-AIVDRSFVLTGGRCE--------------------DVRPRTPGSTASELNAVFT------------------
I2FTC6_USTH4/101-374FFG---P-PLSERILTATGAVCV----------------------------PSGDPQSSPVE------------------
G8JR11_ERECY/38-363WVG--VA-PIMDLVFKLTGGHCS--------------------FDVFDQAMV----VSEKFQDSEPRRLGSLKKLVKWFS
Q6BUP0_DEBHA/108-353CFG---L-PLMDKVFVWTGGKCTGIAQEKLA----LHIPSYGTSSIFTEIESDLSYESKAIT------------------
Q4WJI3_ASPFU/73-304FFG---P-PIIDRSFVITGGKCERVVAE----------TSGNPAVAVAQAGSVSAGLEKLFT------------------
G2R9R1_THETT/97-341FFG---P-ALIDRGFRWTGGKCEAVAT-----------VVGEGREGPSPA----GVVKEVLT------------------
I4YGQ8_WALMC/41-264FFG---D-SLLHRIWLITGAQCV--------------------REEDNLEGTPATPLLVPVN------------------
G2XPX9_BOTF4/55-288FFG---P-PLIDRGFVITGGQCEL------------------V-DAAEKGKIDMDNTRQFLT------------------
G3AEN0_SPAPN/55-285CFG---L-PIMDRIFVLTGGKCVVEDPGR--------HVKLFA------NLGNGKSVSSTIS------------------
C7Z7P3_NECH7/60-283CFG---P-ALIDRGFRWTGGRCELARR-----------EIEMGDSG----------LGEMVT------------------
SCS3_YEAST/33-370WFG--VG-PIMDLVFVYTGGHCH--------------------YDVFDDAGH----VNEDFQGSVTRTNRALALIHNVLT
G3YDY9_ASPNA/76-295FFG---P-PIIDRSFVLTGGKCE-------------------QAVPLAENEPAAADVKTLLT------------------
L8FY78_PSED2/112-347FFG---P-AIIDRGFLLTGGMCEL------------------K-DMIDRVETEVNIVERFVT------------------
A7TR39_VANPO/62-394FLN--IP-PVMDIWFVYTGGVCS--------------------FDVFDDLGG----ANITFQDTSSRRVKAIKKLYSILL
N1JKB0_BLUG1/90-317FFG---P-AIIDRGFKYTGGHCEL------------------V-AMNGSDSIHIGEKVIFLT------------------
B6Q6E7_TALMQ/81-304FFG---P-AIIDRMFVITGGKCERLP--------------AVI------PDDTWEGVKVILT------------------
B8M5R8_TALSN/84-316FFG---P-AIIDRTFVITGGKCERL----------------PAAMANADDNTAWEDLKVVFT------------------
C8V5A4_EMENI/56-278FFG---P-AIIDRSFVITGGKCEDALS-----------ELNNVRNEKGVIGAGVEDFGIYLT------------------
Q6CKM7_KLULA/25-334VFG--LT-PLMDLVFLNSGGICS--------------------FDIFSTDGN-EQTLNLQFHDNEFRRLRGIRRMLNWLG
Q75EB2_ASHGO/35-359WFG--IA-PIMDQVFTSTGGHCS--------------------FDVFDTGMG----LNSGFHDSEGRRTRSLQKLLQWFT
M7SYX4_EUTLA/110-375CFG---P-PIIDRGFRFTGGRCEVALA-----------AVSSSSSSSSDSVSAGADTKDVFT------------------
E9CZW5_COCPS/67-291CFG---P-AIIDRSFTATGGRCE----------------------RIHASGMKEAISDSIMT------------------
F0XPI2_GROCL/81-317-FGSGAPQPSSDRSFRLTGGSCQADG-------------GLGVAEATSAAATAAASLAAVAV------------------
A7UX33_NEUCR/112-389FFG---P-AIVDRGFRVTGGKCQEAQGRVN------AQVKADAMPGPVGSNVEVAGLKEFVT------------------
J3NLN2_GAET3/91-336CFG---P-PLIDRGFRYTGGKCEEAEQ-----------KVRGADNYAAS-------PVDIFS------------------
A7EQ03_SCLS1/55-288FFG---P-AIIDRGFIITGGQCDM------------------V-DAAEKGHVDMDDTRQFLT------------------
G9NCA4_HYPVG/72-300FFG---P-PIIDRSFRWTGGKCELAQR-----------EVAMGDGS----------VKEMLT------------------

PF01569

A4I568_LEIIN/102-249--------------------------------------------------------------------------------
DOPP1_DICDI/54-178--------------------------------------------------------------------------------
Q17D95_AEDAE/56-197------TCEP----------------------------------------------------------------------
G6PC3_MOUSE/53-195--------SC----------------------------------------------------------------------
A0BM37_PARTE/91-226--------------------------------------------------------------------------------
Q23FV4_TETTS/102-237--------------------------------------------------------------------------------
A0EE96_PARTE/81-240--------------------------------------------------------------------------------
A8FE89_BACP2/71-198--------------------------------------------------------------------------------
Q7MUE1_PORGI/58-185--------------------------------------------------------------------------------
A0K0K5_ARTS2/118-241--------------------------------------------------------------------------------
A4XP73_PSEMY/98-234-------MKD----------------------------------------------------------------------
A4X1H8_SALTO/101-242--------PL----------------------------------------------------------------------
Q9EWX3_STRCO/115-237--------------------------------------------------------------------------------
A1BJZ6_CHLPD/56-185--------------------------------------------------------------------------------
A4FQA0_SACEN/76-196--------------------------------------------------------------------------------
B0U8C7_METS4/61-186--------------------------------------------------------------------------------
A1S1V4_SHEAM/77-196--------------------------------------------------------------------------------
A1W5E3_ACISJ/72-191--------------------------------------------------------------------------------
A5CF96_ORITB/78-203--------------------------------------------------------------------------------
B4U5Z7_HYDS0/54-171--------------------------------------------------------------------------------
A5DBA1_PICGU/102-232--------------------------------------------------------------------------------
Q4D544_TRYCC/102-225--------------------------------------------------------------------------------
SSPA_DICDI/88-218--------------------------------------------------------------------------------
Q32GQ5_SHIDS/77-232PQYLRSHWQK----------------------------------------------------------------------
Q9CMX4_PASMU/75-237PNWLKNHYEK----------------------------------------------------------------------
Q21JU9_SACD2/110-231--------------------------------------------------------------------------------
Q0K1U6_CUPNH/103-229--------------------------------------------------------------------------------
Q65GX3_BACLD/179-304--------------------------------------------------------------------------------
Q2IJN8_ANADE/141-265--------------------------------------------------------------------------------
Q6FEM9_ACIAD/65-182--------------------------------------------------------------------------------
A1K7H5_AZOSB/105-237---------C----------------------------------------------------------------------
Q6MBQ7_PARUW/87-223--------SF----------------------------------------------------------------------
A8EX54_ARCB4/94-229---------F----------------------------------------------------------------------
Q87X15_PSESM/102-231---------D----------------------------------------------------------------------
A8BDI5_GIAIC/110-282-------GPN----------------------------------------------------------------------
A8BQZ4_GIAIC/121-285------LGRS----------------------------------------------------------------------
Q6MTZ1_MYCMS/144-270--------------------------------------------------------------------------------
R5TP42_9FIRM/95-216--------------------------------------------------------------------------------
A3LWS4_PICST/248-396-------VYY----------------------------------------------------------------------
Q127S7_POLSJ/95-224--------------------------------------------------------------------------------
A4CJ32_ROBBH/299-448--------------------------------------------------------------------------------
Q2HER5_CHAGB/260-418-------PLL----------------------------------------------------------------------
A8L0R7_FRASN/276-428-------LVT----------------------------------------------------------------------
Q6NJR5_CORDI/194-319--------------------------------------------------------------------------------
A1SKJ7_NOCSJ/98-218--------------------------------------------------------------------------------
Q82Z33_ENTFA/85-204--------------------------------------------------------------------------------
A2DYB5_TRIVA/98-241--------AS----------------------------------------------------------------------
A2EZZ9_TRIVA/91-236-----DELKK----------------------------------------------------------------------
A4H9E7_LEIBR/233-378--------AN----------------------------------------------------------------------
Q6BYN9_DEBHA/112-272SVGPSLHILQ----------------------------------------------------------------------
A7EIU4_SCLS1/134-294ICTGDEDEID----------------------------------------------------------------------
A7TF94_VANPO/122-266-----QANKG----------------------------------------------------------------------
Q2TYI3_ASPOR/35-224ASICQNTDAA----------------------------------------------------------------------
A2EQG2_TRIVA/90-230-------QLA----------------------------------------------------------------------
PLPR5_MOUSE/122-275------DLIM----------------------------------------------------------------------
Q9VNU2_DROME/65-225NNNLSTRQIR----------------------------------------------------------------------
A8WXP5_CAEBR/128-286-TNPNPRKIR----------------------------------------------------------------------
A6X217_OCHA4/121-242--------------------------------------------------------------------------------
Q5NGF4_FRATT/116-236--------------------------------------------------------------------------------
Q5ZX13_LEGPH/91-208--------------------------------------------------------------------------------
Q6MH55_BDEBA/105-226--------------------------------------------------------------------------------
Q7NZZ5_CHRVO/815-932--------------------------------------------------------------------------------
Q89JR9_BRADU/79-199--------------------------------------------------------------------------------
B7VND8_VIBA3/235-351--------------------------------------------------------------------------------
Q5E4L0_ALIF1/241-366--------------------------------------------------------------------------------
Q9RVR6_DEIRA/14-135--------------------------------------------------------------------------------

PF14378

Q5K8D7_CRYNJ/128-311-----IWTTN----------------------------------------------------------------------
B0UG28_METS4/124-315GSLRVIALQD----------------------------------------------------------------------
A1SJR6_NOCSJ/50-230----RVLQPP----------------------------------------------------------------------
E4NIW3_KITSK/45-228--GADGGAGG----------------------------------------------------------------------
G8WRV6_STREN/158-347DAS-APQGLG----------------------------------------------------------------------
C7QD07_CATAD/71-251----YGPMNA----------------------------------------------------------------------
Q2G5H1_NOVAD/115-305GYLRDVTSEA----------------------------------------------------------------------
Q1IHV8_KORVE/153-330-------GPV----------------------------------------------------------------------
F2R3P1_STRVP/39-228EAS-APRGLG----------------------------------------------------------------------
A9HHP2_GLUDA/131-314GHNPPFILNR----------------------------------------------------------------------
Q13PQ7_PARXL/110-293GQARELNLSF----------------------------------------------------------------------
Q63V72_BURPS/125-308GTLRVIDPAA----------------------------------------------------------------------
Q01VD1_SOLUE/159-330--------------------------------------------------------------------------------
D1CA82_SPHTD/53-235---YDQPSVA----------------------------------------------------------------------
K0K1I4_SACES/40-223--SAESRVPR----------------------------------------------------------------------
D1C524_SPHTD/53-234---YDAHADT----------------------------------------------------------------------
W5TLL4_9NOCA/53-242DAS-APRGLG----------------------------------------------------------------------
Q2JBQ4_FRACC/47-236SASAAPDGLE----------------------------------------------------------------------
W0BEC4_9GAMM/94-276QQIHSYIQPT----------------------------------------------------------------------
Q220L9_RHOFT/109-292GRMRDIPLRD----------------------------------------------------------------------
Q87M50_VIBPA/146-355LWQGYVTQVN----------------------------------------------------------------------
B1LSY3_METRJ/129-320GTLHTLALGD----------------------------------------------------------------------
A2BL06_HYPBU/51-224--------------------------------------------------------------------------------
L0PFU2_PNEJ8/5-201GFFGTKLYTS----------------------------------------------------------------------
C9Z2S2_STRSW/63-253EAS-APRGLG----------------------------------------------------------------------
E3JAH2_FRAIE/94-282DAS-APRGLG----------------------------------------------------------------------
F8AWV4_9ACTN/47-236DSSAAPKGLA----------------------------------------------------------------------
R7Y200_9ACTN/124-318FYARKGVVRD----------------------------------------------------------------------
A0LS47_ACIC1/69-252--TWGTAAVS----------------------------------------------------------------------
E2Q4K3_STRCL/45-234EAS-APRGMG----------------------------------------------------------------------
F8J559_HYPSM/123-309GD------HQ----------------------------------------------------------------------
L0ET54_LIBCB/102-293QSPFHLLFRD----------------------------------------------------------------------
Q89QL0_BRADU/109-300GTFRHLVAEG----------------------------------------------------------------------
H0PVV4_9RHOO/74-256GTQAGFSFDD----------------------------------------------------------------------
E3EJC2_PAEPS/1-162-FVGHSVIQL----------------------------------------------------------------------
A1SDU3_NOCSJ/130-324AYGRNNVYWG----------------------------------------------------------------------
C7QBQ6_CATAD/84-272ATSDGVAGLG----------------------------------------------------------------------
A1SHK3_NOCSJ/128-322AERAHFLADP----------------------------------------------------------------------
E3J0M0_FRAIE/110-299SASAAPHGLD----------------------------------------------------------------------
C8XDB0_NAKMY/22-205--NDTSRDLT----------------------------------------------------------------------
G7XGU5_ASPKW/117-299-----AWTQN----------------------------------------------------------------------
B1LVV6_METRJ/99-290GTLRTINLDH----------------------------------------------------------------------
Q5ZV46_LEGPH/101-283HQIHNYIHPT----------------------------------------------------------------------

PF14360

F6UTK5_XENTR/282-355--------------------------------------------------------------------------------
SMSR2_CAEEL/192-265--------------------------------------------------------------------------------
SLS2_TRYB2/201-275--------------------------------------------------------------------------------
B8C480_THAPS/431-503--------------------------------------------------------------------------------
IPCS3_ARATH/172-244--------------------------------------------------------------------------------
SAMD8_HUMAN/292-365--------------------------------------------------------------------------------
A2DHW8_TRIVA/46-124--------------------------------------------------------------------------------
SLS_LEIMA/211-286--------------------------------------------------------------------------------
A5K283_PLAVS/202-273--------------------------------------------------------------------------------
A0A509ASM8_PLABA/201-272--------------------------------------------------------------------------------
A0A384LQJ1_PLAKH/276-347--------------------------------------------------------------------------------
Q28DN3_XENTR/220-293--------------------------------------------------------------------------------
Q4N3L0_THEPA/182-253--------------------------------------------------------------------------------
A8XDY1_CAEBR/127-200--------------------------------------------------------------------------------
IPCS_ORYSJ/172-244--------------------------------------------------------------------------------
SMSR1_CAEEL/321-394--------------------------------------------------------------------------------
SMS2_CAEEL/201-274--------------------------------------------------------------------------------
A8X0T5_CAEBR/264-337--------------------------------------------------------------------------------
A9S9I4_PHYPA/275-346--------------------------------------------------------------------------------
B3SD02_TRIAD/279-352--------------------------------------------------------------------------------
A2DN61_TRIVA/170-240--------------------------------------------------------------------------------
B5YLZ6_THAPS/422-494--------------------------------------------------------------------------------
C6KT87_PLAF7/201-272--------------------------------------------------------------------------------
D0MWV3_PHYIT/192-264--------------------------------------------------------------------------------
B7FUU7_PHATC/326-397--------------------------------------------------------------------------------
SLS11_TRYCC/193-267--------------------------------------------------------------------------------
D2VDJ4_NAEGR/246-319--------------------------------------------------------------------------------
D2VXN5_NAEGR/191-270--------------------------------------------------------------------------------
D2VKR1_NAEGR/196-272--------------------------------------------------------------------------------
B9HC73_POPTR/172-244--------------------------------------------------------------------------------
C6KT86_PLAF7/265-336--------------------------------------------------------------------------------
C4LV27_ENTHI/184-261--------------------------------------------------------------------------------
A2FIE9_TRIVA/168-238--------------------------------------------------------------------------------
B7QHG5_IXOSC/233-306--------------------------------------------------------------------------------
D0NII4_PHYIT/164-244--------------------------------------------------------------------------------
A7ANZ4_BABBO/239-311--------------------------------------------------------------------------------
A0JMN0_DANRE/269-342--------------------------------------------------------------------------------
C3XQA8_BRAFL/273-346--------------------------------------------------------------------------------
F8W5G6_DANRE/232-307--------------------------------------------------------------------------------
H3CAZ2_TETNG/175-248--------------------------------------------------------------------------------
Q4U956_THEAN/200-270--------------------------------------------------------------------------------

PF02681

F2NNY3_MARHT/5-141--------------------------------------------------------------------------------
K9T6M6_9CYAN/8-143--------------------------------------------------------------------------------
D4ZTL8_ARTPN/8-143--------------------------------------------------------------------------------
K9WGM7_9CYAN/8-143--------------------------------------------------------------------------------
B7GI74_ANOFW/24-164--------------------------------------------------------------------------------
B1WS33_CROS5/8-143--------------------------------------------------------------------------------
R5AEV3_9CLOT/9-146--------------------------------------------------------------------------------
Q31Q62_SYNE7/9-145--------------------------------------------------------------------------------
R5XG63_9CLOT/5-137--------------------------------------------------------------------------------
R7A3L4_9FIRM/8-144--------------------------------------------------------------------------------
W0E929_9FIRM/8-143--------------------------------------------------------------------------------
D3FYY4_ALKPO/4-149--------------------------------------------------------------------------------
F0RVM2_SPHGB/6-143--------------------------------------------------------------------------------
H6NB79_9BACL/2-142--------------------------------------------------------------------------------
Q7V6P1_PROMM/15-147--------------------------------------------------------------------------------
Q18B69_CLOD6/8-140--------------------------------------------------------------------------------
G0GF41_SPITZ/9-149--------------------------------------------------------------------------------
Q65FE5_BACLD/4-149--------------------------------------------------------------------------------
U5LF62_9BACI/2-142--------------------------------------------------------------------------------
R7L0C2_9FIRM/5-149--------------------------------------------------------------------------------
Q5WDV5_BACSK/4-146--------------------------------------------------------------------------------
D6GSF2_FILAD/8-144--------------------------------------------------------------------------------
E6U5K5_ETHHY/8-143--------------------------------------------------------------------------------
Q5SJ95_THET8/4-140--------------------------------------------------------------------------------
Q9RSQ8_DEIRA/8-143--------------------------------------------------------------------------------
P73185_SYNY3/8-143--------------------------------------------------------------------------------
D1AKQ0_SEBTE/7-143--------------------------------------------------------------------------------
E0RXA3_BUTPB/8-144--------------------------------------------------------------------------------
F5YE41_TREAZ/16-155--------------------------------------------------------------------------------
V5WEJ9_9SPIO/6-144--------------------------------------------------------------------------------
U5LHE7_9BACI/5-149--------------------------------------------------------------------------------
K9XWG4_STAC7/8-143--------------------------------------------------------------------------------
E6U2C7_BACCJ/4-149--------------------------------------------------------------------------------
K9V3M2_9CYAN/8-143--------------------------------------------------------------------------------
B9IAH9_POPTR/38-171--------------------------------------------------------------------------------
M0RZC5_MUSAM/20-155--------------------------------------------------------------------------------
R5ZD30_9FIRM/8-146--------------------------------------------------------------------------------
R6Q3Q8_9FIRM/8-138--------------------------------------------------------------------------------
C0ZKP9_BREBN/5-150--------------------------------------------------------------------------------
D8TLE7_VOLCA/33-168--------------------------------------------------------------------------------
R6SRI1_9FIRM/7-157--------------------------------------------------------------------------------
K9YEC7_HALP7/8-143--------------------------------------------------------------------------------
K3XML5_SETIT/24-159--------------------------------------------------------------------------------
K9RII7_9CYAN/8-143--------------------------------------------------------------------------------
K4LIZ6_THEPS/40-169--------------------------------------------------------------------------------
E6TWS5_BACCJ/5-142--------------------------------------------------------------------------------
Q73MW8_TREDE/10-150--------------------------------------------------------------------------------
Q8Y4P9_LISMO/4-149--------------------------------------------------------------------------------
M0SK26_MUSAM/139-272--------------------------------------------------------------------------------
G4KW10_OSCVS/4-137--------------------------------------------------------------------------------
R5CL70_9FIRM/8-147--------------------------------------------------------------------------------
I0I5M8_CALAS/5-139--------------------------------------------------------------------------------
D7CKU8_SYNLT/12-144--------------------------------------------------------------------------------
R7IRJ9_9CLOT/8-142--------------------------------------------------------------------------------
B8HXR8_CYAP4/8-143--------------------------------------------------------------------------------
B0C3J0_ACAM1/8-143--------------------------------------------------------------------------------
I4DAH9_DESAJ/3-144--------------------------------------------------------------------------------
Q46K07_PROMT/15-148--------------------------------------------------------------------------------
R7A3G1_9CLOT/8-142--------------------------------------------------------------------------------
Q24V03_DESHY/8-143--------------------------------------------------------------------------------
Q10X44_TRIEI/8-143--------------------------------------------------------------------------------
A4RZ57_OSTLU/3-142--------------------------------------------------------------------------------
D8QR56_SELML/24-159--------------------------------------------------------------------------------
A0A3Q7ELN9_SOLLC/140-274--------------------------------------------------------------------------------
Q8ENX8_OCEIH/4-149--------------------------------------------------------------------------------
K7V114_MAIZE/48-182--------------------------------------------------------------------------------
Q01ES7_OSTTA/128-261--------------------------------------------------------------------------------
E3HA83_ILYPC/7-143--------------------------------------------------------------------------------
A6TR41_ALKMQ/8-144--------------------------------------------------------------------------------
I1KRZ5_SOYBN/9-144--------------------------------------------------------------------------------
R5KDM7_9CLOT/8-150--------------------------------------------------------------------------------
R7I9S8_9FIRM/10-145--------------------------------------------------------------------------------
R6BY11_9CLOT/8-144--------------------------------------------------------------------------------
R5ITD2_9FIRM/8-144--------------------------------------------------------------------------------
K9RQD3_SYNP3/8-143--------------------------------------------------------------------------------
K9SVF9_9SYNE/8-143--------------------------------------------------------------------------------
Q7VBG6_PROMA/16-148--------------------------------------------------------------------------------
O83188_TREPA/14-153--------------------------------------------------------------------------------
G8QY16_SPHPG/6-143--------------------------------------------------------------------------------
D3EMZ3_ATETH/8-144--------------------------------------------------------------------------------
M0SG02_MUSAM/22-157--------------------------------------------------------------------------------
F5YMS6_TREPZ/16-155--------------------------------------------------------------------------------
R7R6N9_9FIRM/8-144--------------------------------------------------------------------------------
C7NE60_LEPBD/7-143--------------------------------------------------------------------------------
R5IDQ6_9CLOT/2-138--------------------------------------------------------------------------------
D9R8M4_CLOSW/8-144--------------------------------------------------------------------------------
D7BAF5_MEISD/5-141--------------------------------------------------------------------------------
F8F1T7_TRECH/16-155--------------------------------------------------------------------------------
Q93ZZ7_ARATH/51-205--------------------------------------------------------------------------------
D8U4F3_VOLCA/38-173--------------------------------------------------------------------------------
J7IS94_DESMD/8-142--------------------------------------------------------------------------------
F9VBI0_LACGL/8-142--------------------------------------------------------------------------------
K9W0K1_9CYAN/16-151--------------------------------------------------------------------------------
A9NHX4_ACHLI/6-144--------------------------------------------------------------------------------
D1AXZ8_STRM9/7-141--------------------------------------------------------------------------------
K9UG93_CHAP6/16-151--------------------------------------------------------------------------------
F4LN44_TREBD/13-152--------------------------------------------------------------------------------
R6NRL3_9CLOT/2-140--------------------------------------------------------------------------------
K0IWZ6_AMPXN/4-149--------------------------------------------------------------------------------
W8TJV6_PEPAC/8-150--------------------------------------------------------------------------------
A8MFI8_ALKOO/8-144--------------------------------------------------------------------------------
H9UHZ5_SPIAZ/13-152--------------------------------------------------------------------------------
B8CY18_HALOH/3-134--------------------------------------------------------------------------------
B2A528_NATTJ/7-141--------------------------------------------------------------------------------
R6ME09_9FIRM/8-142--------------------------------------------------------------------------------
F2NS18_TRES6/11-151--------------------------------------------------------------------------------
R5PNP2_9CLOT/8-138--------------------------------------------------------------------------------
Q1J0I2_DEIGD/9-145--------------------------------------------------------------------------------
R5MBG0_9CLOT/8-144--------------------------------------------------------------------------------
I4D8V5_DESAJ/8-142--------------------------------------------------------------------------------
R7A673_9FIRM/8-144--------------------------------------------------------------------------------
R7FJ12_9CLOT/8-142--------------------------------------------------------------------------------
O51097_BORBU/6-146--------------------------------------------------------------------------------
K8GFC4_9CYAN/8-143--------------------------------------------------------------------------------
M4CGY8_BRARP/134-268--------------------------------------------------------------------------------
R6N1H2_9CLOT/6-146--------------------------------------------------------------------------------
D3FSU1_ALKPO/2-142--------------------------------------------------------------------------------
B9DG97_ARATH/20-155--------------------------------------------------------------------------------
Q9CGU3_LACLA/8-142--------------------------------------------------------------------------------
F2I5F0_AERUA/1-152--------------------------------------------------------------------------------
R7N6H8_9FIRM/8-144--------------------------------------------------------------------------------
C1FDH6_MICCC/170-303--------------------------------------------------------------------------------
R6SUP5_9CLOT/9-142--------------------------------------------------------------------------------
A5GM29_SYNPW/13-145--------------------------------------------------------------------------------
Q2JKH6_SYNJB/6-142--------------------------------------------------------------------------------
F2JMF4_CELLD/8-142--------------------------------------------------------------------------------
E6SHJ0_THEM7/12-146--------------------------------------------------------------------------------
K9S6R1_9CYAN/8-143--------------------------------------------------------------------------------
E3PRG0_ACESD/8-144--------------------------------------------------------------------------------
R5N6N4_9CLOT/8-137--------------------------------------------------------------------------------
R5GZB8_9FIRM/8-144--------------------------------------------------------------------------------
D5WTV2_KYRT2/8-146--------------------------------------------------------------------------------
R6PRB8_9FIRM/8-139--------------------------------------------------------------------------------
C1N1Q0_MICPC/8-144--------------------------------------------------------------------------------
L0A6P8_DEIPD/5-141--------------------------------------------------------------------------------
A0A3R7BI20_9CLOT/5-142--------------------------------------------------------------------------------
E3DMH7_HALPG/3-133--------------------------------------------------------------------------------
E4U9L1_OCEP5/5-141--------------------------------------------------------------------------------
E8N0A2_ANATU/6-140--------------------------------------------------------------------------------
K9SNJ2_9CYAN/8-142--------------------------------------------------------------------------------
F0T097_SYNGF/8-149--------------------------------------------------------------------------------
A8FH06_BACP2/4-149--------------------------------------------------------------------------------
I0JQ19_HALH3/6-151--------------------------------------------------------------------------------
M4FCC5_BRARP/76-227--------------------------------------------------------------------------------
G8LW53_HUNCD/8-141--------------------------------------------------------------------------------
C8WVG2_ALIAD/12-152--------------------------------------------------------------------------------
R5ADD7_9CLOT/7-149--------------------------------------------------------------------------------
K3YAI4_SETIT/11-145--------------------------------------------------------------------------------
R7F8Q2_9CLOT/8-142--------------------------------------------------------------------------------
A3DDN6_HUNT2/8-143--------------------------------------------------------------------------------
K9Z2J9_CYAAP/8-142--------------------------------------------------------------------------------
K9P352_CYAGP/15-157--------------------------------------------------------------------------------
K9XC51_9CHRO/8-143--------------------------------------------------------------------------------
R6Y7H0_9FIRM/7-149--------------------------------------------------------------------------------
E1RAI3_SEDSS/5-141--------------------------------------------------------------------------------
R5R4Q1_9FIRM/8-145--------------------------------------------------------------------------------
B8E2Q0_DICTD/12-146--------------------------------------------------------------------------------
K4KZ53_9FIRM/8-148--------------------------------------------------------------------------------
R6EV23_9FIRM/8-145--------------------------------------------------------------------------------
D6Y193_BACIE/4-149--------------------------------------------------------------------------------
E7FY95_ERYRH/7-143--------------------------------------------------------------------------------
C4L0Z0_EXISA/3-131--------------------------------------------------------------------------------
D7GPW8_9FIRM/6-142--------------------------------------------------------------------------------
D5E1E4_BACMQ/2-142--------------------------------------------------------------------------------
A4J281_DESRM/9-144--------------------------------------------------------------------------------
I0JIT0_HALH3/2-142--------------------------------------------------------------------------------
E1Z6N1_CHLVA/1-136--------------------------------------------------------------------------------
Q8DMU2_THEEB/9-144--------------------------------------------------------------------------------
A4RUH5_OSTLU/12-147--------------------------------------------------------------------------------
Q5L0A2_GEOKA/2-142--------------------------------------------------------------------------------
W1NTD9_AMBTC/34-169--------------------------------------------------------------------------------
K8EPQ0_CARML/4-150--------------------------------------------------------------------------------
C6CSF5_PAESJ/6-132--------------------------------------------------------------------------------
G2TKM5_BACCO/4-146--------------------------------------------------------------------------------
K9TPQ7_9CYAN/8-143--------------------------------------------------------------------------------
N0B1X3_9BACI/2-142--------------------------------------------------------------------------------
V5WJH0_9SPIO/5-132--------------------------------------------------------------------------------
C9RC18_AMMDK/8-140--------------------------------------------------------------------------------
L7VUG0_THES1/9-141--------------------------------------------------------------------------------
R5J5K1_9FIRM/8-139--------------------------------------------------------------------------------
C1E358_MICCC/7-142--------------------------------------------------------------------------------
R6B6R3_9CLOT/12-145--------------------------------------------------------------------------------
A5GRZ6_SYNR3/9-137--------------------------------------------------------------------------------
R7B1C9_9CLOT/8-144--------------------------------------------------------------------------------

PF10261

Q5KDG2_CRYNJ/99-376--------------------------------------------------------------------------------
G2QCT9_MYCTT/113-344--------------------------------------------------------------------------------
E3RV27_PYRTT/85-309--------------------------------------------------------------------------------
R7YND5_CONA1/92-324--------------------------------------------------------------------------------
G2XHJ1_VERDV/98-323--------------------------------------------------------------------------------
C4Y4H3_CLAL4/57-287--------------------------------------------------------------------------------
C5DQ74_ZYGRC/35-359RFQLTTQDELKGNLASHTLAT------------------------LRRLMGISNEKSDSTEPLVSPSEINIFIHDSIKSV
G8BYR0_TETPH/33-386DYKESYIESSYLHHLRC---------------------------------AIDENAEGCMDFVPSKDTNELIKKIQDLDP
E3KJ35_PUCGT/96-348--------------------------------------------------------------------------------
N1RPR7_FUSC4/66-290--------------------------------------------------------------------------------
F9WXZ1_ZYMTI/84-317--------------------------------------------------------------------------------
G3BAX8_CANTC/92-323--------------------------------------------------------------------------------
G8BIE7_CANPC/69-321--------------------------------------------------------------------------------
C5FE12_ARTOC/64-296--------------------------------------------------------------------------------
G8ZXV3_TORDC/32-356KKPAHDELLEQSLNSIRC-------------------------------AMNGTECHRELAKSVVPTDLNHYIHDSLFSG
A5DKF9_PICGU/56-288--------------------------------------------------------------------------------
E3QPL9_COLGM/87-312--------------------------------------------------------------------------------
S3CVS7_OPHP1/100-357--------------------------------------------------------------------------------
A3LYM5_PICST/59-299--------------------------------------------------------------------------------
G0WG33_NAUDC/40-380RTQRDATGDDEKELLLHSLNSI-----------------------GCALEKSCDKINSTISSISSNRKLNEFINTQMNSI
M3IZX9_CANMX/56-283--------------------------------------------------------------------------------
G3JBH7_CORMM/90-318--------------------------------------------------------------------------------
R9AQ78_WALI9/64-296--------------------------------------------------------------------------------
C5E2P1_LACTC/32-359KGAQNPPSLLQNAVSEIE-------------------------------YWISEGKGHLRGEDVTPSQLNSLIDSALHSW
T0K1V0_COLGC/87-312--------------------------------------------------------------------------------
G8Y1H9_PICSO/62-313--------------------------------------------------------------------------------
C5G9K2_AJEDR/75-292--------------------------------------------------------------------------------
C5MI48_CANTT/55-284--------------------------------------------------------------------------------
N1Q4W5_DOTSN/87-323--------------------------------------------------------------------------------
S3DE95_GLAL2/81-314--------------------------------------------------------------------------------
R9P3R6_PSEHS/103-383--------------------------------------------------------------------------------
N1Q6I4_PSEFD/84-317--------------------------------------------------------------------------------
K2R4W1_MACPH/94-328--------------------------------------------------------------------------------
N1QNJ0_SPHMS/101-335--------------------------------------------------------------------------------
F7WC52_SORMK/81-344--------------------------------------------------------------------------------
M2N8T6_BAUPA/89-327--------------------------------------------------------------------------------
K9G927_PEND2/67-311--------------------------------------------------------------------------------
C4R337_KOMPG/57-293--------------------------------------------------------------------------------
A1CR84_ASPCL/74-313--------------------------------------------------------------------------------
A5E4A1_LODEL/62-350--------------------------------------------------------------------------------
E5R3U3_ARTGP/64-297--------------------------------------------------------------------------------
K1WMV9_MARBU/113-341--------------------------------------------------------------------------------
G0VEA6_NAUCC/39-386QFLSKFDSTGPSDSDSQLLDAS----------------------LKTIGCVLNLEKECDMDHDVTSADLNSFIKRKMNSM
Q6FR77_CANGA/32-368DYQKNGKNPLAVDSKLMDFVTGSIEKAIEHYSYHIKSNIMIKEISRLLSDLNITYSTEQINDFIKNFISNTTVGNSSGAN
E9EF85_METAQ/84-313--------------------------------------------------------------------------------
M9LJJ3_PSEA3/95-341--------------------------------------------------------------------------------
M1VZ69_CLAP2/82-312--------------------------------------------------------------------------------
V5GE99_BYSSN/78-302--------------------------------------------------------------------------------
I2FTC6_USTH4/101-374--------------------------------------------------------------------------------
G8JR11_ERECY/38-363ERRDGNAGMGEETVYWL---------------------------------NCRLGEGPCENTSPSNSAMNSFISEALNNA
Q6BUP0_DEBHA/108-353--------------------------------------------------------------------------------
Q4WJI3_ASPFU/73-304--------------------------------------------------------------------------------
G2R9R1_THETT/97-341--------------------------------------------------------------------------------
I4YGQ8_WALMC/41-264--------------------------------------------------------------------------------
G2XPX9_BOTF4/55-288--------------------------------------------------------------------------------
G3AEN0_SPAPN/55-285--------------------------------------------------------------------------------
C7Z7P3_NECH7/60-283--------------------------------------------------------------------------------
SCS3_YEAST/33-370LHGHHQEHRQQQLWDRSIGSI------------------------QGALQATQPKTPKNVTASAAAAINTFIHDQMHRWQ
G3YDY9_ASPNA/76-295--------------------------------------------------------------------------------
L8FY78_PSED2/112-347--------------------------------------------------------------------------------
A7TR39_VANPO/62-394KNTDGVATQGHIQRLKC---------------------------------ALDNKSNCNSVSSPPNINADIKNTVFKLDP
N1JKB0_BLUG1/90-317--------------------------------------------------------------------------------
B6Q6E7_TALMQ/81-304--------------------------------------------------------------------------------
B8M5R8_TALSN/84-316--------------------------------------------------------------------------------
C8V5A4_EMENI/56-278--------------------------------------------------------------------------------
Q6CKM7_KLULA/25-334NVHGSETLLSA---------------------------------------------LNSIISEDSSEYTPELAAELSELS
Q75EB2_ASHGO/35-359AHGAQGDELRERTMYW----------------------------------IRCMLTGGQCENTGLDPTELNSYIQDSVTA
M7SYX4_EUTLA/110-375--------------------------------------------------------------------------------
E9CZW5_COCPS/67-291--------------------------------------------------------------------------------
F0XPI2_GROCL/81-317--------------------------------------------------------------------------------
A7UX33_NEUCR/112-389--------------------------------------------------------------------------------
J3NLN2_GAET3/91-336--------------------------------------------------------------------------------
A7EQ03_SCLS1/55-288--------------------------------------------------------------------------------
G9NCA4_HYPVG/72-300--------------------------------------------------------------------------------

PF01569

A4I568_LEIIN/102-249-----------------------------------------------------G-M---------------------PSD
DOPP1_DICDI/54-178-----------------------------------------------------G-M---------------------PSS
Q17D95_AEDAE/56-197-------------------------------------------------SPGN------------------------PSG
G6PC3_MOUSE/53-195-------------------------------------------------ETGPG-S---------------------PSG
A0BM37_PARTE/91-226-----------------------------------------------------E-F---------------G----KPSG
Q23FV4_TETTS/102-237-------------------------------------------------------F---------------G----NPSG
A0EE96_PARTE/81-240-----------------------------------------------------G-F---------------G----DPSG
A8FE89_BACP2/71-198-----------------------------------------------------S-F---------------------PSG
Q7MUE1_PORGI/58-185---------------------------------------------------KYG-F---------------------ISG
A0K0K5_ARTS2/118-241-----------------------------------------------------S-F---------------------PSG
A4XP73_PSEMY/98-234-------------------------------------------------SASRS-F---------------------PGD
A4X1H8_SALTO/101-242-------------------------------------------------EFTRS-Y---------------------PSG
Q9EWX3_STRCO/115-237-----------------------------------------------------I-F---------------------PSG
A1BJZ6_CHLPD/56-185-----------------------------------------------------S-F---------------------ASS
A4FQA0_SACEN/76-196---------------------------------------------------DWS-L---------------------PSN
B0U8C7_METS4/61-186--------------------------------------------------HWSS-F---------------------PSD
A1S1V4_SHEAM/77-196-----------------------------------------------------S-F---------------------PSA
A1W5E3_ACISJ/72-191----------------------------------------------------YS-L---------------------PSG
A5CF96_ORITB/78-203-------------------------------------------------NCFTS-F---------------------PSA
B4U5Z7_HYDS0/54-171-----------------------------------------------------S-F---------------------PSG
A5DBA1_PICGU/102-232----------------------------------------------------YG-F---------------------PSS
Q4D544_TRYCC/102-225-----------------------------------------------------G-Y---------------------PST
SSPA_DICDI/88-218-----------------------------------------------------G-L---------------------PST
Q32GQ5_SHIDS/77-232-------------------------------------------------ETGFA-F---------------------PSG
Q9CMX4_PASMU/75-237-------------------------------------------------EVGYA-F---------------------PSG
Q21JU9_SACD2/110-231----------------------------------------------------HS-F---------------------PSG
Q0K1U6_CUPNH/103-229---------------------------------------------------DGS-Y---------------------PSG
Q65GX3_BACLD/179-304-------------------------------------------------NKDGG-F---------------------PSG
Q2IJN8_ANADE/141-265-----------------------------------------------------S-F---------------------YSG
Q6FEM9_ACIAD/65-182-----------------------------------------------------S-F---------------------PSG
A1K7H5_AZOSB/105-237-------------------------------------------------DGNCS-F---------------------VSG
Q6MBQ7_PARUW/87-223-------------------------------------------------EPSKS-F---------------------PCG
A8EX54_ARCB4/94-229-------------------------------------------------IQKSK-I---------------KC---WPAG
Q87X15_PSESM/102-231-------------------------------------------------KPGRC-W---------------------PGG
A8BDI5_GIAIC/110-282-------------------------------------------------PANLK-L---------------YS---TPSG
A8BQZ4_GIAIC/121-285-------------------------------------------------QCSHS-L---------------SS---TPSG
Q6MTZ1_MYCMS/144-270---------------------------------------------------HNS-F---------------------PSG
R5TP42_9FIRM/95-216-------------------------------------------------TPTNV-F---------------------PSL
A3LWS4_PICST/248-396-------------------------------------------------AIPNK-F---------------AS---CPSI
Q127S7_POLSJ/95-224----------------------------------------------------AS-G---------------NA---CPSL
A4CJ32_ROBBH/299-448----------------------------------------------------PP-F---------------PE---YTSG
Q2HER5_CHAGB/260-418-------------------------------------------------RPTPS-H---------------PD---YVST
A8L0R7_FRASN/276-428-------------------------------------------------PPHPD-F---------------------TSG
Q6NJR5_CORDI/194-319-----------------------------------------------------S-Y---------------------PSG
A1SKJ7_NOCSJ/98-218-----------------------------------------------------S-F---------------------PSG
Q82Z33_ENTFA/85-204-----------------------------------------------------S-F---------------------PSG
A2DYB5_TRIVA/98-241-------------------------------------------------EFKDQ-F---------------RS---WPSG
A2EZZ9_TRIVA/91-236-------------------------------------------------EAFKS-F---------------------PSG
A4H9E7_LEIBR/233-378-------------------------------------------------EGRLS-F---------------------PSG
Q6BYN9_DEBHA/112-272-------------------------------------------------EGFRS-F---------------------PSG
A7EIU4_SCLS1/134-294-------------------------------------------------DSLES-F---------------------PSG
A7TF94_VANPO/122-266-------------------------------------------------ILHEG-L---------------KS---TPSG
Q2TYI3_ASPOR/35-224-------------------------------------------------VIKDG-F---------------AA---FPSG
A2EQG2_TRIVA/90-230-------------------------------------------------SQFSS-F---------------------PAT
PLPR5_MOUSE/122-275-------------------------------------------------RARKT-F---------------------PSK
Q9VNU2_DROME/65-225-------------------------------------------------ELHVS-F---------------------PSA
A8WXP5_CAEBR/128-286-------------------------------------------------TARTS-F---------------------PSG
A6X217_OCHA4/121-242---------------------------------------------------YES-F---------------------PSG
Q5NGF4_FRATT/116-236----------------------------------------------------YD-F---------------AS---MPSG
Q5ZX13_LEGPH/91-208---------------------------------------------------YWS-F---------------------PSG
Q6MH55_BDEBA/105-226---------------------------------------------------WHS-F---------------------SSG
Q7NZZ5_CHRVO/815-932----------------------------------------------------SS-F---------------------TSN
Q89JR9_BRADU/79-199---------------------------------------------------EDA-F---------------------PSG
B7VND8_VIBA3/235-351----------------------------------------------------YS-F---------------------PSL
Q5E4L0_ALIF1/241-366-----------------------------------------------------G-M---------------------PSM
Q9RVR6_DEIRA/14-135----------------------------------------------------PG-L---------------------PSG

PF14378

Q5K8D7_CRYNJ/128-311-------------------------------------------------KFQNQ-L---------------AA---FPSL
B0UG28_METS4/124-315-------------------------------------------------M--RG-L---------------VT---FPSF
A1SJR6_NOCSJ/50-230-------------------------------------------------NFVNQ-Y---------------AA---MPSL
E4NIW3_KITSK/45-228-------------------------------------------------TGGNH-Y---------------SA---MPSL
G8WRV6_STREN/158-347-------------------------------------------------GMTNQ-Y---------------AA---MPSL
C7QD07_CATAD/71-251-------------------------------------------------DSPDQ-L---------------SA---MPSV
Q2G5H1_NOVAD/115-305----------------------------------------------------AG-L---------------VS---FPSF
Q1IHV8_KORVE/153-330-------------------------------------------------GISGP-R---------------NA---IPSL
F2R3P1_STRVP/39-228-------------------------------------------------GMTNQ-Y---------------AA---MPSL
A9HHP2_GLUDA/131-314-------------------------------------------------M--EG-V---------------YT---FPSF
Q13PQ7_PARXL/110-293-------------------------------------------------V--QG-L---------------VS---FPSL
Q63V72_BURPS/125-308-------------------------------------------------L--QG-M---------------VS---MPSF
Q01VD1_SOLUE/159-330----------------------------------------------------GR-P---------------NA---MPSL
D1CA82_SPHTD/53-235-------------------------------------------------MLYNP-F---------------AA---MPSL
K0K1I4_SACES/40-223-------------------------------------------------PGVNL-L---------------AA---MPSM
D1C524_SPHTD/53-234-------------------------------------------------LLYNP-F---------------AA---MPSM
W5TLL4_9NOCA/53-242-------------------------------------------------SLTND-F---------------AA---MPSL
Q2JBQ4_FRACC/47-236-------------------------------------------------GLTNQ-Y---------------AA---LPSL
W0BEC4_9GAMM/94-276-------------------------------------------------TLEGG-M---------------IA---TPSF
Q220L9_RHOFT/109-292-------------------------------------------------M--QG-L---------------IS---IPSL
Q87M50_VIBPA/146-355-------------------------------------------------GIGSG-I---------------SA---MPSM
B1LSY3_METRJ/129-320-------------------------------------------------L--RG-L---------------AT---FPSF
A2BL06_HYPBU/51-224----------------------------------------------------NP-Y---------------AA---MPSM
L0PFU2_PNEJ8/5-201-------------------------------------------------TFPAS-P---------------LVFGAFPSL
C9Z2S2_STRSW/63-253-------------------------------------------------GMTNQ-Y---------------AA---MPSL
E3JAH2_FRAIE/94-282-------------------------------------------------GLTNQ-Y---------------AA---MPSL
F8AWV4_9ACTN/47-236-------------------------------------------------GITNQ-F---------------AA---MPSL
R7Y200_9ACTN/124-318-------------------------------------------------GIEGA-V---------------QSVAGFASL
A0LS47_ACIC1/69-252-------------------------------------------------AGADE-L---------------AA---MPSV
E2Q4K3_STRCL/45-234-------------------------------------------------NLTNQ-Y---------------AA---MPSL
F8J559_HYPSM/123-309-------------------------------------------------LHFAG-L---------------VT---FPSY
L0ET54_LIBCB/102-293-------------------------------------------------T--AG-I---------------IT---FPSV
Q89QL0_BRADU/109-300-------------------------------------------------A--EG-I---------------IS---FPSL
H0PVV4_9RHOO/74-256-------------------------------------------------M--QG-I---------------VT---FPSY
E3EJC2_PAEPS/1-162-------------------------------------------------IHHDP-N---------------AS---FPSN
A1SDU3_NOCSJ/130-324-------------------------------------------------VVQDA-V---------------QSVAGFASL
C7QBQ6_CATAD/84-272-------------------------------------------------KSTNE-F---------------AA---MPSL
A1SHK3_NOCSJ/128-322-------------------------------------------------HAGDA-F---------------VSISAFASL
E3J0M0_FRAIE/110-299-------------------------------------------------KVANL-Y---------------AA---MPSL
C8XDB0_NAKMY/22-205-------------------------------------------------TGQNH-F---------------SA---MPSL
G7XGU5_ASPKW/117-299-------------------------------------------------KFQLT-I---------------AA---MPSL
B1LVV6_METRJ/99-290-------------------------------------------------V--EG-I---------------IT---FPSF
Q5ZV46_LEGPH/101-283-------------------------------------------------TIEGG-L---------------IA---LPSF

PF14360

F6UTK5_XENTR/282-355------------------------------------------------------------------------------SG
SMSR2_CAEEL/192-265------------------------------------------------------------------------------SG
SLS2_TRYB2/201-275------------------------------------------------------------------------------SG
B8C480_THAPS/431-503------------------------------------------------------------------------------SS
IPCS3_ARATH/172-244------------------------------------------------------------------------------SS
SAMD8_HUMAN/292-365------------------------------------------------------------------------------SG
A2DHW8_TRIVA/46-124------------------------------------------------------------------------------SG
SLS_LEIMA/211-286------------------------------------------------------------------------------SG
A5K283_PLAVS/202-273------------------------------------------------------------------------------SG
A0A509ASM8_PLABA/201-272------------------------------------------------------------------------------SG
A0A384LQJ1_PLAKH/276-347------------------------------------------------------------------------------SG
Q28DN3_XENTR/220-293------------------------------------------------------------------------------SG
Q4N3L0_THEPA/182-253------------------------------------------------------------------------------SG
A8XDY1_CAEBR/127-200------------------------------------------------------------------------------SG
IPCS_ORYSJ/172-244------------------------------------------------------------------------------SS
SMSR1_CAEEL/321-394------------------------------------------------------------------------------SG
SMS2_CAEEL/201-274------------------------------------------------------------------------------SG
A8X0T5_CAEBR/264-337------------------------------------------------------------------------------SG
A9S9I4_PHYPA/275-346------------------------------------------------------------------------------SG
B3SD02_TRIAD/279-352------------------------------------------------------------------------------SG
A2DN61_TRIVA/170-240------------------------------------------------------------------------------SG
B5YLZ6_THAPS/422-494------------------------------------------------------------------------------SG
C6KT87_PLAF7/201-272------------------------------------------------------------------------------SG
D0MWV3_PHYIT/192-264------------------------------------------------------------------------------SS
B7FUU7_PHATC/326-397------------------------------------------------------------------------------SG
SLS11_TRYCC/193-267------------------------------------------------------------------------------SG
D2VDJ4_NAEGR/246-319------------------------------------------------------------------------------SG
D2VXN5_NAEGR/191-270------------------------------------------------------------------------------SG
D2VKR1_NAEGR/196-272------------------------------------------------------------------------------SG
B9HC73_POPTR/172-244------------------------------------------------------------------------------SS
C6KT86_PLAF7/265-336------------------------------------------------------------------------------SG
C4LV27_ENTHI/184-261------------------------------------------------------------------------------SG
A2FIE9_TRIVA/168-238------------------------------------------------------------------------------SG
B7QHG5_IXOSC/233-306------------------------------------------------------------------------------SG
D0NII4_PHYIT/164-244------------------------------------------------------------------------------LG
A7ANZ4_BABBO/239-311------------------------------------------------------------------------------SG
A0JMN0_DANRE/269-342------------------------------------------------------------------------------SG
C3XQA8_BRAFL/273-346------------------------------------------------------------------------------SG
F8W5G6_DANRE/232-307------------------------------------------------------------------------------SG
H3CAZ2_TETNG/175-248------------------------------------------------------------------------------SG
Q4U956_THEAN/200-270------------------------------------------------------------------------------SG

PF02681

F2NNY3_MARHT/5-141-----------------------------------------------------------------------------PSS
K9T6M6_9CYAN/8-143-----------------------------------------------------------------------------PSA
D4ZTL8_ARTPN/8-143-----------------------------------------------------------------------------PSS
K9WGM7_9CYAN/8-143-----------------------------------------------------------------------------PSA
B7GI74_ANOFW/24-164-----------------------------------------------------------------------------PSS
B1WS33_CROS5/8-143-----------------------------------------------------------------------------PSA
R5AEV3_9CLOT/9-146-----------------------------------------------------------------------------PSS
Q31Q62_SYNE7/9-145-----------------------------------------------------------------------------PSS
R5XG63_9CLOT/5-137-----------------------------------------------------------------------------PSS
R7A3L4_9FIRM/8-144-----------------------------------------------------------------------------PSS
W0E929_9FIRM/8-143-----------------------------------------------------------------------------PSS
D3FYY4_ALKPO/4-149-----------------------------------------------------------------------------PSS
F0RVM2_SPHGB/6-143-----------------------------------------------------------------------------PSS
H6NB79_9BACL/2-142-----------------------------------------------------------------------------PSS
Q7V6P1_PROMM/15-147-----------------------------------------------------------------------------PSS
Q18B69_CLOD6/8-140-----------------------------------------------------------------------------PSS
G0GF41_SPITZ/9-149-----------------------------------------------------------------------------PSS
Q65FE5_BACLD/4-149-----------------------------------------------------------------------------PSS
U5LF62_9BACI/2-142-----------------------------------------------------------------------------PSS
R7L0C2_9FIRM/5-149-----------------------------------------------------------------------------PSA
Q5WDV5_BACSK/4-146-----------------------------------------------------------------------------PSS
D6GSF2_FILAD/8-144-----------------------------------------------------------------------------PSS
E6U5K5_ETHHY/8-143-----------------------------------------------------------------------------PSA
Q5SJ95_THET8/4-140-----------------------------------------------------------------------------PST
Q9RSQ8_DEIRA/8-143-----------------------------------------------------------------------------PSS
P73185_SYNY3/8-143-----------------------------------------------------------------------------PSA
D1AKQ0_SEBTE/7-143-----------------------------------------------------------------------------PSS
E0RXA3_BUTPB/8-144-----------------------------------------------------------------------------PSS
F5YE41_TREAZ/16-155-----------------------------------------------------------------------------PSS
V5WEJ9_9SPIO/6-144-----------------------------------------------------------------------------PSS
U5LHE7_9BACI/5-149-----------------------------------------------------------------------------PSS
K9XWG4_STAC7/8-143-----------------------------------------------------------------------------PSA
E6U2C7_BACCJ/4-149-----------------------------------------------------------------------------PSS
K9V3M2_9CYAN/8-143-----------------------------------------------------------------------------PSA
B9IAH9_POPTR/38-171-----------------------------------------------------------------------------PSS
M0RZC5_MUSAM/20-155-----------------------------------------------------------------------------PSS
R5ZD30_9FIRM/8-146-----------------------------------------------------------------------------PSS
R6Q3Q8_9FIRM/8-138-----------------------------------------------------------------------------PSS
C0ZKP9_BREBN/5-150-----------------------------------------------------------------------------PSS
D8TLE7_VOLCA/33-168-----------------------------------------------------------------------------PSS
R6SRI1_9FIRM/7-157-----------------------------------------------------------------------------PSA
K9YEC7_HALP7/8-143-----------------------------------------------------------------------------PSA
K3XML5_SETIT/24-159-----------------------------------------------------------------------------PSS
K9RII7_9CYAN/8-143-----------------------------------------------------------------------------PSA
K4LIZ6_THEPS/40-169-----------------------------------------------------------------------------PSS
E6TWS5_BACCJ/5-142-----------------------------------------------------------------------------PSS
Q73MW8_TREDE/10-150-----------------------------------------------------------------------------PSS
Q8Y4P9_LISMO/4-149-----------------------------------------------------------------------------PSS
M0SK26_MUSAM/139-272-----------------------------------------------------------------------------PSS
G4KW10_OSCVS/4-137-----------------------------------------------------------------------------PSG
R5CL70_9FIRM/8-147-----------------------------------------------------------------------------PSA
I0I5M8_CALAS/5-139-----------------------------------------------------------------------------PSS
D7CKU8_SYNLT/12-144-----------------------------------------------------------------------------PSA
R7IRJ9_9CLOT/8-142-----------------------------------------------------------------------------PSS
B8HXR8_CYAP4/8-143-----------------------------------------------------------------------------PSS
B0C3J0_ACAM1/8-143-----------------------------------------------------------------------------PSS
I4DAH9_DESAJ/3-144-----------------------------------------------------------------------------PSS
Q46K07_PROMT/15-148-----------------------------------------------------------------------------PSS
R7A3G1_9CLOT/8-142-----------------------------------------------------------------------------PSS
Q24V03_DESHY/8-143-----------------------------------------------------------------------------PSS
Q10X44_TRIEI/8-143-----------------------------------------------------------------------------PSA
A4RZ57_OSTLU/3-142-----------------------------------------------------------------------------PSS
D8QR56_SELML/24-159-----------------------------------------------------------------------------PSS
A0A3Q7ELN9_SOLLC/140-274-----------------------------------------------------------------------------PSS
Q8ENX8_OCEIH/4-149-----------------------------------------------------------------------------PSS
K7V114_MAIZE/48-182-----------------------------------------------------------------------------MSS
Q01ES7_OSTTA/128-261-----------------------------------------------------------------------------PSS
E3HA83_ILYPC/7-143-----------------------------------------------------------------------------PSS
A6TR41_ALKMQ/8-144-----------------------------------------------------------------------------PSS
I1KRZ5_SOYBN/9-144-----------------------------------------------------------------------------PSS
R5KDM7_9CLOT/8-150-----------------------------------------------------------------------------PSS
R7I9S8_9FIRM/10-145-----------------------------------------------------------------------------PSS
R6BY11_9CLOT/8-144-----------------------------------------------------------------------------PSS
R5ITD2_9FIRM/8-144-----------------------------------------------------------------------------PSG
K9RQD3_SYNP3/8-143-----------------------------------------------------------------------------PSS
K9SVF9_9SYNE/8-143-----------------------------------------------------------------------------PSS
Q7VBG6_PROMA/16-148-----------------------------------------------------------------------------PSS
O83188_TREPA/14-153-----------------------------------------------------------------------------PSS
G8QY16_SPHPG/6-143-----------------------------------------------------------------------------PSS
D3EMZ3_ATETH/8-144-----------------------------------------------------------------------------PSA
M0SG02_MUSAM/22-157-----------------------------------------------------------------------------PSS
F5YMS6_TREPZ/16-155-----------------------------------------------------------------------------PSS
R7R6N9_9FIRM/8-144-----------------------------------------------------------------------------PSS
C7NE60_LEPBD/7-143-----------------------------------------------------------------------------PSS
R5IDQ6_9CLOT/2-138-----------------------------------------------------------------------------PSS
D9R8M4_CLOSW/8-144-----------------------------------------------------------------------------PSS
D7BAF5_MEISD/5-141-----------------------------------------------------------------------------PSS
F8F1T7_TRECH/16-155-----------------------------------------------------------------------------PSS
Q93ZZ7_ARATH/51-205-----------------------------------------------------------------------------PST
D8U4F3_VOLCA/38-173-----------------------------------------------------------------------------PSS
J7IS94_DESMD/8-142-----------------------------------------------------------------------------PSS
F9VBI0_LACGL/8-142-----------------------------------------------------------------------------PSS
K9W0K1_9CYAN/16-151-----------------------------------------------------------------------------PSA
A9NHX4_ACHLI/6-144-----------------------------------------------------------------------------PSS
D1AXZ8_STRM9/7-141-----------------------------------------------------------------------------PSS
K9UG93_CHAP6/16-151-----------------------------------------------------------------------------PSA
F4LN44_TREBD/13-152-----------------------------------------------------------------------------PSS
R6NRL3_9CLOT/2-140-----------------------------------------------------------------------------PSS
K0IWZ6_AMPXN/4-149-----------------------------------------------------------------------------PSS
W8TJV6_PEPAC/8-150-----------------------------------------------------------------------------PSS
A8MFI8_ALKOO/8-144-----------------------------------------------------------------------------PSS
H9UHZ5_SPIAZ/13-152-----------------------------------------------------------------------------PSS
B8CY18_HALOH/3-134-----------------------------------------------------------------------------PSS
B2A528_NATTJ/7-141-----------------------------------------------------------------------------PSS
R6ME09_9FIRM/8-142-----------------------------------------------------------------------------PSS
F2NS18_TRES6/11-151-----------------------------------------------------------------------------PSS
R5PNP2_9CLOT/8-138-----------------------------------------------------------------------------PSS
Q1J0I2_DEIGD/9-145-----------------------------------------------------------------------------PSS
R5MBG0_9CLOT/8-144-----------------------------------------------------------------------------PSS
I4D8V5_DESAJ/8-142-----------------------------------------------------------------------------PSS
R7A673_9FIRM/8-144-----------------------------------------------------------------------------PSS
R7FJ12_9CLOT/8-142-----------------------------------------------------------------------------PSS
O51097_BORBU/6-146-----------------------------------------------------------------------------PSS
K8GFC4_9CYAN/8-143-----------------------------------------------------------------------------PSA
M4CGY8_BRARP/134-268-----------------------------------------------------------------------------PSS
R6N1H2_9CLOT/6-146-----------------------------------------------------------------------------PSS
D3FSU1_ALKPO/2-142-----------------------------------------------------------------------------PSS
B9DG97_ARATH/20-155-----------------------------------------------------------------------------PSS
Q9CGU3_LACLA/8-142-----------------------------------------------------------------------------PSS
F2I5F0_AERUA/1-152-----------------------------------------------------------------------------PSS
R7N6H8_9FIRM/8-144-----------------------------------------------------------------------------PSS
C1FDH6_MICCC/170-303-----------------------------------------------------------------------------PSS
R6SUP5_9CLOT/9-142-----------------------------------------------------------------------------PSS
A5GM29_SYNPW/13-145-----------------------------------------------------------------------------PSS
Q2JKH6_SYNJB/6-142-----------------------------------------------------------------------------PSS
F2JMF4_CELLD/8-142-----------------------------------------------------------------------------PSS
E6SHJ0_THEM7/12-146-----------------------------------------------------------------------------PSA
K9S6R1_9CYAN/8-143-----------------------------------------------------------------------------PSA
E3PRG0_ACESD/8-144-----------------------------------------------------------------------------PSS
R5N6N4_9CLOT/8-137-----------------------------------------------------------------------------PSS
R5GZB8_9FIRM/8-144-----------------------------------------------------------------------------PSS
D5WTV2_KYRT2/8-146-----------------------------------------------------------------------------PSS
R6PRB8_9FIRM/8-139-----------------------------------------------------------------------------PSS
C1N1Q0_MICPC/8-144-----------------------------------------------------------------------------PSS
L0A6P8_DEIPD/5-141-----------------------------------------------------------------------------PSS
A0A3R7BI20_9CLOT/5-142-----------------------------------------------------------------------------PSS
E3DMH7_HALPG/3-133-----------------------------------------------------------------------------PSS
E4U9L1_OCEP5/5-141-----------------------------------------------------------------------------PSS
E8N0A2_ANATU/6-140-----------------------------------------------------------------------------PSS
K9SNJ2_9CYAN/8-142-----------------------------------------------------------------------------PSS
F0T097_SYNGF/8-149-----------------------------------------------------------------------------PSS
A8FH06_BACP2/4-149-----------------------------------------------------------------------------PSS
I0JQ19_HALH3/6-151-----------------------------------------------------------------------------PSS
M4FCC5_BRARP/76-227-----------------------------------------------------------------------------PST
G8LW53_HUNCD/8-141-----------------------------------------------------------------------------PSS
C8WVG2_ALIAD/12-152-----------------------------------------------------------------------------PSS
R5ADD7_9CLOT/7-149-----------------------------------------------------------------------------PSS
K3YAI4_SETIT/11-145-----------------------------------------------------------------------------PSS
R7F8Q2_9CLOT/8-142-----------------------------------------------------------------------------PSS
A3DDN6_HUNT2/8-143-----------------------------------------------------------------------------PSS
K9Z2J9_CYAAP/8-142-----------------------------------------------------------------------------PSA
K9P352_CYAGP/15-157-----------------------------------------------------------------------------PSS
K9XC51_9CHRO/8-143-----------------------------------------------------------------------------PSA
R6Y7H0_9FIRM/7-149-----------------------------------------------------------------------------PSS
E1RAI3_SEDSS/5-141-----------------------------------------------------------------------------PSS
R5R4Q1_9FIRM/8-145-----------------------------------------------------------------------------PSA
B8E2Q0_DICTD/12-146-----------------------------------------------------------------------------PSS
K4KZ53_9FIRM/8-148-----------------------------------------------------------------------------PSS
R6EV23_9FIRM/8-145-----------------------------------------------------------------------------PSS
D6Y193_BACIE/4-149-----------------------------------------------------------------------------PSS
E7FY95_ERYRH/7-143-----------------------------------------------------------------------------PSS
C4L0Z0_EXISA/3-131-----------------------------------------------------------------------------PSS
D7GPW8_9FIRM/6-142-----------------------------------------------------------------------------PSS
D5E1E4_BACMQ/2-142-----------------------------------------------------------------------------PSS
A4J281_DESRM/9-144-----------------------------------------------------------------------------PSS
I0JIT0_HALH3/2-142-----------------------------------------------------------------------------PSS
E1Z6N1_CHLVA/1-136-----------------------------------------------------------------------------PSS
Q8DMU2_THEEB/9-144-----------------------------------------------------------------------------PSS
A4RUH5_OSTLU/12-147-----------------------------------------------------------------------------PSS
Q5L0A2_GEOKA/2-142-----------------------------------------------------------------------------PSS
W1NTD9_AMBTC/34-169-----------------------------------------------------------------------------PSS
K8EPQ0_CARML/4-150-----------------------------------------------------------------------------PSS
C6CSF5_PAESJ/6-132-----------------------------------------------------------------------------PST
G2TKM5_BACCO/4-146-----------------------------------------------------------------------------PSS
K9TPQ7_9CYAN/8-143-----------------------------------------------------------------------------PSA
N0B1X3_9BACI/2-142-----------------------------------------------------------------------------PSS
V5WJH0_9SPIO/5-132-----------------------------------------------------------------------------PSA
C9RC18_AMMDK/8-140-----------------------------------------------------------------------------PSA
L7VUG0_THES1/9-141-----------------------------------------------------------------------------PSS
R5J5K1_9FIRM/8-139-----------------------------------------------------------------------------PSS
C1E358_MICCC/7-142-----------------------------------------------------------------------------PSS
R6B6R3_9CLOT/12-145-----------------------------------------------------------------------------PSA
A5GRZ6_SYNR3/9-137-----------------------------------------------------------------------------PSS
R7B1C9_9CLOT/8-144-----------------------------------------------------------------------------PSS

PF10261

Q5KDG2_CRYNJ/99-376-----YKFCTGVPLTPDALPELFALLPGGGKGTAIPPGGGPTASHESLAPLPRP-R---------------WHKGFDISG
G2QCT9_MYCTT/113-344-----AAAC----------------------------------------KASGG-S---------------WRGGHDISG
E3RV27_PYRTT/85-309-----AATC----------------------------------------KAVGG-T---------------WKGGHDISG
R7YND5_CONA1/92-324-----AAGC----------------------------------------KLVGG-Q---------------WKGGYDISG
G2XHJ1_VERDV/98-323-----AVAC----------------------------------------KAAGG-A---------------WKGGHDISG
C4Y4H3_CLAL4/57-287-----SSQC----------------------------------------RRLKG-S---------------WEGGHDPSG
C5DQ74_ZYGRC/35-359REISTSAAC----------------------------------------RATGG-H---------------WKGGHDPSG
G8BYR0_TETPH/33-386MVQFISSKC----------------------------------------KRNGG-H---------------WVGGHDPSG
E3KJ35_PUCGT/96-348-----NLYC----------------------------------------QHRWGRKLPGLDNFILSTYKPYWSEGIDVSG
N1RPR7_FUSC4/66-290-----AVAC----------------------------------------KAAGG-K---------------WKGGHDISG
F9WXZ1_ZYMTI/84-317-----HAAC----------------------------------------KATGG-T---------------WRGGHDISG
G3BAX8_CANTC/92-323-----SKVC----------------------------------------RQLRG-N---------------WEGGHDPSG
G8BIE7_CANPC/69-321-----SYHC----------------------------------------RKFKG-S---------------WLGGYDPSG
C5FE12_ARTOC/64-296-----SVSC----------------------------------------KASGG-T---------------WEGGHDVSG
G8ZXV3_TORDC/32-356VTRNSSAVC----------------------------------------RTLGG-Y---------------WVGGHDPSG
A5DKF9_PICGU/56-288-----SYMC----------------------------------------RRLKG-T---------------WQGGHDPSG
E3QPL9_COLGM/87-312-----AVAC----------------------------------------KASGG-R---------------WSGGHDISG
S3CVS7_OPHP1/100-357-----SSAC----------------------------------------KNAGG-T---------------WSGGHDISG
A3LYM5_PICST/59-299-----SYHC----------------------------------------RRIKG-S---------------WEGGHDPSG
G0WG33_NAUDC/40-380RRINTSAQC----------------------------------------RMHGG-Y---------------WTKGHDPSG
M3IZX9_CANMX/56-283-----SYYC----------------------------------------RKMKG-N---------------WIGGHDPSG
G3JBH7_CORMM/90-318-----AVAC----------------------------------------KASGG-R---------------WSGGHDISG
R9AQ78_WALI9/64-296-----HLECYPQLLP---------------------------ASASTTTTSPTSAK---------------WVGGHDVSG
C5E2P1_LACTC/32-359KKINSSNLC----------------------------------------RSMGG-Y---------------WIGGHDPSG
T0K1V0_COLGC/87-312-----AVAC----------------------------------------KAAGG-K---------------WRGGHDISG
G8Y1H9_PICSO/62-313-----SYTC----------------------------------------RKLKG-A---------------WTGGHDPSG
C5G9K2_AJEDR/75-292-----STAC----------------------------------------KASGG-A---------------WTGGHDVSG
C5MI48_CANTT/55-284-----SYTC----------------------------------------RKFKG-N---------------WIGGHDPSG
N1Q4W5_DOTSN/87-323-----HAAC----------------------------------------KAIGG-Q---------------WRGGHDISG
S3DE95_GLAL2/81-314-----GFAC----------------------------------------KAVGG-Q---------------WLGGHDISG
R9P3R6_PSEHS/103-383-----DLYCRTRTPLSSSSHPA--------------LFSSNSAATLKTSKSIRA-M---------------WKGGHDISG
N1Q6I4_PSEFD/84-317-----HAAC----------------------------------------KAVGG-Q---------------WAGGHDISG
K2R4W1_MACPH/94-328-----AATC----------------------------------------KVAGG-T---------------WKGGHDISG
N1QNJ0_SPHMS/101-335-----HAAC----------------------------------------KAIGG-Q---------------WRGGHDISG
F7WC52_SORMK/81-344-----AAAC----------------------------------------KAAGG-R---------------WTGGHDISG
M2N8T6_BAUPA/89-327-----HAAC----------------------------------------KAIGG-Q---------------WRGGHDISG
K9G927_PEND2/67-311-----AATC----------------------------------------KNAGG-A---------------WRGGHDISG
C4R337_KOMPG/57-293-----SSTC----------------------------------------RSIKG-E---------------WTGGHDPSG
A1CR84_ASPCL/74-313-----AAAC----------------------------------------KAAGG-V---------------WAGGHDVSG
A5E4A1_LODEL/62-350-----SYHC----------------------------------------RKLRG-N---------------WEGGHDPLG
E5R3U3_ARTGP/64-297-----SVLC----------------------------------------KASGG-T---------------WKGGHDVSG
K1WMV9_MARBU/113-341-----GVAC----------------------------------------KAVGG-E---------------WKGGHDISG
G0VEA6_NAUCC/39-386GRISTSAMC----------------------------------------RSHGG-Y---------------WTMGHDPSG
Q6FR77_CANGA/32-368STLDNSFAC----------------------------------------RLNGG-Y---------------WQGGHDPSG
E9EF85_METAQ/84-313-----AVAC----------------------------------------KAAGG-K---------------WNGGHDISG
M9LJJ3_PSEA3/95-341-----EMYCRTRTPLSSTS-------------------HPALFSGSGAAKSIRA-A---------------WRGGHDISG
M1VZ69_CLAP2/82-312-----AMAC----------------------------------------KTSGG-R---------------WSGGHDISG
V5GE99_BYSSN/78-302-----AAAC----------------------------------------KAAGG-S---------------WRGGHDVSG
I2FTC6_USTH4/101-374-----ELYCRTRTPLSSSTH------------------PALFSSSSLRSKSIQA-I---------------WKGGHDISG
G8JR11_ERECY/38-363YPIDNGQMC----------------------------------------RKLGG-Y---------------WTGGHDPSG
Q6BUP0_DEBHA/108-353-----SYMC----------------------------------------RKLKG-S---------------WEGGHDPSG
Q4WJI3_ASPFU/73-304-----AAAC----------------------------------------KAAGG-S---------------WTGGHDVSG
G2R9R1_THETT/97-341-----AAAC----------------------------------------KASGG-R---------------WSGGHDISG
I4YGQ8_WALMC/41-264-----HLECYPQPL-----------------------------NSADTSAPLKAAK---------------WVGGHDVSG
G2XPX9_BOTF4/55-288-----GVAC----------------------------------------KAVGG-K---------------WKGGHDISG
G3AEN0_SPAPN/55-285-----SYNC----------------------------------------KRIKGSS---------------WEGGHDPSG
C7Z7P3_NECH7/60-283-----SVAC----------------------------------------KAAGG-K---------------WKGGHDISG
SCS3_YEAST/33-370GPLTTSAQC----------------------------------------RRFGG-H---------------WAGGHDPSG
G3YDY9_ASPNA/76-295-----AAAC----------------------------------------KHAGG-A---------------WKGGHDVSG
L8FY78_PSED2/112-347-----PMAC----------------------------------------KANGG-K---------------WSGGHDISG
A7TR39_VANPO/62-394LVDMVSSNC----------------------------------------RAHGG-H---------------WVGGHDPSG
N1JKB0_BLUG1/90-317-----AATC----------------------------------------KAAGG-K---------------WKGGHDISG
B6Q6E7_TALMQ/81-304-----AAAC----------------------------------------KASGG-L---------------WRGGHDVSG
B8M5R8_TALSN/84-316-----AAAC----------------------------------------KASGG-L---------------WKGGHDVSG
C8V5A4_EMENI/56-278-----ATAC----------------------------------------KAAGG-A---------------WRGGHDVSG
Q6CKM7_KLULA/25-334KLVKSSAGC----------------------------------------SYAGG-H---------------WVGGHDPSG
Q75EB2_ASHGO/35-359SAIRSSHAC----------------------------------------SRLGG-H---------------WMGGHDPSG
M7SYX4_EUTLA/110-375-----AAAC----------------------------------------RAAGG-R---------------WSGGHDISG
E9CZW5_COCPS/67-291-----AMAC----------------------------------------KMVNG-A---------------WNGGHDVSG
F0XPI2_GROCL/81-317-----ASMC----------------------------------------KRAGG-R---------------WSGGHDISG
A7UX33_NEUCR/112-389-----AAAC----------------------------------------KAAGG-K---------------WQGGHDISG
J3NLN2_GAET3/91-336-----AAAC----------------------------------------RTAGG-R---------------WRGGHDISG
A7EQ03_SCLS1/55-288-----GVAC----------------------------------------KAVGG-K---------------WRGGHDISG
G9NCA4_HYPVG/72-300-----AVAC----------------------------------------KAAGG-K---------------WKGGHDISG

PF01569

A4I568_LEIIN/102-249HA---QFMAGFSVYLLR----RWTRARRNRTERRKYSH---LQQRKAA-SASAALA--RTSSPYALV-------------
DOPP1_DICDI/54-178HS---QFMFFFAVLMTL----FYLKKRIRFGS---------------K-I--------------LPI-------------
Q17D95_AEDAE/56-197HL---MTSTTYLYVIFS----VLEEAGMQYG----------------K-M--------------VVV-------------
G6PC3_MOUSE/53-195HC---MITGAALWPVMT----AISSQVASRSR---------------S-P-------------WVRV-------------
A0BM37_PARTE/91-226HA---MSSQAMCFLLPS----ILFPAIWKDQPN-------------CK-YP-----------LYLRV-------------
Q23FV4_TETTS/102-237HG---VNNLVMVYVSHY----IADNDCFKMLIKG-----------ENG-KYK---------LHQRRF-------------
A0EE96_PARTE/81-240HS---LRSFVFYTILIE----TIVLKKYNIQENCSLIQSDKQALDEKEISNSELYKQIYSNQYISYS-------------
A8FE89_BACP2/71-198HS---MNAATIYPFIAY----LLVEMIPWLK----------------E----------------RQK-------------
Q7MUE1_PORGI/58-185HT---TNYISLALFTSR----IFRNKFYT---------------------------------------------------
A0K0K5_ARTS2/118-241HV---LGACDFLLVTTF----LIFSRRQSTW---------------------------------PAV-------------
A4XP73_PSEMY/98-234HA---SVLLIWALFMSF----FARNWRLL---------------------------------------------------
A4X1H8_SALTO/101-242HV---VNTIVWYGVIVL----LLARLLETYGR---------------T-L--------------PPR-------------
Q9EWX3_STRCO/115-237HT---ANAVVTWGILAY----LASTHRTR-------------------------------------R-------------
A1BJZ6_CHLPD/56-185HA---ANAAAVAATIWI----YFYRNGSIV-----------------------------------DK-------------
A4FQA0_SACEN/76-196HS---AIAAASAVALAF----AWRRLAVA---------------------------------------------------
B0U8C7_METS4/61-186SS---AYAFALSTAIWY----ASRSLGSF---------------------------------------------------
A1S1V4_SHEAM/77-196HT---GTVFVIAGMAWT----LCRRTDIK---------------------------------------------------
A1W5E3_ACISJ/72-191HS---TYAALVAGALWP----LTGVRHRL---------------------------------------------------
A5CF96_ORITB/78-203HT---GITFFIVACLWH----KLNRIGKF---------------------------------------------------
B4U5Z7_HYDS0/54-171DT---AMAFVIAMVGSY----NEKPLVKA---------------------------------------------------
A5DBA1_PICGU/102-232HS---ANATAVSLVLFS----RLYDSRDQFT----------------P-I--------------KFV-------------
Q4D544_TRYCC/102-225HA---SHSVLFSYCAYN----LLVFLFPTY-----------------------------------TV-------------
SSPA_DICDI/88-218HT---ASAFGLTFYFLI----YTYFLFPTIGE--------------SF-N-------------ISLL-------------
Q32GQ5_SHIDS/77-232HT---MFAASWALLAVG----LLWPRRRT---------------------------------------------------
Q9CMX4_PASMU/75-237HT---IFAATWLMLVVG----FVHLLSVRSL---------------------------------TAK-------------
Q21JU9_SACD2/110-231HS---LTAFLAATLFFH----YLNSVKMR---------------------------------------------------
Q0K1U6_CUPNH/103-229HS---AIGWAWALILAE----VEPERAND---------------------------------------------------
Q65GX3_BACLD/179-304HT---NAAYLSAFAMAY----AIPERYQE---------------------------------------------------
Q2IJN8_ANADE/141-265HT---STAVAALTAASW----TYTLRRGPA------------------------------------A-------------
Q6FEM9_ACIAD/65-182HT---LHAVMATITLGY----VQPILVVL---------------------------------------------------
A1K7H5_AZOSB/105-237HA---SAGFYLVSLGFL----GGAAARRR---------------------------------------------------
Q6MBQ7_PARUW/87-223HC---SVGFYFFSFLWL----GKHYRSYFL-----------------------------------YI-------------
A8EX54_ARCB4/94-229HA---SMGFSLMALFFL----FKKPRNQK---------------------------------------------------
Q87X15_PSESM/102-231HA---ATGFTLFALFFM----LRDRRPRLA------------------------------------K-------------
A8BDI5_GIAIC/110-282HTMFMASALFPLPILTY----LLAQMYIKVVDSERTP----STSGQGR-LKYMLW---LVFFYLGVA-------------
A8BQZ4_GIAIC/121-285HT---AAAAYCILPSVA----YIIQLFELIRAYWAP-------RLLGL-TILSI------VMGLLLT-------------
Q6MTZ1_MYCMS/144-270HT---YSATTLLFVLLL----FNKINKKA-------------------------------------Y-------------
R5TP42_9FIRM/95-216HV---FNSLAACIAIAQ----SEQLKKHP---------------------------------------------------
A3LWS4_PICST/248-396HA---CTSSLVFFFVCY----YSRTSIFK---------------------------------------------------
Q127S7_POLSJ/95-224HV---ATAFFSGFWLHH----LMRQFRAP-------------------------------------L-------------
A4CJ32_ROBBH/299-448HS---VVSGAAATALTS----IFGDNFAFDDDT-------------EL-PY------------GLPV-------------
Q2HER5_CHAGB/260-418HS---TFGGAAAAVLRA----WNGGKDKIAGTGVT---------VSSN-VTLD--------ARGVIT-------------
A8L0R7_FRASN/276-428HT---CFTTASMSTLAF----FFGRDDIPFSA--------------YS-AD------------SGTT-------------
Q6NJR5_CORDI/194-319HT---AFVTASVITLYL----IAKTAQHQLW----------------------------------RS-------------
A1SKJ7_NOCSJ/98-218HL---GTAVAVYCGIAL----LLAWVAPRT------------------------------------R-------------
Q82Z33_ENTFA/85-204HS---LLAMALVCTILI----ILTYLHVEK-----------------------------------TK-------------
A2DYB5_TRIVA/98-241HS---QTAMSGFVIIAF----FVQRIIKSKN----------------L----------------VGT-------------
A2EZZ9_TRIVA/91-236HS---CTAASGALFFSL----SLISIIDHNR----------------V----------------WSI-------------
A4H9E7_LEIBR/233-378HS---SAGFSAFVPLCF----YVLHSLHAFRR--------------SG-VS------------LWRI-------------
Q6BYN9_DEBHA/112-272HS---STVFCGMVITSL----NFAGKLQIFDK--------------RG-I-------------SFKV-------------
A7EIU4_SCLS1/134-294HS---TAAFAGFVFLSL----YLNAKLKVWSN--------------YH-PA------------MWKL-------------
A7TF94_VANPO/122-266HS---SFISSGMGFIFL----WQCYFVNGN------------------------------------K-------------
Q2TYI3_ASPOR/35-224HS---SFAWAGLLYLSL----WLCAKFAIIPPSHRTGH--SALTRNGP-PAYPLTS-RPAAPPLYLL-------------
A2EQG2_TRIVA/90-230EA---AEAMAAAIFLCL----YIGELIPYYN----------------N----------------VTS-------------
PLPR5_MOUSE/122-275EA---ALSVYAATYLTM----YITSTIKAKGT---------------R-L--------------AKP-------------
Q9VNU2_DROME/65-225HS---SLSFYSMVLLAL----YVHGVWRGRGG---------------V-R-------------VLRH-------------
A8WXP5_CAEBR/128-286HT---AAAFHVFLFVYI----YLRRMATNTGI--------------KE-II------------TVRN-------------
A6X217_OCHA4/121-242HS---MMAGIMMVSLWI----FLPRWRVL---------------------------------------------------
Q5NGF4_FRATT/116-236HS---ITVGAMFIAFFY----IFPKLRYF---------------------------------------------------
Q5ZX13_LEGPH/91-208HS---ITITALAAGLGF----LFPRYFFL---------------------------------------------------
Q6MH55_BDEBA/105-226HS---QVIFTVATMLSV----AFPRFKWF---------------------------------------------------
Q7NZZ5_CHRVO/815-932HT---AILFATVTPFAK----EYDQPWLY---------------------------------------------------
Q89JR9_BRADU/79-199HA---LHMGALASAAGA----MPAGPRRA---------------------------------------------------
B7VND8_VIBA3/235-351LA---GLWVSLTLLVFW----KLKRLLEQ---------------------------------------------------
Q5E4L0_ALIF1/241-366HS---MLSVVIYGTFYL----ILKRLSLPEK---------------------------------ILK-------------
Q9RVR6_DEIRA/14-135HA---QMSATLWLGIAA----QVRRPAFT---------------------------------------------------

PF14378

Q5K8D7_CRYNJ/128-311HF---GYSFVIGLSLFL----YSPHR--P---------------------------------------------------
B0UG28_METS4/124-315HV---SLALITAWA-------LAPVP--G---------------------------------------------------
A1SJR6_NOCSJ/50-230HA---GWDLLVGLAIAT----AATTL--A---------------------------------------------------
E4NIW3_KITSK/45-228HV---GWALWCAYAAWS----ALRPARPR---------------------------------------------------
G8WRV6_STREN/158-347HV---GWALWCGVMLWR----YAENR--V---------------------------------------------------
C7QD07_CATAD/71-251HV---IWAVLVGWTVWR----VSPSK------------------------------------------------------
Q2G5H1_NOVAD/115-305HA---ASAILLGWASLS----WLWVR------------------------------------------------------
Q1IHV8_KORVE/153-330HF---AWVLLAYWNSRD----TKAAI------------------------------------------------------
F2R3P1_STRVP/39-228HV---GWALWCGVMLWR----YGRTP--A---------------------------------------------------
A9HHP2_GLUDA/131-314HA---VMAFLFTYS-------QRGIR--G---------------------------------------------------
Q13PQ7_PARXL/110-293HT---ILALCFAYA-------LRHAG--Y---------------------------------------------------
Q63V72_BURPS/125-308HT---VLGVLFAYA-------LRRGR--V---------------------------------------------------
Q01VD1_SOLUE/159-330HF---GGSLMLFWMARP----WRSLR------------------------------------------------------
D1CA82_SPHTD/53-235HV---AFALFCGIGVIR----VGRKL--A---------------------------------------------------
K0K1I4_SACES/40-223HV---AWTTWCAYALWT----TLRDHAPR---------------------------------------------------
D1C524_SPHTD/53-234HV---AFALFVALGVIR----LSRSR------------------------------------------------------
W5TLL4_9NOCA/53-242HV---GWALWCGLMLYR----FGRTE--L---------------------------------------------------
Q2JBQ4_FRACC/47-236HC---AWSLWCGFLLVR----FGRRP--L---------------------------------------------------
W0BEC4_9GAMM/94-276HA---IWAWFCLYL-------LRPWP--I---------------------------------------------------
Q220L9_RHOFT/109-292HT---VMAVLLVYA-------MRGTG--I---------------------------------------------------
Q87M50_VIBPA/146-355HV---SIAVLMALCTYR----LNKTL------------------------------------------------------
B1LSY3_METRJ/129-320HV---CLALLTAWA-------LAPVP--L---------------------------------------------------
A2BL06_HYPBU/51-224HV---GMAVIFGYYYVK----LYGGS-RR---------------------------------------------------
L0PFU2_PNEJ8/5-201HA---GHAMLEALFLSH----IFPKT------------------------------------------------------
C9Z2S2_STRSW/63-253HV---GWALWCGVILWR----LGSGS-RL---------------------------------------------------
E3JAH2_FRAIE/94-282HC---AWALWCGFLIAR----HARRP--V---------------------------------------------------
F8AWV4_9ACTN/47-236HC---AWALWCGWNIAR----LARHR--V---------------------------------------------------
R7Y200_9ACTN/124-318HV---AITLLVALMVQY----TLRNR--L---------------------------------------------------
A0LS47_ACIC1/69-252HV---AWAAWVLAVLAR----LHMSR--W---------------------------------------------------
E2Q4K3_STRCL/45-234HV---GWALWCGVIMWK----YGRGP--V---------------------------------------------------
F8J559_HYPSM/123-309HA---VVAVLLAYG-------WMAVP--I---------------------------------------------------
L0ET54_LIBCB/102-293HA---AVATLCIWA-------AWPLK--F---------------------------------------------------
Q89QL0_BRADU/109-300HA---ALGLLFLLA-------LWPVR--Y---------------------------------------------------
H0PVV4_9RHOO/74-256HA---AMAIIFMYV-------HRGQR--V---------------------------------------------------
E3EJC2_PAEPS/1-162HA---LGAFALAAILWL----HHQKY------------------------------------------------------
A1SDU3_NOCSJ/130-324HV---AITLLVALMIQY----TVRSR--A---------------------------------------------------
C7QBQ6_CATAD/84-272HI---GWSTWCALVIAH----LAQRR--W---------------------------------------------------
A1SHK3_NOCSJ/128-322HV---GFTCTVLLVARY----YRWRR------------------------------------------------------
E3J0M0_FRAIE/110-299HC---AWALWCGLLIAR----HARWL--W---------------------------------------------------
C8XDB0_NAKMY/22-205HV---GWSALCAYTAWL----ALRDKHPR---------------------------------------------------
G7XGU5_ASPKW/117-299HF---GNSMFIALCLLK----FSPHW--Y---------------------------------------------------
B1LVV6_METRJ/99-290HA---ALGGLYIWAFWS----LRAAR------------------------------------------------------
Q5ZV46_LEGPH/101-283HT---IWAVLCVYL-------IKDWF--I---------------------------------------------------

PF14360

F6UTK5_XENTR/282-355HT---VMLTLTYMFIKE----YSSPRLW----------------------------------------------------
SMSR2_CAEEL/192-265HT---LTIFTAFLVFKT----YAPQRLQ----------------------------------------------------
SLS2_TRYB2/201-275HT---VILTLHLMFHWI----YGAMVHW----------------------------------------------------
B8C480_THAPS/431-503HT---IYTMSFVCVVFK----YFNFKS-----------------------------------------------------
IPCS3_ARATH/172-244HT---IFTLVFVRTYQR----YGTRRW-----------------------------------------------------
SAMD8_HUMAN/292-365HT---VVLTMLNFFVTE----YTPRSWN----------------------------------------------------
A2DHW8_TRIVA/46-124HT---MFMWQSSRWIME----TTSRMLPT---------------------------------L-GST-------------
SLS_LEIMA/211-286HT---MILSLAFILAWD----YSPFLHP--------------------------------------W-------------
A5K283_PLAVS/202-273HS---FSTTIFLLFALF----YVNSVV-----------------------------------------------------
A0A509ASM8_PLABA/201-272HS---FTSTIFLLFIFC----YMDNVV-----------------------------------------------------
A0A384LQJ1_PLAKH/276-347HT---AFTTVLKFFWMF----YEKKIY-----------------------------------------------------
Q28DN3_XENTR/220-293HT---VILTLTYLFIKE----YSPRHFW----------------------------------------------------
Q4N3L0_THEPA/182-253HV---YFVILAFIILSQ----NSGFL------------------------------------------------------
A8XDY1_CAEBR/127-200HT---LVMVTCSLAVAY----YLPKSIK----------------------------------------------------
IPCS_ORYSJ/172-244HM---IFTLVFVRTYHK----YGSKRL-----------------------------------------------------
SMSR1_CAEEL/321-394HT---TVITMISHFITE----YTPADWT----------------------------------------------------
SMS2_CAEEL/201-274HT---VVLTIMYFVQLQ----YTPRGLV----------------------------------------------------
A8X0T5_CAEBR/264-337HT---LVLVVSALFIGE----YSPRRFY----------------------------------------------------
A9S9I4_PHYPA/275-346HM---YVAVLTAMAWQE----AYPGW------------------------------------------------------
B3SD02_TRIAD/279-352HT---VAVTLSNFFITE----YTPDSWH----------------------------------------------------
A2DN61_TRIVA/170-240HT---MGFMFPGLIHHR----FFNKK------------------------------------------------------
B5YLZ6_THAPS/422-494HA---TVTSTLGCASTS----VASNTR-----------------------------------------------------
C6KT87_PLAF7/201-272HS---FSTTIFLMFSFY----YINNVI-----------------------------------------------------
D0MWV3_PHYIT/192-264HT---IYTVSFILTVWK----YWPNKY-----------------------------------------------------
B7FUU7_PHATC/326-397HA---TVTSTLACVAVS----AHPSKV-----------------------------------------------------
SLS11_TRYCC/193-267HT---VSITLSLLVQWI----YGSMLHW----------------------------------------------------
D2VDJ4_NAEGR/246-319HM---SMITILNYTINE----YTPKHWK----------------------------------------------------
D2VXN5_NAEGR/191-270HA---TALILVFWFVWY----YSHSDRWS---------------------------------KAVRM-------------
D2VKR1_NAEGR/196-272HA---TSLSVVCWFVWY----YSNKEWVG------------------------------------RI-------------
B9HC73_POPTR/172-244HM---IFTLVFVLTYQK----CGTKRC-----------------------------------------------------
C6KT86_PLAF7/265-336HT---AFTTLLTFFWFF----YERNIY-----------------------------------------------------
C4LV27_ENTHI/184-261HT---ANLTLCAFIWEY----YSEKVPFF---------------------------------N--PL-------------
A2FIE9_TRIVA/168-238HT---MGFIFPGLIHHH----FIGKI------------------------------------------------------
B7QHG5_IXOSC/233-306HT---VILTLAYLVVRE----YSPQRCK----------------------------------------------------
D0NII4_PHYIT/164-244HI---ANTNSAVLLYLR----TLARNFAG---------------------------------RTASK-------------
A7ANZ4_BABBO/239-311HT---AGSISIMLMFVL----HNRQWY-----------------------------------------------------
A0JMN0_DANRE/269-342HT---VMLTLTYLFIKE----YSPRRFW----------------------------------------------------
C3XQA8_BRAFL/273-346HT---VILTITYLFIKE----YSPRGWF----------------------------------------------------
F8W5G6_DANRE/232-307HT---VMLTLTFLFIYE----YSPRSRLW-------------------------------------T-------------
H3CAZ2_TETNG/175-248HT---VMLTLSYLFIKE----YSPPWMW----------------------------------------------------
Q4U956_THEAN/200-270HT---MFTVITCILFVE----NAKYLI-----------------------------------------------------

PF02681

F2NNY3_MARHT/5-141HS---ATVAAAVVGVGL----TEGWGSPL---------------------------------------------------
K9T6M6_9CYAN/8-143HS---ALVGSLATGVGL----TAGWSSPE---------------------------------------------------
D4ZTL8_ARTPN/8-143HS---AFVGALAASVGQ----VIGWGSPE---------------------------------------------------
K9WGM7_9CYAN/8-143HS---AFVAALAAGVGQ----TMGWDSPD---------------------------------------------------
B7GI74_ANOFW/24-164HS---AGVASLATYVAL----KRGVHSID---------------------------------------------------
B1WS33_CROS5/8-143HS---ALVGALATGVGL----TRGWESPE---------------------------------------------------
R5AEV3_9CLOT/9-146HA---ATVCALSVSALL----HYGVGSPV---------------------------------------------------
Q31Q62_SYNE7/9-145HS---ALVAALATAVGR----QQGWGSLE---------------------------------------------------
R5XG63_9CLOT/5-137HS---SFVTCLSMLVGF----DRGFASTE---------------------------------------------------
R7A3L4_9FIRM/8-144HS---STVTALSMAVGI----QEGFDSTL---------------------------------------------------
W0E929_9FIRM/8-143HA---ATVCALSVGIGK----YYGWDSPI---------------------------------------------------
D3FYY4_ALKPO/4-149HS---AAVTALSTAVAI----EHGMDSTI---------------------------------------------------
F0RVM2_SPHGB/6-143HT---AGVIALVTSIAL----TQGIGTVY---------------------------------------------------
H6NB79_9BACL/2-142HS---AAVVSLATYVGL----KKGFASIP---------------------------------------------------
Q7V6P1_PROMM/15-147HS---ALVTGTAAGVGW----EMGFDHSG---------------------------------------------------
Q18B69_CLOD6/8-140HS---SFVTSLATVVGI----EKGFNSTD---------------------------------------------------
G0GF41_SPITZ/9-149HS---ALVTALATSIGF----HDGADSSL---------------------------------------------------
Q65FE5_BACLD/4-149HS---AAVTALSTGVAL----DHGMDSSL---------------------------------------------------
U5LF62_9BACI/2-142HS---AGVSSLTTFIAL----KRGLPTID---------------------------------------------------
R7L0C2_9FIRM/5-149HS---AMVCSAAAGVYR----VDGANSTQ---------------------------------------------------
Q5WDV5_BACSK/4-146HS---AAVTALSTAVAI----EHGLDSSL---------------------------------------------------
D6GSF2_FILAD/8-144HS---SFVIGLANSVGL----TEGYDSTI---------------------------------------------------
E6U5K5_ETHHY/8-143HS---AMVCALFVGVLR----RCGAASPE---------------------------------------------------
Q5SJ95_THET8/4-140HS---ATVSALAVSVGL----REGFDTSL---------------------------------------------------
Q9RSQ8_DEIRA/8-143HS---AMVSALSTGIGL----TEGWDTPL---------------------------------------------------
P73185_SYNY3/8-143HS---ALVGALATGVGL----QKGWGSNE---------------------------------------------------
D1AKQ0_SEBTE/7-143HA---STVVALATSLAL----LKGMRSVE---------------------------------------------------
E0RXA3_BUTPB/8-144HS---ATVMALVTSAFY----YFGAGSFE---------------------------------------------------
F5YE41_TREAZ/16-155HA---AVVCSMATAVGV----YDGIGSNL---------------------------------------------------
V5WEJ9_9SPIO/6-144HS---ALVTALAVSTGI----LEGINTTL---------------------------------------------------
U5LHE7_9BACI/5-149HS---AAVTALSTGVAL----ETGMDSAV---------------------------------------------------
K9XWG4_STAC7/8-143HS---ALVGALATSIGK----TMGWSSPE---------------------------------------------------
E6U2C7_BACCJ/4-149HS---GAVTALSTAIAL----EEGVGSPL---------------------------------------------------
K9V3M2_9CYAN/8-143HS---ALVTALAAGVGQ----TIGWSSPD---------------------------------------------------
B9IAH9_POPTR/38-171HS---ATVTALAVAVGL----QEGTGSPA---------------------------------------------------
M0RZC5_MUSAM/20-155HS---ATVAALAMAIAL----EEGTGGSS---------------------------------------------------
R5ZD30_9FIRM/8-146HS---STVTGLAMAIGM----QEGFNSAL---------------------------------------------------
R6Q3Q8_9FIRM/8-138HS---SLVMALTTSVGK----YNGFDSAL---------------------------------------------------
C0ZKP9_BREBN/5-150HS---SAVTALSTAVGL----REGFGSNM---------------------------------------------------
D8TLE7_VOLCA/33-168HT---ALIIALTTAVAV----QDGTDSSL---------------------------------------------------
R6SRI1_9FIRM/7-157HS---ATVCATAITTCR----VCGICSPE---------------------------------------------------
K9YEC7_HALP7/8-143HS---ALVASLATGVGI----REGWESTD---------------------------------------------------
K3XML5_SETIT/24-159HS---ATVTALAVAIGF----QDGFNCSL---------------------------------------------------
K9RII7_9CYAN/8-143HS---ALVTALAAGVGQ----TIGWASPE---------------------------------------------------
K4LIZ6_THEPS/40-169HA---AVSAALATSLGL----DYGWTSPI---------------------------------------------------
E6TWS5_BACCJ/5-142HS---AGVASLATYIGL----RLGGRTLD---------------------------------------------------
Q73MW8_TREDE/10-150HS---ALVASLTVSIGI----RQGFDSDL---------------------------------------------------
Q8Y4P9_LISMO/4-149HS---AAVTALMTTLAI----EYGLDSPY---------------------------------------------------
M0SK26_MUSAM/139-272HS---ALCTALTASVAL----CHGVSDSL---------------------------------------------------
G4KW10_OSCVS/4-137HS---ATVTAMAVTAGM----ECGLNSSV---------------------------------------------------
R5CL70_9FIRM/8-147HS---ATVCALVVSTAV----VYGPSGFE---------------------------------------------------
I0I5M8_CALAS/5-139HS---ALVCSLVTAIGY----QYGLDSGL---------------------------------------------------
D7CKU8_SYNLT/12-144HS---AMVVALVAGIGF----TLGYNSDE---------------------------------------------------
R7IRJ9_9CLOT/8-142HS---AIAMCIATMIGK----AEGFDSNI---------------------------------------------------
B8HXR8_CYAP4/8-143HS---ALVAALATGVGQ----TKGWGGTE---------------------------------------------------
B0C3J0_ACAM1/8-143HS---ASVTTLATCVGQ----VQGWDSTE---------------------------------------------------
I4DAH9_DESAJ/3-144HT---ALMVGLTTGCLF----EYGWGDPY---------------------------------------------------
Q46K07_PROMT/15-148HS---ALVTGTAAGIGL----QLGFNDPV---------------------------------------------------
R7A3G1_9CLOT/8-142HS---AVVTCLATLIGK----SEGVDSIM---------------------------------------------------
Q24V03_DESHY/8-143HS---ATVSALAIGVGK----YYGWSSPT---------------------------------------------------
Q10X44_TRIEI/8-143HS---AFVAALAVGVAQ----TKGWGSPE---------------------------------------------------
A4RZ57_OSTLU/3-142HS---AFVTALAAGVGA----QWGYDSGS---------------------------------------------------
D8QR56_SELML/24-159HS---ATVIGLTVAIGL----RDGTGGSL---------------------------------------------------
A0A3Q7ELN9_SOLLC/140-274HS---ALCTALTTSVAI----CHGVADSL---------------------------------------------------
Q8ENX8_OCEIH/4-149HS---AAVTALTTAIGI----TEGVTSSV---------------------------------------------------
K7V114_MAIZE/48-182LS---ATVGSLAVAVGQ----QEGADSSA---------------------------------------------------
Q01ES7_OSTTA/128-261HT---SLVVGLTTSIVH----QHGLGSVY---------------------------------------------------
E3HA83_ILYPC/7-143HS---STATSLATSIAI----VEGMSSSY---------------------------------------------------
A6TR41_ALKMQ/8-144HS---SFVMGLTTAIGL----DKGFDSAI---------------------------------------------------
I1KRZ5_SOYBN/9-144HS---ATVTALAAAIGL----QEGFGGPL---------------------------------------------------
R5KDM7_9CLOT/8-150HS---ATVGGLATVAFL----QFGPDSFE---------------------------------------------------
R7I9S8_9FIRM/10-145HT---AFVVSLTLMIGA----TQGFDSAI---------------------------------------------------
R6BY11_9CLOT/8-144HS---ATVCALATSTCI----YYGAQSFE---------------------------------------------------
R5ITD2_9FIRM/8-144HS---ATVCAVATSAGI----IYGLDSFP---------------------------------------------------
K9RQD3_SYNP3/8-143HS---ALVTALATGVGL----EKGWESVE---------------------------------------------------
K9SVF9_9SYNE/8-143HS---AVVTALATGIGK----TQGWNSGL---------------------------------------------------
Q7VBG6_PROMA/16-148HS---ALVMGTASGIGL----EQGFDHPA---------------------------------------------------
O83188_TREPA/14-153HS---ALVSALTLSFAL----KCGLHSDL---------------------------------------------------
G8QY16_SPHPG/6-143HT---AGVIALLTGIGM----TEGIGTVD---------------------------------------------------
D3EMZ3_ATETH/8-144HS---ALVGSLATSIGL----TEGWESSE---------------------------------------------------
M0SG02_MUSAM/22-157HS---ATVTALAVAIGI----QDGLGSSA---------------------------------------------------
F5YMS6_TREPZ/16-155HA---SMVSAMTTSIAI----IEGVRSNL---------------------------------------------------
R7R6N9_9FIRM/8-144HS---ATVCALSTAAGI----QYGLDSFQ---------------------------------------------------
C7NE60_LEPBD/7-143HA---STVVSLVTGVFL----LKGLSSIE---------------------------------------------------
R5IDQ6_9CLOT/2-138HS---ATVCGLTTAAAL----KYGAGSFE---------------------------------------------------
D9R8M4_CLOSW/8-144HS---STVCALTTAAIY----RYGVGSFE---------------------------------------------------
D7BAF5_MEISD/5-141HA---ATVSALATGVGI----TEGWGSAY---------------------------------------------------
F8F1T7_TRECH/16-155HS---SLVTALATSVAF----KEGIGSTL---------------------------------------------------
Q93ZZ7_ARATH/51-205HS---SSVVAAATAIAF----ERGFADSI---------------------------------------------------
D8U4F3_VOLCA/38-173HS---SLCAGITTAIAI----QQGFGSPL---------------------------------------------------
J7IS94_DESMD/8-142HS---AMVSALALGVGK----YHGWDSPI---------------------------------------------------
F9VBI0_LACGL/8-142HS---ALVVSMTTATGL----SQGFDSAV---------------------------------------------------
K9W0K1_9CYAN/16-151HS---ALVTALATGVGQ----AIGWSSPD---------------------------------------------------
A9NHX4_ACHLI/6-144HS---ALVTALFVSIGMFDYHNQGTLSIG---------------------------------------------------
D1AXZ8_STRM9/7-141HS---SSTVSLCFSVGI----VKGFSTTE---------------------------------------------------
K9UG93_CHAP6/16-151HS---ALVTALAAGVGE----VLGWKSPE---------------------------------------------------
F4LN44_TREBD/13-152HS---ALMCTLCTSIGF----RSGIDSDI---------------------------------------------------
R6NRL3_9CLOT/2-140HT---ATVIALSGCVGM----HSGWDSDV---------------------------------------------------
K0IWZ6_AMPXN/4-149HS---AAVAAVTTGIGI----EHGLSSGI---------------------------------------------------
W8TJV6_PEPAC/8-150HS---SFVTSLATAIGI----VEGYDSVL---------------------------------------------------
A8MFI8_ALKOO/8-144HA---SFVMGLSTAVGL----KHGWDSTY---------------------------------------------------
H9UHZ5_SPIAZ/13-152HS---SMVTSLALSTGL----TYGFNTGL---------------------------------------------------
B8CY18_HALOH/3-134HA---SFVSTLSTTVGL----NYGFDSDL---------------------------------------------------
B2A528_NATTJ/7-141HS---SFVVGLTGALGF----DLGWGAPI---------------------------------------------------
R6ME09_9FIRM/8-142HS---SFVMALTMSIGF----TQGFDSVA---------------------------------------------------
F2NS18_TRES6/11-151HS---ALVATLCTTIGF----RSGVNSDV---------------------------------------------------
R5PNP2_9CLOT/8-138HT---AIVVSITTMVGR----SQGINSVI---------------------------------------------------
Q1J0I2_DEIGD/9-145HS---AMVAALTTGVAL----TQGMGSPL---------------------------------------------------
R5MBG0_9CLOT/8-144HS---STVCALTTASAY----CYGFGSFE---------------------------------------------------
I4D8V5_DESAJ/8-142HS---ATVSALALGIGK----YYGWNSPI---------------------------------------------------
R7A673_9FIRM/8-144HS---ATVCALATATGM----ECGAGSSE---------------------------------------------------
R7FJ12_9CLOT/8-142HS---AIVVSLATLIGK----YQGVDTPI---------------------------------------------------
O51097_BORBU/6-146HS---STVTALSTSIAL----TEGIDTN----------------------------------------------------
K8GFC4_9CYAN/8-143HS---AFVTALASGVGQ----ALGWASPE---------------------------------------------------
M4CGY8_BRARP/134-268HS---ALCMALTTSVAL----CHGVADSL---------------------------------------------------
R6N1H2_9CLOT/6-146HS---AFVCSIAMGIGF----REGFASSF---------------------------------------------------
D3FSU1_ALKPO/2-142HS---AGVTALATYVAL----ERGVSSVD---------------------------------------------------
B9DG97_ARATH/20-155HS---ATVTALAVAIGL----QEGFGGSH---------------------------------------------------
Q9CGU3_LACLA/8-142HS---SLVVALATATGL----RQGFDSSL---------------------------------------------------
F2I5F0_AERUA/1-152HT---AAVTALITSLIL----QEGFLSPY---------------------------------------------------
R7N6H8_9FIRM/8-144HS---ATVCALATATGI----RYGGGSFE---------------------------------------------------
C1FDH6_MICCC/170-303HT---SLVVGLTTAIAY----QYGLGSTL---------------------------------------------------
R6SUP5_9CLOT/9-142HT---AAVVALLIACCI----KHGPASSY---------------------------------------------------
A5GM29_SYNPW/13-145HS---ALVTGTAAAVGW----LDGFDSPA---------------------------------------------------
Q2JKH6_SYNJB/6-142HA---ALVTALSVGVGM----QEGWDSLL---------------------------------------------------
F2JMF4_CELLD/8-142HS---AFVMSLAISAGQ----VWGYDSTY---------------------------------------------------
E6SHJ0_THEM7/12-146HA---ALAIALLTSVVS----LEGWTSPT---------------------------------------------------
K9S6R1_9CYAN/8-143HS---ALVTALATGVGL----SVGWASNE---------------------------------------------------
E3PRG0_ACESD/8-144HT---SFVTSLATAVGL----VSGYESSE---------------------------------------------------
R5N6N4_9CLOT/8-137HS---AIAVSLATMIGK----NVGWDTPI---------------------------------------------------
R5GZB8_9FIRM/8-144HS---ATVCALATAAGM----QYGGSSFE---------------------------------------------------
D5WTV2_KYRT2/8-146HA---AVVSALAVAMGL----SYGWNSPW---------------------------------------------------
R6PRB8_9FIRM/8-139HS---SFVTSLAASTGI----LYGFNSVY---------------------------------------------------
C1N1Q0_MICPC/8-144HS---ALVAALAAGTGC----QVGLADPG---------------------------------------------------
L0A6P8_DEIPD/5-141HT---AMVSALSTGIGL----TAGTGSPL---------------------------------------------------
A0A3R7BI20_9CLOT/5-142HS---STVTALTIAIGM----NEGFDSAL---------------------------------------------------
E3DMH7_HALPG/3-133HS---SFVASLTITVGL----KYGFNSDL---------------------------------------------------
E4U9L1_OCEP5/5-141HS---AMVTALATGVGF----VAGLDSVA---------------------------------------------------
E8N0A2_ANATU/6-140HS---ALIVSAMVAIGL----FEGFNTPL---------------------------------------------------
K9SNJ2_9CYAN/8-142HS---ALVAALAAGIGR----SQGWDTPA---------------------------------------------------
F0T097_SYNGF/8-149HT---AIVCALAISIGK----IYGWDTPS---------------------------------------------------
A8FH06_BACP2/4-149HS---AAVTALSTAVAL----EHGLNTSI---------------------------------------------------
I0JQ19_HALH3/6-151HS---AAVTALATGVGI----QQGFNSSI---------------------------------------------------
M4FCC5_BRARP/76-227HS---SSVVAAATAIAF----ERGFDDSI---------------------------------------------------
G8LW53_HUNCD/8-141HS---AFIVSLTTVVAK----IKGIDSVE---------------------------------------------------
C8WVG2_ALIAD/12-152HS---AGVVALASALWF----VVGPTSPI---------------------------------------------------
R5ADD7_9CLOT/7-149HS---AVCCSVVLTSYF----LYGFQSPV---------------------------------------------------
K3YAI4_SETIT/11-145HS---ATVTALAVAVGI----QEGFRSAT---------------------------------------------------
R7F8Q2_9CLOT/8-142HS---AVVVSLATLIGR----EHGLDSSI---------------------------------------------------
A3DDN6_HUNT2/8-143HS---SFIVSLATVVGK----MRGLDSVE---------------------------------------------------
K9Z2J9_CYAAP/8-142HS---ALVGALATGTGQ----ILGWSSPE---------------------------------------------------
K9P352_CYAGP/15-157HS---SLMTGTAAGLGW----ELGFADPL---------------------------------------------------
K9XC51_9CHRO/8-143HS---ALVTALATGIGQ----TAGWASTE---------------------------------------------------
R6Y7H0_9FIRM/7-149HS---AVCCSVVLTAYF----LYGFQSPA---------------------------------------------------
E1RAI3_SEDSS/5-141HS---AAVSCLAVSMGL----TQGFGSPF---------------------------------------------------
R5R4Q1_9FIRM/8-145HS---ATVCALAGTTFL----HCGPASPE---------------------------------------------------
B8E2Q0_DICTD/12-146HS---ALVVSLSLIIGI----KEGFNSTI---------------------------------------------------
K4KZ53_9FIRM/8-148HT---AIVCALAISIGK----TDGWESSL---------------------------------------------------
R6EV23_9FIRM/8-145HS---ATVCALVTATCY----EYGAGSFE---------------------------------------------------
D6Y193_BACIE/4-149HS---AAVTALATALGL----EQGFDSPF---------------------------------------------------
E7FY95_ERYRH/7-143HT---ALVIGLTLALGY----QSGFSSQY---------------------------------------------------
C4L0Z0_EXISA/3-131HS---STVVALATAIGR----MEGIDSSL---------------------------------------------------
D7GPW8_9FIRM/6-142HS---ATVCALTTASGM----KYGVGSFE---------------------------------------------------
D5E1E4_BACMQ/2-142HS---AGVSSLATYVAL----KRGVSTID---------------------------------------------------
A4J281_DESRM/9-144HS---AMVTALATASGL----QYGWSSSL---------------------------------------------------
I0JIT0_HALH3/2-142HS---AGVAALTTYIAA----NKGSRHPE---------------------------------------------------
E1Z6N1_CHLVA/1-136HT---GLVMGLTTAIGV----LEGTNSPM---------------------------------------------------
Q8DMU2_THEEB/9-144HS---ALVTALATGVGL----QRGWDSIE---------------------------------------------------
A4RUH5_OSTLU/12-147HT---ALVVGLCTSIGL----KEGMQSSI---------------------------------------------------
Q5L0A2_GEOKA/2-142HS---AGVSALATFIAL----ERGVRTID---------------------------------------------------
W1NTD9_AMBTC/34-169HA---ATVTALAIAIGL----REGAGSSM---------------------------------------------------
K8EPQ0_CARML/4-150HS---AGVTALITALIL----NYGWESPY---------------------------------------------------
C6CSF5_PAESJ/6-132HT---TVVTTPSMLIGL----SEGFNSPM---------------------------------------------------
G2TKM5_BACCO/4-146HT---SMVIALTTAIGL----TSGFGSNA---------------------------------------------------
K9TPQ7_9CYAN/8-143HS---ALVTALATGIGQ----TAGWNSTE---------------------------------------------------
N0B1X3_9BACI/2-142HS---AGVTSLTTYIAL----KRGFPTID---------------------------------------------------
V5WJH0_9SPIO/5-132HS---AFVSSLTTYVAL----AEGTSGPW---------------------------------------------------
C9RC18_AMMDK/8-140HS---AMVSALAVAVGL----CLGFDSAE---------------------------------------------------
L7VUG0_THES1/9-141HT---AFTVSLATILGI----HNGFTSDI---------------------------------------------------
R5J5K1_9FIRM/8-139HS---SFVTCLSTMLGV----KYGFNSDM---------------------------------------------------
C1E358_MICCC/7-142HT---ALVVGLTTSVGL----KESLDSSI---------------------------------------------------
R6B6R3_9CLOT/12-145HS---AVVVSITTMIAR----SQGFSSPL---------------------------------------------------
A5GRZ6_SYNR3/9-137HS---ALVTGTAACIGL----EQGFDAPL---------------------------------------------------
R7B1C9_9CLOT/8-144HS---STVCSLATAAAL----RYGVGSFE---------------------------------------------------

PF10261

Q5KDG2_CRYNJ/99-376HS---FLLTLCIMVLGR----ELAP---------TWRAWAGGKTAGLRYGRARGWK--SKVHGLIAL-------------
G2QCT9_MYCTT/113-344HV---FLLVLGSFFLMQ----EAGW---------VVAR--WA----------RWLG--EERSVVMHD--GAVKGALVE--
E3RV27_PYRTT/85-309HV---FLLILGSSLLWL----EFLP---------ALTRV-------------EGLR--DGRLITLPD--GKVASVAVE--
R7YND5_CONA1/92-324HV---FLLTLGSALLWF----EILP---------AVSRA-------------EGLR--DGRRVVMSD--GKVRTAASE--
G2XHJ1_VERDV/98-323HV---FLLVLASGFLLQ----EVGW---------AYLR--HR----------GV-R--EERAIVMND--GAVKSAGVE--
C4Y4H3_CLAL4/57-287HV---FLLVHSSLYMFH----EIKPFWP--GWKSLYRSIIRFT-----RNTNKDNVMAKSRALVVSN-------------
C5DQ74_ZYGRC/35-359HI---FLNTLMIMFLLG----ELD----------FFAPLAWSKL---SSKGLGPL-S--YFTTLLDN--SPL--RNLMQR
G8BYR0_TETPH/33-386HI---FLLTLMMMMIIA----ELP----------KINRIRKQNMIYQKDSKIRRVNIVEKISKIIGEIIGTIPSRSILSN
E3KJ35_PUCGT/96-348HV---FLLTFSILLIVS----SLSPSLIH-LWKTTTKKVNNNDNKEEEKDQQDETVPRNYRLAI----------------
N1RPR7_FUSC4/66-290HV---FLLTLGTAFLMQ----EVGW---------AVLR--WS----------GKRN--EERCVVMTD--GALKSANVE--
F9WXZ1_ZYMTI/84-317HV---FLLMLSSAMLWL----EFLP---------AVLRM-------------EGLT--DARRIRTSD--GAVRSAAVE--
G3BAX8_CANTC/92-323HV---FLLIHSSLYMFF----ETVPFWR--NWTHVRTTLGKLK---------QDLSVSDNRTITVGR-------------
G8BIE7_CANPC/69-321HV---FLMIHSSIYLYF----ETAAWFN---WTDVRGALYSIKQSLRDRRYLESHIWQLVYGIV----------------
C5FE12_ARTOC/64-296HA---FMLVLASAFLIF----EILG---------SKLS--------------TIISN-NGKSVGEGT--QGTMETQAGKG
G8ZXV3_TORDC/32-356HI---FLITLMIMYLLG----ELH----------IFGKRAFSRILREKNMSFKPF------IDLFDN--GAI--WNVLSK
A5DKF9_PICGU/56-288HV---FLLTHSSLYLFH----EILPYWD---WSRAQAAVTNFR-----------SHNGSVRELVLTL-------------
E3QPL9_COLGM/87-312HV---FLLVLGTGFLLS----EVGW---------VVMR--WR----------GSGR--EERSVVMTD--GAVKTATVG--
S3CVS7_OPHP1/100-357HV---FLLTLGTTFLAQ----EIGW---------VLWRKVAASTAT-----GARAV--DSRAIVMGD--GAVKSAEVE--
A3LYM5_PICST/59-299HV---FLLIHSSLYLFL----EVSPYWV--SYSHFKASLSKLR-----KEVVKPVSLGEKFSSFIKY-------------
G0WG33_NAUDC/40-380HI---FLLTLMVMFLSG----ELS----------TFAPRAFKVLFQRK----KIFHLVEYVTKLFDN--GLL--WDVAKM
M3IZX9_CANMX/56-283HV---FLMIHSSLYLFF----ETSSSFP--SLTVLKQNFNHFK---------RTTTLKEKLNVVWNT-------------
G3JBH7_CORMM/90-318HV---FLLTLGSALLMH----EVLW---------PLAR--WA----------GWYA--DERCVVMPD--GALKGANVE--
R9AQ78_WALI9/64-296HT---FLLMLSAYIIYL----TLKPCFAH-FSGADSISASARNEKAPLQKGASAVHRVAV--------------------
C5E2P1_LACTC/32-359HI---FLITLMCMFLLG----ELQ----------AIGKRAL-RVLKTHNKYWQQLRE--HGTSVLTL--GGL--WNLVAH
T0K1V0_COLGC/87-312HV---FLLVLGCGFLLS----EVGW---------VVLR--WK----------GARR--EERNVIMTD--GATKTATVE--
G8Y1H9_PICSO/62-313HV---FLLVHSSLYLFL----ETSQFWG--SWPSFFGSARNLCGKLRRVPADQSAEPKSKLAQVVDF-------------
C5G9K2_AJEDR/75-292HV---FMLVLTSAFLFC----ELQG--------------------------------------------ASVVEGELEEP
C5MI48_CANTT/55-284HV---FLMIHSSLYLYL----ETIDYFP--GFSNIKNNLKRLV---------RVNSFKEKLIILWNT-------------
N1Q4W5_DOTSN/87-323HV---FLLIVGSAMLWL----ELLP---------AVLRM-------------EGLR--EARRILTAD--GLVRKVTIE--
S3DE95_GLAL2/81-314HV---FLLVIGSMFLFE----EVLH---------VVLRS-------------QRVK--EERTVYMAD--GAIKSAEVE--
R9P3R6_PSEHS/103-383HT---FIMVLSSLLLLE----DVAPYLAA-LLGRSAIGRILFPN-KVTVDVARTRWDAKAYAAVGAS-------------
N1Q6I4_PSEFD/84-317HV---FLLILGSAMLWL----ELLP---------AVLRT-------------EGLR--EKRRVMGPD--GLTRSASFE--
K2R4W1_MACPH/94-328HV---FLLILGSLLLWL----EILP---------AVLRA-------------EGLR--DGRRIVMSD--GKTRTAGAE--
N1QNJ0_SPHMS/101-335HV---FLLILGSGMLWL----ELLP---------AVLYN-------------EGLR--EKRRIRTAD--GLVRSASIE--
F7WC52_SORMK/81-344HV---FLLVLGSAFLVQ----EVGW---------VVARHYWR----------RNVRNVDERTVVMHD--GAVKSAGTDLA
M2N8T6_BAUPA/89-327HV---FILILGSAMLWL----ELLP---------AVLKM-------------EGLR--EARRILTPD--GLVRSAAVE--
K9G927_PEND2/67-311HV---LMLVLATGLLVF----EAVG---------ASAP---------------------APACLSHS--GSTGDAGRERK
C4R337_KOMPG/57-293HV---FLLSISWIFLMI----ELTHSLAH-EVNIVQHHTNVFKRLLLTIRKRQFT----QALQVLGD-------------
A1CR84_ASPCL/74-313HV---FMLVLATSMLVF----EAFG---------AVRR---------------------GGFGARGG--EKKQDGDGDGE
A5E4A1_LODEL/62-350HV---FLMIHSSLYLYL----ECAAWFD---WKSLVRCVVYVYRKLQNYGGKSLVRGFEHNEKLFVG-------------
E5R3U3_ARTGP/64-297HA---FMLVLASAFLIF----EMLG---------SRSS--------------AIISNSNDCDAREPA--QRTTDKRVTNG
K1WMV9_MARBU/113-341HV---FLLVLGSMFLFE----EVFH---------VVLKS-------------RGAK--EERTIAMND--GAVKSAEVE--
G0VEA6_NAUCC/39-386HI---FLITLMTMFILG----ELQ----------FFIQDAMARLLHD----FNWVTILKQCGKLFDN--GLI--WNYIKL
Q6FR77_CANGA/32-368HI---FLLTLMILFLVG----ESK----------QFIVGAVMRVVDTRKYVMDKI-------KKICN--EPM--ANASVY
E9EF85_METAQ/84-313HV---FLLVLGTCFLAQ----EIGW---------AVSR--WS----------SRLA--EERCIILPD--GAVKSANIE--
M9LJJ3_PSEA3/95-341HT---FIMVLSSLLLLE----DIAPYLAA-LLNNSSIGRVVFGDAKVDHRAKAVMGEQKAKLAVAAS-------------
M1VZ69_CLAP2/82-312HV---FLLVLGISFLVQ----EIGW---------TVGR--WA----------SRSM--EERCVIMYD--GAVKGANVV--
V5GE99_BYSSN/78-302HI---FMLVLASAFLVF----EVWG---------ASKA---------------------ES-GTAVE--GSKAKQDSEEP
I2FTC6_USTH4/101-374HT---FIMVLSALLLLE----DIAPYLAALLGPDSPIVKSLLPQRTWLQAAARTNWTPAAKGAVAAT-------------
G8JR11_ERECY/38-363HV---FLITLMTMFLIG----ELR----------LFSDKVGRRLRSTSYTYFRMSFA--YVKELLNN--GLV--WNLIDD
Q6BUP0_DEBHA/108-353HV---FLLIHSSLYLFL----EALPFWI--SWATLKHHLCQFVKSWR-------STSGSKPKLLFGL-------------
Q4WJI3_ASPFU/73-304HV---FMLVLATSMLVF----EAVG---------ATRA---------------------VSVGAE-A--DKKVDGEVDGQ
G2R9R1_THETT/97-341HV---FLLVLGSFFLVQ----EVGW---------VVAR--WG----------RYLG--EERCVVMRD--GAVKGAAVE--
I4YGQ8_WALMC/41-264HT---FLLMLSAYVIFV----TLKPCYSH-LIRVNSVK----DEKAPLQSGLSILHKVAV--------------------
G2XPX9_BOTF4/55-288HV---FLLVLGSMFLFQ----EVLH---------VVLRS-------------SGIK--EERTIVMAD--GAVKSAEIE--
G3AEN0_SPAPN/55-285HV---FLLIHSSLYLFL----ETAEYWP--GWGALINSISSVV-----HNHEKTIIEKLKQLAILGV-------------
C7Z7P3_NECH7/60-283HV---FLLSLGTAFLFQ----EVGW---------AVGR--WL----------GQ-D--EERCVVMPD--GALKSANVE--
SCS3_YEAST/33-370HV---FLATLMCMFLLG----ELR----------VFGRRALAHLYAQKWQLVRLV------TRLFDT--GPLWTWRRCGG
G3YDY9_ASPNA/76-295HV---FLLVLATSLVVF----ELVG-------------------------------------GSHGW--GKGGGVNVNGS
L8FY78_PSED2/112-347HV---FLLVLGSMFLFQ----EVLH---------VALRA-------------AKGR--EERVVLLHN--GEIKGADSESG
A7TR39_VANPO/62-394HM---FILTLMIMLISS----EIPRI------IKFKYLRSNGRIEDESKKESSFKRICISITKLFDN--GAI--WNIINN
N1JKB0_BLUG1/90-317HV---FLLVLGTMFLLE----EVLS---------VTLARH------------------REDPTTKKD--CDANGGEINYK
B6Q6E7_TALMQ/81-304HV---FMLVLGSASLAL----EALG-------------------------------------TSPSSGSNTSESGQVHDK
B8M5R8_TALSN/84-316HV---FMLVLGSAFLAL----EVLG-------------------------------------TSQSVSNGTAENSQVHDK
C8V5A4_EMENI/56-278HV---FMLVLVTAVLGF----EALG---------VLAQ---------------------ESEAEKDA--GASANAK----
Q6CKM7_KLULA/25-334HI---FLITLMLMLMFG----ELS----------LYQSRAFRHLQNTYKRFLNRAGS--QLLQLLDN--SAL--ANLWIH
Q75EB2_ASHGO/35-359HV---FLITLMCMFMLG----ELQ----------VFGRRAIGKLSADCQQLQGAPGK--IVARILQA--SPI--RELI--
M7SYX4_EUTLA/110-375HV---FLLVLGSFFLLQ----EIGW---------VVLR--AGILSALDGARSRVRH--EERCVVMSD--GAVKGASVE--
E9CZW5_COCPS/67-291HA---FMLVLASAFLVF----ELLG---------STVS----------------VDEKNDAEDATDD--GARAEVPVNES
F0XPI2_GROCL/81-317HV---FLLVLGSTFLAQ----EVGW---------VLLRARGERGESQRGRDGRQPE--DDRTIVMAD--GAIKTAEVE--
A7UX33_NEUCR/112-389HV---FLLVLGSAFLVQ----EVGW---------VVARHYWR----------RSVR--DERTVVMGD--GAVKSAGTDLA
J3NLN2_GAET3/91-336HV---FLLVLGSFFLLQ----EAGW---------VAVRAWEGASGG------GGRR--DSRAVVMPD--GAVKGVDVE--
A7EQ03_SCLS1/55-288HV---FLLVLGSMFLFQ----EVLH---------VVLRS-------------SGIK--EERTIVMED--GAIKSADVE--
G9NCA4_HYPVG/72-300HV---FLLVLGTAFLMQ----EVGW---------PALR--FS----------GWLA--EERCIVVSD--GTVQSASVE--

PF01569

A4I568_LEIIN/102-249----------------------------------------------ALLLFATL---FIGVGRVYN--------------
DOPP1_DICDI/54-178----------------------------------------------ISVTFLFFLAAGVAYSRVHL--------------
Q17D95_AEDAE/56-197----------------------------------------------ALRACYYLSLLLIAVSRMYF--------------
G6PC3_MOUSE/53-195----------------------------------------------IPGLAYCTFLLAVGLSRVFL--------------
A0BM37_PARTE/91-226----------------------------------------------LFIFIITFWTFMTGFSRVFM--------------
Q23FV4_TETTS/102-237----------------------------------------------WVNLIGLVLCILIGWARVCL--------------
A0EE96_PARTE/81-240----------------------------------------------KYKFFIAIFAFLIGIGRLYF--------------
A8FE89_BACP2/71-198----------------------------------------------IVYLITGICVLMIGVSRMYI--------------
Q7MUE1_PORGI/58-185-------------------------------------------------WTIWSVVALVIYSRIYI--------------
A0K0K5_ARTS2/118-241----------------------------------------------AAFALAVFGIFLASISRLYL--------------
A4XP73_PSEMY/98-234--------------------------------------------------LVWAIAVIGMLPRLVA--------------
A4X1H8_SALTO/101-242----------------------------------------------MATAVRVVPPLVVLTTTTYL--------------
Q9EWX3_STRCO/115-237----------------------------------------------WLSAISAVTSLGVGMSTVYL--------------
A1BJZ6_CHLPD/56-185----------------------------------------------LFSLLIALYAFFVAYSRVYV--------------
A4FQA0_SACEN/76-196---------------------------------------------------AVLLALLEGFSRVYV--------------
B0U8C7_METS4/61-186--------------------------------------------------FYAWSIFVMCLPRIYA--------------
A1S1V4_SHEAM/77-196-------------------------------------------------TLILLLALMVGLSRITN--------------
A1W5E3_ACISJ/72-191--------------------------------------------------ALVAYVVLVGWSRIAA--------------
A5CF96_ORITB/78-203--------------------------------------------------AGVVLVIMVGISRLSL--------------
B4U5Z7_HYDS0/54-171--------------------------------------------------FFFSYAFLIMYERSYV--------------
A5DBA1_PICGU/102-232----------------------------------------------VLASILFIYYFSLIFGRLYC--------------
Q4D544_TRYCC/102-225----------------------------------------------ACTMACIFFTLNVSLSRLFL--------------
SSPA_DICDI/88-218----------------------------------------------SMFFIVLFWSTSVMFSRLYN--------------
Q32GQ5_SHIDS/77-232----------------------------------------------LTIAILLVWATGVMGSRLLL--------------
Q9CMX4_PASMU/75-237----------------------------------------------VLVSFTSLWAVFMLISRLRF--------------
Q21JU9_SACD2/110-231-------------------------------------------------WLFFVAAACAALSRVLV--------------
Q0K1U6_CUPNH/103-229---------------------------------------------------ILARGRAFGQSRVVC--------------
Q65GX3_BACLD/179-304---------------------------------------------------LLTRASELGHNRIVA--------------
Q2IJN8_ANADE/141-265----------------------------------------------WPWLVTAAVGASVGAERVLA--------------
Q6FEM9_ACIAD/65-182---------------------------------------------------MLPFTLLVALSRMIL--------------
A1K7H5_AZOSB/105-237-----------------------------------------------WVLVGLAAGAVFGLGRISQ--------------
Q6MBQ7_PARUW/87-223----------------------------------------------LGLFLTISLGGALSYARLVQ--------------
A8EX54_ARCB4/94-229----------------------------------------------IALGIALVLAWMTGGYKMSI--------------
Q87X15_PSESM/102-231----------------------------------------------LGLALALGLGSIFSAGRMLQ--------------
A8BDI5_GIAIC/110-282----------------------------------------------ITAVFAILMPPTMAYARYAA--------------
A8BQZ4_GIAIC/121-285----------------------------------------------VVAVWGISGIILMIIARMSA--------------
Q6MTZ1_MYCMS/144-270----------------------------------------------LWISFTWILIIIIAMSRIVL--------------
R5TP42_9FIRM/95-216----------------------------------------------VISNGAYILAGLIILATIFL--------------
A3LWS4_PICST/248-396-------------------------------------------------LMAMVYLFGQWWAALYL--------------
Q127S7_POLSJ/95-224----------------------------------------------WIHLVNWTWCVGIIYSTLAV--------------
A4CJ32_ROBBH/299-448----------------------------------------------RSFNSFNEASAEAAISRMYG--------------
Q2HER5_CHAGB/260-418----------------------------------------------RTYTDLKGAAEENSASRVFG--------------
A8L0R7_FRASN/276-428----------------------------------------------RYFRGFSHAIAEVIEARVWG--------------
Q6NJR5_CORDI/194-319----------------------------------------------VAAAGVVLGIVAVAAVVMTQ--------------
A1SKJ7_NOCSJ/98-218----------------------------------------------PWPWLLLVVPVVVALARLYQ--------------
Q82Z33_ENTFA/85-204----------------------------------------------GIKIFLLTYLVLIVLGRLIL--------------
A2DYB5_TRIVA/98-241----------------------------------------------FCGSLFIILAIWCGATRIRD--------------
A2EZZ9_TRIVA/91-236----------------------------------------------LLKLLPLCYAFYIGSMRIVE--------------
A4H9E7_LEIBR/233-378----------------------------------------------LIGLTPLILPITVAVSRTRD--------------
Q6BYN9_DEBHA/112-272----------------------------------------------LLAICPIMVACFVSCTRISD--------------
A7EIU4_SCLS1/134-294----------------------------------------------IVTYAPILGATLIAGALTID--------------
A7TF94_VANPO/122-266----------------------------------------------VRHLWCVVLAVVVMISRLTD--------------
Q2TYI3_ASPOR/35-224----------------------------------------------LIATIPVGLALCICATRYSD--------------
A2EQG2_TRIVA/90-230----------------------------------------------LLMASPIFFAIFVVAACIWD--------------
PLPR5_MOUSE/122-275----------------------------------------------VLCLGLMCLAFLTGLNRVAE--------------
Q9VNU2_DROME/65-225----------------------------------------------VLQFLLLMAALCVSLSRVAD--------------
A8WXP5_CAEBR/128-286----------------------------------------------ILVPFYTIWTVVCAVTRVTD--------------
A6X217_OCHA4/121-242---------------------------------------------------TAPACFLFGISRLAA--------------
Q5NGF4_FRATT/116-236---------------------------------------------------WYLLIVVFAGSRIMV--------------
Q5ZX13_LEGPH/91-208---------------------------------------------------FIGAALLVAATRVIL--------------
Q6MH55_BDEBA/105-226---------------------------------------------------WIPFAMLICLTRVVV--------------
Q7NZZ5_CHRVO/815-932-----------------------------------------------------GIAALGAAGRLAS--------------
Q89JR9_BRADU/79-199---------------------------------------------------IRAIAVGISLTRLVV--------------
B7VND8_VIBA3/235-351----------------------------------------------KAILIVLAGLLWIMLFKSYS--------------
Q5E4L0_ALIF1/241-366----------------------------------------------RYACIFIILIIGQSIARVWL--------------
Q9RVR6_DEIRA/14-135-------------------------------------------------LFAAVLVALIIASRLVL--------------

PF14378

Q5K8D7_CRYNJ/128-311-----------------------------------------------IRAISLLYPLLILLVIMAT--------------
B0UG28_METS4/124-315-----------------------------------------------LGKPAILVNAAVVLATLSA--------------
A1SJR6_NOCSJ/50-230-----------------------------------------------LRWVGFVLPALMALSVVAT--------------
E4NIW3_KITSK/45-228-----------------------------------------------LALLPWAFPVLMTAVVIAT--------------
G8WRV6_STREN/158-347-----------------------------------------------LRVAGLAYPVAITFVVLGT--------------
C7QD07_CATAD/71-251-----------------------------------------------WRWIGPLHTVLTITVVLAT--------------
Q2G5H1_NOVAD/115-305-------------------------------------------------GPILLLNAVMLFSTIVC--------------
Q1IHV8_KORVE/153-330------------------------------------------------RVFCAVMLALTIYATLET--------------
F2R3P1_STRVP/39-228-----------------------------------------------TRALGVAYPLLTTLVVMGT--------------
A9HHP2_GLUDA/131-314-----------------------------------------------FFPVFAVVNGIMLFSIPSE--------------
Q13PQ7_PARXL/110-293-----------------------------------------------VFPVAIVLNAFMIVSTLTQ--------------
Q63V72_BURPS/125-308-----------------------------------------------VAPLALLFNGWMIASTPTQ--------------
Q01VD1_SOLUE/159-330-------------------------------------------------IVTGAICLLMVLATLGR--------------
D1CA82_SPHTD/53-235-----------------------------------------------HWLLGTFYPLLMITAVVGT--------------
K0K1I4_SACES/40-223-----------------------------------------------VARSAWVFPLLTAFVVLVT--------------
D1C524_SPHTD/53-234-----------------------------------------------LRWAALGYWVLVNIVVVGT--------------
W5TLL4_9NOCA/53-242-----------------------------------------------ARFAGVAYPVLITVVVMGT--------------
Q2JBQ4_FRACC/47-236-----------------------------------------------VRVLGALYPAATLFVVMST--------------
W0BEC4_9GAMM/94-276-----------------------------------------------AFGILLIVNLLLFTSCILL--------------
Q220L9_RHOFT/109-292-----------------------------------------------LLSVFIVVNVAMLVSIPVD--------------
Q87M50_VIBPA/146-355------------------------------------------------GYFACAFAVIIQIGSVHL--------------
B1LSY3_METRJ/129-320-----------------------------------------------LGPLAALLNAAVIVATLGS--------------
A2BL06_HYPBU/51-224-----------------------------------------------SLLVAVAWVASMSFATVYT--------------
L0PFU2_PNEJ8/5-201------------------------------------------------TPYFVVYVLWLWWCTMYL--------------
C9Z2S2_STRSW/63-253-----------------------------------------------VRTAAVAYPLITTIVVMGT--------------
E3JAH2_FRAIE/94-282-----------------------------------------------IRVLGASYPVLTTLVVMST--------------
F8AWV4_9ACTN/47-236-----------------------------------------------TRVLGVLYPGATIFVVMAT--------------
R7Y200_9ACTN/124-318-----------------------------------------------VHWIFWINFVITVVATLYF--------------
A0LS47_ACIC1/69-252-----------------------------------------------ALALGSAHLAVTTVDVLAT--------------
E2Q4K3_STRCL/45-234-----------------------------------------------MRTLAVAYPLLTVIVVMGT--------------
F8J559_HYPSM/123-309-----------------------------------------------LRWLFVPLNLLMLVSCVPI--------------
L0ET54_LIBCB/102-293-----------------------------------------------LKWVSLLLNFLMMVSAVAN--------------
Q89QL0_BRADU/109-300-----------------------------------------------VGWIAVLLNVAMIAATPVD--------------
H0PVV4_9RHOO/74-256-----------------------------------------------LFPLITALNALMLLSTPTH--------------
E3EJC2_PAEPS/1-162------------------------------------------------RVLWVILAVLIAISRVWT--------------
A1SDU3_NOCSJ/130-324-----------------------------------------------LKWIFWVNFGVTVIATLYF--------------
C7QBQ6_CATAD/84-272-----------------------------------------------VKVLGIAYPFCTFAVIIGT--------------
A1SHK3_NOCSJ/128-322-----------------------------------------------TTLALATFLSVTMVATVYF--------------
E3J0M0_FRAIE/110-299-----------------------------------------------LRVLGVLYPCCTAFVVMAT--------------
C8XDB0_NAKMY/22-205-----------------------------------------------FGLLVWLFPIVMVAVVITT--------------
G7XGU5_ASPKW/117-299-----------------------------------------------LRAVAPIWPMLMGLTIVAT--------------
B1LVV6_METRJ/99-290-------------------------------------------------IPALVVNALLVAATPID--------------
Q5ZV46_LEGPH/101-283-----------------------------------------------PCLLLSIINVLLILSCVLL--------------

PF14360

F6UTK5_XENTR/282-355----------------------------------------------LYHWICWFLSCVGIFCILLA--------------
SMSR2_CAEEL/192-265----------------------------------------------PLSHIYHVLAFTALFSILLA--------------
SLS2_TRYB2/201-275----------------------------------------------SFRPVVTVVAIFGYYCIVAS--------------
B8C480_THAPS/431-503-----------------------------------------------LKVIMALLQISIVPFILAA--------------
IPCS3_ARATH/172-244-----------------------------------------------IKHLAWLMAVIQSILIIAS--------------
SAMD8_HUMAN/292-365----------------------------------------------FLHTLSWVLNLFGIFFILAA--------------
A2DHW8_TRIVA/46-124----------------------------------------------FVKLGSLYTFLIGICYITLS--------------
SLS_LEIMA/211-286----------------------------------------------AVRVWVSVLLPISYYCILAS--------------
A5K283_PLAVS/202-273-----------------------------------------------LKTLITFLCFVIYAFIIVG--------------
A0A509ASM8_PLABA/201-272-----------------------------------------------IKVITALLSCFVYSVLIVG--------------
A0A384LQJ1_PLAKH/276-347-----------------------------------------------IKAVLFLYCLFIYGMIVIS--------------
Q28DN3_XENTR/220-293----------------------------------------------WYHLICWLLSAAGVICILVA--------------
Q4N3L0_THEPA/182-253-----------------------------------------------FNMTMFVYAALISVSIVAS--------------
A8XDY1_CAEBR/127-200----------------------------------------------PLQWIAHVSCFVGMICMIIS--------------
IPCS_ORYSJ/172-244-----------------------------------------------IKILAWLMAIIQSLLIIAS--------------
SMSR1_CAEEL/321-394----------------------------------------------GLHTFTWVLNCFAIFLILAA--------------
SMS2_CAEEL/201-274----------------------------------------------ILRYIAAPITFLGIAALVVS--------------
A8X0T5_CAEBR/264-337----------------------------------------------ILHWLSWLVCAVGVVFLVLS--------------
A9S9I4_PHYPA/275-346-----------------------------------------------GSVFIWFLVAHTGQREIRE--------------
B3SD02_TRIAD/279-352----------------------------------------------LLHFLTWTLNLSGIFFILAA--------------
A2DN61_TRIVA/170-240-----------------------------------------------LGVLYLVLGFIGSFSLILT--------------
B5YLZ6_THAPS/422-494-----------------------------------------------FSMALWTLMALDYSIEAYQ--------------
C6KT87_PLAF7/201-272-----------------------------------------------IKFIIFTFSCFIYAIIIIG--------------
D0MWV3_PHYIT/192-264-----------------------------------------------GISIMVLVQITIAFLIVAS--------------
B7FUU7_PHATC/326-397-----------------------------------------------FGGCLVCLLLLDYSVEIYE--------------
SLS11_TRYCC/193-267----------------------------------------------VFRPASVLLVLLSFYSIIAS--------------
D2VDJ4_NAEGR/246-319----------------------------------------------GLHIITWVLNCFGAFFVLAA--------------
D2VXN5_NAEGR/191-270----------------------------------------------IFNTILFTVTFVGCFLIIVA--------------
D2VKR1_NAEGR/196-272----------------------------------------------WTNLLLIILHIVGCLGILLA--------------
B9HC73_POPTR/172-244-----------------------------------------------IKQLGWLIAVVLSFLIIAS--------------
C6KT86_PLAF7/265-336-----------------------------------------------VKTTIFLYSIYIYIIIIIS--------------
C4LV27_ENTHI/184-261----------------------------------------------IERICAWIIAFIGYFIFLSN--------------
A2FIE9_TRIVA/168-238-----------------------------------------------IGWIYLFVGVIGAFGLIVS--------------
B7QHG5_IXOSC/233-306----------------------------------------------VVHITYLTLSCVGILMVLLS--------------
D0NII4_PHYIT/164-244----------------------------------------------IRRVCRMTCLMSFGALCIAG--------------
A7ANZ4_BABBO/239-311-----------------------------------------------LNTIIMIVAGIICFLLILT--------------
A0JMN0_DANRE/269-342----------------------------------------------WFHWGCWSLCAVGVFCILLA--------------
C3XQA8_BRAFL/273-346----------------------------------------------ILHWCTWLVSCIGIFCILLA--------------
F8W5G6_DANRE/232-307----------------------------------------------VYHVICGLLSAMGMICILMG--------------
H3CAZ2_TETNG/175-248----------------------------------------------WYHWSCWLLSASGVVCILVA--------------
Q4U956_THEAN/200-270-----------------------------------------------TKVILVLYTGFVLFLIVAC--------------

PF02681

F2NNY3_MARHT/5-141------------------------------------------------FAVTTVFALIVMYDATGIRRAAGRQAELLN--
K9T6M6_9CYAN/8-143------------------------------------------------FAIACLFAVIVMYDAAGVRQAAGKQARILN--
D4ZTL8_ARTPN/8-143------------------------------------------------FAIAVVFAIIVMYDAAGVRQAAGKQARILN--
K9WGM7_9CYAN/8-143------------------------------------------------FAIATIFAVIVMYDAAGVRQAAGKQARILN--
B7GI74_ANOFW/24-164------------------------------------------------FALAAIFGLIVMYDAQGVRHQAGELAIRVN--
B1WS33_CROS5/8-143------------------------------------------------FAIACLFAVIVMYDAAGVRQAAGKQARILN--
R5AEV3_9CLOT/9-146------------------------------------------------FALCVIQTAIVLHDARGVRLETGKQAKMIN--
Q31Q62_SYNE7/9-145------------------------------------------------FAVVTVFAIIVMYDAAGVRWAAGRQARILN--
R5XG63_9CLOT/5-137------------------------------------------------FAMTAVFAIIVMYDASGVRRAVGKQAELLN--
R7A3L4_9FIRM/8-144------------------------------------------------FAITAIFSFIVMYDACHVRYYSGKNIELVK--
W0E929_9FIRM/8-143------------------------------------------------FSVAAVLAMIVMYDAAGVRREAGKQAEVIN--
D3FYY4_ALKPO/4-149------------------------------------------------FAVAAIFGIIVMFDATGVRRHAGYHATVLN--
F0RVM2_SPHGB/6-143------------------------------------------------FAIAATFAAVVIHDAMGIRRAAGKQAEVIN--
H6NB79_9BACL/2-142------------------------------------------------FALSTILSLIVMYDAMGIRRHAGLIAEEVN--
Q7V6P1_PROMM/15-147------------------------------------------------FALAATVAFVVMYDASGIRRAAGFTAARVN--
Q18B69_CLOD6/8-140------------------------------------------------FAIITVLALIIMYDAAGVRRAVGKQATILN--
G0GF41_SPITZ/9-149------------------------------------------------FFLSVFYAAIIIRDAVGVRKAAGQQAQVLN--
Q65FE5_BACLD/4-149------------------------------------------------FAVSAIFAVITMFDATGVRRHAGEQATVIN--
U5LF62_9BACI/2-142------------------------------------------------FALSLVFGLIVMYDAQGIRRQTGELTLKVN--
R7L0C2_9FIRM/5-149------------------------------------------------FAIMCIVALITMYDAMGVRRAAGLQAKEIN--
Q5WDV5_BACSK/4-146------------------------------------------------FAVSAVLGIIVMFDATGVRRHAGYHATVLN--
D6GSF2_FILAD/8-144------------------------------------------------FALSLVFALVVMYDAAGVRQSVGQQAVILN--
E6U5K5_ETHHY/8-143------------------------------------------------FALAFVLAGVVIYDAMGVRRAAGEQARVLN--
Q5SJ95_THET8/4-140------------------------------------------------FAVAAVFAFIVMYDAAGIRRAAGLHAQLLN--
Q9RSQ8_DEIRA/8-143------------------------------------------------FAIAATFALIVMYDASGVRHSSGVQARLLN--
P73185_SYNY3/8-143------------------------------------------------FAIACLFAVIVMYDAAGVRQAAGKQARILN--
D1AKQ0_SEBTE/7-143------------------------------------------------FAISMVFSSIVLYDATGIRRAAGEHAKALN--
E0RXA3_BUTPB/8-144------------------------------------------------FAISGVLALIVMHDAMGVRRETGIQAKVIN--
F5YE41_TREAZ/16-155------------------------------------------------FAVCFFFAMVAMRDAMGVRRSSGLQARALN--
V5WEJ9_9SPIO/6-144------------------------------------------------FALSLFFAIVVIRDALGVRLSTGRQAQALN--
U5LHE7_9BACI/5-149------------------------------------------------FAVAAVFAIITMFDATGVRRQAGEQAIVLN--
K9XWG4_STAC7/8-143------------------------------------------------FAIACLFAVIVMYDAAGVRQAAGKQAKLLN--
E6U2C7_BACCJ/4-149------------------------------------------------FAISAIFGIIVMFDATGVRRHAGEQATVLN--
K9V3M2_9CYAN/8-143------------------------------------------------FALAVVFAIIVMYDAAGVRQAAGKQARILN--
B9IAH9_POPTR/38-171------------------------------------------------FAIVVVLACVVMYDASGVRLHAGRQAELLN--
M0RZC5_MUSAM/20-155------------------------------------------------FALAVILASIVMYDASGIRLHASRQAELLN--
R5ZD30_9FIRM/8-146------------------------------------------------FAVTTIFAFIVMYDACHVRYYSGKNIELVQ--
R6Q3Q8_9FIRM/8-138------------------------------------------------FAISLIFSFVVMYDAAGIRRAAGKQAEIIN--
C0ZKP9_BREBN/5-150------------------------------------------------FAISAILGVIVMFDAAGVRRHAGMQAVVLN--
D8TLE7_VOLCA/33-168------------------------------------------------FAMCLVISLIVMYDATGVRLHAGRQATVLN--
R6SRI1_9FIRM/7-157------------------------------------------------FALAMILAMVVMYDAMGVRRSAGLQAKEIN--
K9YEC7_HALP7/8-143------------------------------------------------FAIALLFAIIVMFDAAGVRQAAGKQARLLN--
K3XML5_SETIT/24-159------------------------------------------------FATATIFASVVMYDASGIRLHAGKQAEVLN--
K9RII7_9CYAN/8-143------------------------------------------------FALAAIFAIIVMYDAAGVRQAAGKQARILN--
K4LIZ6_THEPS/40-169------------------------------------------------FQTAAVLGGIVIYDSVTLRRVVGEHSRLIK--
E6TWS5_BACCJ/5-142------------------------------------------------FALSVIFGLIVMYDAQGIRRYAGETSMKVN--
Q73MW8_TREDE/10-150------------------------------------------------FIFACFMALIVIRDAVGVRRSSGLQAKALN--
Q8Y4P9_LISMO/4-149------------------------------------------------FAISVVFGIIVMFDATGVRRQAGEQAVVLN--
M0SK26_MUSAM/139-272------------------------------------------------FPVCLGFSLIVMYDAIGVRRHAGMQAEVLN--
G4KW10_OSCVS/4-137------------------------------------------------FAIAAILAIIVMHDAMGVRLEAGKHAKALN--
R5CL70_9FIRM/8-147------------------------------------------------FPMAVFFAFIVMYDAMGVRRETGEQAKVLN--
I0I5M8_CALAS/5-139------------------------------------------------FAIAVVLAVIVMYDARGVRQESGKQARVLN--
D7CKU8_SYNLT/12-144------------------------------------------------FALALVFALIVLHDAMGVRRVAGKHSQILR--
R7IRJ9_9CLOT/8-142------------------------------------------------FALALIFALVVMYDAAGVRRAAGKQAKLLN--
B8HXR8_CYAP4/8-143------------------------------------------------FAIALIFAFIVMYDAAGVRQAAGKQARVLN--
B0C3J0_ACAM1/8-143------------------------------------------------FAIATVFAIIVMYDAAGVRQAAGKQAKVLN--
I4DAH9_DESAJ/3-144------------------------------------------------FAISFSITLIVMYDTAGVRRQSGQHAIVLN--
Q46K07_PROMT/15-148------------------------------------------------FALASTIAFIVMYDASGIRRSAGLTAAKVN--
R7A3G1_9CLOT/8-142------------------------------------------------FAMATIFAMVVMYDAAGVRRAAGKQAHLLN--
Q24V03_DESHY/8-143------------------------------------------------FAIAAIFGMIVMYDAAGVRRAAGKQAEVIN--
Q10X44_TRIEI/8-143------------------------------------------------FALALVFAIIVMYDAAGVRQAAGLQARILN--
A4RZ57_OSTLU/3-142------------------------------------------------FACACAVSAVVMYDAMGVRRQAGFHATAIN--
D8QR56_SELML/24-159------------------------------------------------FAIALVLASIVMY