# STOCKHOLM 1.0
#=GF ID   DNA_pol3_a_NI
#=GF AC   PF14480.7
#=GF DE   DNA polymerase III polC-type N-terminus I
#=GF AU   Eberhardt R;0000-0001-6152-1369
#=GF SE   Pfam-B_853 (release 23.0)
#=GF GA   22.00 22.00;
#=GF TC   22.10 22.00;
#=GF NC   21.90 21.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cut_ga HMM metaseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10048037
#=GF RT   A 'gram-negative-type' DNA polymerase III is essential for
#=GF RT   replication of the linear chromosome of Streptomyces coelicolor
#=GF RT   A3(2). 
#=GF RA   Flett F, de Mello Jungmann-Campello D, Mersinias V, Koh SL,
#=GF RA   Godden R, Smith CP; 
#=GF RL   Mol Microbiol. 1999;31:949-958.
#=GF RN   [2]
#=GF RM   17532183
#=GF RT   Replication-associated purine asymmetry may contribute to
#=GF RT   strand-biased gene distribution. 
#=GF RA   Hu J, Zhao X, Yu J; 
#=GF RL   Genomics. 2007;90:186-194.
#=GF RN   [3]
#=GF RM   21740522
#=GF RT   The N-terminal region of the bacterial DNA polymerase PolC
#=GF RT   features a pair of domains, both distantly related to domain V
#=GF RT   of the DNA polymerase III tau subunit.
#=GF RA   Timinskas K, Venclovas C;
#=GF RL   FEBS J. 2011;278:3109-3118.
#=GF DR   INTERPRO; IPR028112;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is the first N-terminal domain, NI domain, of the DNA
#=GF CC   polymerase III polC subunit A that is found only in Firmicutes.
#=GF CC   DNA polymerase polC-type III enzyme functions as the 'replicase'
#=GF CC   in low G + C Gram-positive bacteria [1].  Purine asymmetry is a
#=GF CC   characteristic of organisms with a heterodimeric DNA polymerase
#=GF CC   III alpha-subunit constituted by polC which probably plays a
#=GF CC   direct role in the maintenance of strand-biased gene
#=GF CC   distribution; since, among prokaryotic genomes, the distribution
#=GF CC   of genes on the leading and lagging strands of the replication
#=GF CC   fork is known to be biased [2]. It has been predicted that the
#=GF CC   N-terminus of polC folds into two globular domains, NI and NII.
#=GF CC   A predicted patch of elecrostatic potential at the surface of
#=GF CC   this domain suggests a possible involvement in nucleic acid
#=GF CC   binding [3]. This domain is associated with DNA_pol3_alpha
#=GF CC   Pfam:PF07733 and DNA_pol3_a_NI Pfam:PF11490.
#=GF SQ   9
#=GS 2004238376/4-75    DE [subseq from] '[Mouse Gut Community ob1 ]'
#=GS 2004029481/5-75    DE [subseq from] '[Human Gut Community Subject 8]'
#=GS 2004039567/8-78    DE [subseq from] 'DNA polymerase III, alpha subunit (gram-positive type) [Human Gut Community Subject 8]'
#=GS 2004013565/5-74    DE [subseq from] 'DNA polymerase III, alpha subunit (gram-positive type) [Human Gut Community Subject 7]'
#=GS 2004034357/5-74    DE [subseq from] 'DNA polymerase III, alpha subunit (gram-positive type) [Human Gut Community Subject 8]'
#=GS 2004037482/103-175 DE [subseq from] '[Human Gut Community Subject 8]'
#=GS EBY42654.1/32-72   DE [subseq from] hypothetical protein GOS_5895735 [marine metagenome]
#=GS EDG50679.1/32-72   DE [subseq from] hypothetical protein GOS_770042 [marine metagenome]
#=GS EBJ48798.1/31-71   DE [subseq from] hypothetical protein GOS_8890061 [marine metagenome]
2004238376/4-75            LFFDVFPDLKVPSGMQNLMTEV.EVTKVSSNRRRDHLRVYLLSSRLIHKSNIYRLESDIAKQLFPNHGISIKI
2004029481/5-75            -FKEVFPTLKLDKDMENLLENA.DVTRISVNHARDFYKIYVKAKRLIFKKNIWKLEESIKKQIFKSKDITVKI
2004039567/8-78            -FFSVFPDLKVSDDVRSLFEDA.NIREITLKKKENTLKISFQCDHLISRVDTWRMERTIREQLFSKRFVKIRF
2004013565/5-74            -FFDVFPHLKVKKELEELLDMV.FVTKVSMNPGRTHLRVYIESSRWIHKKNIFALEDEIERQCFPGIPMTVT-
2004034357/5-74            -FFDVFPSLKVKKELEELLDMV.FVTRVSCNPSRTHIWVYIKSERWIHKKHIFELEEQIERQIFAGLNVTVT-
2004037482/103-175         LFFDVFGGLEMPKELDGLFREEvYVTRVVIIENREILRVDISSRHIISRPNIEKAEEALRKHIFGKRRYTVQI
EBY42654.1/32-72           ---LLLQDLKIKEFVEKNLKNA.SIAKVNIERAAKKIRISIYSSR----------------------------
EDG50679.1/32-72           ---LLHQDLKIKNYVEKKLKNA.SISKINVERAAKKLRISIFSSR----------------------------
EBJ48798.1/31-71           ---LLHQDLKIKKYVSEKLKNA.SISKINIERAAKKLRISIFSSR----------------------------
#=GC PP_cons               59*999****************.********************99*********************9999987
#=GC RF                    xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
//